WorldWideScience

Sample records for shields building shd

  1. Dicty_cDB: SHD492 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHD492 (Link to dictyBase) - - - Contig-U16471-1 SHD492P (Link to Original site) SHD492...F 121 SHD492Z 819 SHD492P 920 - - Show SHD492 Library SH (Link to library) Clone ID SHD492... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SH/SHD4-D/SHD492Q.Seq.d/ Representative seq. ID SHD492...P (Link to Original site) Representative DNA sequence >SHD492 (SHD492Q) /CSM/SH/SHD4-D/SHD492....Seq.d/ 805 0.0 SHD613 (SHD613Q) /CSM/SH/SHD6-A/SHD613Q.Seq.d/ 805 0.0 SHD492 (SHD492Q) /CSM/SH/SHD4-D/SHD492

  2. Electromagnetically shielded building

    Energy Technology Data Exchange (ETDEWEB)

    Takahashi, T; Nakamura, M; Yabana, Y; Ishikawa, T; Nagata, K

    1992-04-21

    This invention relates to a building having an electromagnetic shield structure well-suited for application to an information network system utilizing electromagnetic waves, and more particularly to an electromagnetically shielded building for enhancing the electromagnetic shielding performance of an external wall. 6 figs.

  3. Electromagnetically shielded building

    International Nuclear Information System (INIS)

    Takahashi, T.; Nakamura, M.; Yabana, Y.; Ishikawa, T.; Nagata, K.

    1992-01-01

    This invention relates to a building having an electromagnetic shield structure well-suited for application to an information network system utilizing electromagnetic waves, and more particularly to an electromagnetically shielded building for enhancing the electromagnetic shielding performance of an external wall. 6 figs

  4. Dicty_cDB: SHD573 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHD573 (Link to dictyBase) - - - Contig-U11503-1 SHD573E (Link...Clone ID SHD573 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Original site URL http://dict...LFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGCGFNN EPICTSLKDAVSRAFLLISNNSRVCIGIIGNINVTSEQITLGNYCGALWITSENINNENN NYTI...ststtts ax***d*eyyhcysyfgldl Frame C: fsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGCGFNN EPICTSLKD...vegicus clone CH230-428C17, WORKING DRAFT SEQUENCE, 3 unordered pieces. 48 3e-12 3 AC116984 |AC116984.2 Dict

  5. Experience of slowly infused high-iodine-dose contrast computed tomography (SHD) of intracranial tumors

    International Nuclear Information System (INIS)

    Muraoka, Kiyoaki; Numata, Hideharu; Hokama, Yasuo

    1983-01-01

    A study was done on 20 patients with intracranial tumors by means of the slowly infused high-iodine-dose (SHD) contrast-enhancement technique. An intravenous drip infusion of 300 ml of Angiografin was given for three hours. Computerized tomograms were taken 1 hour, (2 hours), and 3 hours after the beginning of the drip infusion. The authors divided the lesions into four groups by analyzing the sequential changes in CT numbers using a histograms or profile of the region of interest. In group I, additional lesions were visible on the SHD scan (one case of metastatic brain tumors from lung cancer). In group 2, lesions were better displayed on the SHD scan due to increased enhancement (17 cases). In group 3, SHD scans showed no change (2 cases of fibrous astrocytoma). In group 4, the enhancement was diminished, but the lesion per se was still clealy identifiable (no case). Finally, in 18 cases out of 20 (90%), an additional or better display of the lesion was detected on SHD enhanced CT. The rational for doing the SHD enhancement is to detect a lesion with a minimally impaired blood-brain barrier by exposing a prolonged high blood-iodine level, and so the scanning is delayed until detectable levels of the contrast medium have accumulated within the vascular-channel pool or extravascular space of the lesion. SHD enhancement is useful: I) for revealing any additional lesion in a metastatic brain tumor; 2) for better displaying an obscure lesion on a usual scan; 3) for differentiating the quality of the lesion (for example, malignancy or cyst formation), and 4) for predicting the prognosis of the lesion. (J.P.N.)

  6. Nuclear shielding of openings in ITER Tokamak building

    Energy Technology Data Exchange (ETDEWEB)

    Dammann, A., E-mail: alexis.dammann@iter.org [ITER Organization, Route de Vinon sur Verdon, 13115 Saint Paul Lez Durance (France); Arumugam, A.P.; Beaudoin, V.; Beltran, D.; Benchikhoune, M.; Berruyer, F.; Cortes, P.; Gandini, F. [ITER Organization, Route de Vinon sur Verdon, 13115 Saint Paul Lez Durance (France); Ghirelli, N. [ASSYSTEM E.O.S, ZAC Saint Martin, 23, rue Benjamin Franklin, 84120 Pertuis (France); Gray, A.; Hurzlmeier, H.; Le Page, M. [ITER Organization, Route de Vinon sur Verdon, 13115 Saint Paul Lez Durance (France); Lemée, A. [SOGETI High Tech, 180 Rue René Descartes, 13851 Aix en Provence (France); Lentini, G.; Loughlin, M.; Mita, Y.; Patisson, L.; Rigoni, G.; Rathi, D.; Song, I. [ITER Organization, Route de Vinon sur Verdon, 13115 Saint Paul Lez Durance (France)

    2013-10-15

    Highlights: ► Establishment of a methodology to design shielded opening in external wall of the Tokamak building. ► Analysis of the shielding requirement, case by case, depending on the localization and the context. ► Implementation of an integrated solution for shielded opening. -- Abstract: The external walls of the Tokamak building, made of thick concrete, provide the nuclear shielding for operators working in adjacent buildings and for the environment. There are a series of openings to these external walls, devoted to ducts or pipes for ventilation, waveguides and transmission lines for heating systems and diagnostics, cooling pipes, cable trays or busbars. The shielding properties of the wall shall be preserved by adequate design of the openings in order not to affect the radiological zoning in adjacent areas. For some of them, shielding properties of the wall are not affected because the size of the network is quite small or the source is far from the opening. But for most of the openings, specific features shall be considered. Even if the approach is the same and the ways to shield can be standardized, specific analysis is requested in any case because the constraints are different.

  7. AP1000 shield building: a constructability challenge

    International Nuclear Information System (INIS)

    Di Giuseppe, Giovanni; Bonanno, Domenico

    2010-01-01

    The AP1000 Shield Building, an enhanced structure which surrounds the containment vessel, consists of standard Reinforced Concrete (RC) and composite Steel and Concrete (SC) construction. In the SC module the surface steel plates, (with attached shear studs and angles) filled with concrete, act as the steel reinforcement in concrete. This is a relatively new design technology that required the appropriate use of structural codes, supplemented with information from applicable tests on similar composite steel and concrete construction. Being a newer design concept, existing codes do not provide explicit guidance on SC construction so a review of literature and test data on composite structures similar to AP1000 shield building was done in order to confirm the technical basis for the design. The SC walls, air inlet structure and roof of the Shield Building will be constructed using modular construction practices and then transported to site and lifted into place. These modules, working also as permanent form-work, will be filled with high strength Self- Consolidating Concrete. (SCC) This paper provides a focused and integrated presentation of the enhanced shield building design methodology, testing, constructability and inspection. (authors)

  8. Building with electromagnetic shield structure for individual floors

    International Nuclear Information System (INIS)

    Takahashi, T.; Nakamura, M.; Yabana, Y.; Ishikawa, T.; Nagata, K.

    1991-01-01

    This invention relates to a building having a floor-by-floor electromagnetic shield structure well-suited for application to an information network system in which an electromagnetically shielded space is divided by individual floors and electric waves are utilized within the building on a floor-by-floor basis. (author). 8 figs

  9. Building with electromagnetic shield structure for individual floors

    Energy Technology Data Exchange (ETDEWEB)

    Takahashi, T; Nakamura, M; Yabana, Y; Ishikawa, T; Nagata, K

    1991-09-10

    This invention relates to a building having a floor-by-floor electromagnetic shield structure well-suited for application to an information network system in which an electromagnetically shielded space is divided by individual floors and electric waves are utilized within the building on a floor-by-floor basis. (author). 8 figs.

  10. Contaminant deposition building shielding factors for US residential structures.

    Science.gov (United States)

    Dickson, Elijah; Hamby, David; Eckerman, Keith

    2017-10-10

    This paper presents validated building shielding factors designed for contemporary US housing-stock under an idealized, yet realistic, exposure scenario from contaminant deposition on the roof and surrounding surfaces. The building shielding factors are intended for use in emergency planning and level three probabilistic risk assessments for a variety of postulated radiological events in which a realistic assessment is necessary to better understand the potential risks for accident mitigation and emergency response planning. Factors are calculated from detailed computational housing-units models using the general-purpose Monte Carlo N-Particle computational code, MCNP5, and are benchmarked from a series of narrow- and broad-beam measurements analyzing the shielding effectiveness of ten common general-purpose construction materials and ten shielding models representing the primary weather barriers (walls and roofs) of likely US housing-stock. Each model was designed to scale based on common residential construction practices and include, to the extent practical, all structurally significant components important for shielding against ionizing radiation. Calculations were performed for floor-specific locations from contaminant deposition on the roof and surrounding ground as well as for computing a weighted-average representative building shielding factor for single- and multi-story detached homes, both with and without basement as well for single-wide manufactured housing-unit. © 2017 IOP Publishing Ltd.

  11. Contaminant deposition building shielding factors for US residential structures

    International Nuclear Information System (INIS)

    Dickson, E D; Hamby, D M; Eckerman, K F

    2015-01-01

    This paper presents validated building shielding factors designed for contemporary US housing-stock under an idealized, yet realistic, exposure scenario from contaminant deposition on the roof and surrounding surfaces. The building shielding factors are intended for use in emergency planning and level three probabilistic risk assessments for a variety of postulated radiological events in which a realistic assessment is necessary to better understand the potential risks for accident mitigation and emergency response planning. Factors are calculated from detailed computational housing-units models using the general-purpose Monte Carlo N-Particle computational code, MCNP5, and are benchmarked from a series of narrow- and broad-beam measurements analyzing the shielding effectiveness of ten common general-purpose construction materials and ten shielding models representing the primary weather barriers (walls and roofs) of likely US housing-stock. Each model was designed to scale based on common residential construction practices and include, to the extent practical, all structurally significant components important for shielding against ionizing radiation. Calculations were performed for floor-specific locations from contaminant deposition on the roof and surrounding ground as well as for computing a weighted-average representative building shielding factor for single- and multi-story detached homes, both with and without basement as well for single-wide manufactured housing-unit. (paper)

  12. Cloud immersion building shielding factors for US residential structures

    International Nuclear Information System (INIS)

    Dickson, E D; Hamby, D M

    2014-01-01

    This paper presents validated building shielding factors designed for contemporary US housing-stock under an idealized, yet realistic, exposure scenario within a semi-infinite cloud of radioactive material. The building shielding factors are intended for use in emergency planning and level three probabilistic risk assessments for a variety of postulated radiological events in which a realistic assessment is necessary to better understand the potential risks for accident mitigation and emergency response planning. Factors are calculated from detailed computational housing-units models using the general-purpose Monte Carlo N-Particle computational code, MCNP5, and are benchmarked from a series of narrow- and broad-beam measurements analyzing the shielding effectiveness of ten common general-purpose construction materials and ten shielding models representing the primary weather barriers (walls and roofs) of likely US housing-stock. Each model was designed to scale based on common residential construction practices and include, to the extent practical, all structurally significant components important for shielding against ionizing radiation. Calculations were performed for floor-specific locations as well as for computing a weighted-average representative building shielding factor for single- and multi-story detached homes, both with and without basement, as well for single-wide manufactured housing-units. (paper)

  13. Dynamic Analysis of AP1000 Shield Building Considering Fluid and Structure Interaction Effects

    Directory of Open Access Journals (Sweden)

    Qiang Xu

    2016-02-01

    Full Text Available The shield building of AP1000 was designed to protect the steel containment vessel of the nuclear reactor. Therefore, the safety and integrity must be ensured during the plant life in any conditions such as an earthquake. The aim of this paper is to study the effect of water in the water tank on the response of the AP1000 shield building when subjected to three-dimensional seismic ground acceleration. The smoothed particle hydrodynamics method (SPH and finite element method (FEM coupling method is used to numerically simulate the fluid and structure interaction (FSI between water in the water tank and the AP1000 shield building. Then the grid convergence of FEM and SPH for the AP1000 shield building is analyzed. Next the modal analysis of the AP1000 shield building with various water levels (WLs in the water tank is taken. Meanwhile, the pressure due to sloshing and oscillation of the water in the gravity drain water tank is studied. The influences of the height of water in the water tank on the time history of acceleration of the AP1000 shield building are discussed, as well as the distributions of amplification, acceleration, displacement, and stresses of the AP1000 shield building. Research on the relationship between the WLs in the water tank and the response spectrums of the structure are also taken. The results show that the high WL in the water tank can limit the vibration of the AP1000 shield building and can more efficiently dissipate the kinetic energy of the AP1000 shield building by fluid-structure interaction.

  14. WASTE HANDLING BUILDING SHIELD WALL ANALYSIS

    International Nuclear Information System (INIS)

    Padula, D.

    2000-01-01

    The scope of this analysis is to estimate the shielding wall, ceiling or equivalent door thicknesses that will be required in the Waste Handling Building to maintain the radiation doses to personnel within acceptable limits. The shielding thickness calculated is the minimum required to meet administrative limits, and not necessarily what will be recommended for the final design. The preliminary evaluations will identify the areas which have the greatest impact on mechanical and facility design concepts. The objective is to provide the design teams with the necessary information to assure an efficient and effective design

  15. Shielding effect of building to natural radiation and its influence to population dose evaluation

    International Nuclear Information System (INIS)

    Nakamura, Takashi; Itoh, Kazuo; Yoshimura, Toshiaki.

    1980-01-01

    This work investigated the shielding effect of the building which is indispensable for the accurate evaluation of the population dose of external exposure from natural radiation. At first, the attenuation coefficients of various building materials were measured and found to agree with the calculated values within 10% errors. The shielding factors of these materials were calculated from the calculated attenuation coefficients and buildup factors. The shielding factors of the wall, window, roof and floor were calculated separately by settling the model houses and combining the shielding factors of the building materials used, and then the shielding factor of the whole building was obtained by use of the opening fraction of the wall and the fractions of the wall, roof and floor areas to the total floor area. The influence of the shielding effect of the building is well represented by the occupancy factor which is the ratio of the group doses including that shielding effect to those excluding it. The occupancy factor lies between 0.9 and 1.0 for four specified districts, Tokyo, Osaka, Ibaraki and Nagano. (author)

  16. Investigations of some building materials for γ-rays shielding effectiveness

    Science.gov (United States)

    Mann, Kulwinder Singh; Kaur, Baljit; Sidhu, Gurdeep Singh; Kumar, Ajay

    2013-06-01

    For construction of residential and non-residential buildings bricks are used as building blocks. Bricks are made from mixtures of sand, clay, cement, fly ash, gypsum, red mud and lime. Shielding effectiveness of five soil samples and two fly ash samples have been investigated using some energy absorption parameters (Mass attenuation coefficients, mass energy absorption coefficients, KERMA (kinetic energy released per unit mass), HVL, equivalent atomic number and electron densities) firstly at 14 different energies from 81-1332 keV then extended to wide energy range 0.015-15 MeV. The soil sample with maximum shielding effectiveness has been used for making eight fly ash bricks [(Lime)0.15 (Gypsum)0.05 (Fly Ash)x (Soil)0.8-x, where values of x are from 0.4-0.7]. High Purity Germanium (HPGe) detector has been used for gamma-ray spectroscopy. The elemental compositions of samples were analysed using an energy dispersive X-ray fluorescence (EDXRF) spectrometer. The agreements of theoretical and experimental values of mass attenuation coefficient have been found to be quite satisfactory. It has been verified that common brick possess the maximum shielding effectiveness for wide energy range 0.015-15 MeV. The results have been shown graphically with some useful conclusions for making radiation safe buildings.

  17. Three-dimensional analysis of AP600 standard plant shield building roof

    International Nuclear Information System (INIS)

    Greimann, L.; Fanous, F.; Safar, S.; Khalil, A.; Bluhm, D.

    1999-01-01

    The AP600 passive containment vessel is surrounded by a concrete cylindrical shell covered with a truncated conical roof. This roof supports the passive containment cooling system (PCS) annular tank, shield plate and other nonstructural attachments. When the shield building is subjected to different loading combinations as defined in the Standard Review Plan (SRP), some of the sections in the shield building could experience forces in excess of their design values. This report summarized the three-dimensional finite element analysis that was conducted to review the adequacy of the proposed Westinghouse shield building design. The ANSYS finite element software was utilized to analyze the Shield Building Roof (SBR) under dead, snow, wind, thermal and seismic loadings. A three-dimensional model that included a portion of the shield building cylindrical shell, the conical roof and its attachments, the eccentricities at the cone-cylinder connection and at the compression ring and the PCS tank was developed. Mesh sensitivity studies were conducted to select appropriate element size in the cylinder, cone, near air intakes and in the vicinity of the eccentricities. Also, a study was carried out to correctly idealize the water-structure interaction in the PCS tank. Response spectrum analysis was used to calculate the internal forces at different sections in the SBR under Safe Shutdown Earthquake (SSE). Forty-nine structural modes and twenty sloshing modes were used. Two horizontal components of the SSE together with a vertical component were used. Modal stress resultants were combined taking into account the effects of closely spaced modes. The three earthquake directions were combined by the Square Root of the Sum Squares method. Two load combinations were studied. The load combination that included dead, snow, fluid, thermal and seismic loads was selected to be the most critical. Interaction diagrams for critical sections were developed and used to check the design

  18. Comparison of experimental and calculated shielding factors for modular buildings in a radioactive fallout scenario

    DEFF Research Database (Denmark)

    Hinrichsen, Yvonne; Finck, Robert; Östlund, Karl

    2018-01-01

    building used was a standard prefabricated structure obtained from a commercial manufacturer. Four reference positions for the gamma radiation detectors were used inside the building. Theoretical dose rate calculations were performed using the Monte Carlo code MCNP6, and additional calculations were......Experimentally and theoretically determined shielding factors for a common light construction dwelling type were obtained and compared. Sources of the gamma-emitting radionuclides 60Co and 137Cs were positioned around and on top of a modular building to represent homogeneous fallout. The modular...... performed that compared the shielding factor for 137Cs and 134Cs. This work demonstrated the applicability of using MCNP6 for theoretical calculations of radioactive fallout scenarios. Furthermore, the work showed that the shielding effect for modular buildings is almost the same for 134Cs as for 137Cs....

  19. UV irradiation of Shigella Dysenteriae induced the transformation and excision of a presumed integrated lysogenic prophage Shd-4L10 into a lytic phase

    International Nuclear Information System (INIS)

    Rodrigues, F. K.; Addy, B.; Armah, G.; Fobil, J.; Steiner-Asiedu, M.; Efavi, J.

    2012-01-01

    Repeated exposures of Shigella dysenteriae strain A to ultra-violet radiation (253.7 nm) with intervening outgrowth of survivors gave rise to clear bacteriophage plaques. Isolation, propagation and partial purification of the new Shd-4LI0 phages showed that they are similar in morphology to the Myxobacteriaphage Mx-4 described earlier. The new phages retained the general characteristics of S. dystenteriae phageShd-4L3, including serological properties and phage typing. It is suggested that ultra-violet irradiation may have played a role in the transformation and excision of the presumed lysogen of S. dysenteriaestrain A into a lytic phase. PhageShd-4LI0 was subsequently partially characterized. It has a density of 1.61, a DNA: protein ratio of 0.42 and thus a cryptogram of D/2:54.3/32.5:X/X: B/O. The phage was further characterised by fractionation of its protein using SDS-polyacrilamide gel electrophoresis. DNA extracted from phages was hydrolysed with restriction endonuclease R., EcoR1. The restriction fragments were catalogued and their apparent molecular weights calculated from electrophoresis gels calibrated with fragments from DNA of coliphageλ λ. From the total fragments obtained with nuclease R., EcoR1, the apparent minimum molecular weight of phage Shd-4LI0DNA was found to be 54.3 x 10 6 Daltons. The molecular weight of the phage DNA was also calculated from measurements of contour length of purified DNA samples, using the formula MW = 1.97 x 10 10 1/(magnification), where 1 is the measured length of DNA in centimetres). The very close relatedness with phage Shd-4L3 was confirmed by these techniques. (au)

  20. AP1000 Shield Building Dynamic Response for Different Water Levels of PCCWST Subjected to Seismic Loading considering FSI

    Directory of Open Access Journals (Sweden)

    Daogang Lu

    2015-01-01

    Full Text Available Huge water storage tank on the top of many buildings may affect the safety of the structure caused by fluid-structure interaction (FSI under the earthquake. AP1000 passive containment cooling system water storage tank (PCCWST placed at the top of shield building is a key component to ensure the safety of nuclear facilities. Under seismic loading, water will impact the wall of PCCWST, which may pose a threat to the integrity of the shield building. In the present study, an FE model of AP1000 shield building is built for the modal and transient seismic analysis considering the FSI. Six different water levels in PCCWST were discussed by comparing the modal frequency, seismic acceleration response, and von Mises stress distribution. The results show the maximum von Mises stress emerges at the joint of shield building roof and water around the air inlet. However, the maximum von Mises stress is below the yield strength of reinforced concrete. The results may provide a reference for design of the AP1000 and CAP1400 in the future.

  1. Determination of shielding factors for typical buildings in Brazil

    International Nuclear Information System (INIS)

    Salinas, Isabel Cristina Poquet

    2006-10-01

    This study presents a methodology for the determination of the air kerma inside buildings due to contamination on the external surfaces and the shielding factors for the construction material to be used on emergency assessment systems for urban areas. The commonly used construction materials were simulated with the MCNP computer code. A special methodology to simulate the bricks with holes were developed, mixing all different regions into a single one, making the simulation easier and faster. The effective density and the attenuation coefficients for the 50-3000 keV energy range were determined. The effective protection for the bricks with no cement cover decreases by 40-50% for energies greater then 300 keV when compared to bricks covered on both sides. With the data made available it was possible to evaluate the influence of the construction materials densities and thickness on the exposure due to external surfaces contamination and to estimate the error on the dose when the shielding factor applied on the calculation differs from the more realistic ones. The shielding factors for three types of walls were determined for a five rooms house. Special protection procedures should be applied for houses built with bricks with no cement cover, because they are due to the double of the dose when compared to houses built with bricks two-sided cement covered. The influence of windows and doors were evaluated too. This work was developed at the IRD in order to provide information on the construction material commonly uses on building in Brazil. (author)

  2. Radiation Build-Up In Shielding Of Low Activity High Energia Gamma Source

    International Nuclear Information System (INIS)

    Helfi-Yuliati; Mukhlis-Akhadi

    2003-01-01

    Research to observe radiation build-up factor (b) in aluminium (Al), iron (Fe) and lead (Pb) for shielding of gamma radiation of high energy from 137 cs (E γ : 662 keV) source and 60 Co (E γ : 1332 keV) of low activity sources has been carried out. Al with Z =13 represent metal of low atomic number, Fe with Z =26 represent metal of medium atomic number, and Pb with Z = 82 represent metal of high atomic number. Low activity source in this research is source which if its dose rate decrease to 3 % of its initial dose rate became safe for the workers. Research was conducted by counting of radiation intensity behind shielding with its thickness vary from 1 to 5 times of half value thickness (HVT). NaI(TI) detector which connected to multi channel analyzer (MCA) was used for the counting. Calculation result show that all of b value are close to 1 (b ∼ 1) for all kinds of metals. No radiation build-up factor is required in estimating the shielding thickness from several kinds of metals for low activity of high energy gamma source. (author)

  3. Radiation shielding and dose rate distribution for the building of the high dose rate accelerator

    International Nuclear Information System (INIS)

    Matsuda, Koji; Takagaki, Torao; Nakase, Yoshiaki; Nakai, Yohta.

    1984-03-01

    A high dose rate electron accelerator was established at Osaka Laboratory for Radiation Chemistry, Takasaki Establishment, JAERI in the fiscal year of 1975. This report shows the fundamental concept for the radiation shielding of the accelerator building and the results of their calculations which were evaluated through the model experiments. After the construction of the building, the leak radiation was measured in order to evaluate the calculating method of radiation shielding. Dose rate distribution of X-rays was also measured in the whole area of the irradiation room as a data base. (author)

  4. Radiation Build-Up Of High Energy Gamma In Shielding Of High Atomic Number

    International Nuclear Information System (INIS)

    Yuliati, Helfi; Akhadi, Mukhlis

    2000-01-01

    Research to observe effect of radiation build-up factor (b) in iron (Fe) and lead (Pb) for high energy gamma shielding from exp.137 Cs (E gamma : 662 keV) and exp.60 Co (E gamma : 1332 keV) sources has been carried out. Research was conducted bt counting of radiation intensity behind shielding with its thickness vary from 1 to 5 times of half value thickness (HVT). NaI (TI) detector which connected to multi channel analyzer (MCA) was used for the counting. Calculation result show that all of b value are near to 1 (b∼1) both for Fe and Pb. Without inserting b in calculation, from the experiment it was obtained HVT value of Fe for high gamma radiation of 662 and 1332 keV were : (12,94 n 0,03) mm and (17,33 n 0,01) mm with their deviation standards were 0,2% and 0,06% respectively. Value of HVT for Pb with the same energy were : (6,31 n 0,03) mm and (11,86 n 0,03) mm with their deviation standars were : 0,48% and 0,25% respectively. HVL concept could be applied directly to estimate shielding thickness of high atomic number of high energy gamma radiation, without inserting correction of radiation build-up factor

  5. Investigation of ionizing radiation shielding effectiveness of decorative building materials used in Bangladeshi dwellings

    International Nuclear Information System (INIS)

    Yesmin, Sabina; Sonker Barua, Bijoy; Uddin Khandaker, Mayeen; Tareque Chowdhury, Mohammed; Kamal, Masud; Rashid, M.A.; Miah, M.M.H.; Bradley, D.A.

    2017-01-01

    Following the rapid growing per capita income, a major portion of Bangladeshi dwellers is upgrading their non-brick houses by rod-cement-concrete materials and simultaneously curious to decorate the houses using luxurious marble stones. Present study was undertaken to investigate the gamma-ray attenuation co-efficient of decorative marble materials leading to their suitability as shielding of ionizing radiation. A number of commercial grades decorative marble stones were collected from home and abroad following their large-scale uses. A well-shielded HPGe γ-ray spectrometer combined with associated electronics was used to evaluate the mass attenuation coefficients of the studied materials for high energy photons. Some allied parameters such as half-value layer and radiation protection efficacy of the investigated marbles were calculated. The results showed that among the studied samples, the marble ‘Carrara’ imported from Italy is suitable to be used as radiation shielding material. - Highlights: • Studies of decorative building materials for shielding of ionizing radiation. • High energy photon beam were used to obtain various interaction properties. • Marble stone ‘Carrara’ from Italy shows suitability to be used as shielding material.

  6. Slipforming of reinforced concrete shield building

    International Nuclear Information System (INIS)

    Hsieh, M.C.; King, J.R.

    1982-01-01

    The unique design and construction features of slipforming the heavily reinforced concrete cylindrical shield walls at the Satsop nuclear plant in Washington, D.C. site are presented. The shield walls were designed in compliance with seismic requirements which resulted in the need for reinforcing steel averaging 326 kg/m/sup 3/. A 7.6 m high, three-deck moving platform was designed to permit easy installation of the reinforcing steel, embedments, and blockouts, and to facilitate concrete placement and finishing. Two circular box trusses, one on each side of the shield wall, were used in combination with a spider truss to meet both the tolerance and strength requirements for the slipform assembly

  7. Investigation the effect of outdoor air infiltration on the heat-shielding characteristics the outer walls of high-rise buildings

    Science.gov (United States)

    Vytchikov, Yu. S.; Kostuganov, A. B.; Saparev, M. E.; Belyakov, I. G.

    2018-03-01

    The presented article considers the influence of infiltrated outdoor air on the heat-shielding characteristics of the exterior walls of modern residential and public buildings. A review of the sources devoted to this problem confirmed its relevance at the present time, especially for high-rise buildings. The authors of the article analyzed the effect of longitudinal and transverse air infiltration on the heat-shielding characteristics of the outer wall of a 25-story building that was built in Samara. The results showed a significant reduction of the reduced resistance to the heat transfer of the outer wall when air is infiltrated through it. There are the results of full-scale examination of external walls to confirm the calculated data. Based on the results of the study carried out by the authors of the article, general recommendations on the internal finishing of the outer walls of high-rise buildings are given.

  8. Survivor shielding. Part A. Nagasaki factory worker shielding

    International Nuclear Information System (INIS)

    Santoro, Robert T.; Barnes, John M.; Azmy, Yousry Y.; Kerr, George D.; Egbert, Stephen D.; Cullings, Harry M.

    2005-01-01

    Recent investigations based on conventional chromosome aberration data by the RERF suggest that the DS86 doses received by many Nagasaki factory workers may have been overestimated by as much as 40% relative to those for other survivors in Japanese-type houses and other shielding configurations (Kodama et al. 2001). Since the factory workers represent about 25% of the Nagasaki survivors with DS86 doses in excess of 0.5 Gy (50 rad), systematic errors in their dose estimates can have a major impact on the risk coefficients from RERF studies. The factory worker doses may have been overestimated for a number of reasons. The calculation techniques, including the factory building modeling, weapon source spectra and cross-section data used in the DS86 shielding calculations were not detailed enough to replicate actual conditions. The models used did not take into account local shielding provided by machinery, tools, and the internal structure in the buildings. In addition, changes in the disposition of shielding following collapse of the building by the blast wave were not considered. The location of large factory complexes may be uncertain, causing large numbers of factory survivors, correctly located relative to each other, to be uniformly too close to the hypocenter. Any or all of these reasons are sufficient to result in an overestimate of the factory worker doses. During the DS02 studies, factory worker doses have been reassessed by more carefully modeling the factory buildings, incorporating improved radiation transport methods and cross-section data and using the most recent bomb leakage spectra (Chapter 2). Two-dimensional discrete ordinates calculations were carried out initially to estimate the effects of workbenches and tools on worker doses to determine if the inclusion of these components would, in fact, reduce the dose by amounts consistent with the RERF observations (Kodama et al. 2001). (author)

  9. Shielding augmentation of roll-on shield from NAPS to Kaiga-2

    International Nuclear Information System (INIS)

    Pradhan, A.S.; Kumar, A.N.

    2000-01-01

    Extensive radiation field surveys were conducted in NAPS and KAPS reactor buildings as a part of commissioning checks on radiation shielding. During such surveys, dose rate higher than the expected values were noticed in fuelling machine service areas. A movable shield, separating high field area fuelling machine vault and low field area fuelling machine service area, known as roll-on shield was identified as one of the causes of high field in fuelling machine service area along with weaker end-shield. This paper discusses systematic approach adopted in bringing down the dose rates in fuelling machine service area by augmentation of roll-on shield. (author)

  10. EBT-P gamma-ray-shielding analysis

    International Nuclear Information System (INIS)

    Gohar, Y.

    1983-01-01

    First, a one-dimensional scoping study was performed for the gamma-ray shield of the ELMO Bumpy Torus proof-of-principle device to define appropriate shielding material and determine the required shielding thickness. The dose-equivalent results are analyzed as a function of the radiation-shield thickness for different shielding options. A sensitivity analysis for the pessimistic case is given. The recommended shielding option based on the performance and cost is discussed. Next, a three-dimensional scoping study for the coil shield was performed for four different shielding options to define the heat load for each component and check the compliance with the design criterion of 10 watts maximum heat load per coil from the gamma-ray sources. Also, a detailed biological-dose survey was performed which included: (a) the dose equivalent inside and outside the building, (b) the dose equivalent from the two mazes of the building, and (c) the skyshine contribution to the dose equivalent

  11. System for detecting and processing abnormality in electromagnetic shielding

    International Nuclear Information System (INIS)

    Takahashi, T.; Nakamura, M.; Yabana, Y.; Ishikawa, T.; Nagata, K.

    1991-01-01

    The present invention relates to a system for detecting and processing an abnormality in electromagnetic shielding of an intelligent building which is constructed using an electromagnetic shielding material for the skeleton and openings such as windows and doorways so that the whole of the building is formed into an electromagnetic shielding structure. (author). 4 figs

  12. External dosimetry sources and shielding

    International Nuclear Information System (INIS)

    Calisto, Washington

    1994-01-01

    A definition of external dosimetry r external sources dosimetry,physical and mathematical treatment of the interaction of gamma radiation with a minimal area in that direction. Concept of attenuation coefficient, cumulated effect by polyenergetic sources, exposition rate, units, cumulated dose,shielding, foton shielding, depth calculation, materials used for shielding.Beta shielding, consideration of range and maximum β energy , low stopping radiation by use of low Z shielding. Tables for β energy of β emitters, I (tau) factor, energy-range curves for β emitters in aqueous media, gamma attenuation factors for U, W and Pb. Y factor for bone tissue,muscle and air, build-up factors

  13. Designing Shelter in New Buildings. A Manual for Architects on the Preliminary Designing of Shielding from Fallout Gamma Radiation in Normally Functioning Spaces in New Buildings.

    Science.gov (United States)

    Knott, Albert

    Analysis of radiation fallout prevention factors in new construction is presented with emphasis on architectural shielding principles. Numerous diagrams and charts illustrate--(1) radiation and fallout properties, (2) building protection principles, (3) details and planning suggestions, and (4) tabular data interpretation. A series of charts is…

  14. Radiation shielding bricks

    International Nuclear Information System (INIS)

    Crowe, G.J.W.

    1983-01-01

    A radiation shielding brick for use in building dry walls to form radiation proof enclosures and other structures is described. It is square in shape and comprises a sandwich of an inner layer of lead or similar shielding material between outer layers of plastics material, for structural stability. The ability to mechanically interlock adjacent bricks is provided by shaping the edges as cooperating external and internal V-sections. Relatively leak-free joints are ensured by enlarging the width of the inner layer in the edge region. (author)

  15. Gamma-ray energy buildup factor calculations and shielding effects of some Jordanian building structures

    Science.gov (United States)

    Sharaf, J. M.; Saleh, H.

    2015-05-01

    The shielding properties of three different construction styles, and building materials, commonly used in Jordan, were evaluated using parameters such as attenuation coefficients, equivalent atomic number, penetration depth and energy buildup factor. Geometric progression (GP) method was used to calculate gamma-ray energy buildup factors of limestone, concrete, bricks, cement plaster and air for the energy range 0.05-3 MeV, and penetration depths up to 40 mfp. It has been observed that among the examined building materials, limestone offers highest value for equivalent atomic number and linear attenuation coefficient and the lowest values for penetration depth and energy buildup factor. The obtained buildup factors were used as basic data to establish the total equivalent energy buildup factors for three different multilayer construction styles using an iterative method. The three styles were then compared in terms of fractional transmission of photons at different incident photon energies. It is concluded that, in case of any nuclear accident, large multistory buildings with five layers exterior walls, style A, could effectively attenuate radiation more than small dwellings of any construction style.

  16. Experimental shielding evaluation of the radiation protection provided by the structurally significant components of residential structures.

    Science.gov (United States)

    Dickson, E D; Hamby, D M

    2014-03-01

    The human health and environmental effects following a postulated accidental release of radioactive material to the environment have been a public and regulatory concern since the early development of nuclear technology. These postulated releases have been researched extensively to better understand the potential risks for accident mitigation and emergency planning purposes. The objective of this investigation is to provide an updated technical basis for contemporary building shielding factors for the US housing stock. Building shielding factors quantify the protection from ionising radiation provided by a certain building type. Much of the current data used to determine the quality of shielding around nuclear facilities and urban environments is based on simplistic point-kernel calculations for 1950s era suburbia and is no longer applicable to the densely populated urban environments realised today. To analyse a building's radiation shielding properties, the ideal approach would be to subject a variety of building types to various radioactive sources and measure the radiation levels in and around the building. While this is not entirely practicable, this research analyses the shielding effectiveness of ten structurally significant US housing-stock models (walls and roofs) important for shielding against ionising radiation. The experimental data are used to benchmark computational models to calculate the shielding effectiveness of various building configurations under investigation from two types of realistic environmental source terms. Various combinations of these ten shielding models can be used to develop full-scale computational housing-unit models for building shielding factor calculations representing 69.6 million housing units (61.3%) in the United States. Results produced in this investigation provide a comparison between theory and experiment behind building shielding factor methodology.

  17. Method for temporary shielding of reactor vessel internals

    International Nuclear Information System (INIS)

    Grimm, N.P.; Sejvar, J.

    1991-01-01

    This patent describes a method for shielding stored internals for reactor vessel annealing. It comprises removing nuclear fuel from the reactor vessel containment building; removing and storing upper and lower core internals under water in a refueling canal storage area; assembling a support structure in the refueling canal between the reactor vessel and the stored internals; introducing vertical shielding tanks individually through a hatch in the containment building and positioning each into the support structure; introducing horizontal shielding tanks individually through a hatch in the containment building and positioning each above the stored internals and vertical tanks; draining water from the refueling canal to the level of a flange of the reactor vessel; placing an annealing apparatus in the reactor vessel; pumping the remaining water from the reactor vessel; and annealing the reactor vessel

  18. Building method for nuclear power plant

    International Nuclear Information System (INIS)

    Iba, Tsutomu.

    1993-01-01

    Outer shielding buildings and inner concretes are dismantled and removed. In this case, foundations are left as they are. Then, new outer shielding buildings and inner concretes are constructed on the old foundations by way of rubber a laminates. The outer shielding buildings and the inner concretes supported by the rubber laminates have an earthquake-proof structure and vibrations upon occurrence of earthquakes can be moderated by the rubber laminates. Therefore, it is not required to make the outer shielding buildings so strong, and the weight of them can be reduced. Accordingly, the weight of the buildings is reduced compared with the buildings before dismantling, so that they can be sufficiently supported by the old foundations. This enables to build a nuclear power plant without ensuring new construction sites. (I.N.)

  19. Experimental shielding evaluation of the radiation protection provided by the structurally significant components of residential structures

    International Nuclear Information System (INIS)

    Dickson, E D; Hamby, D M

    2014-01-01

    The human health and environmental effects following a postulated accidental release of radioactive material to the environment have been a public and regulatory concern since the early development of nuclear technology. These postulated releases have been researched extensively to better understand the potential risks for accident mitigation and emergency planning purposes. The objective of this investigation is to provide an updated technical basis for contemporary building shielding factors for the US housing stock. Building shielding factors quantify the protection from ionising radiation provided by a certain building type. Much of the current data used to determine the quality of shielding around nuclear facilities and urban environments is based on simplistic point-kernel calculations for 1950s era suburbia and is no longer applicable to the densely populated urban environments realised today. To analyse a building’s radiation shielding properties, the ideal approach would be to subject a variety of building types to various radioactive sources and measure the radiation levels in and around the building. While this is not entirely practicable, this research analyses the shielding effectiveness of ten structurally significant US housing-stock models (walls and roofs) important for shielding against ionising radiation. The experimental data are used to benchmark computational models to calculate the shielding effectiveness of various building configurations under investigation from two types of realistic environmental source terms. Various combinations of these ten shielding models can be used to develop full-scale computational housing-unit models for building shielding factor calculations representing 69.6 million housing units (61.3%) in the United States. Results produced in this investigation provide a comparison between theory and experiment behind building shielding factor methodology. (paper)

  20. The trade experiment: Shielding calculations for the building hosting the subcritical system

    International Nuclear Information System (INIS)

    Burn, K. W.; Carta, M.; Casalini, L.; Kadi, Y.; Monti, S.; Nava, E.; Palomba, M.; Petrovich, C.; Picardi, L.; Rubbia, C.; Troiani, F.

    2005-01-01

    The TRADE project (TRIGA Accelerator Driven Experiment), to be performed at the existing TRIGA reactor at ENEA Casaccia, has been proposed as a validation of the accelerator-driven system (ADS) concept. TRADE will be the first experiment in which the three main components of an ADS-the accelerator, spallation target and sub-critical blanket-are coupled at a power level sufficient to encounter reactivity feedback effects. As such, TRADE represents the necessary intermediate step in the development of hybrid transmutation systems, its expected outcomes being considered crucial-in terms of proof of stability of operation, dynamic behaviour and licensing issues-for the subsequent realisation of an ADS Transmutation Demonstrator. An essential role in the feasibility study of the experiment is played by radioprotection calculations. Such a system exhibits new characteristics with respect to a traditional reactor, owing to the presence of the proton accelerator. As beam losses always occur under normal operating conditions of an accelerator, shielding studies need to be performed not only around the reactor but also along the beam line from the accelerator to the spallation target. This paper illustrates a preliminary evaluation, using Monte Carlo methods, of the additional shielding to be located around the reactor structures, the beam transport line and the existing reactor building to allow access into the reactor hall and to restrict the doses outside to their legal limits. (authors)

  1. Calculated shielding factors for selected European houses

    International Nuclear Information System (INIS)

    Hedemann Jensen, P.

    1984-12-01

    Shielding factors for gamma radiation from activity deposited on structures and ground surfaces have been calculated with the computer model DEPSHIELD for single-family and multi-storey buildings in France, United Kingdom and Denmark. For all three countries it was found that the shielding factors for single-family houses are approximately a factor of 2 - 10 higher that those for buildings with five or more storeys. Away from doors and windows the shielding factors for French, British, and Danish single-family houses are in the range 0.03 - 0.1, 0.06 - 0.4, and 0.07 - 0.3, respectively. The uncertainties of the calculations are discussed and DEPSHIELD-results are compared with other methods as well as with experimental results. (author)

  2. Build-up Factor Calculation for Ordinary Concrete, Baryte Concrete and Blast-furnace Slugges Concrete as γ Radiation Shielding

    International Nuclear Information System (INIS)

    Isman MT; Elisabeth Supriatni; Tochrul Binowo

    2002-01-01

    Calculation of build up factor ordinary concrete, baryte concrete and blast-furnace sludge concrete have been carried out. The calculations have been carried out by dose rate measurement of Cs 137 source before and after passing through shielding. The investigated variables were concrete type, thickness of concrete and relative possession of concrete. Concrete type variables are ordinary concrete, baryte concrete and blast sludge furnace concrete. The thickness variables were 6, 12, 18, 24, 30 and 36 cm. The relative position variables were dose to the source and close to detector. The result showed that concrete type and position did not have significant effect to build-up factor value, while the concrete thickness (r) and the attenuation coefficient (μ) were influenced to the build-up factor. The higher μr value the higher build-up factor value. (author)

  3. Determination of shielding factors for typical buildings in Brazil; Determinacao dos fatores de blindagem para construcoes tipicamente brasileiras

    Energy Technology Data Exchange (ETDEWEB)

    Salinas, Isabel Cristina Poquet

    2006-10-15

    This study presents a methodology for the determination of the air kerma inside buildings due to contamination on the external surfaces and the shielding factors for the construction material to be used on emergency assessment systems for urban areas. The commonly used construction materials were simulated with the MCNP computer code. A special methodology to simulate the bricks with holes were developed, mixing all different regions into a single one, making the simulation easier and faster. The effective density and the attenuation coefficients for the 50-3000 keV energy range were determined. The effective protection for the bricks with no cement cover decreases by 40-50% for energies greater then 300 keV when compared to bricks covered on both sides. With the data made available it was possible to evaluate the influence of the construction materials densities and thickness on the exposure due to external surfaces contamination and to estimate the error on the dose when the shielding factor applied on the calculation differs from the more realistic ones. The shielding factors for three types of walls were determined for a five rooms house. Special protection procedures should be applied for houses built with bricks with no cement cover, because they are due to the double of the dose when compared to houses built with bricks two-sided cement covered. The influence of windows and doors were evaluated too. This work was developed at the IRD in order to provide information on the construction material commonly uses on building in Brazil. (author)

  4. Comparison of deterministic and Monte Carlo methods in shielding design.

    Science.gov (United States)

    Oliveira, A D; Oliveira, C

    2005-01-01

    In shielding calculation, deterministic methods have some advantages and also some disadvantages relative to other kind of codes, such as Monte Carlo. The main advantage is the short computer time needed to find solutions while the disadvantages are related to the often-used build-up factor that is extrapolated from high to low energies or with unknown geometrical conditions, which can lead to significant errors in shielding results. The aim of this work is to investigate how good are some deterministic methods to calculating low-energy shielding, using attenuation coefficients and build-up factor corrections. Commercial software MicroShield 5.05 has been used as the deterministic code while MCNP has been used as the Monte Carlo code. Point and cylindrical sources with slab shield have been defined allowing comparison between the capability of both Monte Carlo and deterministic methods in a day-by-day shielding calculation using sensitivity analysis of significant parameters, such as energy and geometrical conditions.

  5. Comparison of deterministic and Monte Carlo methods in shielding design

    International Nuclear Information System (INIS)

    Oliveira, A. D.; Oliveira, C.

    2005-01-01

    In shielding calculation, deterministic methods have some advantages and also some disadvantages relative to other kind of codes, such as Monte Carlo. The main advantage is the short computer time needed to find solutions while the disadvantages are related to the often-used build-up factor that is extrapolated from high to low energies or with unknown geometrical conditions, which can lead to significant errors in shielding results. The aim of this work is to investigate how good are some deterministic methods to calculating low-energy shielding, using attenuation coefficients and build-up factor corrections. Commercial software MicroShield 5.05 has been used as the deterministic code while MCNP has been used as the Monte Carlo code. Point and cylindrical sources with slab shield have been defined allowing comparison between the capability of both Monte Carlo and deterministic methods in a day-by-day shielding calculation using sensitivity analysis of significant parameters, such as energy and geometrical conditions. (authors)

  6. Age of shield-building volcanism of Kauai and linear migration of volcanism in the Hawaiian Island chain

    International Nuclear Information System (INIS)

    McDougall, I.

    1979-01-01

    Tholeiitic basalts of the Napali Formation comprise the bulk of the Kauai shield volcano. Potassium-argon ages measured on 16 samples from three separate areas in this formation lie in the range 5.14 +- 0.20 to 3.81 +- 0.06 m.y. The scatter in the measured ages in each area is greater than that expected from experimental error alone, and variable loss of radiogenic argon is regarded as at least partly responsible. Nevertheless an interval of eruption in the order of 0.8 m.y. is deduced for the Napali Formation. The results from the Napali Formation taken togehter with K-Ar ages measured earlier on basalts of the Makaweli Formation, the youngest formation of the dome-building phase, yield a mean age of 4.43 +- 0.45 m.y. for the construction of the main subaerial shield volcano of Kauai. (orig./ME)

  7. Technology development for radiation shielding analysis

    International Nuclear Information System (INIS)

    Ha, Jung Woo; Lee, Jae Kee; Kim, Jong Kyung

    1986-12-01

    Radiation shielding analysis in nuclear engineering fields is an important technology which is needed for the calculation of reactor shielding as well as radiation related safety problems in nuclear facilities. Moreover, the design technology required in high level radioactive waste management and disposal facilities is faced on serious problems with rapidly glowing nuclear industry development, and more advanced technology has to be developed for tomorrow. The main purpose of this study is therefore to build up the self supporting ability of technology development for the radiation shielding analysis in order to achieve successive development of nuclear industry. It is concluded that basic shielding calculations are possible to handle and analyze by using our current technology, but more advanced technology is still needed and has to be learned for the degree of accuracy in two-dimensional shielding calculation. (Author)

  8. Shielding walls against ionizing radiation

    International Nuclear Information System (INIS)

    1993-05-01

    Hot-cell shielding walls consist of building blocks made of lead according to DIN 25407 part 1, and of special elements according to DIN 25407 part 2. Alpha-gamma cells can be built using elements for protective contamination boxes according to DIN 25480 part 1. This standards document intends to provide planning engineers, manufacturers, future users and the competent authorities and experts with a basis for the design of hot cells with lead shielding walls and the design of hot-cell equipment. (orig./HP) [de

  9. Activation of the concrete in the bio shield of ITER

    International Nuclear Information System (INIS)

    Kalcheva, S.

    2005-02-01

    Calculations of neutron spectra in different parts of the tokamak building of ITER are performed. A computational geometry model of the tokamak building is prepared using MCNP-4C. The model includes adequate material composition and geometry description of the main parts of the tokamak for PPCS plant model A: toroidal field coils, vacuum vessel, shield, blanket structure, first wall, divertor, 14.1 MeV neutron source. The design and the dimensions of the bio shield are taken from the current ITER design. MCNP calculations of the neutron spectra in the bio shield (concrete) of ITER are performed, using the neutron spectra in TF coils calculated at UKAEA as external neutron source. The neutron spectra in the concrete calculated by MCNP are used as input data in the code EASY99 for estimations of the activation of the concrete in the bio shield around the tokamak. The time evolutions of the maximum (in the bio shield floor) and minimum (in the bio shield side walls) specific activity (Bq/kg) and dose rate (Sv/h.) of the main dominant nuclides in the concrete are evaluated and compared for 3 different concrete types, used as biological shield in the PWR and BR3 reactors. (author)

  10. SNF shipping cask shielding analysis

    International Nuclear Information System (INIS)

    Johnson, J.O.; Pace, J.V. III.

    1996-01-01

    The Waste Management and Remedial Action Division has planned a modification sequence for storage facility 7827 in the Solid Waste Storage Area (SWSA). The modification cycle is: (1) modify an empty caisson, (2) transfer the spent nuclear fuel (SNF) of an occupied caisson to a hot cell in building 3525 for inspection and possible repackaging, and (3) return the package to the modified caisson in the SWSA. Although the SNF to be moved is in the solid form, it has different levels of activity. Thus, the following 5 shipping casks will be available for the task: the Loop Transport Carrier, the In- Pile Loop LITR HB-2 Carrier, the 6.5-inch HRLEL Carrier, the HFIR Hot Scrap Carrier, and the 10-inch ORR Experiment Removal Shield Cask. This report describes the shielding tasks for the 5 casks: determination of shielding characteristics, any streaming avenues, estimation of thermal limits, and shielding calculational uncertainty for use in the transportation plan

  11. Radiation shielding lead shield

    International Nuclear Information System (INIS)

    Dei, Shoichi.

    1991-01-01

    The present invention concerns lead shields for radiation shielding. Shield boxes are disposed so as to surround a pipeline through which radioactive liquids, mists or like other objects are passed. Flanges are formed to each of the end edges of the shield boxes and the shield boxes are connected to each other by the flanges. Upon installation, empty shield boxes not charged with lead particles and iron plate shields are secured at first at the periphery of the pipeline. Then, lead particles are charged into the shield boxes. This attains a state as if lead plate corresponding to the depth of the box is disposed. Accordingly, operations for installation, dismantling and restoration can be conducted in an empty state with reduced weight to facilitate the operations. (I.S.)

  12. Shielded room measurements, Final report

    Energy Technology Data Exchange (ETDEWEB)

    Stanton, J.S.

    1949-02-22

    The attenuation of electro-statically and electro-magnetically shielded rooms in the ``E,`` ``R,`` ``I,`` and ``T`` Buildings was measured so that corrective measure could be taken if the attenuation was found to be low. If remedial measures could not be taken, the shortcomings of the rooms would be known. Also, the men making the measurements should oversee construction and correct errors at the time. The work was performed by measuring the attenuation at spot frequencies over the range of from 150 kilocycles to 1280 megacycles with suitable equipment mounted in small rubber-tried trucks. The attenuation was determined by ``before and after`` shielding and/or ``door open and door closed`` measurements after installation of copper shielding. In general, attenuation in the frequency range of approximately 10 to 150 mc. was good and was of the order expected. At frequencies in the range of 150 mc. to 1280 mc., the attenuation curve was more erratic; that is, at certain frequencies a severe loss of attenuation was noted, while at others, the attenuation was very good. This was mainly due to poor or faulty seals around doors and pass windows. These poor seals existed in the ``T,`` ``E,`` and ``I`` Buildings because the doors were fitted improperly and somewhat inferior material was used. By experience from these difficulties, both causes were corrected in the ``R`` Building, which resulted in the improvement of the very high frequency (v.h.f.) range in this building. In some specific cases, however, the results were about the same. For the range of frequencies below approximately 10 mc., the attenuation, in almost all cases, gradually decreased as the frequency decreased and reached a minimum at .3 to 1.0 mc. This loss of attenuation was attributed to multiple grounding caused by moisture in the insulating timbers and will gradually decrease as the wood dries out.

  13. Shielding analysis of high level waste water storage facilities using MCNP code

    Energy Technology Data Exchange (ETDEWEB)

    Yabuta, Naohiro [Mitsubishi Research Inst., Inc., Tokyo (Japan)

    2001-01-01

    The neutron and gamma-ray transport analysis for the facility as a reprocessing facility with large buildings having thick shielding was made. Radiation shielding analysis consists of a deep transmission calculation for the concrete wall and a skyshine calculation for the space out of the buildings. An efficient analysis with a short running time and high accuracy needs a variance reduction technique suitable for all the calculation regions and structures. In this report, the shielding analysis using MCNP and a discrete ordinate transport code is explained and the idea and procedure of decision of variance reduction parameter is completed. (J.P.N.)

  14. Design report for shielded glove box

    International Nuclear Information System (INIS)

    Ku, J. H.; Lee, J. C.; Seo, K. S.; Bang, K. S.; Lee, D. W.; Kim, J. H.; Min, D. K.; Park, S. W.

    1999-05-01

    For the examination of spent fuels and high radioactive specimens using a specially equipped scanning electron microscope, a shielded glove box was designed and constructed at PIE facility of KAERI. This glove box consisted of shielding walls, containment box, lead glasses, manipulators, gloves, ventilation systems, doors, hot-cell specimen cask adapter, etc. It was emphasized that both the easy operation and radiation safety are important factors in the shielded glove box were installed also considered as a important factor to build the basic concept of the assembling. Two sliding doors and one hinge-type door were installed for the easy installation, operation and maintenance of scanning electron microscope. Containment box which confines the radioactive material into the box consisted of reinforced transparent glasses, aluminum frames and stainless steel plate liner. Therefore everything beyond the containment box can be seen through the lead glass which installed at the front shielding wall. All shielding walls and doors were introduced separately into the room and assembled by bolting. (author). 3 refs., 5 tabs., 18 figs

  15. Seismic proof test of shielding block walls

    International Nuclear Information System (INIS)

    Ohte, Yukio; Watanabe, Takahide; Watanabe, Hiroyuki; Maruyama, Kazuhide

    1989-01-01

    Most of the shielding block walls used for building nuclear facilities are built by dry process. When a nuclear facility is designed, seismic waves specific at each site are set as input seismic motions and they are adopted in the design. Therefore, it is necessary to assure safety of the shielding block walls for earthquake by performing anti-seismic experiments under the conditions at each site. In order to establish the normal form that can be applied to various seismic conditions in various areas, Shimizu Corp. made an actual-size test samples for the shielding block wall and confirmed the safety for earthquake and validity of normalization. (author)

  16. Shielding walls against ionizing radiation. Lead bricks

    International Nuclear Information System (INIS)

    1993-04-01

    The standard contains specifications for the shape and requirements set for lead bricks such that they can be used to construct radiation-shielding walls according to the building kit system. The dimensions of the bricks are selected in such a way as to permit any modification of the length, height and thickness of said shielding walls in units of 50 mm. The narrow side of the lead bricks juxtaposed to one another in a wall construction to shield against radiation have to form prismatic grooves and tongues: in this way, direct penetration by radiation is prevented. Only cuboid bricks (serial nos. 55-60 according to Table 10) do not have prismatic tongues and grooves. (orig.) [de

  17. Feasibility of a superconducting FED with 50 cm of magnet shielding

    International Nuclear Information System (INIS)

    Schultz, J.H.; Montgomery, D.B.

    1981-01-01

    The feasibility of the suggestion that the cost of a Fusion Energy Device (FED) could be substantially reduced by operating with a reduced duty factor and only 50 cm of magnet shielding is evaluated here. This report examines the effect of light shielding on insulation life, matrix- and superconductor properties, refrigerator cost and steady-state heat removal. With very careful design, it appears feasible to build a device with only 50 cm of shielding

  18. Improved Metal-Polymeric Laminate Radiation Shielding, Phase II

    Data.gov (United States)

    National Aeronautics and Space Administration — In this proposed Phase II program, builds on the phase I feaibility where a multifunctional lightweight radiation shield composite was developed and fabricated. This...

  19. Air conditioning device for reactor buildings

    International Nuclear Information System (INIS)

    Kikuchi, Shiro.

    1982-01-01

    Purpose: To decrease the opening areas of pipe lines for an air conditioning device at the portions passing through the shielding walls of a reactor building for a FBR type reactor, as well as reduce the size of the building. Constitution: Airs in the building for containing reactor are liquefied in an air liquefying mechanism. The liquefied airs are sent by way of pipe lines to each of evaporators, wherein each of the chambers are cooled because of latent heat of evaporation and evaporated airs are released to each of the chambers. The airs released to each of the chambers are collected into an exhaust chamber and sent by way of a duct to the air liquefying mechanism and liquefied again. Since the volume of the liquefied airs may be smaller than the amount conventionally required for usual cooled airs, the pipe lines passing through the shielding walls of the building can be of smaller diameter. This can decrease the opening areas of the pipe lines at the portions passing through the walls of the shieldings and, since the opening areas are smaller, the structure of the radiation shieldings can be simplified in these portions. Further, since the space of the pipe lines in the building is reduced extremely, the size of the building can be reduced. (Moriyama, K.)

  20. Electron accelerator shielding design of KIPT neutron source facility

    Energy Technology Data Exchange (ETDEWEB)

    Zhong, Zhao Peng; Gohar, Yousry [Argonne National Laboratory, Argonne (United States)

    2016-06-15

    The Argonne National Laboratory of the United States and the Kharkov Institute of Physics and Technology of the Ukraine have been collaborating on the design, development and construction of a neutron source facility at Kharkov Institute of Physics and Technology utilizing an electron-accelerator-driven subcritical assembly. The electron beam power is 100 kW using 100-MeV electrons. The facility was designed to perform basic and applied nuclear research, produce medical isotopes, and train nuclear specialists. The biological shield of the accelerator building was designed to reduce the biological dose to less than 5.0e-03 mSv/h during operation. The main source of the biological dose for the accelerator building is the photons and neutrons generated from different interactions of leaked electrons from the electron gun and the accelerator sections with the surrounding components and materials. The Monte Carlo N-particle extended code (MCNPX) was used for the shielding calculations because of its capability to perform electron-, photon-, and neutron-coupled transport simulations. The photon dose was tallied using the MCNPX calculation, starting with the leaked electrons. However, it is difficult to accurately tally the neutron dose directly from the leaked electrons. The neutron yield per electron from the interactions with the surrounding components is very small, ∼0.01 neutron for 100-MeV electron and even smaller for lower-energy electrons. This causes difficulties for the Monte Carlo analyses and consumes tremendous computation resources for tallying the neutron dose outside the shield boundary with an acceptable accuracy. To avoid these difficulties, the SOURCE and TALLYX user subroutines of MCNPX were utilized for this study. The generated neutrons were banked, together with all related parameters, for a subsequent MCNPX calculation to obtain the neutron dose. The weight windows variance reduction technique was also utilized for both neutron and photon dose

  1. Radiation Shielding Properties of Some Marbles in Turkey

    International Nuclear Information System (INIS)

    Guenoglu, K.; Akkurt, I.

    2011-01-01

    Especially after development of technology, radiation started to be used in a large fields such as medicine, industry and energy. Using radiation in those fields bring hazardous effect of radiation into humancell. Thus radiation protection becomes important in physics. Although there are three ways for radiation protection, shielding of the radiation is the most commonly used method. Natural Stones such as marble is used as construction material especially in critical building and thus its radiation shielding capability should be determined.In this study, gamma ray shielding properties of some different types of marble mined in Turkey, have been measured using a NaI(Tl) scintillator detector. The measured results were also compared with the theoretical calculations XCOM.

  2. Radiation Shielding Properties of Some Marbles in Turkey

    Science.gov (United States)

    Günoǧlu, K.; Akkurt, I.

    2011-12-01

    Especially after development of technology, radiation started to be used in a large fields such as medicine, industry and energy. Using radiation in those fields bring hazordous effect of radition into humancell. Thus radiation protection becomes important in physics. Although there are three ways for radiation protection, shielding of the radiation is the most commonly used method. Natural Stones such as marble is used as construction material especially in critical building and thus its radiation shielding capability should be determined. In this study, gamma ray shielding properties of some different types of marble mined in Turkey, have been measured using a NaI(Tl) scintillator detector. The measured results were also compared with the theoretical calculations XCOM.

  3. Accelerator shield design of KIPT neutron source facility

    International Nuclear Information System (INIS)

    Zhong, Z.; Gohar, Y.

    2013-01-01

    Argonne National Laboratory (ANL) of the United States and Kharkov Institute of Physics and Technology (KIPT) of Ukraine have been collaborating on the design development of a neutron source facility at KIPT utilizing an electron-accelerator-driven subcritical assembly. Electron beam power is 100 kW, using 100 MeV electrons. The facility is designed to perform basic and applied nuclear research, produce medical isotopes, and train young nuclear specialists. The biological shield of the accelerator building is designed to reduce the biological dose to less than 0.5-mrem/hr during operation. The main source of the biological dose is the photons and the neutrons generated by interactions of leaked electrons from the electron gun and accelerator sections with the surrounding concrete and accelerator materials. The Monte Carlo code MCNPX serves as the calculation tool for the shield design, due to its capability to transport electrons, photons, and neutrons coupled problems. The direct photon dose can be tallied by MCNPX calculation, starting with the leaked electrons. However, it is difficult to accurately tally the neutron dose directly from the leaked electrons. The neutron yield per electron from the interactions with the surrounding components is less than 0.01 neutron per electron. This causes difficulties for Monte Carlo analyses and consumes tremendous computation time for tallying with acceptable statistics the neutron dose outside the shield boundary. To avoid these difficulties, the SOURCE and TALLYX user subroutines of MCNPX were developed for the study. The generated neutrons are banked, together with all related parameters, for a subsequent MCNPX calculation to obtain the neutron and secondary photon doses. The weight windows variance reduction technique is utilized for both neutron and photon dose calculations. Two shielding materials, i.e., heavy concrete and ordinary concrete, were considered for the shield design. The main goal is to maintain the total

  4. Features and performance of PCa board which cuts off the electromagnetic wave. Electromagnetic shield building using the carbon fiber contamination PCa board; Denjiha wo shadansuru PCa ban no tokucho to seino. Tanso sen'i konnyu PCa ban wo mochiita denji shirudobiru

    Energy Technology Data Exchange (ETDEWEB)

    Yoshida, Katsuo; Kasai, Yasuaki [Obayashi Corp., Osaka (Japan); Okada, Shin' ichiro; Sakamoto, Shin [Osaka Gas Corp., Osaka (Japan)

    1999-03-10

    With the rapid popularization of public radio information communication equipment, portable telephones, wireless LAN, etc., the interception (building shield) of the electromagnetic wave internal and external the building becomes large problem. As process equal to the convention and the method in which the cost is possible, they did do not shield the whole building, and also ensure the comfort as an office, and PCa board which mixed the carbon fiber into the mortar was developed. They described the survey result of the electromagnetic shield performance of the building which constructed by using this in external wall. They explained electromagnetism characteristics of the contamination mortar and application to the PCa board and method. They carried out the measurement in the electromagnetic shield room laboratory, and they obtained next result. 1) There is seldom on the effect both only the concrete and only by the carbon fiber mesh. 2) They considered the effect that carbon fiber chop 1% are mixed into the concrete. 3) The effect became a maximum, when carbon fiber chop and carbon fiber mesh were mixed, and they confirmed being excellent cost-concerned. (NEDO)

  5. Shielding features of quarry stone

    International Nuclear Information System (INIS)

    Hernandez V, C.; Contreras S, H.; Hernandez A, L.; Baltazar R, A.; Escareno J, E.; Mares E, C. A.; Vega C, H. R.

    2010-10-01

    Quarry stone lineal attenuation coefficient for gamma-rays has been obtained. In Zacatecas, quarry stone is widely utilized as a decorative item in buildings, however its shielding features against gamma-rays unknown. The aim of this work is to determine the shielding properties of quarry stone against γ-rays using Monte Carlo calculations where a detailed model of a good geometry experimental setup was carried out. In the calculations 10 pieces 10 X 10 cm 2 of different thickness were utilized to evaluate the photons transmission as the quarry stone thickness is increased. It was noticed that transmitted photons decay away as the shield thickness is increased, these results were fitted to an exponential function were the linear attenuation coefficient was estimated. Also, using XCOM code the linear attenuation coefficient from several keV up to 100 MeV was estimated. From the comparison between Monte Carlo results and XCOM calculations a good agreement was found. For 0.662 MeV γ-rays the attenuation coefficient of quarry stone, whose density is 2.413 g-cm -3 , is 0.1798 cm -1 , this mean a X 1/2 = 3.9 cm, X 1/4 = 7.7 cm, X 1/10 = 12.8 cm, and X 1/100 = 25.6 cm. Having the information of quarry stone performance as shielding give the chance to use this material to shield X and γ-ray facilities. (Author)

  6. Shielded Canister Transporter

    International Nuclear Information System (INIS)

    Eidem, G.G. Jr.; Fages, R.

    1993-01-01

    The Hanford Waste Vitrification Plant (HWVP) will produce canisters filled with high-level radioactive waste immobilized in borosilicate glass. This report discusses a Shielded Canister Transporter (SCT) which will provide the means for safe transportation and handling of the canisters from the Vitrification Building to the Canister Storage Building (CSB). The stainless steel canisters are 0.61 meters in diameter, 3.0 meters tall, and weigh approximately 2,135 kilograms, with a maximum exterior surface dose rate of 90,000 R/hr. The canisters are placed into storage tubes to a maximum of three tall (two for overpack canisters) with an impact limiter placed at the tube bottom and between each canister. A floor plug seals the top of the storage tube at the operating floor level of the CSB

  7. Effectiveness of construction materials and some minerals used as radiation shielding

    International Nuclear Information System (INIS)

    Khunarak, P.; Bunnak, S.

    1988-01-01

    There are many kinds of ores in Thailand, some large amount of them are cheap and easy to obtain possess shielding properties for gamma radiation. These ores are baryte, illmenite, galena, scheelite, wolframite pyrite, cerrusite. Besides, building structure materials are also introduced for shielding properties study by using Co-60, Cs-137 and Ra-226 as gamma radiation sources in the experiments. The results turn out that those high density ores will possess a better shielding property than the low density ores. Radiation measurement equipment is G.M. tube connected to rate meter

  8. DEVELOPMENT OF EXTREMELY LOW FREQUENCY PASSIVE SHIELDING APPLICATION USING MAGNETIC AQUEOUS SUBSTRATE

    Directory of Open Access Journals (Sweden)

    NOOR ASHIKIN MOHD RASHID

    2016-04-01

    Full Text Available Public concerns on Extremely Low Frequency (ELF Electromagnetic Field (EMF exposure have been elongated since the last few decades. Electrical substations and high tension rooms in commercial buildings were among the contributing factors emanating ELF magnetic fields. This paper discussed various shielding methods conventionally used in mitigating the ELF exposure. Nevertheless, the standard methods were found to be impractical and incapable of meeting currents shielding demands. In response to that, remarkable researches were conducted in effort to invent novel methods which is more convenient and efficient such as magnetic aqueous shielding or paint, textiles and papers shielding. A magnetic aqueous substrate, Manganese Zinc Ferrite was used as shielding material. The magnetic field and flux distribution inside the aqueous magnetic material are evaluated to optimize shielding against ELFEMF exposure, as to mitigate its exposure.

  9. Double-layer neutron shield design as neutron shielding application

    Science.gov (United States)

    Sariyer, Demet; Küçer, Rahmi

    2018-02-01

    The shield design in particle accelerators and other high energy facilities are mainly connected to the high-energy neutrons. The deep penetration of neutrons through massive shield has become a very serious problem. For shielding to be efficient, most of these neutrons should be confined to the shielding volume. If the interior space will become limited, the sufficient thickness of multilayer shield must be used. Concrete and iron are widely used as a multilayer shield material. Two layers shield material was selected to guarantee radiation safety outside of the shield against neutrons generated in the interaction of the different proton energies. One of them was one meter of concrete, the other was iron-contained material (FeB, Fe2B and stainless-steel) to be determined shield thicknesses. FLUKA Monte Carlo code was used for shield design geometry and required neutron dose distributions. The resulting two layered shields are shown better performance than single used concrete, thus the shield design could leave more space in the interior shielded areas.

  10. New facility shield design criteria

    International Nuclear Information System (INIS)

    Howell, W.P.

    1981-07-01

    The purpose of the criteria presented here is to provide standard guidance for the design of nuclear radiation shields thoughout new facilities. These criteria are required to assure a consistent and integrated design that can be operated safely and economically within the DOE standards. The scope of this report is confined to the consideration of radiation shielding for contained sources. The whole body dose limit established by the DOE applies to all doses which are generally distributed throughout the trunk of the body. Therefore, where the whole body is the critical organ for an internally deposited radionuclide, the whole body dose limit applies to the sum of doses received must assure control of the concentration of radionuclides in the building atmosphere and thereby limit the dose from internal sources

  11. Modelling and Optimization of Four-Segment Shielding Coils of Current Transformers.

    Science.gov (United States)

    Gao, Yucheng; Zhao, Wei; Wang, Qing; Qu, Kaifeng; Li, He; Shao, Haiming; Huang, Songling

    2017-05-26

    Applying shielding coils is a practical way to protect current transformers (CTs) for large-capacity generators from the intensive magnetic interference produced by adjacent bus-bars. The aim of this study is to build a simple analytical model for the shielding coils, from which the optimization of the shielding coils can be calculated effectively. Based on an existing stray flux model, a new analytical model for the leakage flux of partial coils is presented, and finite element method-based simulations are carried out to develop empirical equations for the core-pickup factors of the models. Using the flux models, a model of the common four-segment shielding coils is derived. Furthermore, a theoretical analysis is carried out on the optimal performance of the four-segment shielding coils in a typical six-bus-bars scenario. It turns out that the "all parallel" shielding coils with a 45° starting position have the best shielding performance, whereas the "separated loop" shielding coils with a 0° starting position feature the lowest heating value. Physical experiments were performed, which verified all the models and the conclusions proposed in the paper. In addition, for shielding coils with other than the four-segment configuration, the analysis process will generally be the same.

  12. Shielding practice

    International Nuclear Information System (INIS)

    Sauermann, P.F.

    1985-08-01

    The basis of shielding practice against external irradiation is shown in a simple way. For most sources of radiation (point sources) occurring in shielding practice, the basic data are given, mainly in the form of tables, which are required to solve the shielding problems. The application of these data is explained and discussed using practical examples. Thickness of shielding panes of glove boxes for α and β radiation; shielding of sealed γ-radiography sources; shielding of a Co-60 radiation source, and of the manipulator panels for hot cells; damping factors for γ radiation and neutrons; shielding of fast and thermal neutrons, and of bremsstrahlung (X-ray tubes, Kr-85 pressure gas cylinders, 42 MeV betatrons, 20 MeV linacs); two-fold shielding (lead glass windows for hot cells, 14 MeV neutron generators); shielding against scattered radiation. (orig./HP) [de

  13. GARLIC, a shielding program for GAmma Radiation from Line- and Cylinder-sources

    Energy Technology Data Exchange (ETDEWEB)

    Roos, Matts

    1959-07-15

    GARLIC is a program for computing the gamma ray flux or dose rate at a shielded idotropic point detector, due to a line source or the line equivalent of a cylindrical source. The source strength distribution along the line must be either uniform or an arbitrary part of the positive half-cycle of a cosine function. The line source can be oriented arbitrarily with respect to the main shield and the detector, except that the detector must not be located on the line source or on its extension. The main source is a homogeneous plane slab in which scattered radiation is accounted for by multiplying each point element of the line source by a point source build-up factor inside the integral over the point elements. Between, the main shield and the line source additional shields can be introduced, which are either plane slabs, parallel to the main shield, or cylindrical rings, coaxial with the line source. Scattered radiation in the additional shields can only be accounted for by constant build-up factors outside the integral. GARLIC-xyz is an extended version particularly suited for the frequently met problem of shielding a room containing a large number of line sources in different positions. The program computes the angles and linear dimensions of a problem for GARLIC when the positions of the detector point and the end points of the line source are given as points in an arbitrary rectangular coordinate system. As an example the isodose curves in water are presented for a monoenergetic cosine-distributed line source at several source energies and for an operating fuel element of the Swedish reactor R3.

  14. Radiation shielding device

    International Nuclear Information System (INIS)

    Nakagawa, Takahiro; Yamagami, Makoto.

    1996-01-01

    A fixed shielding member made of a radiation shielding material is constituted in perpendicular to an opening formed on radiation shielding walls. The fixed shielding member has one side opened and has other side, the upper portion and the lower portion disposed in close contact with the radiation shielding walls. Movable shielding members made of a radiation shielding material are each disposed openably on both side of the fixed shielding member. The movable shielding member has a shaft as a fulcrum on one side thereof for connecting it to the radiation shielding walls. The other side has a handle attached for opening/closing the movable shielding member. Upon access of an operator, when each one of the movable shielding members is opened/closed on every time, leakage of linear or scattered radiation can be prevented. Even when both of the movable shielding members are opened simultaneously, the fixed shielding member and the movable shielding members form labyrinth to prevent leakage of linear radioactivity. (I.N.)

  15. Investigating Radiation Shielding Properties of Different Mineral Origin Heavyweight Concretes

    Science.gov (United States)

    Basyigit, Celalettin; Uysal, Volkan; Kilinçarslan, Şemsettin; Mavi, Betül; Günoǧlu, Kadir; Akkurt, Iskender; Akkaş, Ayşe

    2011-12-01

    The radiation although has hazardous effects for human health, developing technologies bring lots of usage fields to radiation like in medicine and nuclear power station buildings. In this case protecting from undesirable radiation is a necessity for human health. Heavyweight concrete is one of the most important materials used in where radiation should be shielded, like those areas. In this study, used heavyweight aggregates of different mineral origin (Limonite, Siderite), in order to prepare different series in concrete mixtures and investigated radiation shielding properties. The experimental results on measuring the radiation shielding, the heavyweight concrete prepared with heavyweight aggregates of different mineral origin show that, are useful radiation absorbents when they used in concrete mixtures.

  16. Investigating Radiation Shielding Properties of Different Mineral Origin Heavyweight Concretes

    International Nuclear Information System (INIS)

    Basyigit, Celalettin; Uysal, Volkan; Kilincarslan, Semsettin; Akkas, Ayse; Mavi, Betuel; Guenoglu, Kadir; Akkurt, Iskender

    2011-01-01

    The radiation although has hazardous effects for human health, developing technologies bring lots of usage fields to radiation like in medicine and nuclear power station buildings. In this case protecting from undesirable radiation is a necessity for human health. Heavyweight concrete is one of the most important materials used in where radiation should be shielded, like those areas. In this study, used heavyweight aggregates of different mineral origin (Limonite, Siderite), in order to prepare different series in concrete mixtures and investigated radiation shielding properties. The experimental results on measuring the radiation shielding, the heavyweight concrete prepared with heavyweight aggregates of different mineral origin show that, are useful radiation absorbents when they used in concrete mixtures.

  17. SINEX: SCALE shielding analysis GUI for X-Windows

    International Nuclear Information System (INIS)

    Browman, S.M.; Barnett, D.L.

    1997-12-01

    SINEX (SCALE Interface Environment for X-windows) is an X-Windows graphical user interface (GUI), that is being developed for performing SCALE radiation shielding analyses. SINEX enables the user to generate input for the SAS4/MORSE and QADS/QAD-CGGP shielding analysis sequences in SCALE. The code features will facilitate the use of both analytical sequences with a minimum of additional user input. Included in SINEX is the capability to check the geometry model by generating two-dimensional (2-D) color plots of the geometry model using a new version of the SCALE module, PICTURE. The most sophisticated feature, however, is the 2-D visualization display that provides a graphical representation on screen as the user builds a geometry model. This capability to interactively build a model will significantly increase user productivity and reduce user errors. SINEX will perform extensive error checking and will allow users to execute SCALE directly from the GUI. The interface will also provide direct on-line access to the SCALE manual

  18. Discussions for the shielding materials of synchrotron radiation beamline hutches

    International Nuclear Information System (INIS)

    Asano, Y.

    2006-01-01

    Many synchrotron radiation facilities are now under operation such as E.S.R.F., APS, and S.P.ring-8. New facilities with intermediated stored electron energy are also under construction and designing such as D.I.A.M.O.N.D., S.O.L.E.I.L., and S.S.R.F.. At these third generation synchrotron radiation facilities, the beamline shielding as well as the bulk shield is very important for designing radiation safety because of intense and high energy synchrotron radiation beam. Some reasons employ lead shield wall for the synchrotron radiation beamlines. One is narrow space for the construction of many beamlines at the experimental hall, and the other is the necessary of many movable mechanisms at the beamlines, for examples. Some cases are required to shield high energy neutrons due to stored electron beam loss and photoneutrons due to gas Bremsstrahlung. Ordinary concrete and heavy concrete are coming up to shield material of synchrotron radiation beamline hutches. However, few discussions have been performed so far for the shielding materials of the hutches. In this presentation, therefore, we will discuss the characteristics of the shielding conditions including build up effect for the beamline hutches by using the ordinary concrete, heavy concrete, and lead for shielding materials with 3 GeV and 8 GeV class synchrotron radiation source. (author)

  19. Nuclear reactor building

    International Nuclear Information System (INIS)

    Oshima, Nobuaki.

    1991-01-01

    The secondary container in a nuclear reactor building is made of a transparent structure having a shielding performance such as lead glass, by which the inside of the secondary container can be seen without undergoing radiation exposure. In addition, an operator transportation facility capable of carrying about 5 to 10 operators at one time is disposed, and the side of the facility on the secondary container is constituted with a transparent material such as glass, to provide a structure capable of observing the inside of the secondary container. The ventilation and air conditioning in the operator's transportation facility is in communication with the atmosphere of a not-controlled area. Accordingly, operators at the outside of the reactor building can reach the operator's transportation facility without taking and procedures for entering the controlled area and without undergoing radiation exposure. The inside of the secondary container in the reactor building can be seen from various directions through the transparent structure having the shielding performance. (N.H.)

  20. Shielding plugs

    International Nuclear Information System (INIS)

    Makishima, Kenji.

    1986-01-01

    Purpose: In shielding plugs of an LMFBR type reactor, to restrain natural convection of heat in an annular space between a thermal shield layer and a shield shell, to prevent the lowering of heat-insulation performance, and to alleviate a thermal stress in a reactor container and the shield shell. Constitution: A ring-like leaf spring split in the direction of height is disposed in an annular space between a thermal shield layer and a shield shell. In consequence, the space is partitioned in the direction of height and, therefore, if axial temperature conditions and space width are the same and the space is low, the natural convection is hard to occur. Thus the rise of upper surface temperature of the shielding plugs can prevent the lowering of the heat insulation performance which will result in the increment of shielding plug cooling capacity, thereby improving reliability. In the meantime, since there is mounted an earthquake-resisting support, the thermal shield layer will move for a slight gap in case of an earthquake, being supported by the earthquake-resisting support, and the movement of the thermal shield layer is restricted, thereby maintaining integrity without increasing the stroke of the ring-like spring. (Kawakami, Y.)

  1. Monteray Mark-I: Computer program (PC-version) for shielding calculation with Monte Carlo method

    International Nuclear Information System (INIS)

    Pudjijanto, M.S.; Akhmad, Y.R.

    1998-01-01

    A computer program for gamma ray shielding calculation using Monte Carlo method has been developed. The program is written in WATFOR77 language. The MONTERAY MARH-1 is originally developed by James Wood. The program was modified by the authors that the modified version is easily executed. Applying Monte Carlo method the program observe photon gamma transport in an infinity planar shielding with various thick. A photon gamma is observed till escape from the shielding or when its energy less than the cut off energy. Pair production process is treated as pure absorption process that annihilation photons generated in the process are neglected in the calculation. The out put data calculated by the program are total albedo, build-up factor, and photon spectra. The calculation result for build-up factor of a slab lead and water media with 6 MeV parallel beam gamma source shows that they are in agreement with published data. Hence the program is adequate as a shielding design tool for observing gamma radiation transport in various media

  2. Method for assembling dynamoelectric machine end shield parts

    International Nuclear Information System (INIS)

    Thomson, J.M.

    1984-01-01

    Methods, apparatus, and systems are provided for automatically assembling end shield assemblies of subassemblies for electric motors. In a preferred form, a system and methods are provided that utilize a non-palletized, non-synchronous concept to convey end shields through a number of assembly stations. At process stations situated along a conveyor, operations are performed on components. One method includes controlling traffic of sub-assemblies by toggle type escapements. A stop or latch of unique design stops end shield components in midstream, and ''lifts'' of unique design disengage parts from the conveyor and also support such parts during various operations. Photo-optic devices and proximity and reed switch mechanisms are utilized for control purposes. The work stations involved in one system include a unique assembly and pressing station involving oil well covers; a unique feed wick seating system; a unique lubricant adding operation; and unique ''building block'' mechanisms and methods

  3. Shield wall evaluation of hot cell facility for advanced spent fuel conditioning process

    International Nuclear Information System (INIS)

    Cho, I. J.; Kuk, D. H.; Ko, J. H.; Jung, W. M.; Yoo, G. S.; Lee, E. P.; Park, S. W.

    2002-01-01

    The future hot cell is located in the Irradiated Material Experiment Facility (IMEF) at the Korea Atomic Energy Research Institute (KAERI). It is β-γ type hot cell that was constructed on the base floor in IMEF building for irradiated material testing. And this hot cell will be used for carrying out the Advanced spent fuel Conditioning Process (ACP). The radiation shielding capability of hot cell should be sufficient to meet the radiation dose requirements in the related regulations. Because the radioactive sources of ACP are expected to be higher than radioactive sources of IMEF design criteria, the future hot cell in current status is unsatisfactory to hot test of ACP. So the shielding analysis of the future hot cell is performed to evaluate shielding ability of concrete shield wall. The shielding analysis included (a) identification of ACP source term; (b) photon source spectrum; (c) shielding analysis by QADS and MCNP-4C; and (d) enhancement of concrete shield wall. In this research, dose rates are obtained according to ACP source, geometry and hot cell shield wall thickness. And the evaluation and reinforcement thickness of the shield wall about future hot cell are concluded

  4. Investigation of ionizing radiation shielding effectiveness of decorative building materials used in Bangladeshi dwellings

    Science.gov (United States)

    Yesmin, Sabina; Sonker Barua, Bijoy; Uddin Khandaker, Mayeen; Tareque Chowdhury, Mohammed; Kamal, Masud; Rashid, M. A.; Miah, M. M. H.; Bradley, D. A.

    2017-11-01

    Following the rapid growing per capita income, a major portion of Bangladeshi dwellers is upgrading their non-brick houses by rod-cement-concrete materials and simultaneously curious to decorate the houses using luxurious marble stones. Present study was undertaken to investigate the gamma-ray attenuation co-efficient of decorative marble materials leading to their suitability as shielding of ionizing radiation. A number of commercial grades decorative marble stones were collected from home and abroad following their large-scale uses. A well-shielded HPGe γ-ray spectrometer combined with associated electronics was used to evaluate the mass attenuation coefficients of the studied materials for high energy photons. Some allied parameters such as half-value layer and radiation protection efficacy of the investigated marbles were calculated. The results showed that among the studied samples, the marble 'Carrara' imported from Italy is suitable to be used as radiation shielding material.

  5. Shielding for a tandem accelerator coupled to linac booster

    International Nuclear Information System (INIS)

    Bhattacharyya, S.; Bisht, J.S.; Venkataraman, G.

    1996-01-01

    Shielding calculation for the Beam-Hall-II of pelletron facility, augmented with linac booster in its phase-II at Nuclear Science Centre, New Delhi, has been done. An estimate is obtained by reduction factor method considering source radiation of monoenergetic neutrons, which is then compared with the detail computation using computer code ALICE considering total energy and angular distribution of neutrons. Another code ASFIT is used to take into account the build up of gamma dose from (n, gamma) reactions within the concrete shield incorporating new radiation weighting factors as recommended by ICRP-60. (author). 8 refs., 2 figs

  6. Study on Basic Characteristics for the Development of Radiation Shielding High-Weight Concrete

    Energy Technology Data Exchange (ETDEWEB)

    Mun, Young Bum; Lee, Jea Hyung; Choi, Hyun Kook [Sungshin Cement CO., Sejong (Korea, Republic of); Oh, Jeong Hwan; Choi, Soo Seok [Jeju National University, Jeju (Korea, Republic of)

    2016-05-15

    It is planned to build a power plant more than 6 units. Although the demand of a nuclear power plant is going to increase, the attention for radiation shielding is relatively in a low level. Concrete is one of the excellent and widely used shielding materials. Since the radiation shielding of a given material is proportional to density and thickness, a high-weight concrete with high-weight aggregate which is higher than normal concrete is used for radiation shielding. However, there are a few studies and references about radiation shielding concrete. Therefore, it is required to find a high-weight aggregate. The purpose of this paper is the development of a highweight concrete to improve radiation shielding capability. The radiation shielding rate of high-weight concrete is higher than that of reference concrete. It is confirmed that the density of aggregate and the unit weight of concreate is proportional to the radiation shielding rate. In addition, the chemical composition of aggregate has also has an important effect on γ-ray shielding. Therefore, high weight aggregates of higher density are essentially required to improve radiation shielding capability. The compressive strength of a high weight concrete is better than that of reference concrete. Slump and air contents, however, are slightly increased with by-product aggregates.

  7. Detailed mechanical design of the LIPAc beam dump radiological shielding

    Energy Technology Data Exchange (ETDEWEB)

    Nomen, Oriol, E-mail: onomen@irec.cat [IREC, Barcelona, Catalonia (Spain); CDEI-UPC, Barcelona, Catalonia (Spain); Martínez, José I.; Arranz, Fernando; Iglesias, Daniel; Barrera, Germán; Brañas, Beatriz [CIEMAT, Madrid (Spain); Ogando, Francisco [UNED, Madrid (Spain); Molla, Joaquín [CIEMAT, Madrid (Spain); Sanmartí, Manel [IREC, Barcelona, Catalonia (Spain)

    2013-10-15

    Highlights: ► Mechanical design of the IFMIF LIPAc beam dump shielding has been performed. ► Lead shutter design performed to shield radiation from beam dump when LIPAc is off. ► External loads, working and dismantling conditions, included as design constraints. -- Abstract: The LIPAc is a 9 MeV, D{sup +} linear prototype accelerator for the validation of the IFMIF accelerator design. The high intensity, 125 mA CW beam is stopped in a copper cone involving a high production of neutrons and gamma radiation and activation of its surface. The beam stopper is surrounded by a shielding to attenuate the resulting radiation so that dose rate values comply with the limits at the different zones of the installation. The shielding includes for that purpose polyethylene rings, water tanks and gray cast iron rings. A lead shutter has also been designed to shield the gamma radiation that comes through the beam tube when the linear accelerator is not in operation, in order to allow access inside the building for maintenance tasks. The present work summarizes the detailed mechanical design of the beam dump shielding and the lead shutter taking into account the design constraints, such as working conditions and other external loads, as well as including provisions for dismantling.

  8. Shielding Benchmark Computational Analysis

    International Nuclear Information System (INIS)

    Hunter, H.T.; Slater, C.O.; Holland, L.B.; Tracz, G.; Marshall, W.J.; Parsons, J.L.

    2000-01-01

    Over the past several decades, nuclear science has relied on experimental research to verify and validate information about shielding nuclear radiation for a variety of applications. These benchmarks are compared with results from computer code models and are useful for the development of more accurate cross-section libraries, computer code development of radiation transport modeling, and building accurate tests for miniature shielding mockups of new nuclear facilities. When documenting measurements, one must describe many parts of the experimental results to allow a complete computational analysis. Both old and new benchmark experiments, by any definition, must provide a sound basis for modeling more complex geometries required for quality assurance and cost savings in nuclear project development. Benchmarks may involve one or many materials and thicknesses, types of sources, and measurement techniques. In this paper the benchmark experiments of varying complexity are chosen to study the transport properties of some popular materials and thicknesses. These were analyzed using three-dimensional (3-D) models and continuous energy libraries of MCNP4B2, a Monte Carlo code developed at Los Alamos National Laboratory, New Mexico. A shielding benchmark library provided the experimental data and allowed a wide range of choices for source, geometry, and measurement data. The experimental data had often been used in previous analyses by reputable groups such as the Cross Section Evaluation Working Group (CSEWG) and the Organization for Economic Cooperation and Development/Nuclear Energy Agency Nuclear Science Committee (OECD/NEANSC)

  9. Shielding Calculations for Positron Emission Tomography - Computed Tomography Facilities

    Energy Technology Data Exchange (ETDEWEB)

    Baasandorj, Khashbayar [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Yang, Jeongseon [Korea Institute of Nuclear Safety, Daejeon (Korea, Republic of)

    2015-10-15

    Integrated PET-CT has been shown to be more accurate for lesion localization and characterization than PET or CT alone, and the results obtained from PET and CT separately and interpreted side by side or following software based fusion of the PET and CT datasets. At the same time, PET-CT scans can result in high patient and staff doses; therefore, careful site planning and shielding of this imaging modality have become challenging issues in the field. In Mongolia, the introduction of PET-CT facilities is currently being considered in many hospitals. Thus, additional regulatory legislation for nuclear and radiation applications is necessary, for example, in regulating licensee processes and ensuring radiation safety during the operations. This paper aims to determine appropriate PET-CT shielding designs using numerical formulas and computer code. Since presently there are no PET-CT facilities in Mongolia, contact was made with radiological staff at the Nuclear Medicine Center of the National Cancer Center of Mongolia (NCCM) to get information about facilities where the introduction of PET-CT is being considered. Well-designed facilities do not require additional shielding, which should help cut down overall costs related to PET-CT installation. According to the results of this study, building barrier thicknesses of the NCCM building is not sufficient to keep radiation dose within the limits.

  10. Influence of the Radiation Shield on the Temperature of Rails Rolled in the Reversing Mill

    Directory of Open Access Journals (Sweden)

    Gołdasz A.

    2015-04-01

    Full Text Available The paper presents a mathematical model of heat transfer during cooling of hot-rolled rails in the reversing mill. The influence of the radiation shield on the temperature of rolled rails has been analyzed. The heat transfer model for cooling a strip covered by the thermal shield has been presented. The two types of shields build of steel and aluminum sheets separated with insulating layer have been studded. Calculations have been performed with self developed software which utilizes the finite element method.

  11. Preliminary shielding calculation for the system of CyberKnife robotic radiosurgery

    International Nuclear Information System (INIS)

    Toreti, Dalila; Xavier, Clarice; Moura, Fabio

    2011-01-01

    The CyberKnife robotic system uses a manipulator with six grade of freedom for positioning a 6 MV Linac accelerator for treatment of lesions. This paper presents calculations for a standard room, with 200 cm of thickness walls primary, build for a CyberKnife system, and calculations for a room originally designed for a Linac conventional (with gantry), with secondary barriers of 107 cm thickness. After the realization of shielding for both rooms, the results shown that walls of standard room with 200 cm thickness are adequate for the secondary shield, and for a room with a conventional Linac, from all six evaluated points, two would require additional shielding of nine cm and four cm of concrete with 2.4 g/cubic cm. This shows that the CyberKnife system can be installed in a originally designed room for a conventional Linac with neither restrict nor any shielding, since no incidence of beams on the secondary barriers is existent

  12. Electromagnetic shielding

    International Nuclear Information System (INIS)

    Tzeng, Wen-Shian V.

    1991-01-01

    Electromagnetic interference (EMI) shielding materials are well known in the art in forms such as gaskets, caulking compounds, adhesives, coatings and the like for a variety of EMI shielding purposes. In the past, where high shielding performance is necessary, EMI shielding has tended to use silver particles or silver coated copper particles dispersed in a resin binder. More recently, aluminum core silver coated particles have been used to reduce costs while maintaining good electrical and physical properties. (author). 8 figs

  13. About the Scythian Shields

    Directory of Open Access Journals (Sweden)

    About the Scythian Shields

    2017-10-01

    Full Text Available Shields played major role in the armament system of the Scythians. Made from organic materials, they are poorly traced on the materials of archaeological excavations. Besides, scaly surface of shields was often perceived in practice as the remnants of the scaly armor. E. V. Chernenko was able to discern the difference between shields’ scaly plates and armor scales. The top edge of the scales was bent inwards, and shield plates had a wire fixation. These observations let significantly increase the number of shields, found in the burial complexes of the Scythians. The comparison of archaeological materials and the images of Scythian warriors allow distinguishing the main forms of Scythian shields. All shields are divided into fencing shields and cover shields. The fencing shields include round wooden shields, reinforced with bronze sheet, and round moon-shaped shields with a notch at the top, with a metal scaly surface. They came to the Scythians under the Greek influence and are known in the monuments of the 4th century BC. Oval shields with scaly surface (back cover shields were used by the Scythian cavalry. They protected the rider in case of frontal attack, and moved back in case of maneuver or closein fighting. Scythian battle tactics were based on rapid approaching the enemy and throwing spears and further rapid withdrawal. Spears stuck in the shields of enemies, forcing them to drop the shields, uncover, and in this stage of the battle the archers attacked the disorganized ranks of the enemy. That was followed by the stage of close fight. Oval form of a wooden shield with leather covering was used by the Scythian infantry and spearmen. Rectangular shields, including wooden shields and the shields pleached from rods, represented a special category. The top of such shield was made of wood, and a pleached pad on leather basis was attached to it. This shield could be a reliable protection from arrows, but it could not protect against javelins

  14. Survivor shielding. Part C. Improvements in terrain shielding

    International Nuclear Information System (INIS)

    Egbert, Stephen D.; Kaul, Dean C.; Roberts, James A.; Kerr, George D.

    2005-01-01

    A number of atomic-bomb survivors were affected by shielding provided by terrain features. These terrain features can be a small hill, affecting one or two houses, or a high mountain that shields large neighborhoods. In the survivor dosimetry system, terrain shielding can be described by a transmission factor (TF), which is the ratio between the dose with and without the terrain present. The terrain TF typically ranges between 0.1 and 1.0. After DS86 was implemented at RERF, the terrain shielding categories were examined and found to either have a bias or an excessive uncertainty that could readily be removed. In 1989, an improvement in the terrain model was implemented at RERF in the revised DS86 code, but the documentation was not published. It is now presented in this section. The solution to the terrain shielding in front of a house is described in this section. The problem of terrain shielding of survivors behind Hijiyama mountain at Hiroshima and Konpirasan mountain at Nagasaki has also been recognized, and a solution to this problem has been included in DS02. (author)

  15. ITER [International Thermonuclear Experimental Reactor] reactor building design study

    International Nuclear Information System (INIS)

    Thomson, S.L.; Blevins, J.D.; Delisle, M.W.

    1989-01-01

    The International Thermonuclear Experimental Reactor (ITER) is at the midpoint of a two-year conceptual design. The ITER reactor building is a reinforced concrete structure that houses the tokamak and associated equipment and systems and forms a barrier between the tokamak and the external environment. It provides radiation shielding and controls the release of radioactive materials to the environment during both routine operations and accidents. The building protects the tokamak from external events, such as earthquakes or aircraft strikes. The reactor building requirements have been developed from the component designs and the preliminary safety analysis. The equipment requirements, tritium confinement, and biological shielding have been studied. The building design in progress requires continuous iteraction with the component and system designs and with the safety analysis. 8 figs

  16. Shielding Design and Radiation Shielding Evaluation for LSDS System Facility

    International Nuclear Information System (INIS)

    Kim, Younggook; Kim, Jeongdong; Lee, Yongdeok

    2015-01-01

    As the system characteristics, the target in the spectrometer emits approximately 1012 neutrons/s. To efficiently shield the neutron, the shielding door designs are proposed for the LSDS system through a comparison of the direct shield and maze designs. Hence, to guarantee the radiation safety for the facility, the door design is a compulsory course of the development of the LSDS system. To improve the shielding rates, 250x250 covering structure was added as a subsidiary around the spectrometer. In this study, the evaluations of the suggested shielding designs were conducted using MCNP code. The suggested door design and covering structures can shield the neutron efficiently, thus all evaluations of all conditions are satisfied within the public dose limits. From the Monte Carlo code simulation, Resin(Indoor type) and Tungsten(Outdoor type) were selected as the shielding door materials. From a comparative evaluation of the door thickness, In and Out door thickness was selected 50 cm

  17. Shielding benchmark problems

    International Nuclear Information System (INIS)

    Tanaka, Shun-ichi; Sasamoto, Nobuo; Oka, Yoshiaki; Kawai, Masayoshi; Nakazawa, Masaharu.

    1978-09-01

    Shielding benchmark problems were prepared by the Working Group of Assessment of Shielding Experiments in the Research Comittee on Shielding Design of the Atomic Energy Society of Japan, and compiled by the Shielding Laboratory of Japan Atomic Energy Research Institute. Twenty-one kinds of shielding benchmark problems are presented for evaluating the calculational algorithm and the accuracy of computer codes based on the discrete ordinates method and the Monte Carlo method and for evaluating the nuclear data used in the codes. (author)

  18. Grounding and shielding in the accelerator environment

    International Nuclear Information System (INIS)

    Kerns, Q.

    1991-01-01

    Everyday features of the accelerator environment include long cable runs, high power and low level equipment sharing building space, stray electromagnetic fields and ground voltage differences between the sending and receiving ends of an installation. This paper pictures some Fermilab installations chosen to highlight significant features and presents practices, test methods and equipment that have been helpful in achieving successful shielding. Throughout the report are numbered statements aimed at summarizing good practices and avoiding pitfalls

  19. Design and demonstration of adiabatic quantum-flux-parametron logic circuits with superconductor magnetic shields

    International Nuclear Information System (INIS)

    Inoue, Kenta; Narama, Tatsuya; Yamanashi, Yuki; Yoshikawa, Nobuyuki; Takeuchi, Naoki

    2015-01-01

    Adiabatic quantum-flux-parametron (AQFP) logic is an energy-efficient superconductor logic with zero static power and very small dynamic power due to adiabatic switching operations. In order to build large-scale digital circuits, we built AQFP logic cells using superconductor magnetic shields, which are necessary in order to avoid unwanted magnetic couplings between the cells and excitation currents. In preliminary experimental tests, we confirmed that the unwanted coupling became negligibly small thanks to the superconductor shields. As a demonstration, we designed a four-to-one multiplexor and a 16-junction full adder using the shielded logic cells. In both circuits, we confirmed correct logic operations with wide operation margins of excitation currents. These results indicate that large-scale AQFP digital circuits can be realized using the shielded logic cells. (paper)

  20. News from the Library: Facilitating access to a program for radiation shielding - the Library can help

    CERN Multimedia

    CERN Library

    2013-01-01

    MicroShield® is a comprehensive photon/gamma ray shielding and dose assessment programme. It is widely used for designing shields, estimating source strength from radiation measurements, minimising exposure to people, and teaching shielding principles.   Integrated tools allow the graphing of results, material and source file creation, source inference with decay (dose-to-Bq calculations accounting for decay and daughter buildup), the projection of exposure rate versus time as a result of decay, access to material and nuclide data, and decay heat calculations. The latest version is able to export results using Microsoft Office (formatted and colour-coded for readability). Sixteen geometries accommodate offset dose points and as many as ten standard shields plus source self-shielding and cylinder cladding are available. The library data (radionuclides, attenuation, build-up and dose conversion) reflect standard data from ICRP 38 and 107* as well as ANSI/ANS standards and RSICC publicat...

  1. Loop-mediated isothermal amplification (LAMP) shield for Arduino DNA detection.

    Science.gov (United States)

    Velders, Aldrik H; Schoen, Cor; Saggiomo, Vittorio

    2018-02-01

    Loop-mediated isothermal amplification (LAMP) of DNA is gaining relevance as a method to detect nucleic acids, as it is easier, faster, and more powerful than conventional Polymerase Chain Reaction. However, LAMP is still mostly used in laboratory settings, because of the lack of a cheap and easy, one-button device that can perform LAMP experiments. Here we show how to build and program an Arduino shield for a LAMP and detection of DNA. The here described Arduino Shield is cheap, easy to assemble, to program and use, it is battery operated and the detection of DNA is done by naked-eye so that it can be used in field.

  2. Shielding factors for vehicles to gamma radiation from activity deposited on structures and ground surfaces

    International Nuclear Information System (INIS)

    Lauridsen, B.; Hedemann Jensen, P.

    1982-04-01

    This report describes a measuring procedure for the determination of shielding factors for vehicles passing through areas that have been contaminated by activity released to the atmosphere from a reactor accident. A simulated radiation field from fallout has been approximated by a point source that has been placed in a matrix around and above the vehicle. Modifying factors are discussed such as mutual shielding by nearby buildings and passengers. From measurements on different vehicles with and without passengers shielding factors are recommended for ordinary cars and busses in both urban and open areas, and areas with single family houses. (author)

  3. Radiation shielding properties of a novel cement–basalt mixture for nuclear energy applications

    Energy Technology Data Exchange (ETDEWEB)

    Ipbüker, Cagatay; Nulk, Helena; Gulik, Volodymyr [University of Tartu, Institute of Physics (Estonia); Biland, Alex [HHK Technologies, Houston (United States); Tkaczyk, Alan Henry, E-mail: alan@ut.ee [University of Tartu, Institute of Physics (Estonia)

    2015-04-01

    Highlights: • Basalt fiber is a relatively cheap material that can be used as reinforcement. • Gamma-ray attenuation remains relatively stable with addition of basalt fiber. • Neutron attenuation remains relatively stable with addition of basalt fiber. • Cement–basalt mixture has a good potential for use in nuclear energy applications. - Abstract: The radiation shielding properties of a new proposed building material, a novel cement–basalt fiber mixture (CBM), are investigated. The authors analyze the possibility of this material to be a viable substitute to outgoing materials in nuclear energy applications, which will lead to a further sustained development of nuclear energy in the future. This computational study involves four types of concrete with various amounts of basalt fiber in them. The gamma-ray shielding characteristics of proposed CBM material are investigated with the help of WinXCom program, whereas the neutron shielding characteristics are computed by the Serpent code. For gamma-ray shielding, we find that the attenuation coefficients of concretes with basalt fibers are not notably influenced by the addition of fibers. For neutron shielding, additional basalt fiber in mixture presents negligible effect on neutron radiation shielding. With respect to radiation shielding, it can be concluded that basalt fibers have good potential as an addition to heavyweight concrete for nuclear energy applications.

  4. Radiation shielding properties of a novel cement–basalt mixture for nuclear energy applications

    International Nuclear Information System (INIS)

    Ipbüker, Cagatay; Nulk, Helena; Gulik, Volodymyr; Biland, Alex; Tkaczyk, Alan Henry

    2015-01-01

    Highlights: • Basalt fiber is a relatively cheap material that can be used as reinforcement. • Gamma-ray attenuation remains relatively stable with addition of basalt fiber. • Neutron attenuation remains relatively stable with addition of basalt fiber. • Cement–basalt mixture has a good potential for use in nuclear energy applications. - Abstract: The radiation shielding properties of a new proposed building material, a novel cement–basalt fiber mixture (CBM), are investigated. The authors analyze the possibility of this material to be a viable substitute to outgoing materials in nuclear energy applications, which will lead to a further sustained development of nuclear energy in the future. This computational study involves four types of concrete with various amounts of basalt fiber in them. The gamma-ray shielding characteristics of proposed CBM material are investigated with the help of WinXCom program, whereas the neutron shielding characteristics are computed by the Serpent code. For gamma-ray shielding, we find that the attenuation coefficients of concretes with basalt fibers are not notably influenced by the addition of fibers. For neutron shielding, additional basalt fiber in mixture presents negligible effect on neutron radiation shielding. With respect to radiation shielding, it can be concluded that basalt fibers have good potential as an addition to heavyweight concrete for nuclear energy applications

  5. Electromagnetic shielding formulae

    International Nuclear Information System (INIS)

    Dahlberg, E.

    1979-02-01

    This addendum to an earlier collection of electromagnetic shielding formulae (TRITA-EPP-75-27) contains simple transfer matrices suitable for calculating the quasistatic shielding efficiency for multiple transverse-field and axial-field cylindrical and spherical shields, as well as for estimating leakage fields from long coaxial cables and the normal-incidence transmission of a plane wave through a multiple plane shield. The differences and similarities between these cases are illustrated by means of equivalent circuits and transmission line analogies. The addendum also includes a discussion of a possible heuristic improvement of some shielding formulae. (author)

  6. Methods for calculating radiation attenuation in shields

    Energy Technology Data Exchange (ETDEWEB)

    Butler, J; Bueneman, D; Etemad, A; Lafore, P; Moncassoli, A M; Penkuhn, H; Shindo, M; Stoces, B

    1964-10-01

    In recent years the development of high-speed digital computers of large capacity has revolutionized the field of reactor shield design. For compact special-purpose reactor shields, Monte-Carlo codes in two- and three dimensional geometries are now available for the proper treatment of both the neutron and gamma- ray problems. Furthermore, techniques are being developed for the theoretical optimization of minimum-weight shield configurations for this type of reactor system. In the design of land-based power reactors, on the other hand, there is a strong incentive to reduce the capital cost of the plant, and economic considerations are also relevant to reactors designed for merchant ship propulsion. In this context simple methods are needed which are economic in their data input and computing time requirements and which, at the same time, are sufficiently accurate for design work. In general the computing time required for Monte-Carlo calculations in complex geometry is excessive for routine design calculations and the capacity of the present codes is inadequate for the proper treatment of large reactor shield systems in three dimensions. In these circumstances a wide range of simpler techniques are currently being employed for design calculations. The methods of calculation for neutrons in reactor shields fall naturally into four categories: Multigroup diffusion theory; Multigroup diffusion with removal sources; Transport codes; and Monte Carlo methods. In spite of the numerous Monte- Carlo techniques which are available for penetration and back scattering, serious problems are still encountered in practice with the scattering of gamma rays from walls of buildings which contain critical facilities and also concrete-lined discharge shafts containing irradiated fuel elements. The considerable volume of data in the unclassified literature on the solution of problems of this type in civil defence work appears not to have been evaluated for reactor shield design. In

  7. Shielding member for thermonuclear device

    Energy Technology Data Exchange (ETDEWEB)

    Onozuka, Masanori

    1997-06-30

    In a thermonuclear device for shielding fast neutrons by shielding members disposed in a shielding vessel (vacuum vessel and structures such as a blanket disposed in the vacuum vessel), the shielding member comprises a large number of shielding wires formed fine and short so as to have elasticity. The shielding wires are sealed in a shielding vessel together with water, and when the width of the shielding vessel is changed, the shielding wires follow after the change of the width while elastically deforming in the shielding vessel, so that great stress and deformation are not formed thereby enabling to improve reliability. In addition, the length, the diameter and the shape of each of the shielding wires can be selected in accordance with the shielding space of the shielding vessel. Even if the shape of the shielding vessel is complicated, the shielding wires can be inserted easily. Accordingly, the filling rate of the shielding members can be changed easily. It can be produced more easily compared with a conventional spherical pebbles. It can be produced more easily than existent spherical shielding pebbles thereby enabling to reduce the production cost. (N.H.)

  8. ICRS1, Proceedings of the First Radiation Shielding Symposium, Cambridge, UK 1958

    International Nuclear Information System (INIS)

    Goebelbecker, Hans-Juergen

    2008-01-01

    Description: The papers of the European Atomic Energy Society Symposium VI-58 on radiation shielding (ICRS1) held at Caius College, Cambridge England from 26 to 29 August 1958 are collected here for the first time in electronic form. This symposium was organised in connection with the Second Atoms for Peace Conference held in Geneva Held in Geneva from 1 to 13 September 1958. The Topics discussed covered gamma rays and neutron radiation; the Methods discussed were analytical approaches, semi-empirical Methods, simple computer codes, Monte Carlo method. Little quality nuclear data for shielding calculations was available and the presentations would concentrate on removal cross-sections and build-up factors. Experimental techniques in support to estimate the effective shielding properties of materials were discussed such as general experimental shielding techniques and experiments on neutron attenuation in different materials and on concrete as shield. Foil detectors for spectra measurements and determination of dose rates were mainly used. The typical issues addressed were gamma-heating, gamma spectra, neutron induced gammas, fission products gamma spectra, skyshine radiation and neutron ducts - streaming. Most participants were researchers from the naval and aeronautics sector

  9. Special concrete shield selection using the analytic hierarchy process

    International Nuclear Information System (INIS)

    Abulfaraj, W.H.

    1994-01-01

    Special types of concrete radiation shields that depend on locally available materials and have improved properties for both neutron and gamma-ray attenuation were developed by using plastic materials and heavy ores. The analytic hierarchy process (AHP) is implemented to evaluate these types for selecting the best biological radiation shield for nuclear reactors. Factors affecting the selection decision are degree of protection against neutrons, degree of protection against gamma rays, suitability of the concrete as building material, and economic considerations. The seven concrete alternatives are barite-polyethylene concrete, barite-polyvinyl chloride (PVC) concrete, barite-portland cement concrete, pyrite-polyethylene concrete, pyrite-PVC concrete, pyrite-portland cement concrete, and ordinary concrete. The AHP analysis shows the superiority of pyrite-polyethylene concrete over the others

  10. A contribution to shielding effectiveness analysis of shielded tents

    Directory of Open Access Journals (Sweden)

    Vranić Zoran M.

    2004-01-01

    Full Text Available An analysis of shielding effectiveness (SE of the shielded tents made of the metallised fabrics is given. First, two electromagnetic characteristic fundamental for coupling through electrically thin shield, the skin depth break frequency and the surface resistance or transfer impedance, is defined and analyzed. Then, the transfer function and the SE are analyzed regarding to the frequency range of interest to the Electromagnetic Compatibility (EMC Community.

  11. Transparent fast neutron shielding material and shielding method

    International Nuclear Information System (INIS)

    Nashimoto, Tetsuji; Katase, Haruhisa.

    1993-01-01

    Polyisobutylene having a viscosity average molecular weight of 20,000 to 80,000 and a hydrogen atom density of greater than 7.0 x 10 22 /cm 3 is used as a fast neutron shielding material. The shielding material is excellent in the shielding performance against fast neutrons, and there is no worry of leakage even when holes should be formed to a vessel. Further, it is excellent in fabricability, relatively safe even upon occurrence of fire and, in addition, it is transparent to enable to observe contents easily. (T.M.)

  12. Radiation shielding concrete

    International Nuclear Information System (INIS)

    Kunishima, Shigeru.

    1990-01-01

    The radiation shielding concretes comprise water, cement, fine aggregates consisting of serpentines and blown mist slags, coarse aggregates consisting of serpentines and kneading materials. Since serpentines containing a relatively great amount of water of crystallization in rocks as coarse aggregates and fine aggregates, the hydrogen content in the radiation shielding concretes is increased and the neutron shielding effect is improved. In addition, since serpentines are added as the fine aggregates and blown mists slags of a great specific gravity are used, the specific gravity of the shielding concretes is increased to improve the γ-ray shielding effect. Further, by the use of the kneading material having a water reducing effect and fluidizing effect, and by the bearing effect of the spherical blown mist slags used as the fine aggregates, concrete fluidity can be increased. Accordingly, workability of the radiation shielding concretes can be improved. (T.M.)

  13. Gamma ray shielding: a web based interactive program

    International Nuclear Information System (INIS)

    Subbaiah, K.V.; Senthi Kumar, C.; Sarangapani, R.

    2005-01-01

    A web based interactive computing program is developed using java for quick assessment of Gamma Ray shielding problems. The program addresses usually encountered source geometries like POINT, LINE, CYLINDRICAL, ANNULAR, SPHERICAL, BOX, followed by 'SLAB' shield configurations. The calculation is based on point kernel technique. The source points are randomly sampled within the source volume. From each source point, optical path traversed in the source and shield media up to the detector location is estimated to calculate geometrical and material attenuations, and then corresponding buildup factor is obtained, which accounts for scattered contribution. Finally, the dose rate for entire source is obtained by summing over all sampled points. The application allows the user to select one of the seven regular geometrical bodies and provision exist to give source details such as emission energies, intensities, physical dimensions and material composition. Similar provision is provided to specify shield slab details. To aid the user, atomic numbers, densities, standard build factor materials and isotope list with respective emission energies and intensity for ready reference are given in dropdown combo boxes. Typical results obtained from this program are validated against existing point kernel gamma ray shielding codes. Additional facility is provided to compute fission product gamma ray source strengths based on the fuel type, burn up and cooling time. Plots of Fission product gamma ray source strengths, Gamma ray cross-sections and buildup factors can be optionally obtained, which enable the user to draw inference on the computed results. It is expected that this tool will be handy to all health physicists and radiological safety officers as it will be available on the internet. (author)

  14. Wake Shield Target Protection

    International Nuclear Information System (INIS)

    Valmianski, Emanuil I.; Petzoldt, Ronald W.; Alexander, Neil B.

    2003-01-01

    The heat flux from both gas convection and chamber radiation on a direct drive target must be limited to avoid target damage from excessive D-T temperature increase. One of the possibilities of protecting the target is a wake shield flying in front of the target. A shield will also reduce drag force on the target, thereby facilitating target tracking and position prediction. A Direct Simulation Monte Carlo (DSMC) code was used to calculate convection heat loads as boundary conditions input into ANSYS thermal calculations. These were used for studying the quality of target protection depending on various shapes of shields, target-shield distance, and protective properties of the shield moving relative to the target. The results show that the shield can reduce the convective heat flux by a factor of 2 to 5 depending on pressure, temperature, and velocity. The protective effect of a shield moving relative to the target is greater than the protective properties of a fixed shield. However, the protective effect of a shield moving under the drag force is not sufficient for bringing the heat load on the target down to the necessary limit. Some other ways of diminishing heat flux using a protective shield are discussed

  15. Optimal beta-ray shielding thicknesses for different therapeutic radionuclides and shielding materials

    International Nuclear Information System (INIS)

    Cho, Yong In; Kim, Ja Mee; Kim, Jung Hoon

    2017-01-01

    To better understand the distribution of deposited energy of beta and gamma rays according to changes in shielding materials and thicknesses when radionuclides are used for therapeutic nuclear medicine, a simulation was conducted. The results showed that due to the physical characteristics of each therapeutic radionuclide, the thicknesses of shielding materials at which beta-ray shielding takes place varied. Additional analysis of the shielding of gamma ray was conducted for radionuclides that emit both beta and gamma rays simultaneously with results showing shielding effects proportional to the atomic number and density of the shielding materials. Also, analysis of bremsstrahlung emission after beta-ray interactions in the simulation revealed that the occurrence of bremsstrahlung was relatively lower than theoretically calculated and varied depending on different radionuclides. (authors)

  16. Calculations for Extra Well Shielding for 15 MV Clinical Linear accelerator

    International Nuclear Information System (INIS)

    Mahmoud, M.A.; Emran, M.M.; Ahmad, A.S.

    2000-01-01

    A radiological survey was conducted around the walls of a clinical linear accelerator (Siemens Mevatron) in South Egypt Cancer Institute, Assiut University. Neutron measurements showed adequate results for all beam orientations. Photon measurements showed adequate results for all beam orientations except for beam orientation 270 degree, facing the control room. During operation, photon measurements were taken in order to calculate the additional shield thickness required to reduce measurements to accepted values. For convenience, lead was the material of choice for extra shielding. A value for the build up factor needed in the calculations of broad beam attenuation was estimated. Measurements inside the control room after adding the calculated lead thickness are much lower than the annual effective equivalent dose limits recommended by the ICRP-60 (International Commission on Radiation Protection) for occupational exposure. Also, measurements taken in the patients waiting hall recorded levels consistent with the six-hour daily occupancy for members of the public. The value of the build up factor was verified by calculations. Also the variation of build up factor distance from the field centre was calculated. Important and useful recommendations were reached from this experience which should be discussed to avoid facing similar situations in radiotherapy departments in Egypt

  17. Self-Homodyne Detection in Optical Communication Systems

    Directory of Open Access Journals (Sweden)

    Benjamin J. Puttnam

    2014-05-01

    Full Text Available We review work on self-homodyne detection (SHD for optical communication systems. SHD uses a transmitted pilot-tone (PT, originating from the transmitter laser, to exploit phase noise cancellation at a coherent receiver and to enable transmitter linewidth tolerance and potential energy savings. We give an overview of SHD performance, outlining the key contributors to the optical signal-to-noise ratio penalty compared to equivalent intradyne systems, and summarize the advantages, differences and similarities between schemes using polarization-division multiplexed PTs (PDM-SHD and those using space-division multiplexed PTs (SDM-SHD. For PDM-SHD, we review the extensive work on the transmission of advanced modulation formats and techniques to minimize the trade-off with spectral efficiency, as well as recent work on digital SHD, where the SHD receiver is combined with an polarization-diversity ID front-end receiver to provide both polarization and modulation format alignment. We then focus on SDM-SHD systems, describing experimental results using multi-core fibers (MCFs with up to 19 cores, including high capacity transmission with broad-linewidth lasers and experiments incorporating SDM-SHD in networking. Additionally, we discuss the requirement for polarization tracking of the PTs at the receiver and path length alignment and review some variants of SHD before outlining the future challenges of self-homodyne optical transmission and gaps in current knowledge.

  18. Photon Shielding Features of Quarry Tuff

    Directory of Open Access Journals (Sweden)

    Vega-Carrillo Hector Rene

    2017-01-01

    Full Text Available Cantera is a quarry tuff widely used in the building industry; in this work the shielding features of cantera were determined. The shielding characteristics were calculated using XCOM and MCNP5 codes for 0.03, 0.07, 0.1, 0.3, 0.662, 1, 2, and 3 MeV photons. With XCOM the mass interaction coefficients, and the total mass attenuation coefficients, were calculated. With the MCNP5 code a transmission experiment was modelled using a point-like source located 42 cm apart from a point-like detector. Between the source and the detector, cantera pieces with different thickness, ranging from 0 to 40 cm were included. The collided and uncollided photon fluence, the Kerma in air and the Ambient dose equivalent were estimated. With the uncollided fluence the linear attenuation coefficients were determined and compared with those calculated with XCOM. The linear attenuation coefficient for 0.662 MeV photons was compared with the coefficient measured with a NaI(Tl-based γ-ray spectrometer and a 137Cs source.

  19. Sci-Fri AM: Quality, Safety, and Professional Issues 03: The Increasing Costs of Shielding Diagnostic CT Scanners in Ontario

    Energy Technology Data Exchange (ETDEWEB)

    Richer, Jeff; Frimeth, Jeff; Nesbitt, James [Windsor Regional Hospital, Xspect Inc., XRCT Inc. (Canada)

    2016-08-15

    Purpose: In Ontario, shielding for all X-ray machines, including CT scanners, must be evaluated according to Safety Code 20A (Health Canada, 1983) which is based on NCRP-49 (NCRP, 1976). NCRP-147 (NCRP, 2004) is the international standard for shielding calculations of CT scanners and is also referenced in Safety Code 35 (Health Canada, 2008) which, was published to supersede SC20A. The goal of this work is to demonstrate the cost effectiveness of NCRP-147 for CT scanner shielding. Methods: CT scanner shielding calculations are performed using SC20A and NCRP-147: A room located on the third floor with the nearest building 75m away A room with high occupancy uncontrolled adjacent spaces Two side by side rooms on the main floor Results: 1. SC20A: The exterior windows required 0.1mm of Pb to protect the public who may occupy the building at 75m. 1. NCRP-147: No additional shielding required. 2. SC20A: Two walls adjacent to high occupancy uncontrolled space required an additional 1.58mm Pb. 2. NCRP-147: No additional shielding required. 3. SC20A: The entire floor and ceiling slabs in both rooms required an additional 0.79mm Pb. In addition, 0.79mm Pb was added to the walls from the ceiling to overlap the existing Pb shielding in the walls. 3. NCRP-147: No additional shielding required. Conclusion: The application of NCRP Report No. 147 affords the required protection to staff and the public, in the true spirit of the ALARA principle, taking into account relevant social and economic factors.

  20. The shielding calculation for the CN guide shielding assembly in HANARO

    International Nuclear Information System (INIS)

    Kim, H. S.; Lee, B. C.; Lee, K. H.; Kim, H.

    2006-01-01

    The cold neutron research facility in HANARO is under construction. The area including neutron guides and rotary shutter in the reactor hall should be shielded by the guide shielding assembly which is constructed of heavy concrete blocks and structure. The guide shielding assembly is divided into 2 parts, A and B. Part A is about 6.4 meters apart from the reactor biological shield and it is constructed of heavy concrete blocks whose density is above 4.0g/cm 3 . And part B is a fixed heavy concrete structure whose density is above 3.5g/cm 3 . The rotary shutter is also made with heavy concrete whose density is above 4.0g/cm 3 and includes 5 neutron guides inside. It can block the neutron beam by rotating when CNS is not operating. The dose criterion outside the guide shielding assembly is established as 12.5 μSv/hr which is also applied to reactor shielding in HANARO

  1. Shielding synchrotron light sources: Advantages of circular shield walls tunnels

    Energy Technology Data Exchange (ETDEWEB)

    Kramer, S.L. [Design and Accelerator Operations Consulting, 568 Wintergreen Ct Ridge, NY 11961 (United States); Ghosh, V.J.; Breitfeller, M. [NSLS-II, Brookhaven National Laboratory, Upton, NY 11973 (United States)

    2016-08-11

    Third generation high brightness light sources are designed to have low emittance and high current beams, which contribute to higher beam loss rates that will be compensated by Top-Off injection. Shielding for these higher loss rates will be critical to protect the projected higher occupancy factors for the users. Top-Off injection requires a full energy injector, which will demand greater consideration of the potential abnormal beam miss-steering and localized losses that could occur. The high energy electron injection beam produce significantly higher neutron component dose to the experimental floor than lower energy injection and ramped operations. High energy neutrons produced in the forward direction from thin target beam losses are a major component of the dose rate outside the shield walls of the tunnel. The convention has been to provide thicker 90° ratchet walls to reduce this dose to the beam line users. We present an alternate circular shield wall design, which naturally and cost effectively increases the path length for this forward radiation in the shield wall and thereby substantially decreasing the dose rate for these beam losses. This shield wall design will greatly reduce the dose rate to the users working near the front end optical components but will challenge the beam line designers to effectively utilize the longer length of beam line penetration in the shield wall. Additional advantages of the circular shield wall tunnel are that it's simpler to construct, allows greater access to the insertion devices and the upstream in tunnel beam line components, as well as reducing the volume of concrete and therefore the cost of the shield wall.

  2. Radiation shielding techniques and applications. 3. Analysis of Photon Streaming Through and Around Shield Doors

    International Nuclear Information System (INIS)

    Barnett, Marvin; Hack, Joe; Nathan, Steve; White, Travis

    2001-01-01

    Westinghouse Safety Management Solutions (Westinghouse SMS) has been tasked with providing radiological engineering design support for the new Commercial Light Water Reactor Tritium Extraction Facility (CLWR-TEF) being constructed at the Savannah River Site (SRS). The Remote Handling Building (RHB) of the CLWR-TEF will act as the receiving facility for irradiated targets used in the production of tritium for the U.S. Department of Energy (DOE). Because of the high dose rates, approaching 50 000 rads/h (500 Gy/h) from the irradiated target bundles, significant attention has been made to shielding structures within the facility. One aspect of the design that has undergone intense review is the shield doors. The RHB has six shield doors that needed to be studied with respect to photon streaming. Several aspects had to be examined to ensure that the design meets the radiation dose levels. Both the thickness and streaming issues around the door edges were designed and examined. Photon streaming through and around a shield door is a complicated problem, creating a reliance on computer modeling to perform the analyses. The computer code typically used by the Westinghouse SMS in the evaluation of photon transport through complex geometries is the MCNP Monte Carlo computer code. The complexity of the geometry within the problem can cause problems even with the Monte Carlo codes. Striking a balance between how the code handles transport through the shield door with transport through the streaming paths, particularly with the use of typical variance reduction methods, is difficult when trying to ensure that all important regions of the model are sampled appropriately. The thickness determination used a simple variance reduction technique. In construction, the shield door will not be flush against the wall, so a solid rectangular slab leaves streaming paths around the edges. Administrative controls could be used to control dose to workers; however, 10 CFR 835.1001 states

  3. INTOR radiation shielding for personnel access

    International Nuclear Information System (INIS)

    Gohar, Y.; Abdou, M.

    1981-01-01

    The INTOR reactor shield system consists of the blanket, bulk shield, penetration shield, component shield, and biological shield. The bulk shield consists of two parts: (a) the inboard shield; and (b) the outboard shield. The distinction between the different components of the shield system is essential to satisfy the different design constraints and achieve various objectives

  4. Shielding factors for gamma radiation from activity deposited on structures and ground surfaces

    International Nuclear Information System (INIS)

    Hedemann Jensen, P.

    1982-11-01

    This report describes a computer model that calculates shielding factors for indoor residence in multistorey and single-family houses for gamma radiation from activity despoited on roofs, outer walls, and ground surfaces. The dimensions of the buildings including window areas and the nearby surroundings has to be speficied in the calculations. Shielding factors can be calculated for different photon energies and for a uniform surface activity distribution as well as for separate activity on roof, outer wall, and ground surface achieved from decontamination or different deposition velocities. For a given area with a known distribution of different houses a weighted shielding factor can be calculated as well as a time-averaged one based on a given residence time distribution for work/school, home, outdoors, and transportation. Calculated shielding factors are shown for typical Danish houses. To give an impression of the sensitivity of the shielding factor on the parameters used in the model, variations were made in some of the most important parameters: wall thickness, road and ground width, percentage of outer wall covered by windows, photon energy, and decontamination percentage for outer walls, ground and roofs. The uncertainity of the calculations is discussed. (author)

  5. Neutron shieldings

    International Nuclear Information System (INIS)

    Tarutani, Kohei

    1979-01-01

    Purpose: To decrease the stresses resulted by the core bendings to the base of an entrance nozzle. Constitution: Three types of round shielding rods of different diameter are arranged in a hexagonal tube. The hexagonal tube is provided with several spacer pads receiving the loads from the core constrain mechanism at its outer circumference, a handling head for a fuel exchanger at its top and an entrance nozzle for self-holding the neutron shieldings and flowing heat-removing coolants at its bottom. The diameters for R 1 , R 2 and R 3 for the round shielding rods are designed as: 0.1 R 1 2 1 and 0.2 R 1 2 1 . Since a plurality of shielding rods of small diameter are provided, soft structure are obtained and a plurality of coolant paths are formed. (Furukawa, Y.)

  6. Re-evaluation of Baby EBM Shielding Thickness

    International Nuclear Information System (INIS)

    Mohd Rizal Mohd Chulan; Siti Aisah Hashim; Wah, L.K.; Mukhlis Moktar

    2013-01-01

    The minimum energy required for an electron beam (EB) to be used as an irradiation device is 200 keV. Nuclear Malaysia's home grown EB machine, the Baby EB can generate up to 140 keV. Therefore, to enable it to be used for application, an internal funding was acquired to increase the energy to up to 300 keV. In doing so, the existing shielding with thickness of 0.35 cm for the top frame and 0.7 cm for the middle and bottom frame needs to be reevaluated. This is to ensure that the shield can still provide significant protection from harmful radiation. This re-evaluation is also needed because of the recent change of clean area dose limit from 2.5 μSv/ hr to 1.0 μSv/ hr. The location of Baby EBM also needs to be re-evaluated if the weight reached 4500 kg/ m 2 (concentrated load for laboratories area). From the calculation it was found that the existing shielding is unable to provide the required protection from the harmful radiation. The recommended thicknesses for the shielding are 3.26 cm for the top frame, 3.5 cm for the middle frame and 3.78 for the bottom frame. Therefore, the total weight of the Baby EBM becomes more than 3000 kg/ m 2 (3337.38 kg/ m 2 ) and this justify the need for the Baby EBM to be transferred from first floor (room no.43008), block 43 (ALUTRON building) to a more suitable location. It is preferable that the new location is in a ground floor that can bear the increased weight. (author)

  7. Shielding calculations for the TFTR neutral beam injectors

    International Nuclear Information System (INIS)

    Santoro, R.T.; Lillie, R.A.; Alsmiller, R.G. Jr.; Barnes, J.M.

    1979-07-01

    Two-dimensional discrete ordinates calculations have been performed to determine the location and thickness of concrete shielding around the Tokamak Fusion Test Reactor (TFTR) neutral beam injectors. Two sets of calculations were performed: one to determine the dose equivalent rate on the roof and walls of the test cell building when no injectors are present, and one to determine the contribution to the dose equivalent rate at these locations from radiation streaming through the injection duct. Shielding the side and rear of the neutral beam injector with 0.305 and 0.61 m of concrete, respectively, and lining the inside of the test cell wall with an additional layer of concrete having a thickness of 0.305 m and a height above the axis of deuteron injection of 3.10 m are sufficient to maintain the biological dose equivalent rate outside the test cell to approx. 1 mrem/DT pulse

  8. Radiation shielding plate

    International Nuclear Information System (INIS)

    Kobayashi, Torakichi; Sugawara, Takeo.

    1983-01-01

    Purpose: To reduce the weight and stabilize the configuration of a radiation shielding plate which is used in close contact with an object to be irradiated with radiation rays. Constitution: The radiation shielding plate comprises a substrate made of lead glass and a metallic lead coating on the surface of the substrate by means of plating, vapor deposition or the like. Apertures for permeating radiation rays are formed to the radiation shielding plate. Since the shielding plate is based on a lead glass plate, a sufficient mechanical strength can be obtained with a thinner structure as compared with the conventional plate made of metallic lead. Accordingly, if the shielding plate is disposed on a soft object to be irradiated with radiation rays, the object and the plate itself less deform to obtain a radiation irradiation pattern with distinct edges. (Moriyama, K.)

  9. Infinite slab-shield dose calculations

    International Nuclear Information System (INIS)

    Russell, G.J.

    1989-01-01

    I calculated neutron and gamma-ray equivalent doses leaking through a variety of infinite (laminate) slab-shields. In the shield computations, I used, as the incident neutron spectrum, the leakage spectrum (<20 MeV) calculated for the LANSCE tungsten production target at 90 degree to the target axis. The shield thickness was fixed at 60 cm. The results of the shield calculations show a minimum in the total leakage equivalent dose if the shield is 40-45 cm of iron followed by 20-15 cm of borated (5% B) polyethylene. High-performance shields can be attained by using multiple laminations. The calculated dose at the shield surface is very dependent on shield material. 4 refs., 4 figs., 1 tab

  10. Shielding design of RIKEN RI Beam Factory

    Energy Technology Data Exchange (ETDEWEB)

    Uwamino, Yoshitomo; Fukunishi, Nobuhisa [Institute of Physical and Chemical Research, Wako, Saitama (Japan); Oishi, Koji [Shimizu Corp., Tokyo (Japan)

    2000-03-01

    Construction of the RIKEN RI Beam Factory is started, and the phase 1 will be finished by the end of March 2003. Two ring cyclotrons including one superconducting machine and two Big RIPSs will be constructed in the phase 1. Heavy ions of proton to uranium will be accelerated up to 400 MeV/u (A<40) and 150 MeV/u for uranium at an intensity of 10{sup 13} pps. Neutron production by the 400 MeV/u {sup 20}Ne beam was measured at HIMAC of NIRS and it was used for the source term of the shielding calculations. The deep penetration of high-energy neutrons was calculated by using the ANISN code with the DLC-119/HILO86R group constants and also by using the HETC code. The ANISN results were modified by using the HETC results and the shielding experiment at ISIS, and they were fitted by a simple formula for practical use. High-energy neutron penetrations of slantwise injection and the reflection probabilities of iron slab were calculated with the HETC code, and these results were used for the estimation of the thickness for the iron local shielding of Big RIPSs. Induced radioactivity in the air, accelerator components and the building, and the skyshine effect were also estimated. (author)

  11. Electromagnetic shield

    International Nuclear Information System (INIS)

    Miller, J.S.

    1987-01-01

    An electromagnetic shield is described comprising: closed, electrically-conductive rings, each having an open center; and binder means for arranging the rings in a predetermined, fixed relationship relative to each other, the so-arranged rings and binder means defining an outer surface; wherein electromagnetic energy received by the shield from a source adjacent its outer surface induces an electrical current to flow in a predetermined direction adjacent and parallel to the outer surface, through the rings; and wherein each ring is configured to cause source-induced alternating current flowing through the portion of the ring closest to the outer surface to electromagnetically induce an oppositely-directed current in the portion of the ring furthest from the surface, such oppositely-directed current bucking any source-induced current in the latter ring portion and thus reducing the magnitude of current flowing through it, whereby the electromagnetic shielding effected by the shield is enhanced

  12. Shielding Calculations for PUSPATI TRIGA Reactor (RTP) Fuel Transfer Cask with Micro shield

    International Nuclear Information System (INIS)

    Nurhayati Ramli; Ahmad Nabil Abdul Rahim; Ariff Shah Ismail

    2011-01-01

    The shielding calculations for RTP fuel transfer cask was performed by using computer code Micro shield 7.02. Micro shield is a computer code designed to provide a model to be used for shielding calculations. The results of the calculations can be obtained fast but the code is not suitable for complex geometries with a shielding composed of more than one material. Nevertheless, the program is sufficient for As Low As Reasonable Achievable (ALARA) optimization calculations. In this calculation, a geometry based on the conceptual design of RTP fuel transfer cask was modeled. Shielding material used in the calculations were lead (Pb) and stainless steel 304 (SS304). The results obtained from these calculations are discussed in this paper. (author)

  13. The Active Muon Shield

    CERN Document Server

    Bezshyiko, Iaroslava

    2016-01-01

    In the SHiP beam-dump of the order of 1011 muons will be produced per second. An active muon-shield is used to magnetically deflect these muons out of the acceptance of the spectrom- eter. This note describes how this shield is modelled and optimized. The SHiP spectrometer is being re-optimized using a conical decay-vessel, and utilizing the possibility to magnetize part of the beam-dump shielding iron. A shield adapted to these new conditions is presented which is significantly shorter and lighter than the shield used in the Technical Proposal (TP), while showing a similar performance.

  14. GRAB - WRS system module number 60221 for calculating gamma-ray penetration in slab shields by the method of kernel integration with build-up factors

    International Nuclear Information System (INIS)

    Grimstone, M.J.

    1978-06-01

    The WRS Modular Programming System has been developed as a means by which programmes may be more efficiently constructed, maintained and modified. In this system a module is a self-contained unit typically composed of one or more Fortran routines, and a programme is constructed from a number of such modules. This report describes one WRS module, the function of which is to calculate the gamma-ray flux, dose, or heating rate in a slab shield using the build-up factor method. The information given in this manual is of use both to the programmer wishing to incorporate the module in a programme, and to the user of such a programme. (author)

  15. REACTOR SHIELD

    Science.gov (United States)

    Wigner, E.P.; Ohlinger, L.E.; Young, G.J.; Weinberg, A.M.

    1959-02-17

    Radiation shield construction is described for a nuclear reactor. The shield is comprised of a plurality of steel plates arranged in parallel spaced relationship within a peripheral shell. Reactor coolant inlet tubes extend at right angles through the plates and baffles are arranged between the plates at right angles thereto and extend between the tubes to create a series of zigzag channels between the plates for the circulation of coolant fluid through the shield. The shield may be divided into two main sections; an inner section adjacent the reactor container and an outer section spaced therefrom. Coolant through the first section may be circulated at a faster rate than coolant circulated through the outer section since the area closest to the reactor container is at a higher temperature and is more radioactive. The two sections may have separate cooling systems to prevent the coolant in the outer section from mixing with the more contaminated coolant in the inner section.

  16. SHIELD 1.0: development of a shielding calculator program in diagnostic radiology

    International Nuclear Information System (INIS)

    Santos, Romulo R.; Real, Jessica V.; Luz, Renata M. da; Friedrich, Barbara Q.; Silva, Ana Maria Marques da

    2013-01-01

    In shielding calculation of radiological facilities, several parameters are required, such as occupancy, use factor, number of patients, source-barrier distance, area type (controlled and uncontrolled), radiation (primary or secondary) and material used in the barrier. The shielding design optimization requires a review of several options about the physical facility design and, mainly, the achievement of the best cost-benefit relationship for the shielding material. To facilitate the development of this kind of design, a program to calculate the shielding in diagnostic radiology was implemented, based on data and limits established by National Council on Radiation Protection and Measurements (NCRP) 147 and SVS-MS 453/98. The program was developed in C⌗ language, and presents a graphical interface for user data input and reporting capabilities. The module initially implemented, called SHIELD 1.0, refers to calculating barriers for conventional X-ray rooms. The program validation was performed by the comparison with the results of examples of shielding calculations presented in NCRP 147.

  17. Design of emergency shield

    International Nuclear Information System (INIS)

    Soliman, S.E.

    1993-01-01

    Manufacturing of an emergency movable shield in the hot laboratories center is urgently needed for the safety of personnel in case of accidents or spilling of radioactive materials. In this report, a full design for an emergency shield is presented and the corresponding dose rates behind the shield for different activities (from 1 mCi to 5 Ci) was calculated by using micro shield computer code. 4 figs., 1 tab

  18. RadShield: semiautomated shielding design using a floor plan driven graphical user interface.

    Science.gov (United States)

    DeLorenzo, Matthew C; Wu, Dee H; Yang, Kai; Rutel, Isaac B

    2016-09-08

    The purpose of this study was to introduce and describe the development of RadShield, a Java-based graphical user interface (GUI), which provides a base design that uniquely performs thorough, spatially distributed calculations at many points and reports the maximum air-kerma rate and barrier thickness for each barrier pursuant to NCRP Report 147 methodology. Semiautomated shielding design calculations are validated by two approaches: a geometry-based approach and a manual approach. A series of geometry-based equations were derived giv-ing the maximum air-kerma rate magnitude and location through a first derivative root finding approach. The second approach consisted of comparing RadShield results with those found by manual shielding design by an American Board of Radiology (ABR)-certified medical physicist for two clinical room situations: two adjacent catheterization labs, and a radiographic and fluoroscopic (R&F) exam room. RadShield's efficacy in finding the maximum air-kerma rate was compared against the geometry-based approach and the overall shielding recommendations by RadShield were compared against the medical physicist's shielding results. Percentage errors between the geometry-based approach and RadShield's approach in finding the magnitude and location of the maximum air-kerma rate was within 0.00124% and 14 mm. RadShield's barrier thickness calculations were found to be within 0.156 mm lead (Pb) and 0.150 mm lead (Pb) for the adjacent catheteriza-tion labs and R&F room examples, respectively. However, within the R&F room example, differences in locating the most sensitive calculation point on the floor plan for one of the barriers was not considered in the medical physicist's calculation and was revealed by the RadShield calculations. RadShield is shown to accurately find the maximum values of air-kerma rate and barrier thickness using NCRP Report 147 methodology. Visual inspection alone of the 2D X-ray exam distribution by a medical physicist may not

  19. Shielding analysis in the design phase of the new Emergency Operation Facility for Tihange Nuclear Power Plant

    Science.gov (United States)

    Genard, Gilles; Portal, Romain; Bouchat, Virginie; Vanderperre, Serge

    2017-09-01

    In the framework of the design studies for a new Emergency Operation Facility (EOF) for Tihange NPP, radiation protection analyses are needed to comply with effective dose rate criteria. In this aim, the shielding performed by, at the one hand, external walls and roof of the building and, on the other hand, internal walls, has been sized by means of MicroShield calculations. This paper explains how the calculations for external walls, doors, roof, floor and internal walls are made. The assumptions on the source terms and on the source geometry as well as the way the shielding is determined and the results of the sizing are presented.

  20. Shielding analysis in the design phase of the new Emergency Operation Facility for Tihange Nuclear Power Plant

    Directory of Open Access Journals (Sweden)

    Genard Gilles

    2017-01-01

    Full Text Available In the framework of the design studies for a new Emergency Operation Facility (EOF for Tihange NPP, radiation protection analyses are needed to comply with effective dose rate criteria. In this aim, the shielding performed by, at the one hand, external walls and roof of the building and, on the other hand, internal walls, has been sized by means of MicroShield calculations. This paper explains how the calculations for external walls, doors, roof, floor and internal walls are made. The assumptions on the source terms and on the source geometry as well as the way the shielding is determined and the results of the sizing are presented.

  1. Neutron shielding material

    International Nuclear Information System (INIS)

    Nodaka, M.; Iida, T.; Taniuchi, H.; Yosimura, K.; Nagahama, H.

    1993-01-01

    From among the neutron shielding materials of the 'kobesh' series developed by Kobe Steel, Ltd. for transport and storage packagings, silicon rubber base type material has been tested for several items with a view to practical application and official authorization, and in order to determine its adaptability to actual vessels. Silicon rubber base type 'kobesh SR-T01' is a material in which, from among the silicone rubber based neutron shielding materials, the hydrogen content is highest and the boron content is most optimized. Its neutron shielding capability has been already described in the previous report (Taniuchi, 1986). The following tests were carried out to determine suitability for practical application; 1) Long-term thermal stability test 2) Pouring test on an actual-scale model 3) Fire test The experimental results showed that the silicone rubber based neutron shielding material has good neutron shielding capability and high long-term fire resistance, and that it can be applied to the advanced transport packaging. (author)

  2. Shielding benchmark problems, (2)

    International Nuclear Information System (INIS)

    Tanaka, Shun-ichi; Sasamoto, Nobuo; Oka, Yoshiaki; Shin, Kazuo; Tada, Keiko.

    1980-02-01

    Shielding benchmark problems prepared by Working Group of Assessment of Shielding Experiments in the Research Committee on Shielding Design in the Atomic Energy Society of Japan were compiled by Shielding Laboratory in Japan Atomic Energy Research Institute. Fourteen shielding benchmark problems are presented newly in addition to twenty-one problems proposed already, for evaluating the calculational algorithm and accuracy of computer codes based on discrete ordinates method and Monte Carlo method and for evaluating the nuclear data used in codes. The present benchmark problems are principally for investigating the backscattering and the streaming of neutrons and gamma rays in two- and three-dimensional configurations. (author)

  3. Primary shield displacement and bowing

    International Nuclear Information System (INIS)

    Scott, K.V.

    1978-01-01

    The reactor primary shield is constructed of high density concrete and surrounds the reactor core. The inlet, outlet and side primary shields were constructed in-place using 2.54 cm (1 in) thick steel plates as the forms. The plates remained as an integral part of the shields. The elongation of the pressure tubes due to thermal expansion and pressurization is not moving through the inlet nozzle hardware as designed but is accommodated by outward displacement and bowing of the inlet and outlet shields. Excessive distortion of the shields may result in gas seal failures, intolerable helium gas leaks, increased argon-41 emissions, and shield cooling tube failures. The shield surveillance and testing results are presented

  4. Evaluation of the shielding integrity of end-shields in PHWR type NPPs

    International Nuclear Information System (INIS)

    Sah, B.M.L.; Ramamirtham, B.; Kutty, B.S.

    1996-01-01

    In the new plants (Narora Atomic Power Plants (NAPP) onwards) relatively higher radiation fields exist on the north and south fuelling machine (FM) vault walls of the E1 100m accessible area passages. These fields were first noticed at NAPS-1 and subsequently at NAPS-2 and KAPS-1. Such surveys done at RAPS have indicated that the fields on these walls would come out to be quite low (only 1-2 mR/h) from sources other than that arising from 41 Ar contamination. RAPS/MAPS experience pointed to adequacy of shielding of the FM vault walls and sufficient overall shielding thickness of the end-shields. Further, radiometry tests of end-shields carried out at Kaiga and RAPP 3 and 4 indicated fairly satisfactory and uniform filling of balls. Hence, incomplete filling of water column of the end-shields due to any venting problem was suspected to be one possible reason for the observed high fields in NAPS and Kakrapar Atomic Power Station (KAPS). Since the presence of high radiation fields, both neutron and gamma, is of long-term concern, a special study/measurement of radiation levels on reactor face during high power operation was undertaken. In order to compare the shielding integrity of the older (RAPS/MAPS solid plate type shielding) and newer (NAPS/KAPS steel ball-filled type) end shields, these experiments were done at MAPS-2 and NAPS-2. (author). 2 refs., 2 tabs

  5. Radiation shielding analysis of a special linear accelerator for electron beam and X-ray.

    Science.gov (United States)

    Kang, W G; Pyo, S H; Alkhuraiji, T S; Han, B S; Kang, C M

    2017-01-01

    The King AbdulAziz City for Science & Technology in the Kingdom of Saudi Arabia plans to build a 10 MeV, 15 kW linear accelerator (LINAC) for electron beam and X-ray. The accelerator will be supplied by EB Tech, Republic of Korea, and the design and construction of the accelerator building will be conducted in the cooperation with EB Tech. This report presents the shielding analysis of the accelerator building using the Monte Carlo N-Particle Transport Code (MCNP). In order to improve the accuracy in estimating deep radiation penetration and to reduce computation time, various variance reduction techniques, including the weight window (WW) method, the deterministic transport (DXTRAN) spheres were considered. Radiation levels were estimated at selected locations in the shielding facility running MCNP6 for particle histories up to 1.0×10+8. The final results indicated that the calculated doses at all selected detector locations met the dose requirement of 50 mSv/yr, which is the United State Nuclear Regulatory Commission (U.S. NRC) requirement.

  6. Magnetic shielding for superconducting RF cavities

    Science.gov (United States)

    Masuzawa, M.; Terashima, A.; Tsuchiya, K.; Ueki, R.

    2017-03-01

    Magnetic shielding is a key technology for superconducting radio frequency (RF) cavities. There are basically two approaches for shielding: (1) surround the cavity of interest with high permeability material and divert magnetic flux around it (passive shielding); and (2) create a magnetic field using coils that cancels the ambient magnetic field in the area of interest (active shielding). The choice of approach depends on the magnitude of the ambient magnetic field, residual magnetic field tolerance, shape of the magnetic shield, usage, cost, etc. However, passive shielding is more commonly used for superconducting RF cavities. The issue with passive shielding is that as the volume to be shielded increases, the size of the shielding material increases, thereby leading to cost increase. A recent trend is to place a magnetic shield in a cryogenic environment inside a cryostat, very close to the cavities, reducing the size and volume of the magnetic shield. In this case, the shielding effectiveness at cryogenic temperatures becomes important. We measured the permeabilities of various shielding materials at both room temperature and cryogenic temperature (4 K) and studied shielding degradation at that cryogenic temperature.

  7. Shielding container for radioactive isotopes

    International Nuclear Information System (INIS)

    Sumi, Tetsuo; Tosa, Masayoshi; Hatogai, Tatsuaki.

    1975-01-01

    Object: To effect opening and closing bidirectional radiation used particularly for a gamma densimeter or the like by one operation. Structure: This device comprises a rotatable shielding body for receiving radioactive isotope in the central portion thereof and having at least two radiation openings through which radiation is taken out of the isotope, and a shielding container having openings corresponding to the first mentioned radiation openings, respectively. The radioactive isotope is secured to a rotational shaft of the shielding body, and the shielding body is rotated to register the openings of the shielding container with the openings of the shielding body or to shield the openings, thereby effecting radiation and cut off of gamma ray in the bidirection by one operation. (Kamimura, M.)

  8. Shielding in experimental areas

    International Nuclear Information System (INIS)

    Stevens, A.; Tarnopolsky, G.; Thorndike, A.; White, S.

    1979-01-01

    The amount of shielding necessary to protect experimental detectors from various sources of background radiation is discussed. As illustrated an experiment has line of sight to sources extending approx. 90 m upstream from the intersection point. Packing a significant fraction of this space with shielding blocks would in general be unacceptable because primary access to the ring tunnel is from the experimental halls. (1) From basic machine design considerations and the inherent necessity to protect superconducting magnets it is expected that experimental areas in general will be cleaner than at any existing accelerator. (2) Even so, it will likely be necessary to have some shielding blocks available to protect experimental apparatus, and it may well be necessary to have a large amount of shielding available in the WAH. (3) Scraping will likely have some influence on all halls, and retractable apparatus may sometimes be necessary. (4) If access to any tunnel is needed to replace a magnet, one has 96 h (4 days) available to move shielding away to permit access without additional downtime. This (the amount of shielding one can shuffle about in 96 h) is a reasonable upper limit to shielding necessary in a hall

  9. Influence of Indoor Environment and Occupant Behaviour on Energy Consumption in Passive House Apartments

    DEFF Research Database (Denmark)

    Skød Søvsø, Asger; Peuhkuri, Ruut; Andersen, Rune Korsholm

    2015-01-01

    In 2012 Køge Boligselskab built 9 building blocks totalling 126 passive house apartments. Their monitored space heating demand (SHD) has been a lot higher than the passive house requirements. The aim of this study was to identify why, and how it relates to indoor environment and occupant behaviour...

  10. Continuous Energy, Multi-Dimensional Transport Calculations for Problem Dependent Resonance Self-Shielding

    International Nuclear Information System (INIS)

    Downar, T.

    2009-01-01

    The overall objective of the work here has been to eliminate the approximations used in current resonance treatments by developing continuous energy multi-dimensional transport calculations for problem dependent self-shielding calculations. The work here builds on the existing resonance treatment capabilities in the ORNL SCALE code system. The overall objective of the work here has been to eliminate the approximations used in current resonance treatments by developing continuous energy multidimensional transport calculations for problem dependent self-shielding calculations. The work here builds on the existing resonance treatment capabilities in the ORNL SCALE code system. Specifically, the methods here utilize the existing continuous energy SCALE5 module, CENTRM, and the multi-dimensional discrete ordinates solver, NEWT to develop a new code, CENTRM( ) NEWT. The work here addresses specific theoretical limitations in existing CENTRM resonance treatment, as well as investigates advanced numerical and parallel computing algorithms for CENTRM and NEWT in order to reduce the computational burden. The result of the work here will be a new computer code capable of performing problem dependent self-shielding analysis for both existing and proposed GENIV fuel designs. The objective of the work was to have an immediate impact on the safety analysis of existing reactors through improvements in the calculation of fuel temperature effects, as well as on the analysis of more sophisticated GENIV/NGNP systems through improvements in the depletion/transmutation of actinides for Advanced Fuel Cycle Initiatives.

  11. Neutron shielding properties of a new high-density concrete

    International Nuclear Information System (INIS)

    Lorente, A.; Gallego, E.; Vega Carrillo, H.R.; Mendez, R.

    2008-01-01

    The neutron shielding properties of a new high-density concrete (commercially available under the name Hormirad TM , developed in Spain by the company CT-RAD) have been characterized both experimentally and by Monte Carlo calculations. The shielding properties of this concrete against photons were previously studied and the material is being used to build bunkers, mazes and doors in medical accelerator facilities with good overall results. In this work, the objective was to characterize the material behaviour against neutrons, as well as to test alternative mixings including boron compounds in an effort to improve neutron shielding efficiency. With that purpose, Hormirad TM slabs of different thicknesses were exposed to an 241 Am-Be neutron source under controlled conditions in the neutron measurements laboratory of the Nuclear Engineering Department at UPM. The original mix, which includes a high fraction of magnetite, was then modified by adding different proportions of anhydrous borax (Na 2 B 4 O 7 ). In order to have a reference against common concrete used to shield medical accelerator facilities, the same experiment was repeated with ordinary (HA-25) concrete slabs. In parallel to the experiments, Monte Carlo calculations of the experiments were performed with MCNP5. The experimental results agree reasonably well with the Monte Carlo calculations. Therefore, the first and equilibrium tenth-value layers have been determined for the different types of concrete tested. The results show an advantageous behaviour of the Hormirad TM concrete, in terms of neutron attenuation against real thickness of the shielding. Borated concretes seem less practical since they did not show better neutron attenuation with respect to real thickness and their structural properties are worse. The neutron attenuation properties of Hormirad TM for typical neutron spectra in clinical LINAC accelerators rooms have been also characterized by Monte Carlo calculation. (author)

  12. The P450 enzyme Shade mediates the hydroxylation of ecdysone to 20-hydroxyecdysone in the Colorado potato beetle, Leptinotarsa decemlineata.

    Science.gov (United States)

    Kong, Y; Liu, X-P; Wan, P-J; Shi, X-Q; Guo, W-C; Li, G-Q

    2014-10-01

    Ecdysone 20-monooxygenase (E20MO), a cytochrome P450 monooxygenase (CYP314A1), catalyses the conversion of ecdysone (E) to 20-hydroxyecdysone (20E). We report here the cloning and characterization of the Halloween gene Shade (Shd) encoding E20MO in the Colorado potato beetle, Leptinotarsa decemlineata. LdSHD has five conserved motifs typical of insect P450s, ie the Helix-C, Helix-I, Helix-K, PxxFxPE/DRF (PERF) and heme-binding motifs. LdShd was expressed in developing eggs, the first to fourth instars, wandering larvae, pupae and adults, with statistically significant fluctuations. Its mRNA was ubiquitously distributed in the head, thorax and abdomen. The recombinant LdSHD protein expressed in Spodoptera frugiperda 9 (Sf9) cells catalysed the conversion of E to 20E. Dietary introduction of double-stranded RNA (dsRNA) of LdShd into the second instar larvae successfully knocked down the LdShd expression level, decreased the mRNA level of the ecdysone receptor (LdEcR) gene, caused larval lethality, delayed development and affected pupation. Moreover, ingestion of LdShd-dsRNA by the fourth instars also down-regulated LdShd and LdEcR expression, reduced the 20E titre, and negatively influenced pupation. Introduction of 20E and a nonsteroidal ecdysteroid agonist halofenozide into the LdShd-dsRNA-ingested second instars, and of halofenozide into the LdShd-dsRNA-ingested fourth instars almost completely relieved the negative effects on larval performance. Thus, LdSHD functions to regulate metamorphotic processes by converting E to 20E in a coleopteran insect species Le. decemlineata. © 2014 The Royal Entomological Society.

  13. Electromagnetic Shielding Characteristics of Eco-Friendly Foamed Concrete Wall

    Directory of Open Access Journals (Sweden)

    Sung-Sil Cho

    2017-01-01

    Full Text Available The electromagnetic shielding characteristics according to the material composition of foamed concrete, which was manufactured to reduce environmental pollution and to economically apply it in actual building walls, were researched herein. Industrial by-products such as ladle furnace slag (LFS, gypsum, and blast furnace slag (BFS were added to manufacture foamed concrete with enhanced functionalities such as lightweight, heat insulation, and sound insulation. The electrical characteristics such as permittivity and loss tangent according to the foam and BFS content were calculated and measured. Free space measurement was used to measure the electromagnetic shielding characteristics of the actually manufactured foamed concrete. It was confirmed that electromagnetic signals were better blocked when the foam content was low and the BFS content was high in the measured frequency bands (1–8 GHz and that approximately 90% of the electromagnetic signals were blocked over 4 GHz.

  14. Concrete shielding for nuclear ship 'Mutsu'

    International Nuclear Information System (INIS)

    Nagase, Tetsuo; Saito, Tetsuo

    1983-01-01

    The repair works of the shielding for the nuclear ship ''Mutsu'' were completed in August, 1982. For the primary shielding, serpentine concrete was adopted as it contains a large quantity of water required for neutron shielding, and in the secondary shielding at the upper part of the reactor containment vessel, the original shielding was abolished, and the heavy concrete (high water content, high density concrete) which is effective for neutron and gamma-ray shielding was newly adopted. In this report, the design and construction using these shielding concrete are outlined. In September, 1974, Mutsu caused radiation leak during the test, and the cause was found to be the fast neutrons streaming through a gap between the reactor pressure vessel and the primary shielding. The repair works were carried out in the Sasebo Shipyard. The outline of the repair works of the shielding is described. The design condition for the shielding, the design standard for the radiation dose outside and inside the ship, the method of shielding analysis and the performance required for shielding concrete are reported. The selection of materials, the method of construction and mixing ratio, the evaluation of the soundness and properties of concrete, and the works of placing the shielding concrete are outlined. (Kako, I.)

  15. A MODEL BUILDING CODE ARTICLE ON FALLOUT SHELTERS WITH RECOMMENDATIONS FOR INCLUSION OF REQUIREMENTS FOR FALLOUT SHELTER CONSTRUCTION IN FOUR NATIONAL MODEL BUILDING CODES.

    Science.gov (United States)

    American Inst. of Architects, Washington, DC.

    A MODEL BUILDING CODE FOR FALLOUT SHELTERS WAS DRAWN UP FOR INCLUSION IN FOUR NATIONAL MODEL BUILDING CODES. DISCUSSION IS GIVEN OF FALLOUT SHELTERS WITH RESPECT TO--(1) NUCLEAR RADIATION, (2) NATIONAL POLICIES, AND (3) COMMUNITY PLANNING. FALLOUT SHELTER REQUIREMENTS FOR SHIELDING, SPACE, VENTILATION, CONSTRUCTION, AND SERVICES SUCH AS ELECTRICAL…

  16. Shielding container

    International Nuclear Information System (INIS)

    Darling, K.A.M.

    1981-01-01

    A shielding container incorporates a dense shield, for example of depleted uranium, cast around a tubular member of curvilinear configuration for accommodating a radiation source capsule. A lining for the tubular member, in the form of a close-coiled flexible guide, provides easy replaceability to counter wear while the container is in service. Container life is extended, and maintenance costs are reduced. (author)

  17. The measurement theory of radioactivity in building materials

    International Nuclear Information System (INIS)

    Qu Jinhui; Wang Renbo; Zhang Xiongjie; Tan Hai; Zhu Zhipu; Man Zaigang

    2010-01-01

    Radioactivity in Building Materials is the main source of natural radiation dose that the individual is received, which has caused serious concern of all Social Sector. The paper completely introduce the measurement theory of the Radioactivity in Building Materials along with the measurement principle of natural radioactivity, design of shielding facility, choosing measurement time, sample prepared and spectrum analyzed. (authors)

  18. Shielding analysis in the design phase of the new Emergency Operation Facility for Tihange Nuclear Power Plant

    OpenAIRE

    Genard Gilles; Portal Romain; Bouchat Virginie; Vanderperre Serge

    2017-01-01

    In the framework of the design studies for a new Emergency Operation Facility (EOF) for Tihange NPP, radiation protection analyses are needed to comply with effective dose rate criteria. In this aim, the shielding performed by, at the one hand, external walls and roof of the building and, on the other hand, internal walls, has been sized by means of MicroShield calculations. This paper explains how the calculations for external walls, doors, roof, floor and internal walls are made. The assump...

  19. Concrete radiation shielding

    International Nuclear Information System (INIS)

    Kaplan, M.F.

    1989-01-01

    The increased use of nuclear energy has given rise to a growth in the amount of artificially produced radiation and radioactive materials. The design and construction of shielding to protect people, equipment and structures from the effects of radiation has never been more important. Experience has shown that concrete is an effective, versatile and economical material for the construction of radiation shielding. This book provides information on the principles governing the interaction of radiation with matter and on relevant nuclear physics to give the engineer an understanding of the design and construction of concrete shielding. It covers the physical, mechanical and nuclear properties of concrete; the effects of elevated temperatures and possible damage to concrete due to radiation; basic procedures for the design of concrete radiation shields and finally the special problems associated with their construction and cost. Although written primarily for engineers concerned with the design and construction of concrete shielding, the book also reviews the widely scattered data and information available on this subject and should therefore be of interest to students and those wishing to research further in this field. (author)

  20. Gonad shielding in diagnostic radiology

    International Nuclear Information System (INIS)

    Anon.

    1975-01-01

    The use of gonad shielding is an important radiation protection technique, intended to reduce unnecessary x-ray exposure of the gonads of patients from diagnostic x-ray procedures. The types of gonad shields in use are discussed as are the types of diagnostic examinations that should include gonad shielding. It was found that when properly used, most shields provided substantial gonad dose reductions

  1. Shielding structure analysis for LSDS facility

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Hong Yeop; Kim, Jeong Dong; Lee, Yong Deok; Kim, Ho Dong [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2014-05-15

    The nuclear material (Pyro, Spent nuclear fuel) itself and the target material to generate neutrons is the LSDS system for isotopic fissile assay release of high intensity neutron and gamma rays. This research was performed to shield from various strong radiation. A shielding evaluation was carried out with a facilities model of LSDS system. The MCNPX 2.5 code was used and a shielding evaluation was performed for the shielding structure and location. The radiation dose based on the hole structure and location of the wall was evaluated. The shielding evaluation was performed to satisfy the safety standard for a normal person (1 μSv/h) and to use enough interior space. The MCNPX2.5 code was used and a dose evaluation was performed for the location of the shielding material, shielding structure, and hole structure. The evaluation result differs according to the shielding material location. The dose rate was small when the shielding material was positioned at the center. The dose evaluation result regarding the location of the shielding material was applied to the facility and the shielding thickness was determined (In 50 cm + Borax 5 cm + Out 45cm). In the existing hole structure, the radiation leak is higher than the standard. A hole structure model to prevent leakage of radiation was proposed. The general public dose limit was satisfied when using the concrete reinforcement and a zigzag structure. The shielding result will be of help to the facility shielding optimization.

  2. Shielding structure analysis for LSDS facility

    International Nuclear Information System (INIS)

    Choi, Hong Yeop; Kim, Jeong Dong; Lee, Yong Deok; Kim, Ho Dong

    2014-01-01

    The nuclear material (Pyro, Spent nuclear fuel) itself and the target material to generate neutrons is the LSDS system for isotopic fissile assay release of high intensity neutron and gamma rays. This research was performed to shield from various strong radiation. A shielding evaluation was carried out with a facilities model of LSDS system. The MCNPX 2.5 code was used and a shielding evaluation was performed for the shielding structure and location. The radiation dose based on the hole structure and location of the wall was evaluated. The shielding evaluation was performed to satisfy the safety standard for a normal person (1 μSv/h) and to use enough interior space. The MCNPX2.5 code was used and a dose evaluation was performed for the location of the shielding material, shielding structure, and hole structure. The evaluation result differs according to the shielding material location. The dose rate was small when the shielding material was positioned at the center. The dose evaluation result regarding the location of the shielding material was applied to the facility and the shielding thickness was determined (In 50 cm + Borax 5 cm + Out 45cm). In the existing hole structure, the radiation leak is higher than the standard. A hole structure model to prevent leakage of radiation was proposed. The general public dose limit was satisfied when using the concrete reinforcement and a zigzag structure. The shielding result will be of help to the facility shielding optimization

  3. Concrete Shielding For Radiation Safety And Unexpected Dangerous Inside Cobalt-60 Industrial Irradiator

    International Nuclear Information System (INIS)

    Keshk, A.B.; Aly, R.A.

    2011-01-01

    The study shows a proposed destruction inside one of three cobalt-60 industrial irradiators to determine and reduce the negative results, to improve and modify emergency plan to face terrorism works. The results show the performance of concrete shielding (walls and ceiling) contains the bad effect of dynamic pressures. The explosion forces are prevented to destructive by performance of their concrete shielding, which will contain the most components of devastated systems inside each irradiator after explosion. Shield penetration like electrical cable tunnels, pushers holes, hole with removable plug, product boxes openings, lens opening and ozone duct are affected badly by destruction. Through probability of transporting, some of devastated parts of broken radioactive cobalt- 60 pencils from inside radiation concreter room to outside (surrounded environment) are maintained and causing very danger radiation exposure by gamma rays outside irradiator. A necessity needs to modify emergency plan to prevent any explosive materials to enter inside the main building (irradiation sale) and also discovering any explosive materials which are placed inside the product boxes before passing to inside irradiator. The minimizing radiation exposure (2 mrem/h) inside underground radiation shelters are maintained by reducing radiation dose exerted from a nuclear explosion of 20 kT about 1 km away to a safe value, and calculating the protective factors of radiation main building basements are more than 40 (safety factor) as they are located under ground level, are surrounded by sandy soil and are constructed by concrete. The study shows the proposed basements of the main building maintain success to use as under ground safe radiation shelter (during emergency) with separate safe radiation trace. It begins from the main opening of irradiation sale and leads to underground proposed shelter through modified main stair

  4. Design experience: CRBRP radiation shielding

    International Nuclear Information System (INIS)

    Disney, R.K.; Chan, T.C.; Gallo, F.G.; Hedgecock, L.R.; McGinnis, C.A.; Wrights, G.N.

    1978-11-01

    The Clinch River Breeder Reactor Plant (CRBRP) is being designed as a fast breeder demonstration project in the U.S. Liquid Metal Fast Breeder Reactor (LMFBR) program. Radiation shielding design of the facility consists of a comprehensive design approach to assure compliance with design and government regulatory requirements. Studies conducted during the CRBRP design process involved the aspects of radiation shielding dealing with protection of components, systems, and personnel from radiation exposure. Achievement of feasible designs, while considering the mechanical, structural, nuclear, and thermal performance of the component or system, has required judicious trade-offs in radiation shielding performance. Specific design problems which have been addressed are in-vessel radial shielding to protect permanent core support structures, flux monitor system shielding to isolate flux monitoring systems for extraneous background sources, reactor vessel support shielding to allow personnel access to the closure head during full power operation, and primary heat transport system pipe chaseway shielding to limit intermediate heat transport system sodium system coolant activation. The shielding design solutions to these problems defined a need for prototypic or benchmark experiments to provide assurance of the predicted shielding performance of selected design solutions and the verification of design methodology. Design activities of CRBRP plant components an systems, which have the potential for radiation exposure of plant personnel during operation or maintenance, are controlled by a design review process related to radiation shielding. The program implements design objectives, design requirements, and cost/benefit guidelines to assure that radiation exposures will be ''as low as reasonably achievable''

  5. Radiation shielding calculation using MCNP

    International Nuclear Information System (INIS)

    Masukawa, Fumihiro

    2001-01-01

    To verify the Monte Carlo code MCNP4A as a tool to generate the reference data in the shielding designs and the safety evaluations, various shielding benchmark experiments were analyzed using this code. These experiments were categorized in three types of the shielding subjects; bulk shielding, streaming, and skyshine. For the variance reduction technique, which is indispensable to get meaningful results with the Monte Carlo shielding calculation, we mainly used the weight window, the energy dependent Russian roulette and spitting. As a whole, our analyses performed enough small statistical errors and showed good agreements with these experiments. (author)

  6. MMW [multimegawatt] shielding design and analysis

    International Nuclear Information System (INIS)

    Olson, A.P.

    1988-01-01

    Reactor shielding for multimegawatt (MMW) space power must satisfy a mass constraint as well as performance specifications for neutron fluence and gamma dose. A minimum mass shield is helpful in attaining the launch mass goal for the entire vehicle, because the shield comprises about 1% to 2% of the total vehicle mass. In addition, the shield internal heating must produce tolerable temperatures. The analysis of shield performance for neutrons and gamma rays is emphasized. Topics addressed include cross section preparation for multigroup 2D S/sub n/-transport analyses, and the results of parametric design studies on shadow shield performance and mass versus key shield design variables such as cone angle, number, placement, and thickness of layers of tungsten, and shield top radius. Finally, adjoint methods are applied to the shield in order to spatially map its relative contribution to dose reduction, and to provide insight into further design optimization. 7 refs., 2 figs., 3 tabs

  7. LOFT shield tank steady state temperatures with addition of gamma and neutron shielding

    International Nuclear Information System (INIS)

    Kyllingstad, G.

    1977-01-01

    The effect of introducing a neutron and gamma shield into the annulus between the reactor vessel and the shield tank is analyzed. This addition has been proposed in order to intercept neutron streaming up the annulus during nuclear operations. Its installation will require removal of approximately 20- 1 / 2 inches of stainless steel foil insulation at the top of the annulus. The resulting conduction path is believed to result in increased water temperatures within the shield tank, possibly beyond the 150 0 F limit, and/or cooling of the reactor vessel nozzles such that adverse thermal stresses would be generated. A two dimensional thermal analysis using the finite element code COUPLE/MOD2 was done for the shield tank system illustrated in the figure (1). The reactor was assumed to be at full power, 55 MW (th), with a loop flow rate of 2.15 x 10 6 lbm/hr (268.4 kg/s) at 2250 psi (15.51 MPa). Calculations indicate a steady state shield tank water temperature of 140 0 F (60 0 C). This is below the 150 0 F (65.56 0 C) limit. Also, no significant changes in thermal gradients within the nozzle or reactor vessel wall are generated. A spacer between the gamma shield and the shield tank is recommended, however, in order to ensure free air circulation through the annulus

  8. PS buildings : reinforced concrete structure for shielding "bridge" pillar

    CERN Multimedia

    CERN PhotoLab

    1956-01-01

    The PS ring traverses the region between the experimental halls South and North (buildings Nos 150 and 151) under massive bridge-shaped concrete beams. This pillar stands at the S-W end of the structure.

  9. Concrete shielding for nuclear ship 'Mutsu'

    International Nuclear Information System (INIS)

    Nagase, Tetsuo; Nakajima, Tadao; Okumura, Tadahiko; Saito, Tetsuo

    1983-01-01

    The nuclear ship ''Mutsu'' was constructed in 1970 as the fourth in the world. On September 1, 1974, during the power raising test in the Pacific Ocean, radiation leak was detected. As the result of investigation, it was found that the cause was the fast neutrons streaming through the gap between the reactor pressure vessel and the primary shield. In order to repair the shielding facility, the Japan Nuclear Ship Research Development Agency carried out research and development and shielding design. It was decided to adopt serpentine concrete for the primary shield, which is the excellent moderator of fast neutrons even at high temperature, and heavy concrete for the secondary shield, which is effective for shielding both gamma ray and neutron beam. The repair of shielding was carried out in the Sasebo Shipyard, and completed in August, 1982. The outline of the repair work is reported. The weight increase was about 300 t. The conditions of the shielding design, the method of shielding analysis, the performance required for the shielding concrete, the preliminary experiment on heavy concrete and the construction works of serpentine concrete and heavy concrete are described. (Kako, I.)

  10. Accelerator shielding benchmark problems

    International Nuclear Information System (INIS)

    Hirayama, H.; Ban, S.; Nakamura, T.

    1993-01-01

    Accelerator shielding benchmark problems prepared by Working Group of Accelerator Shielding in the Research Committee on Radiation Behavior in the Atomic Energy Society of Japan were compiled by Radiation Safety Control Center of National Laboratory for High Energy Physics. Twenty-five accelerator shielding benchmark problems are presented for evaluating the calculational algorithm, the accuracy of computer codes and the nuclear data used in codes. (author)

  11. HPGe detector shielding adjustment

    International Nuclear Information System (INIS)

    Trnkova, L.; Rulik, P.

    2008-01-01

    Low-level background shielding of HPGe detectors is used mainly for environmental samples with very low content of radionuclides. National Radiation Protection Institute (SURO) in Prague is equipped with 14 HPGe detectors with relative efficiency up to 150%. The detectors are placed in a room built from materials with low content of natural radionuclides and equipped with a double isolation of the floor against radon. Detectors themselves are placed in lead or steel shielding. Steel shielding with one of these detectors with relative efficiency of 100% was chosen to be rebuilt to achieve lower minimum detectable activity (MDA). Additional lead and copper shielding was built up inside the original steel shielding to reduce the volume of the inner space and filled with nitrogen by means of evaporating liquid nitrogen. The additional lead and copper shielding, consequent reduction of the inner volume and supply of evaporated nitrogen, caused a decrease of the background count and accordingly MDA values as well. The effect of nitrogen evaporation on the net areas of peaks belonging to radon daughters is significant. The enhanced shielding adjustment has the biggest influence in low energy range, what can be seen in collected data. MDA values in energy range from 30 keV to 400 keV decreased to 0.65-0.85 of original value, in energy range from 400 keV to 2 MeV they fell to 0.70-0.97 of original value. (authors)

  12. Utilization of recycled cathode ray tubes glass in cement mortar for X-ray radiation-shielding applications

    International Nuclear Information System (INIS)

    Ling, Tung-Chai; Poon, Chi-Sun; Lam, Wai-Shung; Chan, Tai-Po; Fung, Karl Ka-Lok

    2012-01-01

    Highlights: ► It is feasible to use recycled CRT glass in mortar as shield against X-ray radiation. ► Shielding properties of CRT mortar is strongly depended on CRT content. ► Linear attenuation coefficient was reduced by 142% upon 100% CRT glass in mortar. ► Effect of mortar thickness and irradiation energies on shielding was investigated. - Abstract: Recycled glass derived from cathode ray tubes (CRT) glass with a specific gravity of approximately 3.0 g/cm 3 can be potentially suitable to be used as fine aggregate for preparing cement mortars for X-ray radiation-shielding applications. In this work, the effects of using crushed glass derived from crushed CRT funnel glass (both acid washed and unwashed) and crushed ordinary beverage container glass at different replacement levels (0%, 25%, 50%, 75% and 100% by volume) of sand on the mechanical properties (strength and density) and radiation-shielding performance of the cement–sand mortars were studied. The results show that all the prepared mortars had compressive strength values greater than 30 MPa which are suitable for most building applications based on ASTM C 270. The density and shielding performance of the mortar prepared with ordinary crushed (lead-free) glass was similar to the control mortar. However, a significant enhancement of radiation-shielding was achieved when the CRT glasses were used due to the presence of lead in the glass. In addition, the radiation shielding contribution of CRT glasses was more pronounced when the mortar was subject to a higher level of X-ray energy.

  13. Method for dismantling shields

    International Nuclear Information System (INIS)

    Fukuzawa, Rokuro; Kondo, Nobuhiro; Kamiyama, Yoshinori; Kawasato, Ken; Hiraga, Tomoaki.

    1990-01-01

    The object of the present invention is to enable operators to dismantle shieldings contaminated by radioactivity easily and in a short period of time without danger of radiation exposure. A plurality of introduction pipes are embedded previously to the shielding walls of shielding members which contain a reactor core in a state where both ends of the introduction pipes are in communication with the outside. A wire saw is inserted into the introduction pipes to cut the shieldings upon dismantling. Then, shieldings can be dismantled easily in a short period of time with no radiation exposure to operator's. Further, according to the present invention, since the wire saw can be set easily and a large area can be cut at once, operation efficiency is improved. Further, since remote control is possible, cutting can be conducted in water and complicated places of the reactor. Biting upon starting the wire saw in the introduction pipe is reduced to facilitate startup for the rotation. (I.S.)

  14. Magnetic shield effect simulation of superconducting film shield covering directly coupled HTS dc-SQUID magnetometer

    International Nuclear Information System (INIS)

    Terauchi, N.; Noguchi, S.; Igarashi, H.

    2011-01-01

    A superconducting film shield over a SQUID ring improves the robustness of the SQUID with respect to magnetic noise. Supercurrent in the SQUID magnetometer and the superconducting film shield were simulated. The superconducting film shield reduces the influence of the external magnetic field on the SQUID ring. An HTS SQUID is a high sensitive magnetic sensor. In recent years, the HTS SQUID is widely used in various applications. In some applications, high robustness with respect to magnetic noise is required to realize stable operation at outside of a magnetic shielding room. The target of this paper is a directly coupled HTS dc-SQUID magnetometer. To enhance the robustness of the SQUID magnetometer, use of a superconducting thin film shield has been proposed. The magnetic field directly penetrating the SQUID ring causes the change of the critical current of Josephson junction, and then the SQUID magnetometer transitions into inoperative state. In order to confirm the magnetic shield effect of the superconducting film shield, electromagnetic field simulation with 3D edge finite element method was performed. To simulate the high temperature superconductor, E-J characteristics and c-axis anisotropy are considered. To evaluate the effect of the superconducting film shield, an external magnetic field which is supposed to be a magnetic noise is applied. From the simulation results, the time transition of the magnetic flux penetrating the SQUID ring is investigated and the effect of the superconducting film shield is confirmed. The amplitude of the magnetic flux penetrating the SQUID ring can be reduced to about one-sixth since the superconducting film shield prevents the magnetic noise from directly penetrating the SQUID ring.

  15. Passive magnetic shielding in MRI-Linac systems

    Science.gov (United States)

    Whelan, Brendan; Kolling, Stefan; Oborn, Brad M.; Keall, Paul

    2018-04-01

    Passive magnetic shielding refers to the use of ferromagnetic materials to redirect magnetic field lines away from vulnerable regions. An application of particular interest to the medical physics community is shielding in MRI systems, especially integrated MRI-linear accelerator (MRI-Linac) systems. In these systems, the goal is not only to minimize the magnetic field in some volume, but also to minimize the impact of the shield on the magnetic fields within the imaging volume of the MRI scanner. In this work, finite element modelling was used to assess the shielding of a side coupled 6 MV linac and resultant heterogeneity induced within the 30 cm diameter of spherical volume (DSV) of a novel 1 Tesla split bore MRI magnet. A number of different shield parameters were investigated; distance between shield and magnet, shield shape, shield thickness, shield length, openings in the shield, number of concentric layers, spacing between each layer, and shield material. Both the in-line and perpendicular MRI-Linac configurations were studied. By modifying the shield shape around the linac from the starting design of an open ended cylinder, the shielding effect was boosted by approximately 70% whilst the impact on the magnet was simultaneously reduced by approximately 10%. Openings in the shield for the RF port and beam exit were substantial sources of field leakage; however it was demonstrated that shielding could be added around these openings to compensate for this leakage. Layering multiple concentric shield shells was highly effective in the perpendicular configuration, but less so for the in-line configuration. Cautious use of high permeability materials such as Mu-metal can greatly increase the shielding performance in some scenarios. In the perpendicular configuration, magnetic shielding was more effective and the impact on the magnet lower compared with the in-line configuration.

  16. Scintillation counter, segmented shield

    International Nuclear Information System (INIS)

    Olson, R.E.; Thumim, A.D.

    1975-01-01

    A scintillation counter, particularly for counting gamma ray photons, includes a massive lead radiation shield surrounding a sample-receiving zone. The shield is disassembleable into a plurality of segments to allow facile installation and removal of a photomultiplier tube assembly, the segments being so constructed as to prevent straight-line access of external radiation through the shield into radiation-responsive areas. Provisions are made for accurately aligning the photomultiplier tube with respect to one or more sample-transmitting bores extending through the shield to the sample receiving zone. A sample elevator, used in transporting samples into the zone, is designed to provide a maximum gamma-receiving aspect to maximize the gamma detecting efficiency. (U.S.)

  17. Radiation shielding for fusion reactors

    International Nuclear Information System (INIS)

    Santoro, R.T.

    2000-01-01

    Radiation shielding requirements for fusion reactors present different problems than those for fission reactors and accelerators. Fusion devices, particularly tokamak reactors, are complicated by geometry constraints that complicate disposition of fully effective shielding. This paper reviews some of these shielding issues and suggested solutions for optimizing the machine and biological shielding. Radiation transport calculations are essential for predicting and confirming the nuclear performance of the reactor and, as such, must be an essential part of the reactor design process. Development and optimization of reactor components from the first wall and primary shielding to the penetrations and containment shielding must be carried out in a sensible progression. Initial results from one-dimensional transport calculations are used for scoping studies and are followed by detailed two- and three-dimensional analyses to effectively characterize the overall radiation environment. These detail model calculations are essential for accounting for the radiation leakage through ports and other penetrations in the bulk shield. Careful analysis of component activation and radiation damage is cardinal for defining remote handling requirements, in-situ replacement of components, and personnel access at specific locations inside the reactor containment vessel. (author)

  18. Radiation Resistance Test of Wireless Sensor Node and the Radiation Shielding Calculation

    Energy Technology Data Exchange (ETDEWEB)

    Li, Liqan; Sur, Bhaskar [Atomic Energy of Canada Limited, Ontario (Canada); Wang, Quan [University of Western Ontario, Ontario (Canada); Deng, Changjian [The University of Electronic Science and Technology, Chengdu (China); Chen, Dongyi; Jiang, Jin [Applied Physics Branch, Ontario (Korea, Republic of)

    2014-08-15

    A wireless sensor network (WSN) is being developed for nuclear power plants. Amongst others, ionizing radiation resistance is one essential requirement for WSN to be successful. This paper documents the work done in Chalk River Laboratories of Atomic Energy of Canada Limited (AECL) to test the resistance to neutron and gamma radiation of some WSN nodes. The recorded dose limit that the nodes can withstand before being damaged by the radiation is compared with the radiation environment inside a typical CANDU (CANada Deuterium Uranium) power plant reactor building. Shielding effects of polyethylene, cadmium and lead to neutron and gamma radiations are also analyzed using MCNP simulation. The shielding calculation can be a reference for the node case design when high dose rate or accidental condition (like Fukushima) is to be considered.

  19. Parameters calculation of shielding experiment

    International Nuclear Information System (INIS)

    Gavazza, S.

    1986-02-01

    The radiation transport methodology comparing the calculated reactions and dose rates for neutrons and gama-rays, with experimental measurements obtained on iron shield, irradiated in the YAYOI reactor is evaluated. The ENDF/B-IV and VITAMIN-C libraries and the AMPX-II modular system, for cross sections generation collapsed by the ANISN code were used. The transport calculations were made using the DOT 3.5 code, adjusting the boundary iron shield source spectrum to the reactions and dose rates, measured at the beginning of shield. The neutron and gamma ray distributions calculated on the iron shield presented reasonable agreement with experimental measurements. An experimental arrangement using the IEA-R1 reactor to determine a shielding benchmark is proposed. (Author) [pt

  20. Morphometry of terrestrial shield volcanoes

    Science.gov (United States)

    Grosse, Pablo; Kervyn, Matthieu

    2018-03-01

    Shield volcanoes are described as low-angle edifices built primarily by the accumulation of successive lava flows. This generic view of shield volcano morphology is based on a limited number of monogenetic shields from Iceland and Mexico, and a small set of large oceanic islands (Hawaii, Galápagos). Here, the morphometry of 158 monogenetic and polygenetic shield volcanoes is analyzed quantitatively from 90-meter resolution SRTM DEMs using the MORVOLC algorithm. An additional set of 24 lava-dominated 'shield-like' volcanoes, considered so far as stratovolcanoes, are documented for comparison. Results show that there is a large variation in shield size (volumes from 0.1 to > 1000 km3), profile shape (height/basal width (H/WB) ratios mostly from 0.01 to 0.1), flank slope gradients (average slopes mostly from 1° to 15°), elongation and summit truncation. Although there is no clear-cut morphometric difference between shield volcanoes and stratovolcanoes, an approximate threshold can be drawn at 12° average slope and 0.10 H/WB ratio. Principal component analysis of the obtained database enables to identify four key morphometric descriptors: size, steepness, plan shape and truncation. Hierarchical cluster analysis of these descriptors results in 12 end-member shield types, with intermediate cases defining a continuum of morphologies. The shield types can be linked in terms of growth stages and shape evolution, related to (1) magma composition and rheology, effusion rate and lava/pyroclast ratio, which will condition edifice steepness; (2) spatial distribution of vents, in turn related to the magmatic feeding system and the tectonic framework, which will control edifice plan shape; and (3) caldera formation, which will condition edifice truncation.

  1. PWR upper/lower internals shield

    Energy Technology Data Exchange (ETDEWEB)

    Homyk, W.A. [Indian Point Station, Buchanan, NY (United States)

    1995-03-01

    During refueling of a nuclear power plant, the reactor upper internals must be removed from the reactor vessel to permit transfer of the fuel. The upper internals are stored in the flooded reactor cavity. Refueling personnel working in containment at a number of nuclear stations typically receive radiation exposure from a portion of the highly contaminated upper intervals package which extends above the normal water level of the refueling pool. This same issue exists with reactor lower internals withdrawn for inservice inspection activities. One solution to this problem is to provide adequate shielding of the unimmersed portion. The use of lead sheets or blankets for shielding of the protruding components would be time consuming and require more effort for installation since the shielding mass would need to be transported to a support structure over the refueling pool. A preferable approach is to use the existing shielding mass of the refueling pool water. A method of shielding was devised which would use a vacuum pump to draw refueling pool water into an inverted canister suspended over the upper internals to provide shielding from the normally exposed components. During the Spring 1993 refueling of Indian Point 2 (IP2), a prototype shield device was demonstrated. This shield consists of a cylindrical tank open at the bottom that is suspended over the refueling pool with I-beams. The lower lip of the tank is two feet below normal pool level. After installation, the air width of the natural shielding provided by the existing pool water. This paper describes the design, development, testing and demonstration of the prototype device.

  2. Studies of ionizing radiation shielding effectiveness of silica-based commercial glasses used in Bangladeshi dwellings

    Directory of Open Access Journals (Sweden)

    Sabina Yasmin

    2018-06-01

    Full Text Available Following the rapid growing economy, the Bangladeshi dwellers are replacing their traditional (mud-, bamboo-, and wood-based houses to modern multistoried buildings, where different types of glasses are being used as decorative as well as structural materials due to their various advantageous properties. In this study, we inquire the protective and dosimetric capability of commercial glasses for ionizing radiation. Four branded glass samples (PHP-Bangladesh, Osmania-Bangladesh, Nasir-Bangladesh, and Rider-China of same thickness and color but different elemental weight fractions were analyzed for shielding and dosimetric properties. The chemical composition of the studied material was evaluated by EDX technique. A well-shielded HPGe γ-ray spectrometer combined with associated electronics was used to evaluate the attenuation coefficients of the studied materials for 59 keV, 661 keV, 1173 keV and 1332 keV photon energies. A number of shielding parameters- half value layer (HVL, radiation protection efficiency (RPE and effective atomic number (Zeff were also evaluated. The data were compared with the available literature (where applicable to understand its shielding capability relative to the standard materials such as lead. Among the studied brands, Rider (China shows relatively better indices to be used as ionizing radiation shielding material. The obtained, Zeff of the studied glass samples showed comparable values to the TLD-200 dosimeter, thus considered suitable for environmental radiation monitoring purposes. Keywords: Silica-based commercial glass, HPGe γ-ray spectrometry, EDX analyses, Shielding effectiveness, Dosimetric properties

  3. Shielding experiments for accelerator facilities

    Energy Technology Data Exchange (ETDEWEB)

    Nakashima, Hiroshi; Tanaka, Susumu; Sakamoto, Yukio [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment] [and others

    2000-06-01

    A series of shielding experiments was carried out by using AVF cyclotron accelerator of TIARA at JAERI in order to validate shielding design methods for accelerator facilities in intermediate energy region. In this paper neutron transmission experiment through thick shields and radiation streaming experiment through a labyrinth are reported. (author)

  4. Shielding experiments for accelerator facilities

    International Nuclear Information System (INIS)

    Nakashima, Hiroshi; Tanaka, Susumu; Sakamoto, Yukio

    2000-01-01

    A series of shielding experiments was carried out by using AVF cyclotron accelerator of TIARA at JAERI in order to validate shielding design methods for accelerator facilities in intermediate energy region. In this paper neutron transmission experiment through thick shields and radiation streaming experiment through a labyrinth are reported. (author)

  5. Nuclear data for radiation shielding

    International Nuclear Information System (INIS)

    Miyasaka, Shunichi; Takahashi, Hiroshi.

    1976-01-01

    The third shielding expert conference was convened in Paris in Oct. 1975 for exchanging informations about the sensitivity evaluation of nuclear data in shielding calculation and integral bench mark experiment. The requirements about nuclear data presented at present from the field of nuclear design do not reflect sufficiently the requirements of shielding design, therefore it was the object to gather the requirements about nuclear data from the field of shielding. The nuclides used for shielding are numerous, and the nuclear data on these isotopes are required. Some of them cannot be ignored as the source of secondary γ-ray or in view of the radioactivation of materials. The requirements for the nuclear data of neutrons in the field of shielding are those concerning the reaction cross sections producing secondary γ-ray, the reaction cross sections including the production of secondary neutrons, elastic scattering cross sections, and total cross sections. The topics in the Paris conference about neutron shielding data are described, such as the methodology of sensitivity evaluation, the standardization of group constant libraries, the bench mark experiment on iron and sodium, and the cross section of γ-ray production. In the shielding of nuclear fission reactors, the γ-ray production owing to nuclear fission reaction is also important. In (d, t) fusion reactors, high energy neutrons are generated, and high energy γ-ray is emitted through giant E1 resonance. (Kako, I.)

  6. Optimization of multi-layered metallic shield

    International Nuclear Information System (INIS)

    Ben-Dor, G.; Dubinsky, A.; Elperin, T.

    2011-01-01

    Research highlights: → We investigated the problem of optimization of a multi-layered metallic shield. → The maximum ballistic limit velocity is a criterion of optimization. → The sequence of materials and the thicknesses of layers in the shield are varied. → The general problem is reduced to the problem of Geometric Programming. → Analytical solutions are obtained for two- and three-layered shields. - Abstract: We investigate the problem of optimization of multi-layered metallic shield whereby the goal is to determine the sequence of materials and the thicknesses of the layers that provide the maximum ballistic limit velocity of the shield. Optimization is performed under the following constraints: fixed areal density of the shield, the upper bound on the total thickness of the shield and the bounds on the thicknesses of the plates manufactured from every material. The problem is reduced to the problem of Geometric Programming which can be solved numerically using known methods. For the most interesting in practice cases of two-layered and three-layered shields the solution is obtained in the explicit analytical form.

  7. SHIELD 1.0: development of a shielding calculator program in diagnostic radiology; SHIELD 1.0: desenvolvimento de um programa de calculo de blindagem em radiodiagnostico

    Energy Technology Data Exchange (ETDEWEB)

    Santos, Romulo R.; Real, Jessica V.; Luz, Renata M. da [Hospital Sao Lucas (PUCRS), Porto Alegre, RS (Brazil); Friedrich, Barbara Q.; Silva, Ana Maria Marques da, E-mail: ana.marques@pucrs.br [Pontificia Universidade Catolica do Rio Grande do Sul (PUCRS), Porto Alegre, RS (Brazil)

    2013-08-15

    In shielding calculation of radiological facilities, several parameters are required, such as occupancy, use factor, number of patients, source-barrier distance, area type (controlled and uncontrolled), radiation (primary or secondary) and material used in the barrier. The shielding design optimization requires a review of several options about the physical facility design and, mainly, the achievement of the best cost-benefit relationship for the shielding material. To facilitate the development of this kind of design, a program to calculate the shielding in diagnostic radiology was implemented, based on data and limits established by National Council on Radiation Protection and Measurements (NCRP) 147 and SVS-MS 453/98. The program was developed in C⌗ language, and presents a graphical interface for user data input and reporting capabilities. The module initially implemented, called SHIELD 1.0, refers to calculating barriers for conventional X-ray rooms. The program validation was performed by the comparison with the results of examples of shielding calculations presented in NCRP 147.

  8. SHIELD verification and validation report

    International Nuclear Information System (INIS)

    Boman, C.

    1992-02-01

    This document outlines the verification and validation effort for the SHIELD, SHLDED, GEDIT, GENPRT, FIPROD, FPCALC, and PROCES modules of the SHIELD system code. Along with its predecessors, SHIELD has been in use at the Savannah River Site (SRS) for more than ten years. During this time the code has been extensively tested and a variety of validation documents have been issued. The primary function of this report is to specify the features and capabilities for which SHIELD is to be considered validated, and to reference the documents that establish the validation

  9. Radiation shield for nuclear reactors

    International Nuclear Information System (INIS)

    Weissenfluh, J.A.

    1978-01-01

    A shield for use with nuclear reactor systems to attenuate radiation resulting from reactor operation is described. The shield comprises a container preferably of a thin, flexible or elastic material, which may be in the form of a bag, a mattress, a toroidal segment or toroid or the like filled with radiation attenuating liuid. Means are provided in the container for filling and draining the container in place. Due to its flexibility, the shield readily conforms to irregularities in surfaces with which it may be in contact in a shielding position

  10. Structure of pool in reactor building

    International Nuclear Information System (INIS)

    Yokoyama, Shigeki.

    1997-01-01

    Shielding walls made of iron-reinforced concrete having a metal liner including two body walls rigidly combined to the upper surface of a reactor container are disposed at least to one of an equipment pool or spent fuel storage pool in a reactor building. A rack for temporarily placing an upper lattice plate is detachably attached at least above one of a steam dryer or a gas/liquid separator temporarily placed in the temporary pool, and the height from the bottom portion to the upper end of the shielding wall is determined based on the height of an upper lattice plate temporary placed on the rack and the water depth required for shielding radiation from the upper lattice plate. An operator's exposure on the operation floor can be reduced by the shielding wall, and radiation dose from the spent fuels is reduced. The increase of the height of a pool guarder enhances bending resistance as a ceiling. In addition, the total height of them is made identical with the depth of the spent fuel storage pool thereby enabling to increase storage area for spent fuels. (N.H.)

  11. Hybrid Active-Passive Radiation Shielding System

    Data.gov (United States)

    National Aeronautics and Space Administration — A radiation shielding system is proposed that integrates active magnetic fields with passive shielding materials. The objective is to increase the shielding...

  12. Handout on shielding calculation

    International Nuclear Information System (INIS)

    Heilbron Filho, P.F.L.

    1991-01-01

    In order to avoid the difficulties of the radioprotection supervisors in the tasks related to shielding calculations, is presented in this paper the basic concepts of shielding theory. It also includes exercises and examples. (author)

  13. Pretinning Nickel-Plated Wire Shields

    Science.gov (United States)

    Igawa, J. A.

    1985-01-01

    Nickel-plated copper shielding for wires pretinned for subsequent soldering with help of activated rosin flux. Shield cut at point 0.25 to 0.375 in. (6 to 10 mm) from cut end of outer jacket. Loosened end of shield straightened and pulled toward cut end. Insulation of inner wires kept intact during pretinning.

  14. Radiation Shielding Materials and Containers Incorporating Same

    Energy Technology Data Exchange (ETDEWEB)

    Mirsky, Steven M.; Krill, Stephen J.; and Murray, Alexander P.

    2005-11-01

    An improved radiation shielding material and storage systems for radioactive materials incorporating the same. The PYRolytic Uranium Compound (''PYRUC'') shielding material is preferably formed by heat and/or pressure treatment of a precursor material comprising microspheres of a uranium compound, such as uranium dioxide or uranium carbide, and a suitable binder. The PYRUC shielding material provides improved radiation shielding, thermal characteristic, cost and ease of use in comparison with other shielding materials. The shielding material can be used to form containment systems, container vessels, shielding structures, and containment storage areas, all of which can be used to house radioactive waste. The preferred shielding system is in the form of a container for storage, transportation, and disposal of radioactive waste. In addition, improved methods for preparing uranium dioxide and uranium carbide microspheres for use in the radiation shielding materials are also provided.

  15. Measuring space radiation shielding effectiveness

    Directory of Open Access Journals (Sweden)

    Bahadori Amir

    2017-01-01

    Full Text Available Passive radiation shielding is one strategy to mitigate the problem of space radiation exposure. While space vehicles are constructed largely of aluminum, polyethylene has been demonstrated to have superior shielding characteristics for both galactic cosmic rays and solar particle events due to the high hydrogen content. A method to calculate the shielding effectiveness of a material relative to reference material from Bragg peak measurements performed using energetic heavy charged particles is described. Using accelerated alpha particles at the National Aeronautics and Space Administration Space Radiation Laboratory at Brookhaven National Laboratory, the method is applied to sample tiles from the Heat Melt Compactor, which were created by melting material from a simulated astronaut waste stream, consisting of materials such as trash and unconsumed food. The shielding effectiveness calculated from measurements of the Heat Melt Compactor sample tiles is about 10% less than the shielding effectiveness of polyethylene. Shielding material produced from the astronaut waste stream in the form of Heat Melt Compactor tiles is therefore found to be an attractive solution for protection against space radiation.

  16. Measuring space radiation shielding effectiveness

    Science.gov (United States)

    Bahadori, Amir; Semones, Edward; Ewert, Michael; Broyan, James; Walker, Steven

    2017-09-01

    Passive radiation shielding is one strategy to mitigate the problem of space radiation exposure. While space vehicles are constructed largely of aluminum, polyethylene has been demonstrated to have superior shielding characteristics for both galactic cosmic rays and solar particle events due to the high hydrogen content. A method to calculate the shielding effectiveness of a material relative to reference material from Bragg peak measurements performed using energetic heavy charged particles is described. Using accelerated alpha particles at the National Aeronautics and Space Administration Space Radiation Laboratory at Brookhaven National Laboratory, the method is applied to sample tiles from the Heat Melt Compactor, which were created by melting material from a simulated astronaut waste stream, consisting of materials such as trash and unconsumed food. The shielding effectiveness calculated from measurements of the Heat Melt Compactor sample tiles is about 10% less than the shielding effectiveness of polyethylene. Shielding material produced from the astronaut waste stream in the form of Heat Melt Compactor tiles is therefore found to be an attractive solution for protection against space radiation.

  17. Evaluation of usability of the shielding effect for thyroid shield for peripheral dose during whole brain radiation therapy

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Myung Sic; Park, Ju Kyeong; Lee, Seung Hun; Kim, Yang Su; Lee, Sun Young; Cha, Seok Yong [Dept. of Radiation Oncology, Chonbuk National University Hospital, Jeonju (Korea, Republic of)

    2014-12-15

    To reduce the radiation dose to the thyroid that is affected to scattered radiation, the shield was used. And we evaluated the shielding effect for the thyroid during whole brain radiation therapy. To measure the dose of the thyroid, 300cGy were delivered to the phantom using a linear accelerator(Clinac iX VARIAN, USA.)in the way of the 6MV X-ray in bilateral. To measure the entrance surface dose of the thyroid, five glass dosimeters were placed in the 10th slice's surface of the phantom with a 1.5 cm interval. The average values were calculated by measured values in five times each, using bismuth shield, 0.5 mmPb shield, self-made 1.0 mmPb shield and unshield. In the same location, to measure the depth dose of the thyroid, five glass dosimeters were placed in the 10th slice by 2.5 cm depth of the phantom with a 1.5 cm interval. The average values were calculated by measured values in five times each, using bismuth shield, 0.5 mmPb shield, self-made 1.0 mmPb shield and unshield. Entrance surface dose of the thyroid were respectively 44.89 mGy at the unshield, 36.03 mGy at the bismuth shield, 31.03 mGy at the 0.5 mmPb shield and 23.21 mGy at a self-made 1.0 mmPb shield. In addition, the depth dose of the thyroid were respectively 36.10 mGy at the unshield, 34.52 mGy at the bismuth shield, 32.28 mGy at the 0.5 mmPb shield and 25.50 mGy at a self-made 1.0 mmPb shield. The thyroid was affected by the secondary scattering dose and leakage dose outside of the radiation field during whole brain radiation therapy. When using a shield in the thyroid, the depth dose of thyroid showed 11-30% reduction effect and the surface dose of thyroid showed 20-48% reduction effect. Therefore, by using the thyroid shield, it is considered to effectively protect the thyroid and can perform the treatment.

  18. Utilization of recycled cathode ray tubes glass in cement mortar for X-ray radiation-shielding applications.

    Science.gov (United States)

    Ling, Tung-Chai; Poon, Chi-Sun; Lam, Wai-Shung; Chan, Tai-Po; Fung, Karl Ka-Lok

    2012-01-15

    Recycled glass derived from cathode ray tubes (CRT) glass with a specific gravity of approximately 3.0 g/cm(3) can be potentially suitable to be used as fine aggregate for preparing cement mortars for X-ray radiation-shielding applications. In this work, the effects of using crushed glass derived from crushed CRT funnel glass (both acid washed and unwashed) and crushed ordinary beverage container glass at different replacement levels (0%, 25%, 50%, 75% and 100% by volume) of sand on the mechanical properties (strength and density) and radiation-shielding performance of the cement-sand mortars were studied. The results show that all the prepared mortars had compressive strength values greater than 30 MPa which are suitable for most building applications based on ASTM C 270. The density and shielding performance of the mortar prepared with ordinary crushed (lead-free) glass was similar to the control mortar. However, a significant enhancement of radiation-shielding was achieved when the CRT glasses were used due to the presence of lead in the glass. In addition, the radiation shielding contribution of CRT glasses was more pronounced when the mortar was subject to a higher level of X-ray energy. Copyright © 2011 Elsevier B.V. All rights reserved.

  19. Shielding technology for high energy radiation production facility

    International Nuclear Information System (INIS)

    Lee, Byung Chul; Kim, Heon Il

    2004-06-01

    In order to develop shielding technology for high energy radiation production facility, references and data for high energy neutron shielding are searched and collected, and calculations to obtain the characteristics of neutron shield materials are performed. For the evaluation of characteristics of neutron shield material, it is chosen not only general shield materials such as concrete, polyethylene, etc., but also KAERI developed neutron shields of High Density PolyEthylene (HDPE) mixed with boron compound (B 2 O 3 , H 2 BO 3 , Borax). Neutron attenuation coefficients for these materials are obtained for later use in shielding design. The effect of source shape and source angular distribution on the shielding characteristics for several shield materials is examined. This effect can contribute to create shielding concept in case of no detail source information. It is also evaluated the effect of the arrangement of shield materials using current shield materials. With these results, conceptual shielding design for PET cyclotron is performed. The shielding composite using HDPE and concrete is selected to meet the target dose rate outside the composite, and the dose evaluation is performed by configuring the facility room conceptually. From the result, the proper shield configuration for this PET cyclotron is proposed

  20. Hybrid Magnetic Shielding

    Science.gov (United States)

    Royal, Kevin; Crawford, Christopher; Mullins, Andrew; Porter, Greg; Blanton, Hunter; Johnstone, Connor; Kistler, Ben; Olivera, Daniela

    2017-09-01

    The search for the electric dipole moment of the neutron requires the ambient magnetic field to be on the pT scale which is accomplished with large magnetic shielding rooms. These rooms are fitted with large mu-metal sheets to allow for passive cancellation of background magnetic fields. Active shielding technology cannot uniformly cancel background magnetic fields. These issues can be remedied by combining the methods into a hybrid system. The design used is composed of panels that have an active layer of cancellation between two sheets of mu-metal. The panels form a cube and draw in magnetic fields perpendicular to the surface which can then be reduced using active shielding. This work is supported by the Department of Energy under Contract DE-SC0008107.

  1. Modular reactor head shielding system

    International Nuclear Information System (INIS)

    Jacobson, E. B.

    1985-01-01

    An improved modular reactor head shielding system is provided that includes a frame which is removably assembled on a reactor head such that no structural or mechanical alteration of the head is required. The shielding system also includes hanging assemblies to mount flexible shielding pads on trolleys which can be moved along the frame. The assemblies allow individual pivoting movement of the pads. The pivoting movement along with the movement allowed by the trolleys provides ease of access to any point on the reactor head. The assemblies also facilitate safe and efficient mounting of the pads directly to and from storage containers such that workers have additional shielding throughout virtually the entire installation and removal process. The flexible shielding pads are designed to interleave with one another when assembled around the reactor head for substantially improved containment of radiation leakage

  2. Mechanical shielded hot cell

    International Nuclear Information System (INIS)

    Higgy, H.R.; Abdel-Rassoul, A.A.

    1983-01-01

    A plan to erect a mechanical shielded hot cell in the process hall of the Radiochemical Laboratory at Inchas is described. The hot cell is designed for safe handling of spent fuel bundles, from the Inchas reactor, and for dismantling and cutting the fuel rods in preparation for subsequent treatment. The biological shielding allows for the safe handling of a total radioactivity level up to 10,000 MeV-Ci. The hot cell consists of an α-tight stainless-steel box, connected to a γ-shielded SAS, through an air-lock containing a movable carriage. The α-box is tightly connected with six dry-storage cavities for adequate storage of the spent fuel bundles. Both the α-box, with the dry-storage cavities, and the SAS are surrounded by 200-mm thick biological lead shielding. The α-box is equipped with two master-slave manipulators, a lead-glass window, a monorail crane and Padirac and Minirag systems. The SAS is equipped with a lead-glass window, tong manipulator, a shielded pit and a mechanism for the entry of the spent fuel bundle. The hot cell is served by adequate ventilation and monitoring systems. (author)

  3. Radiation shielding

    International Nuclear Information System (INIS)

    Aitken, D.

    1979-01-01

    Shields for equipment in which ionising radiation is associated with high electrical gradients, for example X-ray tubes and particle accelerators, incorporate a radiation-absorbing metal, as such or as a compound, and are electrically non-conducting and can be placed in the high electrical gradient region of the equipment. Substances disclosed include dispersions of lead, tungsten, uranium or oxides of these in acrylics polyesters, PVC, ABS, polyamides, PTFE, epoxy resins, glass or ceramics. The material used may constitute an evacuable enclosure of the equipment or may be an external shield thereof. (U.K.)

  4. Studies of ionizing radiation shielding effectiveness of silica-based commercial glasses used in Bangladeshi dwellings

    Science.gov (United States)

    Yasmin, Sabina; Barua, Bijoy Sonker; Khandaker, Mayeen Uddin; Chowdhury, Faruque-Uz-Zaman; Rashid, Md. Abdur; Bradley, David A.; Olatunji, Michael Adekunle; Kamal, Masud

    2018-06-01

    Following the rapid growing economy, the Bangladeshi dwellers are replacing their traditional (mud-, bamboo-, and wood-based) houses to modern multistoried buildings, where different types of glasses are being used as decorative as well as structural materials due to their various advantageous properties. In this study, we inquire the protective and dosimetric capability of commercial glasses for ionizing radiation. Four branded glass samples (PHP-Bangladesh, Osmania-Bangladesh, Nasir-Bangladesh, and Rider-China) of same thickness and color but different elemental weight fractions were analyzed for shielding and dosimetric properties. The chemical composition of the studied material was evaluated by EDX technique. A well-shielded HPGe γ-ray spectrometer combined with associated electronics was used to evaluate the attenuation coefficients of the studied materials for 59 keV, 661 keV, 1173 keV and 1332 keV photon energies. A number of shielding parameters- half value layer (HVL), radiation protection efficiency (RPE) and effective atomic number (Zeff) were also evaluated. The data were compared with the available literature (where applicable) to understand its shielding capability relative to the standard materials such as lead. Among the studied brands, Rider (China) shows relatively better indices to be used as ionizing radiation shielding material. The obtained, Zeff of the studied glass samples showed comparable values to the TLD-200 dosimeter, thus considered suitable for environmental radiation monitoring purposes.

  5. Computed tomography shielding methods: a literature review.

    Science.gov (United States)

    Curtis, Jessica Ryann

    2010-01-01

    To investigate available shielding methods in an effort to further awareness and understanding of existing preventive measures related to patient exposure in computed tomography (CT) scanning. Searches were conducted to locate literature discussing the effectiveness of commercially available shields. Literature containing information regarding breast, gonad, eye and thyroid shielding was identified. Because of rapidly advancing technology, the selection of articles was limited to those published within the past 5 years. The selected studies were examined using the following topics as guidelines: the effectiveness of the shield (percentage of dose reduction), the shield's effect on image quality, arguments for or against its use (including practicality) and overall recommendation for its use in clinical practice. Only a limited number of studies have been performed on the use of shields for the eyes, thyroid and gonads, but the evidence shows an overall benefit to their use. Breast shielding has been the most studied shielding method, with consistent agreement throughout the literature on its effectiveness at reducing radiation dose. The effect of shielding on image quality was not remarkable in a majority of studies. Although it is noted that more studies need to be conducted regarding the impact on image quality, the currently published literature stresses the importance of shielding in reducing dose. Commercially available shields for the breast, thyroid, eyes and gonads should be implemented in clinical practice. Further research is needed to ascertain the prevalence of shielding in the clinical setting.

  6. Radiation shielding cloth

    International Nuclear Information System (INIS)

    Ijiri, Yasuo; Fujinuma, Tadashi; Tamura, Shoji.

    1989-01-01

    Radiation shielding cloth having radiation shielding layers comprising a composition of inorganic powder of high specific gravity and rubber are excellentin flexibility and comfortable to put on. However, since they are heavy in the weight, operators are tired upon putting them for a long time. In view of the above, the radiation ray shielding layers are prepared by calendering sheets obtained by preliminary molding of the composition to set the variation of the thickness within a range of +15% to -0% of prescribed thickness. Since the composition of inorganic powder at high specific gravity and rubber used for radiation ray shielding comprises a great amount of inorganic powder at high specific gravity blended therein, it is generally poor in fabricability. Therefor, it is difficult to attain fine control for the sheet thickness by merely molding a composition block at once. Then, the composition is at first preliminarily molded into a sheet-like shape which is somewhat thickener than the final thickness and then finished by calendering, by which the thickness can be reduced in average as compared with conventional products while keeping the prescribed thickness and reducing the weight reduce by so much. (N.H.)

  7. Radiation shielding glass

    International Nuclear Information System (INIS)

    Kido, Kazuhiro; Ueda, Hajime.

    1997-01-01

    It was found that a glass composition comprising, as essential ingredients, SiO 2 , PbO, Gd 2 O 3 and alkali metal oxides can provide a shielding performance against electromagnetic waves, charged particles and neutrons. The present invention provides radiation shielding glass containing at least from 16 to 46wt% of SiO 2 , from 47 to 75wt% of PbO, from 1 to 10wt% of Gd 2 O 3 , from 0 to 3wt% of Li 2 O, from 0 to 7wt% of Na 2 O, from 0 to 7wt% of K 2 O provided that Li 2 O + Na 2 O + K 2 O is from 1 to 10wt%, B 2 O 3 is from 0 to 10wt%, CeO 2 is from 0 to 3wt%, As 2 O 3 is from 0 to 1wt% and Sb 2 O 3 is from 0 to 1wt%. Since the glass can shield electromagnetic waves, charged particles and neutrons simultaneously, radiation shielding windows can be designed and manufactured at a reduced thickness and by less constitutional numbers in a circumstance where they are present altogether. (T.M.)

  8. Buildup factors for multilayer shieldings in deterministic methods and their comparison with Monte Carlo

    International Nuclear Information System (INIS)

    Listjak, M.; Slavik, O.; Kubovcova, D.; Vermeersch, F.

    2008-01-01

    In general there are two ways how to calculate effective doses. The first way is by use of deterministic methods like point kernel method which is implemented in Visiplan or Microshield. These kind of calculations are very fast, but they are not very convenient for a complex geometry with shielding composed of more then one material in meaning of result precision. In spite of this that programs are sufficient for ALARA optimisation calculations. On other side there are Monte Carlo methods which can be used for calculations. This way of calculation is quite precise in comparison with reality but calculation time is usually very large. Deterministic method like programs have one disadvantage -usually there is option to choose buildup factor (BUF) only for one material in multilayer stratified slabs shielding calculation problems even if shielding is composed from different materials. In literature there are proposed different formulas for multilayer BUF approximation. Aim of this paper was to examine these different formulas and their comparison with MCNP calculations. At first ware compared results of Visiplan and Microshield. Simple geometry was modelled - point source behind single and double slab shielding. For Build-up calculations was chosen Geometric Progression method (feature of the newest version of Visiplan) because there are lower deviations in comparison with Taylor fitting. (authors)

  9. Buildup factors for multilayer shieldings in deterministic methods and their comparison with Monte Carlo

    International Nuclear Information System (INIS)

    Listjak, M.; Slavik, O.; Kubovcova, D.; Vermeersch, F.

    2009-01-01

    In general there are two ways how to calculate effective doses. The first way is by use of deterministic methods like point kernel method which is implemented in Visiplan or Microshield. These kind of calculations are very fast, but they are not very convenient for a complex geometry with shielding composed of more then one material in meaning of result precision. In spite of this that programs are sufficient for ALARA optimisation calculations. On other side there are Monte Carlo methods which can be used for calculations. This way of calculation is quite precise in comparison with reality but calculation time is usually very large. Deterministic method like programs have one disadvantage -usually there is option to choose buildup factor (BUF) only for one material in multilayer stratified slabs shielding calculation problems even if shielding is composed from different materials. In literature there are proposed different formulas for multilayer BUF approximation. Aim of this paper was to examine these different formulas and their comparison with MCNP calculations. At first ware compared results of Visiplan and Microshield. Simple geometry was modelled - point source behind single and double slab shielding. For Build-up calculations was chosen Geometric Progression method (feature of the newest version of Visiplan) because there are lower deviations in comparison with Taylor fitting. (authors)

  10. Shielding modification design of the N.S. Mutsu

    International Nuclear Information System (INIS)

    Yamaji, A.; Miyakoshi, J.; Kageyama, T.; Futamura, Y.

    1983-01-01

    Shielding modification design of the N.S. Mutsu was performed for reducing the radiation doses outside the primary and the secondary shields by providing shields for neutrons streaming through the air gap between the pressure vessel and the primary shield. This was accomplished by replacing parts of the shields and adding new shields in the upper and lower sections of both primary and secondary shields, and also replacing the thermal insulator in the gap. The shielding design calculations were made using one- and two-dimensional discrete ordinates codes and also a point kernel code. Special attention was paid to the calculations of, (1) the neutrons streaming through the gap between the pressure vessel and the primary shield, (2) the radiations transmitted through the radial shield of the core in the primary shield, (3) the radiations transmitted through the upper and lower sections of the secondary shield, and (4) the dose rate equivalent in the accommodation area. Their calculational accuracies were estimated by analyzing various experiments. To support the modification, a variety of experiments and tests were carried out, which were material tests, cooling test of the primary shield, mechanical strength test of the double bottom, trial fabrication tests of new shields, performance degradation test of heavy concrete and duct streaming experiment in the secondary shield. (author)

  11. LL/ILW: Post-Qualification of Old Waste through Non-Destructive Extraction of Barrels from Cement Shields - 13535

    International Nuclear Information System (INIS)

    Oehmigen, Steffen; Ambos, Frank

    2013-01-01

    Currently there is a large number of radioactive waste drums entombed in cement shields at German nuclear power plants. These concrete containers used in the past for the waste are not approved for the final repository. Compliance with current acceptance criteria of the final repository has to be proven by qualification measures on the waste. To meet these criteria, a new declaration and new packing is necessary. A simple non-destructive extraction of about 2000 drums from their concrete shields is not possible. So different methods were tested to find a way of non-destructive extraction of old waste drums from cement shields and therefore reduce the final repository volume and final repository costs by using a container accepted and approved for Konrad. The main objective was to build a mobile system to offer this service to nuclear plant stations. (authors)

  12. Radiation shielding curtain

    International Nuclear Information System (INIS)

    Winkler, N.T.

    1976-01-01

    A radiation shield is described in the form of a stranded curtain made up of bead-chains whose material and geometry are selected to produce a cross-sectional density that is the equivalent of 0.25 mm or more of lead and which curtain may be mounted on various radiological devices to shield against scattered radiation while offering a minimum of obstruction to the radiologist

  13. Method for limiting movement of a thermal shield for a nuclear reactor, and thermal shield displacement limiter therefor

    International Nuclear Information System (INIS)

    Meuschke, R.E.; Boyd, C.H.

    1989-01-01

    This patent describes a method of limiting the movement of a thermal shield of a nuclear reactor. It comprises: machining at least four (4) pockets in upper portions of a thermal shield circumferentially about a core barrel of a nuclear reactor to receive key-wave inserts; tapping bolt holes in the pockets of the thermal shield to receive bolts; positioning key-wave inserts into the pockets of the thermal shield to be bolted in place with the bolt holes; machining dowel holes at least partially through the positioned key-way inserts and the thermal shield to receive dowel pins; positioning dowel pins in the dowel holes in the key-way insert and thermal shield to tangentially restrain movement of the thermal shield relative to the core barrel; sliding limiter keys into the key-way inserts and bolting the limiter keys to the core barrel to tangentially restrain movement of the thermal shield relative and the core barrel while allowing radial and axial movement of the thermal shield relative to the core barrel; machining dowel holes through the limiter key and at least partially through the core barrel to receive dowel pins; positioning dowel pins in the dowel holes in the limiter key and core barrel to restrain tangential movement of the thermal shield relative to the core barrel of the nuclear reactor

  14. Penetration shielding applications of CYLSEC

    International Nuclear Information System (INIS)

    Dexheimer, D.T.; Hathaway, J.M.

    1985-01-01

    Evaluation of penetration and discontinuity shielding is necessary to meet 10CFR20 regulations for ensuring personnel exposures are as low as reasonably achievable (ALARA). Historically, those shielding evaluations have been done to some degree on all projects. However, many early plants used conservative methods due to lack of an economical computer code, resulting in costly penetration shielding programs. With the increased industry interest in cost effectively reducing personnel exposures to meet ALARA regulations and with the development of the CYLSEC gamma transport computer code at Bechtel, a comprehensive effort was initiated to reduce penetration and discontinuity shielding but still provide a prudent degree of protection for plant personnel from radiation streaming. This effort was more comprehensive than previous programs due to advances in shielding analysis technology and increased interest in controlling project costs while maintaining personnel exposures ALARA. Methodology and resulting cost savings are discussed

  15. Welding shield for coupling heaters

    Science.gov (United States)

    Menotti, James Louis

    2010-03-09

    Systems for coupling end portions of two elongated heater portions and methods of using such systems to treat a subsurface formation are described herein. A system may include a holding system configured to hold end portions of the two elongated heater portions so that the end portions are abutted together or located near each other; a shield for enclosing the end portions, and one or more inert gas inlets configured to provide at least one inert gas to flush the system with inert gas during welding of the end portions. The shield may be configured to inhibit oxidation during welding that joins the end portions together. The shield may include a hinged door that, when closed, is configured to at least partially isolate the interior of the shield from the atmosphere. The hinged door, when open, is configured to allow access to the interior of the shield.

  16. Shield calculations, optimization vs. paradigm

    International Nuclear Information System (INIS)

    Cornejo D, N.; Hernandez S, A.; Martinez G, A.

    2006-01-01

    Many shieldings have been designed under the criteria of 'Maximum dose rates of project'. It has created the paradigm of those 'low dose rates', for the one which not few specialists would consider unacceptable levels of dose rate superior to the units of μSv.h -1 , independently of the exposure times. At the present time numerous shieldings are being designed considering dose restrictions in real times of exposure. After these new shieldings, the dose rates could be notably superior to those after traditional shieldings, without it implies inadequate designs or constructive errors. In the work significant differences in levels of dose rates and thickness of shieldings estimated by both methods for some typical facilities. It was concluded that the use of real times of exposure is more adequate for the optimization of the Radiological Protection, although this method demands bigger care in its application. (Author)

  17. Several problems in accelerator shielding study

    International Nuclear Information System (INIS)

    Nakamura, Takashi; Hirayama, Hideo; Ban, Shuichi.

    1980-01-01

    Recently, the utilization of accelerators has increased rapidly, and the increase of accelerating energy and beam intensity is also remarkable. The studies on accelerator shielding have become important, because the amount of radiation emitted from accelerators increased, the regulation of the dose of environmental radiation was tightened, and the cost of constructing shielding rose. As the plans of constructing large accelerators have been made successively, the survey on the present state and the problems of the studies on accelerator shielding was carried out. Accelerators are classified into electron accelerators and proton accelerators in view of the studies on shielding. In order to start the studies on accelerator shielding, first, the preparation of the cross section data is indispensable. The cross sections for generating Bremsstrahlung, photonuclear reactions generating neutrons, generation of neutrons by hadrons, nuclear reaction of neutrons and generation of gamma-ray by hadrons are described. The generation of neutrons and gamma-ray as the problems of thick targets is explained. The shielding problems are complex and diversified, but in this paper, the studies on the shielding, by which basic data are obtainable, are taken up, such as beam damping and side wall shielding. As for residual radioactivity, main nuclides and the difference of residual radioactivity according to substances have been studied. (J.P.N.)

  18. Shielding concerns at a spallation source

    International Nuclear Information System (INIS)

    Russell, G.J.; Robinson, H.; Legate, G.L.; Woods, R.

    1989-01-01

    Neutrons produced by 800-MeV proton reactions at the Los Alamos Neutron Scattering Center spallation neutron source cause a variety of challenging shielding problems. We identify several characteristics distinctly different from reactor shielding and compute the dose attenuation through an infinite slab/shield composed of iron (100 cm) and borated polyethylene (15 cm). Our calculations show that (for an incident spallation spectrum characteristic of neutrons leaking from a tungsten target at 90/degree/) the dose through the shield is a complex mixture of neutrons and gamma rays. High-energy (> 20 MeV) neutron production from the target is ≅5% of the total, yet causes ≅68% of the dose at the shield surface. Primary low-energy (< 20 MeV) neutrons from the target contribute negligibly (≅0.5%) to the dose at the shield surface yet cause gamma rays, which contribute ≅31% to the total dose at the shield surface. Low-energy neutrons from spallation reactions behave similarly to neutrons with a fission spectrum distribution. 6 refs., 8 figs., 1 tab

  19. Highly heat removing radiation shielding material

    International Nuclear Information System (INIS)

    Asano, Norio; Hozumi, Masahiro.

    1990-01-01

    Organic materials, inorganic materials or metals having excellent radiation shielding performance are impregnated into expanded metal materials, such as Al, Cu or Mg, having high heat conductivity. Further, the porosity of the expanded metals and combination of the expanded metals and the materials to be impregnated are changed depending on the purpose. Further, a plurality of shielding materials are impregnated into the expanded metal of the same kind, to constitute shielding materials. In such shielding materials, impregnated materials provide shielding performance against radiation rays such as neutrons and gamma rays, the expanded metals provide heat removing performance respectively and they act as shielding materials having heat removing performance as a whole. Accordingly, problems of non-informity and discontinuity in the prior art can be dissolved be provide materials having flexibility in view of fabrication work. (T.M.)

  20. Gonadal Shielding in Radiography: A Best Practice?

    Science.gov (United States)

    Fauber, Terri L

    2016-11-01

    To investigate radiation dose to phantom testes with and without shielding. A male anthropomorphic pelvis phantom was imaged with thermoluminescent dosimeters (TLDs) placed in the right and left detector holes corresponding to the testes. Ten exposures were made of the pelvis with and without shielding. The exposed TLDs were packaged securely and mailed to the University of Wisconsin Calibration Laboratory for reading and analysis. A t test was calculated for the 2 exposure groups (no shield and shielded) and found to be significant, F = 8.306, P shield was used during pelvic imaging. Using a flat contact shield during imaging of the adult male pelvis significantly reduces radiation dose to the testes. Regardless of the contradictions in the literature on gonadal shielding, the routine practice of shielding adult male gonads during radiographic imaging of the pelvis is a best practice. © 2016 American Society of Radiologic Technologists.

  1. Estimating ISABELLE shielding requirements

    International Nuclear Information System (INIS)

    Stevens, A.J.; Thorndike, A.M.

    1976-01-01

    Estimates were made of the shielding thicknesses required at various points around the ISABELLE ring. Both hadron and muon requirements are considered. Radiation levels at the outside of the shield and at the BNL site boundary are kept at or below 1000 mrem per year and 5 mrem/year respectively. Muon requirements are based on the Wang formula for pion spectra, and the hadron requirements on the hadron cascade program CYLKAZ of Ranft. A muon shield thickness of 77 meters of sand is indicated outside the ring in one area, and hadron shields equivalent to from 2.7 to 5.6 meters in thickness of sand above the ring. The suggested safety allowance would increase these values to 86 meters and 4.0 to 7.2 meters respectively. There are many uncertainties in such estimates, but these last figures are considered to be rather conservative

  2. Selective shielding device for scintiphotography

    International Nuclear Information System (INIS)

    Harper, J.W.; Kay, T.D.

    1976-01-01

    A selective shielding device to be used in combination with a scintillation camera is described. The shielding device is a substantially oval-shaped configuration removably secured to the scintillation camera. As a result of this combination scanning of preselected areas of a patient can be rapidly and accurately performed without the requirement of mounting any type of shielding paraphernalia on the patient. 1 claim, 2 drawing figures

  3. Radiation shielding material

    International Nuclear Information System (INIS)

    Matsumoto, Akio; Isobe, Eiji.

    1976-01-01

    Purpose: To increase the shielding capacity of the radiation shielding material having an abundant flexibility. Constitution: A mat consisting of a lead or lead alloy fibrous material is covered with a cloth, and the two are made integral by sewing in a kilted fashion by using a yarn. Thereafter, the system is covered with a gas-tight film or sheet. The shielding material obtained in this way has, in addition to the above merits, advantages in that (1) it is free from restoration due to elasticity so that it can readily seal contaminants, (2) it can be used in a state consisting of a number of overlapped layers, (3) it fits the shoulder well and is readily portable and (4) it permits attachment of fasteners or the like. (Ikeda, J.)

  4. Refurbishment of industrial buildings

    International Nuclear Information System (INIS)

    Gustafsson, Stig-Inge

    2006-01-01

    When a building is subject for refurbishment, there is a golden opportunity to change its behavior as an energy system. This paper shows the importance of careful investigations of the processes, the climate shield and the heating systems already present in the building before measures are implemented in reality. A case study is presented dealing with a carpentry factory. The building is poorly insulated according to standards today, and initially it was assumed that a better thermal shield would be of vital importance in order to reach optimal conditions. Instead, it is shown that the main problem is the ordinary heating system. This uses steam from a wood chips boiler and the wood chips come from the manufacturing processes. These wood chips are, therefore, a very cheap fuel. The boiler had, during decades of use, slowly degraded into a poor state. Hence, aero-tempers using expensive electricity have been installed to remedy the situation. These use not only expensive kWh but also very expensive kW due to the electricity tariff. It is shown that electricity for heating purposes must be abandoned and further, that this could be achieved at a surprisingly small cost. By stopping a large waste of steam, it was possible to find resources, in the form of unspent money, for further mending the existing heating system. Not only economy but also environmental hazards in the form of CO 2 emissions urges us to abandon electricity and instead use heat from cheap biomass fired boilers. Such equipment saves environment at the same time it saves money

  5. Radiation shielding in dental radiography

    International Nuclear Information System (INIS)

    Stenstroem, B.; Rehnmark-Larsson, S.; Julin, P.; Richter, S.

    1983-01-01

    The protective effect in the thyroid region from different types of radiation shieldings at intraoral radiography has been studied as well as the reduction of the absorbed dose to the sternal and the gonadal regions. The shieldings tested were five different types of leaded aprons, of which three had an attached leaded collar and the other two were used in combination with separate soft leaded collars. Furthermore one of the soft leaded collars and an unflexible horizontal leaded shield were tested separately. Two dental x-ray machines of 60 and 65 kVp with rectangular and circular tube collimators were used. The exposure time corresponded to speed group E film. The absorbed doses were measured with two ionization chambers. No significant difference in the protective effect in the thyroid gland could be found between the different types of radiation shieldings. There was a dose reduction by approximately a factor of 2 to the thyroid region down to 0.08 mGy per full survey using parallelling technique, and below 0.001 mGy per single bitewing exposure. The shieldings reduced the thyroid dose using bisecting-angle technique by a factor of 5 down to 0.15 mGy per full survey (20 exposures). In the sternal region the combinations of apron and collar reduced the absorbed dose from a full survey to below 2 μGy compared with 18 μGy (parallelling) and 31 μGy (biscting-angle) without any shielding. With the horizontal leaded shield a reduction by a factor of 6 was obtained but no significant sternal dose reduction could be detected from the soft collar alone. The gonadal dose could be reduced by a factor of 10 with the horizontal leaded shield, parallelling technique and circular collimator. Using leaded aprons the gonadal dose was approximately one per cent of the dose without any shielding, i.e. below 0.01 μGy per single intraoral exposure. (Authors)

  6. Shielding effectiveness of superconductive particles in plastics

    International Nuclear Information System (INIS)

    Pienkowski, T.; Kincaid, J.; Lanagan, M.T.; Poeppel, R.B.; Dusek, J.T.; Shi, D.; Goretta, K.C.

    1988-09-01

    The ability to cool superconductors with liquid nitrogen instead of liquid helium has opened the door to a wide range of research. The well known Meissner effect, which states superconductors are perfectly diamagnetic, suggests shielding applications. One of the drawbacks to the new ceramic superconductors is the brittleness of the finished material. Because of this drawback, any application which required flexibility (e.g., wire and cable) would be impractical. Therefore, this paper presents the results of a preliminary investigation into the shielding effectiveness of YBa 2 Cu 3 O/sub 7-x/ both as a composite and as a monolithic material. Shielding effectiveness was measured using two separate test methods. One tested the magnetic (near field) shielding, and the other tested the electromagnetic (far field) shielding. No shielding was seen in the near field measurements on the composite samples, and only one heavily loaded sample showed some shielding in the far field. The monolithic samples showed a large amount of magnetic shielding. 5 refs., 5 figs

  7. Shielding and grounding in large detectors

    International Nuclear Information System (INIS)

    Radeka, V.

    1998-09-01

    Prevention of electromagnetic interference (EMI), or ''noise pickup,'' is an important design aspect in large detectors in accelerator environments. Shielding effectiveness as a function of shield thickness and conductivity vs the type and frequency of the interference field is described. Noise induced in transmission lines by ground loop driven currents in the shield is evaluated and the importance of low shield resistance is emphasized. Some measures for prevention of ground loops and isolation of detector-readout systems are discussed

  8. Tax Shield, Insolvenz und Zinsschranke

    OpenAIRE

    Arnold, Sven; Lahmann, Alexander; Schwetzler, Bernhard

    2010-01-01

    Dieser Beitrag analysiert den Wertbeitrag fremdfinanzierungsbedingter Steuervorteile (Tax Shield) unter realistischen Bedingungen (keine Negativsteuer; mögliche Insolvenz) für unterschiedliche Finanzierungspolitiken. Zusätzlich wird der Effekt der sogenannten Zinsschranke auf den Wert des Tax Shield ermittelt. Die Bewertung des Tax Shield mit und ohne Zinsschranke findet im einperiodigen Fall auf der Basis von Optionspreismodellen und im mehrperiodigen Fall auf der Basis von Monte Carlo Simul...

  9. Measuring space radiation shielding effectiveness

    OpenAIRE

    Bahadori Amir; Semones Edward; Ewert Michael; Broyan James; Walker Steven

    2017-01-01

    Passive radiation shielding is one strategy to mitigate the problem of space radiation exposure. While space vehicles are constructed largely of aluminum, polyethylene has been demonstrated to have superior shielding characteristics for both galactic cosmic rays and solar particle events due to the high hydrogen content. A method to calculate the shielding effectiveness of a material relative to reference material from Bragg peak measurements performed using energetic heavy charged particles ...

  10. Gonad shielding in computerized tomography

    International Nuclear Information System (INIS)

    Rockstroh, G.

    1984-01-01

    The reduction of gonadal dose by shielding of the gonads was investigated for a Somatom 2 using an anthropomorphic phantom. For small distances from the slice examined the gonadal dose results from intracorporal secondary radiation and is only insignificantly reduced by shielding. For greater distances shielding is relatively more effective, the gonadal dose however is small because of the approximately exponential decay. Shielding of the gonads therefore does not seem adequate for the reduction of gonadal dose. From dose measurements in cylinder phantoms of several diameters it appears that no different results would be obtained for children and young adults. An effective reduction of gonadal dose is only possible with lead capsules for males. (author)

  11. Dosimetry and shielding

    International Nuclear Information System (INIS)

    Farinelli, U.

    1977-01-01

    Today, reactor dosimetry and shielding have wide areas of overlap as concerns both problems and methods. Increased interchange of results and know-how would benefit both. The areas of common interest include calculational methods, sensitivity studies, theoretical and experimental benchmarks, cross sections and other nuclear data, multigroup libraries and procedures for their adjustment, experimental techniques and damage functions. This paper reviews the state-of-the-art and the latest development in each of these areas as far as shielding is concerned, and suggests a number of interactions that could be profitable for reactor dosimetry. Among them, re-evaluation of the potentialities of calculational methods (in view of the recent developments) in predicting radiation environments of interest; the application of sensitivity analysis to dosimetry problems; a common effort in the field of theoretical benchmarks; the use of the shielding one-material propagation experiments as reference spectra for detector cross sections; common standardization of the detector nuclear data used in both fields; the setting up of a common (or compatible) multigroup structure and library applicable to shielding, dosimetry and core physics; the exchange of information and experience in the fields of cross section errors, correlations and adjustment; and the intercomparison of experimental techniques

  12. In-Plane Shielding for CT: Effect of Off-Centering, Automatic Exposure Control and Shield-to-Surface Distance

    Energy Technology Data Exchange (ETDEWEB)

    Kalra, Mannudeep K.; Dang, Pragya; Singh, Sarabjeet; Saini, Sanjay; Shepard, Jo Anne O. [Massachusetts General Hospital, Boston (United States)

    2009-04-15

    To assess effects of off-centering, automatic exposure control, and padding on attenuation values, noise, and radiation dose when using in-plane bismuth-based shields for CT scanning. A 30 cm anthropomorphic chest phantom was scanned on a 64-multidetector CT, with the center of the phantom aligned to the gantry isocenter. Scanning was repeated after placing a bismuth breast shield on the anterior surface with no gap and with 1, 2, and 6 cm of padding between the shield and the phantom surface. The 'shielded' phantom was also scanned with combined modulation and off-centering of the phantom at 2 cm, 4 cm and 6 cm below the gantry isocenter. CT numbers, noise, and surface radiation dose were measured. The data were analyzed using an analysis of variance. The in-plane shield was not associated with any significant increment for the surface dose or CT dose index volume, which was achieved by comparing the radiation dose measured by combined modulation technique to the fixed mAs (p > 0.05). Irrespective of the gap or the surface CT numbers, surface noise increased to a larger extent compared to Hounsfield unit (HU) (0-6 cm, 26-55%) and noise (0-6 cm, 30-40%) in the center. With off-centering, in-plane shielding devices are associated with less dose savings, although dose reduction was still higher than in the absence of shielding (0 cm off-center, 90% dose reduction; 2 cm, 61%) (p < 0.0001). Streak artifacts were noted at 0 cm and 1 cm gaps but not at 2 cm and 6 cm gaps of shielding to the surface distances. In-plane shields are associated with greater image noise, artificially increased attenuation values, and streak artifacts. However, shields reduce radiation dose regardless of the extent of off-centering. Automatic exposure control did not increase radiation dose when using a shield.

  13. An experimental study of the shielding characteristics of the dwelling house building materials against gamma radiations in the Central Region of Syria

    International Nuclear Information System (INIS)

    Albarhoum, M.; Soufan, A.H.; Mustafa, H.

    2011-01-01

    Highlights: → We measure shielding properties of dwelling houses in the central region of Syria. → The concrete used for ceiling construction is good for shielding from gamma radiations. → Fairly high linear attenuation coefficients are obtained (from 0.173 to 0.198 cm -1 ). → Blocks used for house walls are not effective against gamma radiations. → Blocks efficiency can be improved by filling their holes with a cement paste. - Abstract: The shielding properties of the concrete and blocks used for the construction of dwelling houses in the Central Region of Syria (CRS) were measured and studied. The concrete used for the ceiling construction was found to have optimum shielding properties with 0.182 cm -1 (or equivalently 0.0859 cm 2 g -1 ) for the linear (mass) attenuation coefficient [L(M)AC]. In addition gamma radiation is attenuated by 73.221% on average, while the blocks used for the walls have smaller LACs (0.082 cm -1 for the bare blocks, and 0.118 cm -1 for the coated ones). Although the LACs for the blocks are smaller than those for the concrete their shielding properties are good to protect from the gamma radiations coming from radioactive or nuclear accidents (78.630% attenuation), even Chernobyl - like disasters, because of their big width (10-12 cm). The LACs were measured by an ionization chamber and simple theoretical calculations have been made to predict the concrete LACs. The calculations showed an average LAC for the six samples equal to 0.1664 cm -1 with 8.47% error with respect to the experimental values. The average LAC for the concrete used for ceiling construction in the CRS was found to be comparable or even better than the average of some international values for the reactor shielding concretes, which are about 0.163 cm -1 .

  14. Impact of a flattening filter free linear accelerator on structural shielding design

    International Nuclear Information System (INIS)

    Jank, Julia; Kragl, Gabriele; Georg, Dietmar; Medical University of Vienna

    2014-01-01

    accommodated linac operates with or without a flattening filter. The lower consumption of shielding space and material for new treatment vaults housing a FFF machine may reduce building costs, whereas for existing vaults one might benefit in terms of increased weekly workload. Also a more frequent use of monitor unit intense treatment techniques as well as aiming at reduced occupational exposure for staff is conceivable. (orig.)

  15. Impact of a flattening filter free linear accelerator on structural shielding design.

    Science.gov (United States)

    Jank, Julia; Kragl, Gabriele; Georg, Dietmar

    2014-03-01

    lower consumption of shielding space and material for new treatment vaults housing a FFF machine may reduce building costs, whereas for existing vaults one might benefit in terms of increased weekly workload. Also a more frequent use of monitor unit intense treatment techniques as well as aiming at reduced occupational exposure for staff is conceivable. Copyright © 2013. Published by Elsevier GmbH.

  16. Impact of a flattening filter free linear accelerator on structural shielding design

    Energy Technology Data Exchange (ETDEWEB)

    Jank, Julia [Klinikum - Klagenfurt am Woerthersee (Austria). Inst. fuer Strahlentherapie und Radioonkologie; Kragl, Gabriele [Medical University of Vienna/AKH Vienna (Austria). Div. Medical Radiation Physics; Georg, Dietmar [Medical University of Vienna/AKH Vienna (Austria). Div. Medical Radiation Physics; Medical University of Vienna (Austria). Christian Doppler Lab. for Medical Radiation Research for Radiation Oncology

    2014-04-01

    accommodated linac operates with or without a flattening filter. The lower consumption of shielding space and material for new treatment vaults housing a FFF machine may reduce building costs, whereas for existing vaults one might benefit in terms of increased weekly workload. Also a more frequent use of monitor unit intense treatment techniques as well as aiming at reduced occupational exposure for staff is conceivable. (orig.)

  17. Critique of PEP interaction building design

    International Nuclear Information System (INIS)

    1988-01-01

    This note reviews the design of the interaction region 2, 8 and 12 buildings from the viewpoint of shielding adequacy, available space and amenities provided. Conclusions are drawn that the present design is not the best way to satisfy the requirements. An alternative design is proposed which, it is claimed, is a better solution to the problems without an increase in cost

  18. Improving the shielding effectiveness of a board-level shield by bonding it with the waveguide-below-cutoff principle

    OpenAIRE

    Degraeve, Andy; Pissoort, Davy; Armstrong, Keith

    2015-01-01

    This paper discusses the shielding performance or shielding effectiveness of a board-level shield in function of its bonding method. Improved shielding performance at board-level in order to harden integrated circuits against unintentional and intentional electromagnetic interference, and this under harsh environmental conditions, is getting more and more important to achieve the desired levels of functional performance and operational reliability despite an ever more aggressive electromagnet...

  19. Radiation protection/shield design

    International Nuclear Information System (INIS)

    Disney, R.K.

    1977-01-01

    Radiation protection/shielding design of a nuclear facility requires a coordinated effort of many engineering disciplines to meet the requirements imposed by regulations. In the following discussion, the system approach to Clinch River Breeder Reactor Plant (CRBRP) radiation protection will be described, and the program developed to implement this approach will be defined. In addition, the principal shielding design problems of LMFBR nuclear reactor systems will be discussed in realtion to LWR nuclear reactor system shielding designs. The methodology used to analyze these problems in the U.S. LMFBR program, the resultant design solutions, and the experimental verification of these designs and/or methods will be discussed. (orig.) [de

  20. Shielding design of ITER pressure suppression system

    International Nuclear Information System (INIS)

    Yamauchi, Michinori; Sato, Satoshi; Nishitani, Takeo; Kawasaki, Hiromitsu

    2006-01-01

    The duct shield from streaming D-T neutrons has been designed for the ITER pressure suppression system. Streaming calculations are performed with the DUCT-III code for the region from the inlet of the pressure relief line to the rupture disk. Next, the neutron permeation through the shield is studied by Monte Carlo calculations with the MCNP code. It is found that 0.15 m thick iron shield is enough to suppress the permeating component from the outside. In addition, it is suggested that the volume of the shield can be reduced by about 30% if the optimized iron shield structure having localized thickness across intense permeation paths is employed to shield the pressure suppression line. (T.I.)

  1. Superconducting magnetic shields production. Realisation d'ecrans magnetiques supraconducteurs

    Energy Technology Data Exchange (ETDEWEB)

    Lainee, F; Kormann, R [Thomson-CSF, Domaine de Corbeville, 91 - Orsay (FR); Lainee, F [Ecole des Mines de Paris, 91 - Evry (FR)

    1992-02-01

    Low fields and low frequency shielding properties of YBCO magnetic shields are measured at 77 K. They compare favourably with shielding properties of mumetal shields. Therefore high-T{sub c} superconducting magnetic shields can already be used to shield small volumes. The case of magnetic shields for large volumes is also discussed. 3 refs; 6 figs; 4 tabs.

  2. Problems of the power plant shield optimization

    International Nuclear Information System (INIS)

    Abagyan, A.A.; Dubinin, A.A.; Zhuravlev, V.I.; Kurachenko, Yu.A.; Petrov, Eh.E.

    1981-01-01

    General approaches to the solution of problems on the nuclear power plant radiation shield optimization are considered. The requirements to the shield parameters are formulated in a form of restrictions on a number of functionals, determined by the solution of γ quantum and neutron transport equations or dimensional and weight characteristics of shield components. Functional determined by weight-dimensional parameters (shield cost, mass and thickness) and functionals, determined by radiation fields (equivalent dose rate, produced by neutrons and γ quanta, activation functional, radiation functional, heat flux, integral heat flux in a particular part of the shield volume, total energy flux through a particular shield surface are considered. The following methods of numerical solution of simplified optimization problems are discussed: semiempirical methods using radiation transport physical leaks, numerical solution of approximate transport equations, numerical solution of transport equations for the simplest configurations making possible to decrease essentially a number of variables in the problem. The conclusion is drawn that the attained level of investigations on the problem of nuclear power plant shield optimization gives the possibility to pass on at present to the solution of problems with a more detailed account of the real shield operating conditions (shield temperature field account, its strength and other characteristics) [ru

  3. Neutron shielding for a 252 Cf source

    International Nuclear Information System (INIS)

    Vega C, H.R.; Manzanares A, E.; Hernandez D, V.M.; Eduardo Gallego, Alfredo Lorente

    2006-01-01

    To determine the neutron shielding features of water-extended polyester a Monte Carlo study was carried out. Materials with low atomic number are predominantly used for neutron shielding because these materials effectively attenuate neutrons, mainly through inelastic collisions and absorption reactions. During the selection of materials to design a neutron shield, prompt gamma production as well as radionuclide production induced by neutron activation must be considered. In this investigation the Monte Carlo method was used to evaluate the performance of a water-extended polyester shield designed for the transportation, storage, and use of a 252 Cf isotopic neutron source. During calculations a detailed model for the 252 Cf and the shield was utilized. To compare the shielding features of water extended polyester, the calculations were also made for the bare 252 Cf in vacuum, air and the shield filled with water. For all cases the calculated neutron spectra was utilized to determine the ambient equivalent neutron dose at four sites around the shielding. In the case of water extended polyester and water shielding the calculations were extended to include the prompt gamma rays produced during neutron interactions, with this information the Kerma in air was calculated at the same locations where the ambient equivalent neutron dose was determined. (Author)

  4. Radiation shielding application of lead glass

    International Nuclear Information System (INIS)

    Nathuram, R.

    2017-01-01

    Nuclear medicine and radiotherapy centers equipped with high intensity X-ray or teletherapy sources use lead glasses as viewing windows to protect personal from radiation exposure. Lead is the main component of glass which is responsible for shielding against photons. It is therefore essential to check the shielding efficiency before they are put in use. This can be done by studying photon transmission through the lead glasses. The study of photon transmission in shielding materials has been an important subject in medical physics and is potential useful in the development of radiation shielding materials

  5. Characterization of Radiation Fields for Assessing Concrete Degradation in Biological Shields of NPPs

    Science.gov (United States)

    Remec, Igor; Rosseel, Thomas M.; Field, Kevin G.; Pape, Yann Le

    2017-09-01

    Life extensions of nuclear power plants (NPPs) to 60 years of operation and the possibility of subsequent license renewal to 80 years have renewed interest in long-term material degradation in NPPs. Large irreplaceable sections of most nuclear generating stations are constructed from concrete, including safety-related structures such as biological shields and containment buildings; therefore, concrete degradation is being considered with particular focus on radiation-induced effects. Based on the projected neutron fluence values (E > 0.1 MeV) in the concrete biological shields of the US pressurized water reactor fleet and the currently available data on radiation effects on concrete, some decrease in mechanical properties of concrete cannot be ruled out during extended operation beyond 60 years. An expansion of the irradiated concrete database is desirable to ensure reliable risk assessment for extended operation of nuclear power plants.

  6. Core test reactor shield cooling system analysis

    International Nuclear Information System (INIS)

    Larson, E.M.; Elliott, R.D.

    1971-01-01

    System requirements for cooling the shield within the vacuum vessel for the core test reactor are analyzed. The total heat to be removed by the coolant system is less than 22,700 Btu/hr, with an additional 4600 Btu/hr to be removed by the 2-inch thick steel plate below the shield. The maximum temperature of the concrete in the shield can be kept below 200 0 F if the shield plug walls are kept below 160 0 F. The walls of the two ''donut'' shaped shield segments, which are cooled by the water from the shield and vessel cooling system, should operate below 95 0 F. The walls of the center plug, which are cooled with nitrogen, should operate below 100 0 F. (U.S.)

  7. Practical radiation shielding for biomedical research

    International Nuclear Information System (INIS)

    Klein, R.C.; Reginatto, M.; Party, E.; Gershey, E.L.

    1990-01-01

    This paper reports on calculations which exist for estimating shielding required for radioactivity; however, they are often not applicable for the radionuclides and activities common in biomedical research. A variety of commercially available Lucite shields are being marketed to the biomedical community. Their advertisements may lead laboratory workers to expect better radiation protection than these shields can provide or to assume erroneously that very weak beta emitters require extensive shielding. The authors have conducted a series of shielding experiments designed to simulate exposures from the amounts of 32 P, 51 Cr and 125 I typically used in biomedical laboratories. For most routine work, ≥0.64 cm of Lucite covered with various thicknesses of lead will reduce whole-body occupational exposure rates of < 1mR/hr at the point of contact

  8. BRH Gonad Shielding Program: where it has led

    International Nuclear Information System (INIS)

    Arcarese, J.S.

    1975-01-01

    Some topics discussed are: Bureau of Radiological Health guidelines; types of gonad shields; specific area shielding; gonad shielding guidelines; and publication of pamphlet on types of shields and circumstances under which they should be used

  9. Penetration portion shielding structure

    International Nuclear Information System (INIS)

    Hayashi, Katsumi; Narita, Hitoshi; Handa, Hiroyuki; Takeuchi, Jun; Tozuka, Fumio.

    1994-01-01

    Openings of a plurality of shieldings for penetration members are aligned to each other, and penetration members are inserted from the openings. Then, the openings of the plurality of shielding members are slightly displaced with each other to make the penetration portions into a helical configuration, so that leakage of radiation is reduced. Upon removal of the members, reverse operation is conducted. When a flowable shielding material is used, the penetration portions are constituted with two plates having previously formed openings and pipes for connecting the openings with each other and a vessel covering the entire of them. After passing the penetration members such as a cable, the relative position of the two plates is changed by twisting, to form a helical configuration which reduces radiation leakage. Since they are bent into the helical configuration, shielding performance is extremely improved compared with a case that radiation leakage is caused from an opening of a straight pipe. In addition, since they can be returned to straight pipes, attachment, detachment and maintenance can be conducted easily. (N.H.)

  10. The effect of some organic and non-organic additions on the shielding and mechanical properties of radiation shielding concrete

    International Nuclear Information System (INIS)

    Kharita, M. H.; Yousef, S.; Al-Nassar, M.

    2011-04-01

    Few studies on the effect of some additives on the shielding properties of concrete have been carried out in this research. These studies included the effect of carbon powder, boron compounds, and waste polyethylene. The effect of water to cement ratio has been studied too. The research results showed that carbon powder and some boron compounds could be used to improve shielding concrete properties, and the possibility to add waste polyethylene in shielding concrete without effects on shielding properties. No significant effect for water to cement ratio on shielding properties of concrete. (author)

  11. Technical products for radiation shielding. Shield assembled from lead blocks for radiation protection. General technical requirements

    International Nuclear Information System (INIS)

    1981-01-01

    The object of this standard description is the general technological requirements of 50 and 100 mm thick radiation protection shields assembled from lead blocks. The standard contains the definitions, types, parameters and dimensions of shields, their technical and acceptance criteria with testing methods, tagging, packaging, transportation and storage requirements, producer's liability. Some illustrated assembling examples, preferred parameters and dosimetry methods for shield inspection are given. (R.P.)

  12. Shield support frame. Schildausbaugestell

    Energy Technology Data Exchange (ETDEWEB)

    Plaga, K.

    1981-09-17

    A powered shield support frame for coal sheds is described comprising of two bottom sliding shoes, a large area gob shield and a larg area roof assembly, all joined movable together. The sliding shoes and the gob shield are joined by a lemniscate guide. Two hydraulic props are arranged at the face-side at one third of the length of the sliding shoes and at the goaf-side at one third of the length of the roof assembly. A nearly horizontal lying pushing prop unit joins the bottom wall sliding shoes to the goaf-side lemniscate guide. This assembly can be applied to seams with a thickness down to 45 cm. (OGR).

  13. Reactor head shielding apparatus

    International Nuclear Information System (INIS)

    Schukei, G.E.; Roebelen, G.J.

    1992-01-01

    This patent describes a nuclear reactor head shielding apparatus for mounting on spaced reactor head lifting members radially inwardly of the head bolts. It comprises a frame of sections for mounting on the lifting members and extending around the top central area of the head, mounting means for so mounting the frame sections, including downwardly projecting members on the frame sections and complementary upwardly open recessed members for fastening to the lifting members for receiving the downwardly projecting members when the frame sections are lowered thereto with lead shielding supported thereby on means for hanging lead shielding on the frame to minimize radiation exposure or personnel working with the head bolts or in the vicinity thereof

  14. Thermal design of top shield for PFBR

    International Nuclear Information System (INIS)

    Gajapathy, R.; Jalaludeen, S.; Selvaraj, A.; Bhoje, S.B.

    1988-01-01

    India's Liquid Metal Cooled Fast Breeder Reactor programme started with the construction of loop type 13MW(e) Fast Breeder Test Reactor (FBTR) which attained criticality in October 1985. With the experience of FBTR, the design work on pool type 500 MW(e) Prototype Fast Breeder Reactor (PFBR) which will be a forerunner for future commercial fast breeder reactors, has been started. The Top Shield forms the cover for the main vessel which contains the primary circuit. Argon cover gas separates the Top Shield from the free level of hot sodium pool (803K). The Top Shield which is of box type construction consists of control plug, two rotatable plugs and roof slab, assembled together, which provide biological shielding, thermal shielding and leak tight containment at the top of the main vessel. Heat is transferred from the sodium pool to the Top Shield through argon cover gas and through components supported by it and dipped in the sodium pool. The Top Shield should be maintained at the desired operating temperature by incorporating a cooling system inside it. Insulation may be provided below the bottom plate to reduce the heat load to the cooling system, if required. The thermal design of Top Shield consists of estimation of heat transfer to the Top Shield, selection of operating temperature, assessment of insulation requirement, design of cooling system and evaluation of transient temperature changes

  15. Computer code for shielding calculations of x-rays rooms

    International Nuclear Information System (INIS)

    Affonso, R.R.W.; Borges, D. da S.; Lava, D.D.; Moreira, M. de L.; Guimarães, A.C.F.

    2015-01-01

    The building an effective barrier against ionizing radiation present in radiographic rooms requires consideration of many variables. The methodology used for thickness specification of primary and secondary, barrier of a traditional radiographic room, considers the following factors: Use Factor, Occupational Factor, distance between the source and the wall, Workload, Kerma in the air and distance between the patient and the source. With these data it was possible to develop a computer code, which aims to identify and use variables in functions obtained through graphics regressions provided by NCRP-147 (Structural Shielding Design for Medical X-Ray Imaging Facilities) report, for shielding calculation of room walls, and the walls of the dark room and adjacent areas. With the implemented methodology, it was made a code validation by comparison of results with a study case provided by the report. The obtained values for thickness comprise different materials such as concrete, lead and glass. After validation it was made a case study of an arbitrary radiographic room.The development of the code resulted in a user-friendly tool for planning radiographic rooms to comply with the limits established by CNEN-NN-3:01 published in september/2011. (authors)

  16. Radiation Attenuation and Stability of ClearView Radiation Shielding TM-A Transparent Liquid High Radiation Shield.

    Science.gov (United States)

    Bakshi, Jayeesh

    2018-04-01

    Radiation exposure is a limiting factor to work in sensitive environments seen in nuclear power and test reactors, medical isotope production facilities, spent fuel handling, etc. The established choice for high radiation shielding is lead (Pb), which is toxic, heavy, and abidance by RoHS. Concrete, leaded (Pb) bricks are used as construction materials in nuclear facilities, vaults, and hot cells for radioisotope production. Existing transparent shielding such as leaded glass provides minimal shielding attenuation in radiotherapy procedures, which in some cases is not sufficient. To make working in radioactive environments more practicable while resolving the lead (Pb) issue, a transparent, lightweight, liquid, and lead-free high radiation shield-ClearView Radiation Shielding-(Radium Incorporated, 463 Dinwiddie Ave, Waynesboro, VA). was developed. This paper presents the motivation for developing ClearView, characterization of certain aspects of its use and performance, and its specific attenuation testing. Gamma attenuation testing was done using a 1.11 × 10 Bq Co source and ANSI/HPS-N 13.11 standard. Transparency with increasing thickness, time stability of liquid state, measurements of physical properties, and performance in freezing temperatures are reported. This paper also presents a comparison of ClearView with existing radiation shields. Excerpts from LaSalle nuclear power plant are included, giving additional validation. Results demonstrated and strengthened the expected performance of ClearView as a radiation shield. Due to the proprietary nature of the work, some information is withheld.

  17. Evaluation of Neutron shielding efficiency of Metal hydrides

    Energy Technology Data Exchange (ETDEWEB)

    Jeon, Sang Hwan; Chae, San; Kim, Yong Soo [Hanyang University, Seoul (Korea, Republic of)

    2012-05-15

    Neutron shielding is achieved of interaction with material by moderation and absorption. Material that contains large amounts hydrogen atoms which are almost same neutron atomic weight is suited for fast neutron shielding material. Therefore, polymers containing high density hydrogen atom are being used for fast neutron shielding. On the other hand, composite materials containing high thermal neutron absorption cross section atom (Li, B, etc) are being used for thermal neutron shielding. However, these materials have low fast neutron absorption cross section. Therefore, these materials are not suited for fast neutron shielding. Hydrogen which has outstanding neutron energy reduction ability has very low thermal neutron absorption cross section, almost cannot be used for thermal neutron shielding. In this case, a large atomic number material (Pb, U, etc.) has been used. Thus, metal hydrides are considered as complement to concrete shielding material. Because metal hydrides contain high hydrogen density and elements with high atomic number. In this research neutron shielding performance and characteristic of nuclear about metal hydrides ((TiH{sub 2}, ZrH{sub 2}, HfH{sub 2}) is evaluated by experiment and MCNPX using {sup 252}Cf neutron source as purpose development shielding material to developed shielding material

  18. Radiation dose reduction by water shield

    International Nuclear Information System (INIS)

    Zeb, J.; Arshed, W.; Ahmad, S.S.

    2007-06-01

    This report is an operational manual of shielding software W-Shielder, developed at Health Physics Division (HPD), Pakistan Institute of Nuclear Science and Technology (PINSTECH), Pakistan Atomic Energy Commission. The software estimates shielding thickness for photons having their energy in the range 0.5 to 10 MeV. To compute the shield thickness, self absorption in the source has been neglected and the source has been assumed as a point source. Water is used as a shielding material in this software. The software is helpful in estimating the water thickness for safe handling, storage of gamma emitting radionuclide. (author)

  19. Final report of Shield System Trade Study. Volume II. WANL support activities for shielding trade study

    International Nuclear Information System (INIS)

    1970-07-01

    Based on the trades made within this study BATH (mixture of B 4 C, aluminum and TiH 1 . 8 ) was selected as the internal shield material. Borated titanium hydride can also meet the criteria with a competitive weight but was rejected because of schedular constraints. A baseline internal shield design was accomplished. This design resulted in a single internal shield weighing about 3300 lb for both manned and unmanned missions. WANL checks on ANSC calculations are generally in agreement, but with some difference in the prediction of the effectiveness of the Boral liner. All of the alternate NSS concepts in the system weight reduction program were rejected. While some did save shield weight, they complicated the NSS design to an unacceptable degree. Studies were made of the feasibility of manual maintenance of NSS components outside of the pressure vessel. The requirements of the NSS components located forward of the internal shield were considered from a thermal and radiation damage standpoint. (auth)

  20. Radiation shielding for neutron guides

    International Nuclear Information System (INIS)

    Ersez, T.; Braoudakis, G.; Osborn, J.C.

    2005-01-01

    Full text: Models of the neutron guide shielding for the out of bunker guides on the thermal and cold neutron beam lines of the OPAL Reactor (ANSTO) were constructed using the Monte Carlo code MCNP 4B. The neutrons that were not reflected inside the guides but were absorbed by the supermirror (SM) layers were noted to be a significant source of gammas. Gammas also arise from neutrons absorbed by the B, Si, Na and K contained in the glass. The proposed shielding design has produced compact shielding assemblies. These arrangements are consistent with safety requirements, floor load limits, and cost constraints. To verify the design a prototype was assembled consisting of 120mm thick Pb(96%)Sb(4%) walls resting on a concrete block. There was good agreement between experimental measurements and calculated dose rates for bulk shield regions. (authors)

  1. Shielding calculations. Optimization vs. Paradigms

    International Nuclear Information System (INIS)

    Cornejo Diaz, Nestor; Hernandez Saiz, Alejandro; Martinez Gonzalez, Alina

    2005-01-01

    Many radiation shielding barriers in Cuba have been designed according to the criterion of Maxi-mum Projected Dose Rates. This fact has created the paradigm of low dose rates. Because of this, dose rate levels greater than units of Sv.h-1 would be considered unacceptable by many specialists, regardless of the real exposure times. Nowadays many shielding barriers are being designed using dose constraints in real exposure times. Behind the new barriers, dose rates could be notably greater than those behind the traditional ones, and it does not imply inadequate designs or constructive errors. In this work were obtained significant differences in dose rate levels and shield-ing thicknesses calculated by both methods for some typical installations. The work concludes that real exposure time approach is more adequate in order to optimise Radiation Protection, although this method should be carefully applied

  2. Radiation shielding for neutron guides

    International Nuclear Information System (INIS)

    Ersez, T.; Braoudakis, G.; Osborn, J.C.

    2006-01-01

    Models of the neutron guide shielding for the out of bunker guides on the thermal and cold neutron beam lines of the OPAL Reactor (ANSTO) were constructed using the Monte Carlo code MCNP 4B. The neutrons that were not reflected inside the guides but were absorbed by the supermirror (SM) layers were noted to be a significant source of gammas. Gammas also arise from neutrons absorbed by the B, Si, Na and K contained in the glass. The proposed shielding design has produced compact shielding assemblies. These arrangements are consistent with safety requirements, floor load limits, and cost constraints. To verify the design a prototype was assembled consisting of 120 mm thick Pb(96%)Sb(4%) walls resting on a concrete block. There was good agreement between experimental measurements and calculated dose rates for bulk shield regions

  3. The use of nipple shields: A review

    Directory of Open Access Journals (Sweden)

    Selina Chow

    2016-11-01

    Full Text Available A nipple shield is a breastfeeding aid with a nipple-shaped shield that is positioned over the nipple and areola prior to nursing. Nipple shields are usually recommended to mothers with flat nipples or in cases in which there is a failure of the baby to effectively latch onto the breast within the first two days postpartum. The use of nipple shields is a controversial topic in the field of lactation. Its use has been an issue in the clinical literature since some older studies discovered reduced breast milk transfer when using nipple shields, while more recent studies reported successful breastfeeding outcomes. The purpose of this review was to examine the evidence and outcomes with nipple shield use. Methods: A literature search was conducted in Ovid MEDLINE, OLDMEDLINE, EMBASE Classic, EMBASE, Cochrane Central Register of Controlled Trials and CINAHL. The primary endpoint was any breastfeeding outcome following nipple shield use. Secondary endpoints included the reasons for nipple shield use and the average/median length of use. For the analysis, we examined the effect of nipple shield use on physiological responses, premature infants, mothers’ experiences, and health professionals’ experiences. Results: The literature search yielded 261 articles, 14 of which were included in this review. Of these 14 articles, three reported on physiological responses, two reported on premature infants, eight reported on mothers’ experiences, and one reported on health professionals’ experiences. Conclusion: Through examining the use of nipple shields, further insight is provided on the advantages and disadvantages of this practice, thus allowing clinicians and researchers to address improvements on areas that will benefit mothers and infants the most.

  4. Hot Cell Window Shielding Analysis Using MCNP

    International Nuclear Information System (INIS)

    Pope, Chad L.; Scates, Wade W.; Taylor, J. Todd

    2009-01-01

    The Idaho National Laboratory Materials and Fuels Complex nuclear facilities are undergoing a documented safety analysis upgrade. In conjunction with the upgrade effort, shielding analysis of the Fuel Conditioning Facility (FCF) hot cell windows has been conducted. This paper describes the shielding analysis methodology. Each 4-ft thick window uses nine glass slabs, an oil film between the slabs, numerous steel plates, and packed lead wool. Operations in the hot cell center on used nuclear fuel (UNF) processing. Prior to the shielding analysis, shield testing with a gamma ray source was conducted, and the windows were found to be very effective gamma shields. Despite these results, because the glass contained significant amounts of lead and little neutron absorbing material, some doubt lingered regarding the effectiveness of the windows in neutron shielding situations, such as during an accidental criticality. MCNP was selected as an analysis tool because it could model complicated geometry, and it could track gamma and neutron radiation. A bounding criticality source was developed based on the composition of the UNF. Additionally, a bounding gamma source was developed based on the fission product content of the UNF. Modeling the windows required field inspections and detailed examination of drawings and material specifications. Consistent with the shield testing results, MCNP results demonstrated that the shielding was very effective with respect to gamma radiation, and in addition, the analysis demonstrated that the shielding was also very effective during an accidental criticality.

  5. Physiological characteristics of elite short- and long-distance triathletes.

    Science.gov (United States)

    Millet, Grégoire P; Dréano, Patrick; Bentley, David J

    2003-01-01

    The purpose of this study was to compare the physiological responses in cycling and running of elite short-distance (ShD) and long-distance (LD) triathletes. Fifteen elite male triathletes participating in the World Championships were divided into two groups (ShD and LD) and performed a laboratory trial that comprised submaximal treadmill running, maximal then submaximal ergometry cycling and then an additional submaximal run. "In situ" best ShD triathlon performances were also analysed for each athlete. ShD demonstrated a significantly faster swim time than LD whereas .VO(2max) (ml kg(-1) min(-1)), cycling economy (W l(-1) min(-1)), peak power output (.W(peak),W) and ventilatory threshold (%.VO(2max)) were all similar between ShD and LD. Moreover, there were no differences between the two groups in the change (%) in running economy from the first to the second running bout. Swimming time was correlated to .W(peak)(r=-0.76; Ptriathlon was correlated to .W(peak)(r=-0.83; P<0.05) in LD. In conclusion, ShD triathletes had a faster swimming time but did not exhibit different maximal or submaximal physiological characteristics measured in cycling and running than LD triathletes.

  6. A study of gamma shielding

    International Nuclear Information System (INIS)

    Roogtanakait, N.

    1981-01-01

    Gamma rays have high penetration power and its attenuation depends upon the thickness and the attenuation coefficient of the shield, so it is necessary to use the high density shield to attenuate the gamma rays. Heavy concrete is considered to be used for high radiation laboratory and the testing of the shielding ability and compressibility of various types of heavy concrete composed of baryte, hematite, ilmenite and galena is carried out. The results of this study show that baryte-ilmenite concrete is the most suitable for high radiation laboratory in Thailand

  7. Neutron shielding performance of water-extended polyester

    International Nuclear Information System (INIS)

    Vega Carrillo, H.R.; Manzanares-Acuna, E.; Hernandez-Davila, V.M.; Vega Carrillo, H.R.; Hernandez-Davila, V.M.; Gallego, E.; Lorente, A.

    2006-01-01

    A Monte Carlo study to determine the shielding features to neutrons of water-extended polyester (WEP) was carried out. Materials with low atomic number are predominantly used for neutron shielding because these materials effectively attenuate neutrons, mainly through elastic and inelastic collisions. In addition to neutron attenuation properties, other desirable properties for neutron shielding materials include mechanical strength, stability, low cost, and ease of handling. During the selection of materials to design a neutron shield, prompt gamma production as well as radionuclide induced by neutron activation must be considered. In this investigation the Monte Carlo method (MCNP code) was used to evaluate the performance of a water-extended polyester shield designed for the transportation, storage, and use of a 252 Cf isotopic neutron source, for comparison the calculations were extended to water shielding, the bare source in vacuum and in air. (authors)

  8. Neutron shielding performance of water-extended polyester

    Energy Technology Data Exchange (ETDEWEB)

    Vega Carrillo, H.R.; Manzanares-Acuna, E.; Hernandez-Davila, V.M. [Zacatecas Univ. Autonoma, Nuclear Studies (Mexico); Vega Carrillo, H.R.; Hernandez-Davila, V.M. [Zacatecas Univ. Autonoma, Electric Engineering Academic Units (Mexico); Gallego, E.; Lorente, A. [Madrid Univ. Politecnica, cNuclear Engineering Department (Mexico)

    2006-07-01

    A Monte Carlo study to determine the shielding features to neutrons of water-extended polyester (WEP) was carried out. Materials with low atomic number are predominantly used for neutron shielding because these materials effectively attenuate neutrons, mainly through elastic and inelastic collisions. In addition to neutron attenuation properties, other desirable properties for neutron shielding materials include mechanical strength, stability, low cost, and ease of handling. During the selection of materials to design a neutron shield, prompt gamma production as well as radionuclide induced by neutron activation must be considered. In this investigation the Monte Carlo method (MCNP code) was used to evaluate the performance of a water-extended polyester shield designed for the transportation, storage, and use of a {sup 252}Cf isotopic neutron source, for comparison the calculations were extended to water shielding, the bare source in vacuum and in air. (authors)

  9. Shielded regenerative neutron detector

    International Nuclear Information System (INIS)

    Terhune, J.H.; Neissel, J.P.

    1978-01-01

    An ion chamber type neutron detector is disclosed which has a greatly extended lifespan. The detector includes a fission chamber containing a mixture of active and breeding material and a neutron shielding material. The breeding and shielding materials are selected to have similar or substantially matching neutron capture cross-sections so that their individual effects on increased detector life are mutually enhanced

  10. Engineering modeling of traffic noise in shielded areas in cities.

    Science.gov (United States)

    Salomons, Erik M; Polinder, Henk; Lohman, Walter J A; Zhou, Han; Borst, Hieronymous C; Miedema, Henk M E

    2009-11-01

    A computational study of road traffic noise in cities is presented. Based on numerical boundary-element calculations of canyon-to-canyon propagation, an efficient engineering algorithm is developed to calculate the effect of multiple reflections in street canyons. The algorithm is supported by a room-acoustical analysis of the reverberant sound fields in the source and receiver canyons. Using the algorithm, a simple model for traffic noise in cities is developed. Noise maps and exposure distributions of the city of Amsterdam are calculated with the model, and for comparison also with an engineering model that is currently used for traffic noise impact assessments in cities. Considerable differences between the two model predictions are found for shielded buildings with day-evening-night levels of 40-60 dB at the facades. Further, an analysis is presented of level differences between the most and the least exposed facades of buildings. Large level differences are found for buildings directly exposed to traffic noise from nearby roads. It is shown that by a redistribution of traffic flow around these buildings, one can achieve low sound levels at quiet sides and a corresponding reduction in the percentage of highly annoyed inhabitants from typically 23% to 18%.

  11. Space Shielding Materials for Prometheus Application

    Energy Technology Data Exchange (ETDEWEB)

    R. Lewis

    2006-01-20

    At the time of Prometheus program restructuring, shield material and design screening efforts had progressed to the point where a down-selection from approximately eighty-eight materials to a set of five ''primary'' materials was in process. The primary materials were beryllium (Be), boron carbide (B{sub 4}C), tungsten (W), lithium hydride (LiH), and water (H{sub 2}O). The primary materials were judged to be sufficient to design a Prometheus shield--excluding structural and insulating materials, that had not been studied in detail. The foremost preconceptual shield concepts included: (1) a Be/B{sub 4}C/W/LiH shield; (2) a Be/B{sub 4}C/W shield; (3) and a Be/B{sub 4}C/H{sub 2}O shield. Since the shield design and materials studies were still preliminary, alternative materials (e.g., {sup nal}B or {sup 10}B metal) were still being screened, but at a low level of effort. Two competing low mass neutron shielding materials are included in the primary materials due to significant materials uncertainties in both. For LiH, irradiation-induced swelling was the key issue, whereas for H{sub 2}O, containment corrosion without active chemistry control was key, Although detailed design studies are required to accurately estimate the mass of shields based on either hydrogenous material, both are expected to be similar in mass, and lower mass than virtually any alternative. Unlike Be, W, and B{sub 4}C, which are not expected to have restrictive temperature limits, shield temperature limits and design accommodations are likely to be needed for either LiH or H{sub 2}O. The NRPCT focused efforts on understanding swelting of LiH, and observed, from approximately fifty prior irradiation tests, that either casting ar thorough out-gassing should reduce swelling. A potential contributor to LiH swelling appears to be LiOH contamination due to exposure to humid air, that can be eliminated by careful processing. To better understand LiH irradiation performance and

  12. ANS shielding standards for light-water reactors

    International Nuclear Information System (INIS)

    Trubey, D.K.

    1982-01-01

    The purpose of the American Nuclear Society Standards Subcommittee, ANS-6, Radiation Protection and Shielding, is to develop standards for radiation protection and shield design, to provide shielding information to other standards-writing groups, and to develop standard reference shielding data and test problems. A total of seven published ANS-6 standards are now current. Additional projects of the subcommittee, now composed of nine working groups, include: standard reference data for multigroup cross sections, gamma-ray absorption coefficients and buildup factors, additional benchwork problems for shielding problems and energy spectrum unfolding, power plant zoning design for normal and accident conditions, process radiation monitors, and design for postaccident radiological conditions

  13. Seismic analysis of the mirror fusion test facility shielding vault

    International Nuclear Information System (INIS)

    Gabrielsen, B.L.; Tsai, K.

    1981-04-01

    This report presents a seismic analysis of the vault in Building 431 at Lawrence Livermore National Laboratory which houses the mirror Fusion Test Facility. The shielding vault structure is approximately 120 ft long by 80 ft wide and is constructed of concrete blocks approximately 7 x 7 x 7 ft. The north and south walls are approximately 53 ft high and the east wall is approximately 29 ft high. These walls are supported on a monolithic concrete foundation that surrounds a 21-ft deep open pit. Since the 53-ft walls appeared to present the greatest seismic problem they were the first investigated

  14. Comprehensive analysis of shielding effectiveness for HDPE, BPE and concrete as candidate materials for neutron shielding

    International Nuclear Information System (INIS)

    Dhang, Prosenjit; Verma, Rishi; Shyam, Anurag

    2015-01-01

    In the compact accelerator based DD neutron generator, the deuterium ions generated by the ion source are accelerated after the extraction and bombarded to a deuterated titanium target. The emitted neutrons have typical energy of ∼2.45MeV. Utilization of these compact accelerator based neutron generators of yield up to 10 9 neutron/second (DD) is under active consideration in many research laboratories for conducting active neutron interrogation experiments. Requirement of an adequately shielded laboratory is mandatory for the effective and safe utilization of these generators for intended applications. In this reference, we report the comprehensive analysis of shielding effectiveness for High Density Polyethylene (HDPE), Borated Polyethylene (BPE) and Concrete as candidate materials for neutron shielding. In shielding calculations, neutron induced scattering and absorption gamma dose has also been considered along with neutron dose. Contemporarily any material with higher hydrogenous concentration is best suited for neutron shielding. Choice of shielding material is also dominated by practical issues like economic viability and availability of space. Our computational analysis results reveal that utilization of BPE sheets results in minimum wall thickness requirement for attaining similar range of attenuation in neutron and gamma dose. The added advantage of using borated polyethylene is that it reduces the effect of both neutron and gamma dose by absorbing neutron and producing lithium and alpha particle. It has also been realized that for deciding upon optimum thickness determination of any shielding material, three important factors to be necessarily considered are: use factor, occupancy factor and work load factor. (author)

  15. Experimental study on one-thirtieth scale model of reinforced concrete reactor building under cyclic lateral loading

    International Nuclear Information System (INIS)

    Fukada, Y.; Hirashima, S.; Shobara, R.

    1981-01-01

    The test models, three types of earthquake-resistant components, are reduced to a scale of one-thirtieth of the prototype which is based on the design of the reactor building for a BWR Mark II Improved Type 1100 MWe Nuclear Power Plant in Japan. Experiments on earthquake-resistant components are conducted as a first step. Three types of components are selected: Outer Box (a box-shape outer wall of an auxiliary building), Inner Box (a box-shape building wall inside the Outer Box) and Shield Wall (a conical-shape innermost shield wall). Outer Box has one story, Inner Box four stories and Shield Wall three stories, respectively. Lateral forces are statically applied to each height of a specimen and axial force is simultaneously applied on top of the specimen. The shear reinforcement ratio is 1.2% for both Outer Box and Inner Box, 1.6% for Shield Wall. The test results are discussed to confirm safety factors for the design load and the relationships between loads and displacements, and then they are compared with analytical results. The ratio of the maximum load to the design load is above 2.5. Flexural and shear displacements are analyzed independently in the tests. The relationships of moment-curvature and shear stress-shear strain, and the relationships of load-displacement which are calculated from these two show good agreement with those in conventional analyses. The FEM non-linear analysis shows good agreement with the experiments. (orig./HP)

  16. New applications and developments in the neutron shielding

    Directory of Open Access Journals (Sweden)

    Uğur Fatma Aysun

    2017-01-01

    Full Text Available Shielding neutrons involve three steps that are slowing neutrons, absorption of neutrons, and impregnation of gamma rays. Neutrons slow down with thermal energy by hydrogen, water, paraffin, plastic. Hydrogenated materials are also very effective for the absorption of neutrons. Gamma rays are produced by neutron (radiation retention on the neutron shield, inelastic scattering, and degradation of activation products. If a source emits gamma rays at various energies, high-energy gamma rays sometimes specify shielding requirements. Multipurpose Materials for Neutron Shields; Concrete, especially with barium mixed in, can slow and absorb the neutrons, and shield the gamma rays. Plastic with boron is also a good multipurpose shielding material. In this study; new applications and developments in the area of neutron shielding will be discussed in terms of different materials.

  17. New applications and developments in the neutron shielding

    Science.gov (United States)

    Uğur, Fatma Aysun

    2017-09-01

    Shielding neutrons involve three steps that are slowing neutrons, absorption of neutrons, and impregnation of gamma rays. Neutrons slow down with thermal energy by hydrogen, water, paraffin, plastic. Hydrogenated materials are also very effective for the absorption of neutrons. Gamma rays are produced by neutron (radiation) retention on the neutron shield, inelastic scattering, and degradation of activation products. If a source emits gamma rays at various energies, high-energy gamma rays sometimes specify shielding requirements. Multipurpose Materials for Neutron Shields; Concrete, especially with barium mixed in, can slow and absorb the neutrons, and shield the gamma rays. Plastic with boron is also a good multipurpose shielding material. In this study; new applications and developments in the area of neutron shielding will be discussed in terms of different materials.

  18. Neutron shielding performance of water-extended polyester

    International Nuclear Information System (INIS)

    Vega Carrillo, H.R.; Manzanares-Acuna, E.; Hernandez-Davila, V.M.; Vega Carrillo, H.R.; Gallegoc, E.; Lorentec, A.; Hernandez-Davila, V.M.

    2006-01-01

    A Monte Carlo study to determine the shielding features to neutrons of water-extended polyester was carried out. Materials with low atomic number are predominantly used for neutron shielding because these materials effectively attenuate neutrons, mainly through elastic and inelastic collisions. In addition to neutron attenuation properties, other desirable properties for neutron shielding materials include mechanical strength, stability, low cost, and ease of handling. During the selection of materials to design a neutron shield, prompt gamma production as well as radionuclide induced by neutron activation must be considered. In this investigation the Monte Carlo method (M.C.N.P. code) was used to evaluate the performance of a water-extended polyester shield designed for the transportation, storage, and use of a 252 Cf isotopic neutron source, for comparison the calculations were extended to water shielding, the bare source in vacuum and in air. (authors)

  19. Shields for nuclear reactors

    International Nuclear Information System (INIS)

    Aspden, G.J.

    1984-01-01

    The patent concerns shields for nuclear reactors. The roof shield comprises a normally fixed radial outer portion, a radial inner portion rotatable about a vertical axis, and a connection between the inner and outer portions. In the event of hypothecal core disruption conditions, a cantilever system on the inner wall allows the upward movement of the inner wall, in order to prevent loss of containment. (UK)

  20. Shielding research in France

    Energy Technology Data Exchange (ETDEWEB)

    Lafore, P

    1964-10-01

    Shielding research as an independent subject in France dates from 1956. The importance of these studies has been reflected in the contribution which they have made to power reactor design and in the resultant savings in expenditure for civil engineering and machinery for the removal of mobile shields. The Reactor Shielding Research Division numbers approximately 60 persons and uses several experimental facilities. These include: NAIADE I, installed near the ZOE reactor and operating with a natural uranium slab 2 cm thick (an effective diameter of 60 cm is the one most commonly used); the TRITON pool-type reactor, mainly used in shielding studies, includes an active-water loop, by means of which the secondary shields required for light-water reactors can be studied; core, NEREIDE, which is situated near a 2 m x 2 m aluminium window enables a large neutron source to be placed in a compartment without water in which large-scale mock-ups can be mounted for the study, in particular, of neutron diffusion in large cavities, and of reactor shielding of greater thickness than that in NAIADE I; SAMES 600 keV accelerator is used for monoenergetic neutron studies. Instrumentation studies are an important part of the work, mainly in the measurement of fast neutrons and their spectra by activation detectors. Of late, attention has been directed towards the use of (n, n') (rhodium) reactions and of heavy detectors for low-flux measurements. The simultaneous use of a large number of detectors poses automation problems. With our installation we can count 16 detectors simultaneously. Neutron spectrum studies are conducted with nuclear emulsions and a lithium-6 semiconductor spectrometer. As to the materials used, the research carried out in France involves chiefly graphite, iron and concrete at various temperatures up to 800 deg C. Different compounds, borated and non-borated and of densities up to between 1 and 9 are under consideration. Problems connected with applications are

  1. MEANS FOR SHIELDING AND COOLING REACTORS

    Science.gov (United States)

    Wigner, E.P.; Ohlinger, L.A.; Young, G.J.; Weinberg, A.M.

    1959-02-10

    Reactors of the water-cooled type and a means for shielding such a rcactor to protect operating personnel from harmful radiation are discussed. In this reactor coolant tubes which contain the fissionable material extend vertically through a mass of moderator. Liquid coolant enters through the bottom of the coolant tubes and passes upwardly over the fissionable material. A shield tank is disposed over the top of the reactor and communicates through its bottom with the upper end of the coolant tubes. A hydrocarbon shielding fluid floats on the coolant within the shield tank. With this arrangements the upper face of the reactor can be opened to the atmosphere through the two superimposed liquid layers. A principal feature of the invention is that in the event radioactive fission products enter thc coolant stream. imposed layer of hydrocarbon reduces the intense radioactivity introduced into the layer over the reactors and permits removal of the offending fuel material by personnel shielded by the uncontaminated hydrocarbon layer.

  2. Development of HANARO ST3 shield

    International Nuclear Information System (INIS)

    Park, K. N.; Lee, J. S.; Shim, H. S.

    2004-12-01

    This report contains the design, fabrication and accurate installation of ST3 shield, which would be installed at ST3 beam port of HANARO. At first, we designed and fabricated ST3 shield casemate composed of 14 blocks. We filled it with heavy concrete, lead ingot and polyethylene that mixed B 4 C powder and epoxy. The average filling density of total shield casemate was 4.7g/cm 3 . The developed ST3 shield was installed at the ST3 beam port and the accuracy of installation for each beam path and channel was evaluated. We found that the extraction of neutron beam to meet the requirement of neutron spectrometer is possible. Also, we developed ancillary equipment such as BGU, quick shutter and exterior shield door for the effective opening and closing of neutron beam. As a result of this study, it was found that neutron spectrometer such as neutron reflectometer and high intensity powder diffractomater can be installed at the ST3 beam port

  3. Cage for shield-type support. Schildausbaugestell

    Energy Technology Data Exchange (ETDEWEB)

    Harryers, W; Blumenthal, G; Irresberger, H

    1981-08-13

    A cage for shield-type support containing a fracture shield supported by a hydraulic stamp and a projecting roof bar was constructed in such a way that no cellular shirt is needed to timber the caved room. The roof bar which is linked at a joint axis at the face-side end of the fracture shield is formed at the face side as a multiply foldable bar. (HGOE).

  4. Revised neutral gas shielding model for pellet ablation - combined neutral and plasma shielding

    International Nuclear Information System (INIS)

    Houlberg, W.A.; Schuresko, D.D.; Attenberger, S.E.

    1986-01-01

    The ablation and penetration of pellets in early ORMAK and ISX-A experiments were reliably predicted by the neutral gas shielding model of Milora and Foster. These experiments demonstrated that the principle components of the model - a self-generated shield which reduces the heat flux at the plasma surface - were correct. In more recent experiments with higher temperature plasmas, this model consistently predicts greater penetration than observed in the experiments. Upgarding known limitations of the original model brings the predicted and observed penetration values into agreement. These improvements include: (1) treating the incident electrons as having distribution in energy rather than being monoenergetic; (2) including the shielding effects of cold, dense plasma extending along the magnetic field outside the neutral shield; and (3) modifying the finite plasma, self-limiting incident heat flux so that it represents a collisionless plasma limit rather than a collisional limit. Comparisons are made between the models for a selection of ISX-B Alcator-C, and TFTR shots. The net effect of the changes in the model is an increase in pellet ablation rates and decrease in penetration for current and future experiments

  5. Heating profiles on ICRF antenna Faraday shields

    International Nuclear Information System (INIS)

    Taylor, D.J.; Baity, F.W.; Hahs, C.L. Riemer, B.W.; Ryan, D.M.; Williamson, D.E.

    1992-01-01

    Poor definition of the heating profiles that occur during normal operation of Faraday shields for ion cyclotron resonant frequency (ICRF) antennas has complicated the mechanical design of ICRF system components. This paper reports that at Oak Ridge National Laboratory (ORNL), Faraday shield analysis is being used in defining rf heating profiles. In recent numerical analyses of proposed hardware for the Burning Plasma Experiment (BPX) and DIII-D, rf magnetic fields at Faraday shield surfaces were calculated, providing realistic predictions of the induced skin currents flowing on the shield elements and the resulting dissipated power profile. Detailed measurements on mock-ups of the Faraday shields for DIII-D and the Tokamak Fusion Test Reactor (TFTR) confirmed the predicted magnetic field distributions. A conceptual design for an uncooled Faraday shield for the BPX ion cyclotron resonance heating (ICRH) antenna, which should withstand the proposed long-pulse operation, has been completed. The analytical effort is described in detail, with emphasis on the design work for the BPX ICRH antenna conceptual design and for the replacement Faraday shield for the DIII-D FWCD antenna. Results of analyses are shown, and configuration issues involved in component modeling are discussed

  6. Shielding calculation for bremsstrahlung from β-emitters

    International Nuclear Information System (INIS)

    Ichimiya, Tsutomu

    1990-01-01

    Accompanying the revision of radiation injury prevention law, the shielding calculation method for photon corresponding to the dose equivalent was shown. However, regarding the electron from β decay nuclide and bremsstrahlung caused by shielding material, the shielding calculation method corresponding to the 1 cm dose equivalent has not been reported, hence, in this report, the spectrum of β-ray is calculated and the 1 cm dose equivalent transmission rate of the bremsstrahlung was calculated for three kinds of shielding materials (iron, lead, concrete). As the result of consideration, it is sufficient to think about the bremsstrahlung due to negative electron emission accompanying β-decay. In β-decay, electrons which constitute the continuous spectrum with maximum energy are emitted. The shape of the spectrum differs with nuclides. The maximum energy of β-ray of generally used nuclides is mostly below 3MeV and, besides, the electron ray itself is easily shielded, while the strength of bremsstrahlung depends on the atomic number of shielding materials and its generating mechanism is complicated. In this report, the actual shielding calculation method for bremsstrahlung is shown with regard to the most frequently used β-decay nuclides. (M.T.)

  7. Preliminary evaluation of FY98 KALIMER shielding design

    Energy Technology Data Exchange (ETDEWEB)

    Yoo, Jae Woon; Kang, Chang Mu; Kim, Young Jin [Korea Atomic Energy Research Institute, Taejon (Korea)

    1999-01-01

    This report describes a preliminary evaluation of the shielding design of FY98 KALIMER. The KALIMER shielding design includes the Inner Fixed Shield of a stainless cylinder located inside the support barrel; the Radial PSDRS Shields which are three B{sub 4}C cylinders located outside the support barrel at core level; the Lower IHX shield of a cylindrical B{sub 4}C plate located above the flow guide; and Inner and Outer IHX shields of B{sub 4}C cylinders located inside and outside of the support barrel, respectively. The DORT3.1 two-dimensional transport code was used to evaluate the KALIMER shielding design. The reactor system was represented by four axial zones, each of which was modeled in the R-Z geometry. The KAFAX-F22 library was used in the analyses, which was generated from the JEF-2.2 of OECD/NEA files for LMR applications by KAERI. The performance of the KALIMER shielding design is compared against the shielding design criteria. The results indicate that the support barrel, upper grid plate, and other reactor structures meet the maximum neutron fluence and DPA limits established in the shielding design criteria. Activities of the air effluent in the PSDRS were also evaluated and are shown to satisfy the maximum permissible concentration (MPC) limits in 10 CFR Part 20. In the future, the validation of the DORT model by a detailed three dimensional calculation such as MCNP and the justification of the current shielding design limits are needed. (author). 13 refs., 23 figs., 31 tabs.

  8. Shielded scanning electron microscope for radioactive samples

    International Nuclear Information System (INIS)

    Crouse, R.S.; Parsley, W.B.

    1977-01-01

    A small commercial SEM had been successfully shielded for examining radioactive materials transferred directly from a remote handling facility. Relatively minor mechanical modifications were required to achieve excellent operation. Two inches of steel provide adequate shielding for most samples encountered. However, samples reading 75 rad/hr γ have been examined by adding extra shielding in the form of tungsten sample holders and external lead shadow shields. Some degradation of secondary electron imaging was seen but was adequately compensated for by changing operating conditions

  9. Autodisplay of an avidin with biotin-binding activity on the surface of Escherichia coli.

    Science.gov (United States)

    Pardavé-Alejandre, H D; Alvarado-Yaah, J E; Pompa-Mera, E N; Muñoz-Medina, J E; Sárquiz-Martínez, B; Santacruz-Tinoco, C E; Manning-Cela, R G; Ortíz-Navarrete, V; López-Macías, C; González-Bonilla, C R

    2018-03-01

    To display a recombinant avidin fused to the autotransporter ShdA to bind biotinylated molecules on the surface of Escherichia coli. Two chimeric protein constructs containing avidin fused to the autotransporter ShdA were expressed on the surface of Escherichia coli DH5α. One fusion protein contained 476 amino acids of the ShdA α and β domains, whereas the second consisted of a 314 amino acid from α and truncated β domains. Protein production was verified by SDS-PAGE using an antibody to the molecular FLAG-tag. The surface display of the avidin-shdA fusion protein was confirmed by confocal microscopy and flow cytometry analysis, and the biotin-binding activity was evaluated by fluorescence microscopy and flow cytometry using biotin-4-fluorescein and biotinylated-ovalbumin (OVA). Expression of a recombinant avidin with biotin-binding activity on the surface of E. coli was achieved using the autotransporter ShdA. This system is an alternative to bind biotinylated molecules to E. coli.

  10. Gonad shielding in diagnostic radiology

    International Nuclear Information System (INIS)

    1975-06-01

    The use of gonad shielding is an important radiation protection technique, intended to reduce unnecessary x-ray exposure of the gonads of patients from diagnostic x-ray procedures. This pamphlet will provide physicians and radiologic technologists with information which will aid their appropriate use of gonad shielding

  11. SU-F-I-71: Fetal Protection During Fluoroscopy: To Shield Or Not to Shield?

    International Nuclear Information System (INIS)

    Joshi, S; Vanderhoek, M

    2016-01-01

    Purpose: Lead aprons are routinely used to shield the fetus from radiation during fluoroscopically guided interventions (FGI) involving pregnant patients. When placed in the primary beam, lead aprons often reduce image quality and increase fluoroscopic radiation output, which can adversely affect fetal dose. The purpose of this work is to identify an effective and practical method to reduce fetal dose without affecting image quality. Methods: A pregnant patient equivalent abdominal phantom is set on the table along with an image quality test object (CIRS model 903) representing patient anatomy of interest. An ion chamber is positioned at the x-ray beam entrance to the phantom, which is used to estimate the relative fetal dose. For three protective methods, image quality and fetal dose measurements are compared to baseline (no protection):1. Lead apron shielding the entire abdomen; 2. Lead apron shielding part of the abdomen, including the fetus; 3. Narrow collimation such that fetus is excluded from the primary beam. Results: With lead shielding the entire abdomen, the dose is reduced by 80% relative to baseline along with a drastic deterioration of image quality. With lead shielding only the fetus, the dose is reduced by 65% along with complete preservation of image quality, since the image quality test object is not shielded. However, narrow collimation results in 90% dose reduction and a slight improvement of image quality relative to baseline. Conclusion: The use of narrow collimation to protect the fetus during FGI is a simple and highly effective method that simultaneously reduces fetal dose and maintains sufficient image quality. Lead aprons are not as effective at fetal dose reduction, and if placed improperly, they can severely degrade image quality. Future work aims to investigate a wider variety of fluoroscopy systems to confirm these results across many different system geometries.

  12. SU-F-I-71: Fetal Protection During Fluoroscopy: To Shield Or Not to Shield?

    Energy Technology Data Exchange (ETDEWEB)

    Joshi, S; Vanderhoek, M [Henry Ford Health System, Detroit, MI (United States)

    2016-06-15

    Purpose: Lead aprons are routinely used to shield the fetus from radiation during fluoroscopically guided interventions (FGI) involving pregnant patients. When placed in the primary beam, lead aprons often reduce image quality and increase fluoroscopic radiation output, which can adversely affect fetal dose. The purpose of this work is to identify an effective and practical method to reduce fetal dose without affecting image quality. Methods: A pregnant patient equivalent abdominal phantom is set on the table along with an image quality test object (CIRS model 903) representing patient anatomy of interest. An ion chamber is positioned at the x-ray beam entrance to the phantom, which is used to estimate the relative fetal dose. For three protective methods, image quality and fetal dose measurements are compared to baseline (no protection):1. Lead apron shielding the entire abdomen; 2. Lead apron shielding part of the abdomen, including the fetus; 3. Narrow collimation such that fetus is excluded from the primary beam. Results: With lead shielding the entire abdomen, the dose is reduced by 80% relative to baseline along with a drastic deterioration of image quality. With lead shielding only the fetus, the dose is reduced by 65% along with complete preservation of image quality, since the image quality test object is not shielded. However, narrow collimation results in 90% dose reduction and a slight improvement of image quality relative to baseline. Conclusion: The use of narrow collimation to protect the fetus during FGI is a simple and highly effective method that simultaneously reduces fetal dose and maintains sufficient image quality. Lead aprons are not as effective at fetal dose reduction, and if placed improperly, they can severely degrade image quality. Future work aims to investigate a wider variety of fluoroscopy systems to confirm these results across many different system geometries.

  13. Neutron shielding for a {sup 252} Cf source

    Energy Technology Data Exchange (ETDEWEB)

    Vega C, H.R.; Manzanares A, E.; Hernandez D, V.M. [Unidades Academicas de Estudios Nucleares e Ingenieria Electrica, Universidad Autonoma de Zacatecas, C. Cipres 10, Fracc. La Penuela, 98068 Zacatecas (Mexico); Eduardo Gallego, Alfredo Lorente [Depto. de Ingenieria Nuclear, ETS Ingenieros Industriales, Universidad Politecnica de Madrid, C. Jose Gutierrez Abascal 2, 28006 Madrid (Spain)]. e-mail: fermineutron@yahoo.com

    2006-07-01

    To determine the neutron shielding features of water-extended polyester a Monte Carlo study was carried out. Materials with low atomic number are predominantly used for neutron shielding because these materials effectively attenuate neutrons, mainly through inelastic collisions and absorption reactions. During the selection of materials to design a neutron shield, prompt gamma production as well as radionuclide production induced by neutron activation must be considered. In this investigation the Monte Carlo method was used to evaluate the performance of a water-extended polyester shield designed for the transportation, storage, and use of a {sup 252}Cf isotopic neutron source. During calculations a detailed model for the {sup 252}Cf and the shield was utilized. To compare the shielding features of water extended polyester, the calculations were also made for the bare {sup 252}Cf in vacuum, air and the shield filled with water. For all cases the calculated neutron spectra was utilized to determine the ambient equivalent neutron dose at four sites around the shielding. In the case of water extended polyester and water shielding the calculations were extended to include the prompt gamma rays produced during neutron interactions, with this information the Kerma in air was calculated at the same locations where the ambient equivalent neutron dose was determined. (Author)

  14. A conceptual redesign of an Inter-Building Fuel Transfer Cask

    International Nuclear Information System (INIS)

    Klann, R.T.; Picker, B.A. Jr.

    1993-01-01

    The Inter-Building Fuel Transfer Cask, referred to as the IBC, is a lead shielded cask for transporting subassemblies between buildings on the Argonne National Laboratory-West site near Idaho Falls, Idaho. The cask transports both newly fabricated and spent reactor subassemblies between the Experimental Breeder Reactor-II (EBR-II), the Fuel Cycle Facility (FCF) and the Hot Fuel Examination Facility (HFEF). The IBC will play a key role in the Integral Fast Reactor (IFR) fuel recycling demonstration project. This report discusses a conceptual redesign of the IBC which has been performed. The objective of the conceptual design was to increase the passive heat removal capabilities, reduce the personnel radiation exposure and incorporate enhanced safety features into the design. The heat transfer, radiation and thermal-hydraulic properties of the IBC were analytically modelled to determine the principal factors controlling the desip. The scoping studies that were performed determined the vital physical characteristics (i.e., size, shielding, pumps, etc.) of the MC conceptual design

  15. A perturbation technique for shield weight minimization

    International Nuclear Information System (INIS)

    Watkins, E.F.; Greenspan, E.

    1993-01-01

    The radiation shield optimization code SWAN (Ref. 1) was originally developed for minimizing the thickness of a shield that will meet a given dose (or another) constraint or for extremizing a performance parameter of interest (e.g., maximizing energy multiplication or minimizing dose) while maintaining the shield volume constraint. The SWAN optimization process proved to be highly effective (e.g., see Refs. 2, 3, and 4). The purpose of this work is to investigate the applicability of the SWAN methodology to problems in which the weight rather than the volume is the relevant shield characteristic. Such problems are encountered in shield design for space nuclear power systems. The investigation is carried out using SWAN with the coupled neutron-photon cross-section library FLUNG (Ref. 5)

  16. Secondary gamma-ray data for shielding calculation

    International Nuclear Information System (INIS)

    Miyasaka, Sunichi

    1979-01-01

    In deep penetration transport calculations, the integral design parameters is determined mainly by secondary particles which are produced by interactions of the primary radiation with materials. The shield thickness and the biological dose rate at a given point of a bulk shield are determined from the contribution from secondary gamma rays. The heat generation and the radiation damage in the structural and shield materials depend strongly on the secondary gamma rays. In this paper, the status of the secondary gamma ray data and its further problems are described from the viewpoint of shield design. The secondary gamma-ray data in ENDF/B-IV and POPOP4 are also discussed based on the test calculations made for several shield assemblies. (author)

  17. PC based temporary shielding administrative procedure (TSAP)

    International Nuclear Information System (INIS)

    Olsen, D.E.; Pederson, G.E.; Hamby, P.N.

    1995-01-01

    A completely new Administrative Procedure for temporary shielding was developed for use at Commonwealth Edison's six nuclear stations. This procedure promotes the use of shielding, and addresses industry requirements for the use and control of temporary shielding. The importance of an effective procedure has increased since more temporary shielding is being used as ALARA goals become more ambitious. To help implement the administrative procedure, a personal computer software program was written to incorporate the procedural requirements. This software incorporates the useability of a Windows graphical user interface with extensive help and database features. This combination of a comprehensive administrative procedure and user friendly software promotes the effective use and management of temporary shielding while ensuring that industry requirements are met

  18. PC based temporary shielding administrative procedure (TSAP)

    Energy Technology Data Exchange (ETDEWEB)

    Olsen, D.E.; Pederson, G.E. [Sargent & Lundy, Chicago, IL (United States); Hamby, P.N. [Commonwealth Edison Co., Downers Grove, IL (United States)

    1995-03-01

    A completely new Administrative Procedure for temporary shielding was developed for use at Commonwealth Edison`s six nuclear stations. This procedure promotes the use of shielding, and addresses industry requirements for the use and control of temporary shielding. The importance of an effective procedure has increased since more temporary shielding is being used as ALARA goals become more ambitious. To help implement the administrative procedure, a personal computer software program was written to incorporate the procedural requirements. This software incorporates the useability of a Windows graphical user interface with extensive help and database features. This combination of a comprehensive administrative procedure and user friendly software promotes the effective use and management of temporary shielding while ensuring that industry requirements are met.

  19. Mechanical design of the TIBER breeding shield

    Energy Technology Data Exchange (ETDEWEB)

    Rathke, J.; Deutsch, L. (Grumman Corp., Bethpage, NY (USA). Space Systems Div.)

    1989-04-01

    TIBER features a segmented shield assembly that provides the nuclear shielding for the superconducting toroidal field coils. In addition to its primary function, the shield also provides tritium breeding through the use of water coolant that contains 16 wt% dissolved lithium nitrate. Because the TIBER reactor need not provide electrical power, the coolant is maintained at low pressure (0.2 MPa) and low temperature (75/sup 0/C). The shield is made in several segments to facilitate assembly and allow for replacement of high heat flux components (divertor blades). The segments are designated as inboard, outboard, upper, lower, and divertor modules. In total, there are 96 separate modules in the machine, consisting of six different types. The design features of the different modules vary primarily depending on the thickness of the shield in a given location. The very thick outboard shield has a breeding zone in the inboard portion of the module, with a shielding zone behind it. The breeding zone consists of a stainless steel casing filled with beryllium spheres. The shielding zone consists of the same casing filled with steel spheres. Both of these zones have lithiated water circulated throughout to provide cooling and breeding. In zones with minimal thickness, tungsten alloys are used to achieve the required shielding. These alloys are incoprorated in subassemblies utilizing stainless steel casings surrounding blocks of tungsten heavy metal alloy. These are infiltrated with lead on final assembly to form a thermally continuous panel. Several of these panels are then assembled into an outer stainless steel case to form an inboard module. These modules also use the lithiated coolant. The details of the design are presented and discussed. (orig.).

  20. Using glass as a shielding material

    International Nuclear Information System (INIS)

    Yousef, S.

    2002-04-01

    Different theoretical and technological concepts and problems in using glass as a shielding material was discussed, some primarily designs for different types of radiation shielding windows were illustrated. (author)

  1. Using glass as a shielding material

    International Nuclear Information System (INIS)

    Yousef, S.

    2003-01-01

    Different theoretical and technological concepts and problems in using glass as a shielding material was discussed, some primarily designs for different types of radiation shielding windows were illustrated. (author)

  2. Development of neutron shielding concrete containing iron content materials

    Science.gov (United States)

    Sariyer, Demet; Küçer, Rahmi

    2018-02-01

    Concrete is one of the most important construction materials which widely used as a neutron shielding. Neutron shield is obtained of interaction with matter depends on neutron energy and the density of the shielding material. Shielding properties of concrete could be improved by changing its composition and density. High density materials such as iron or high atomic number elements are added to concrete to increase the radiation resistance property. In this study, shielding properties of concrete were investigated by adding iron, FeB, Fe2B, stainless - steel at different ratios into concrete. Neutron dose distributions and shield design was obtained by using FLUKA Monte Carlo code. The determined shield thicknesses vary depending on the densities of the mixture formed by the additional material and ratio. It is seen that a combination of iron rich materials is enhanced the neutron shielding of capabilities of concrete. Also, the thicknesses of shield are reduced.

  3. Radon levels in dwelling shielded spaces (DSS) in Israel

    International Nuclear Information System (INIS)

    Haquin, G.; Margaliot, M.; Riemer, T.; Shamash, S.; Even, O.; Shamai, Y.

    2002-01-01

    Exposure to radon gas is known as the major contributor to the general public exposure to ionizing radiation. The typical radon concentration in Israeli houses with a direct ground contact is about 50 Bq/m 3 , attributed mainly to soil gas penetration into the house. All newly constructed buildings (since 1991) must include Dwelling Shielded Spaces (DSS) which are rooms made of massive solid concrete, equipped with air-tight steel door and window. The DSS serve as shelters against both explosive and chemical warfare. In normal practice, the DSS serves as a conventional room in the household. Standard size DSS contain a mass of around 35 tons of concrete with typical 2 26R a activity concentration of 30 Bq/kg. This mass of concrete is expected to increase the radon concentration in the DSS room due to exhalation from the building material. Published exhalation rate values from concrete in the US and Europe vary from 0.1 to 8 mBq/m 2 sec. (0.5 - 30 Bq/m 2 h). This work presents short and long-term radon measurements performed in high-rise building DSS's. Measurements of the free exhalation rate and wall exhalation rate as well as ventilation rate in DSS are also presented and the relation between these quantities is analyzed

  4. Recent Improvements in the SHIELD-HIT Code

    DEFF Research Database (Denmark)

    Hansen, David Christoffer; Lühr, Armin Christian; Herrmann, Rochus

    2012-01-01

    Purpose: The SHIELD-HIT Monte Carlo particle transport code has previously been used to study a wide range of problems for heavy-ion treatment and has been benchmarked extensively against other Monte Carlo codes and experimental data. Here, an improved version of SHIELD-HIT is developed concentra......Purpose: The SHIELD-HIT Monte Carlo particle transport code has previously been used to study a wide range of problems for heavy-ion treatment and has been benchmarked extensively against other Monte Carlo codes and experimental data. Here, an improved version of SHIELD-HIT is developed...

  5. RADSHI: shielding calculation program for different geometries sources

    International Nuclear Information System (INIS)

    Gelen, A.; Alvarez, I.; Lopez, H.; Manso, M.

    1996-01-01

    A computer code written in pascal language for IBM/Pc is described. The program calculates the optimum thickness of slab shield for different geometries sources. The Point Kernel Method is employed, which enables the obtention of the ionizing radiation flux density. The calculation takes into account the possibility of self-absorption in the source. The air kerma rate for gamma radiation is determined, and with the concept of attenuation length through the equivalent attenuation length the shield is obtained. The scattering and the exponential attenuation inside the shield material is considered in the program. The shield materials can be: concrete, water, iron or lead. It also calculates the shield for point isotropic neutron source, using as shield materials paraffin, concrete or water. (authors). 13 refs

  6. Measurements and Monte-Carlo simulations of the particle self-shielding effect of B4C grains in neutron shielding concrete

    Science.gov (United States)

    DiJulio, D. D.; Cooper-Jensen, C. P.; Llamas-Jansa, I.; Kazi, S.; Bentley, P. M.

    2018-06-01

    A combined measurement and Monte-Carlo simulation study was carried out in order to characterize the particle self-shielding effect of B4C grains in neutron shielding concrete. Several batches of a specialized neutron shielding concrete, with varying B4C grain sizes, were exposed to a 2 Å neutron beam at the R2D2 test beamline at the Institute for Energy Technology located in Kjeller, Norway. The direct and scattered neutrons were detected with a neutron detector placed behind the concrete blocks and the results were compared to Geant4 simulations. The particle self-shielding effect was included in the Geant4 simulations by calculating effective neutron cross-sections during the Monte-Carlo simulation process. It is shown that this method well reproduces the measured results. Our results show that shielding calculations for low-energy neutrons using such materials would lead to an underestimate of the shielding required for a certain design scenario if the particle self-shielding effect is not included in the calculations.

  7. 21 CFR 886.4750 - Ophthalmic eye shield.

    Science.gov (United States)

    2010-04-01

    ...) MEDICAL DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4750 Ophthalmic eye shield. (a) Identification. An ophthalmic eye shield is a device that consists of a plastic or aluminum eye covering intended to... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Ophthalmic eye shield. 886.4750 Section 886.4750...

  8. MFTF-α + T shield design

    International Nuclear Information System (INIS)

    Gohar, Y.

    1985-01-01

    MFTF-α+T is a DT upgrade option of the Tandem Mirror Fusion Test Facility (MFTF-B) to study better plasma performance, and test tritium breeding blankets in an actual fusion reactor environment. The central cell insert, designated DT axicell, has a 2-MW/m 2 neutron wall loading at the first wall for blanket testing. This upgrade is completely shielded to protect the reactor components, the workers, and the general public from the radiation environment during operation and after shutdown. The shield design for this upgrade is the subject of this paper including the design criteria and the tradeoff studies to reduce the shield cost

  9. Neutral and plasma shielding model for pellet ablation

    International Nuclear Information System (INIS)

    Houlberg, W.A.; Milora, S.L.; Attenberger, S.E.

    1987-10-01

    The neutral gas shielding model for ablation of frozen hydrogenic pellets is extended to include the effects of an initial Maxwelliam distribution of incident electron energies; a cold plasma shield outside the neutral shield and extended along the magnetic field; energetic neutral beam ions and alpha particles; and self-limiting electron ablation in the collisionless plasma limit. Including the full electron distribution increases ablation, but adding the cold ionized shield reduces ablation; the net effect is a modest reduction in pellet penetration compared with the monoenergetic electron neutral shielding model with no plasma shield. Unlike electrons, fast ions can enter the neutral shield directly without passing through the cold ionized shield because their gyro-orbits are typically larger than the diameter of the cold plasma tube. Fast alpha particles should not enhance the ablation rate unless their population exceeds that expected from local classical thermalization. Fast beam ions, however, may enhance ablation in the plasma periphery if their population is high enough. Self-limiting ablation in the collisionless limit leads to a temporary distortion of the original plasma electron Maxwellian distribution function through preferential depopulation of the higher-energy electrons. 23 refs., 9 figs

  10. Transparent Metal-Salt-Filled Polymeric Radiation Shields

    Science.gov (United States)

    Edwards, David; Lennhoff, John; Harris, George

    2003-01-01

    "COR-RA" (colorless atomic oxygen resistant -- radiation shield) is the name of a transparent polymeric material filled with x-ray-absorbing salts of lead, bismuth, cesium, and thorium. COR-RA is suitable for use in shielding personnel against bremsstrahlung radiation from electron-beam welding and industrial and medical x-ray equipment. In comparison with lead-foil and leaded-glass shields that give equivalent protection against x-rays (see table), COR-RA shields are mechanically more durable. COR-RA absorbs not only x-rays but also neutrons and rays without adverse effects on optical or mechanical performance. The formulation of COR-RA with the most favorable mechanical-durability and optical properties contains 22 weight percent of bismuth to absorb x-rays, plus 45 atomic percent hydrogen for shielding against neutrons.

  11. Mechanical design of the storage tubes in the HWVP canister storage building

    International Nuclear Information System (INIS)

    Divona, C.J.; Fages, R.; Janicek, G.P.; Mullally, J.A.

    1993-01-01

    Canisters of high-level waste from the Hanford Waste Vitrification Plant (HWVP) will be stored in an adjacent facility, the Canister Storage Building (CSB). The canisters are stored vertically in an array of tubes within the shielded vault area of the CSB. This paper describes the mechanical design of the storage tubes, the shield floor plugs that confine the waste within the tubes and the impact absorber system used to assure that the canisters are not breached in the event of an accidental drop. Installation and testing of the components is also discussed

  12. Building shielding effects on radiation doses from routine radionuclide releases

    International Nuclear Information System (INIS)

    Kocher, D.C.

    1977-01-01

    In calculating population doses from the release of radionuclides to the atmosphere, it is usually assumed that man spends all of his time outdoors standing on a smooth infinite plane. Realistically, however, man spends most of the time indoors, so that substantial reductions in radiation doses may result compared with the usual estimates. Calculational models were developed to study the effects of building structures on radiation doses from routine releases of radionuclides to the atmosphere. Both internal dose from inhaled radionuclides and external photon dose from airborne and surface-deposited radionuclides are considered. The effect of building structures is described quantitatively by a dose reduction factor, which is the ratio of the dose inside a structure to the corresponding dose with no structure present. The internal dose from inhaled radionuclides is proportional to the radionuclide concentration in the air. Assuming that the outdoor airborne concentration is constant with time, the time-dependence of the indoor airborne concentration in terms of the structure air ventilation rate, the deposition velocities for radionuclides on the inside floor, walls, and ceiling, and the radioactive decay constant, were calculated

  13. Innovative technologies for Faraday shield cooling

    International Nuclear Information System (INIS)

    Rosenfeld, J.H.; Lindemuth, J.E.; North, M.T.; Goulding, R.H.

    1995-01-01

    Alternative advanced technologies are being evaluated for use in cooling the Faraday shields used for protection of ion cyclotron range of frequencies (ICR) antennae in Tokamaks. Two approaches currently under evaluation include heat pipe cooling and gas cooling. A Monel/water heat pipe cooled Faraday shield has been successfully demonstrated. Heat pipe cooling offers the advantage of reducing the amount of water discharged into the Tokamak in the event of a tube weld failure. The device was recently tested on an antenna at Oak Ridge National Laboratory. The heat pipe design uses inclined water heat pipes with warm water condensers located outside of the plasma chamber. This approach can passively remove absorbed heat fluxes in excess of 200 W/cm 2 ;. Helium-cooled Faraday shields are also being evaluated. This approach offers the advantage of no liquid discharge into the Tokamak in the event of a tube failure. Innovative internal cooling structures based on porous metal cooling are being used to develop a helium-cooled Faraday shield structure. This approach can dissipate the high heat fluxes typical of Faraday shield applications while minimizing the required helium blower power. Preliminary analysis shows that nominal helium flow and pressure drop can sufficiently cool a Faraday shield in typical applications. Plans are in progress to fabricate and test prototype hardware based on this approach

  14. Solar Storm GIC Forecasting: Solar Shield Extension Development of the End-User Forecasting System Requirements

    Science.gov (United States)

    Pulkkinen, A.; Mahmood, S.; Ngwira, C.; Balch, C.; Lordan, R.; Fugate, D.; Jacobs, W.; Honkonen, I.

    2015-01-01

    A NASA Goddard Space Flight Center Heliophysics Science Division-led team that includes NOAA Space Weather Prediction Center, the Catholic University of America, Electric Power Research Institute (EPRI), and Electric Research and Management, Inc., recently partnered with the Department of Homeland Security (DHS) Science and Technology Directorate (S&T) to better understand the impact of Geomagnetically Induced Currents (GIC) on the electric power industry. This effort builds on a previous NASA-sponsored Applied Sciences Program for predicting GIC, known as Solar Shield. The focus of the new DHS S&T funded effort is to revise and extend the existing Solar Shield system to enhance its forecasting capability and provide tailored, timely, actionable information for electric utility decision makers. To enhance the forecasting capabilities of the new Solar Shield, a key undertaking is to extend the prediction system coverage across Contiguous United States (CONUS), as the previous version was only applicable to high latitudes. The team also leverages the latest enhancements in space weather modeling capacity residing at Community Coordinated Modeling Center to increase the Technological Readiness Level, or Applications Readiness Level of the system http://www.nasa.gov/sites/default/files/files/ExpandedARLDefinitions4813.pdf.

  15. Shielding requirements for particle bed propulsion systems

    Science.gov (United States)

    Gruneisen, S. J.

    1991-06-01

    Nuclear Thermal Propulsion systems present unique challenges in reliability and safety. Due to the radiation incident upon all components of the propulsion system, shielding must be used to keep nuclear heating in the materials within limits; in addition, electronic control systems must be protected. This report analyzes the nuclear heating due to the radiation and the shielding required to meet the established criteria while also minimizing the shield mass. Heating rates were determined in a 2000 MWt Particle Bed Reactor (PBR) system for all materials in the interstage region, between the reactor vessel and the propellant tank, with special emphasis on meeting the silicon dose criteria. Using a Lithium Hydride/Tungsten shield, the optimum shield design was found to be: 50 cm LiH/2 cm W on the axial reflector in the reactor vessel and 50 cm LiH/2 cm W in a collar extension of the inside shield outside of the pressure vessel. Within these parameters, the radiation doses in all of the components in the interstage and lower tank regions would be within acceptable limits for mission requirements.

  16. Potential of Nanocellulose Composite for Electromagnetic Shielding

    Directory of Open Access Journals (Sweden)

    Nabila Yah Nurul Fatihah

    2017-01-01

    Full Text Available Nowadays, most people rely on the electronic devices for work, communicating with friends and family, school and personal enjoyment. As a result, more new equipment or devices operates in higher frequency were rapidly developed to accommodate the consumers need. However, the demand of using wireless technology and higher frequency in new devices also brings the need to shield the unwanted electromagnetic signals from those devices for both proper operation and human health concerns. This paper highlights the potential of nanocellulose for electromagnetic shielding using the organic environmental nanocellulose composite materials. In addition, the theory of electromagnetic shielding and recent development of green and organic material in electromagnetic shielding application has also been reviewed in this paper. The use of the natural fibers which is nanocelllose instead of traditional reinforcement materials provides several advantages including the natural fibers are renewable, abundant and low cost. Furthermore, added with other advantages such as lightweight and high electromagnetic shielding ability, nanocellulose has a great potential as an alternative material for electromagnetic shielding application.

  17. Multi-objective optimization design method of radiation shielding

    International Nuclear Information System (INIS)

    Yang Shouhai; Wang Weijin; Lu Daogang; Chen Yixue

    2012-01-01

    Due to the shielding design goals of diversification and uncertain process of many factors, it is necessary to develop an optimization design method of intelligent shielding by which the shielding scheme selection will be achieved automatically and the uncertainties of human impact will be reduced. For economical feasibility to achieve a radiation shielding design for automation, the multi-objective genetic algorithm optimization of screening code which combines the genetic algorithm and discrete-ordinate method was developed to minimize the costs, size, weight, and so on. This work has some practical significance for gaining the optimization design of shielding. (authors)

  18. Improved Monte Carlo modelling of multi-energy a-rays penetration through thick stratified shielding slabs

    International Nuclear Information System (INIS)

    Bakos, G.C.

    2001-01-01

    This paper deals with the application of Monte Carlo method for the calculation of dose build up factor of, mixed 1.37 and 2.75 MeV, a-rays penetration through stratified shielding slabs. Six double layer shielding slabs namely, 12 A l+Fe, 12 A l+Pb, 6 F e+Al, 6 F e+Pb, 4 P b+Al, 4 P b+Fe were examined. Furthermore, experimental and theoretical results are also presented. The experimental results were taken from the experimental facility installed at the Universities Research reactor Center (Risley, UK). Activated Na2SO3 solution provided a uniform Na-24 disc source of a-rays at both energies (1.37 and 2.75 MeV) with equal intensity. The theoretical results were calculated using the Bowman and Trubey formula. This formula takes into account an exponentially decaying function of the shield thickness (in mfp) to the end point of the multi-layer slab. The experimental and theoretical results were used to evaluate the simulation results produced from a Monte Carlo program (DUTMONCA code) which was developed in Democritus University of Thrace (Xanthi, Greece). The DUTMONCA code was written in Pascal language and run on an Intel PIII-800 microprocessor. The developed code (which is an improved version of an existing Monte Carlo program) has the ability to produce good results for thick shielding slabs overcoming the problems encountered in older version program. The simulation results are compared with experimental and theoretical results. Good agreement can be observed, even for thick layer shielding slabs, although there are some wayward experimental values which are due to sources of error associated with the experimental procedure

  19. Shield design development of nuclear propulsion merchant ship

    International Nuclear Information System (INIS)

    Tanaka, Yoshihisa

    1975-01-01

    Shielding design both in Japan and abroad for nuclear propulsion merchant ships is explained, with emphasis on the various technological problems having occurred in the shield design for one-body type and separate type LWRs as conceptual design. The following matters are described: the peculiarities of the design as compared with the case of land-based nuclear reactors, problems in the design standards of shielding, the present status and development of the design methods, and the instances of the design; thereby, the trends of shielding design are disclosed. The following matters are pointed out: Importance of the optimum design, of shielding, significance of radiation streaming through large voids, activation of the secondary water in built-in type steam generators, and the need of the guides for shield design. (Mori, K.)

  20. Estimation of temperature distribution in a reactor shield

    International Nuclear Information System (INIS)

    Agarwal, R.A.; Goverdhan, P.; Gupta, S.K.

    1989-01-01

    Shielding is provided in a nuclear reactor to absorb the radiations emanating from the core. The energy of these radiations appear in the form of heat. Concrete which is commonly used as a shielding material in nuclear power plants must be able to withstand the temperatures and temperature gradients appearing in the shield due to this heat. High temperatures lead to dehydration of the concrete and in turn reduce the shielding effectiveness of the material. Adequate cooling needs to be provided in these shields in order to limit the maximum temperature. This paper describes a method to estimate steady state and transient temperature distribution in reactor shields. The results due to loss of coolant in the coolant tubes have been studied and presented in the paper. (author). 5 figs

  1. Preliminary shielding calculation for the system of CyberKnife robotic radiosurgery; Calculo de blindagem preliminar para o sistema de radiocirurgia robotica CyberKnife

    Energy Technology Data Exchange (ETDEWEB)

    Toreti, Dalila; Xavier, Clarice; Moura, Fabio, E-mail: clarice.xavier@rem.ind.b, E-mail: fabio.moura@rem.ind.b [REM Industria e Comercio Ltda., Sao Paulo, SP (Brazil)

    2011-10-26

    The CyberKnife robotic system uses a manipulator with six grade of freedom for positioning a 6 MV Linac accelerator for treatment of lesions. This paper presents calculations for a standard room, with 200 cm of thickness walls primary, build for a CyberKnife system, and calculations for a room originally designed for a Linac conventional (with gantry), with secondary barriers of 107 cm thickness. After the realization of shielding for both rooms, the results shown that walls of standard room with 200 cm thickness are adequate for the secondary shield, and for a room with a conventional Linac, from all six evaluated points, two would require additional shielding of nine cm and four cm of concrete with 2.4 g/cubic cm. This shows that the CyberKnife system can be installed in a originally designed room for a conventional Linac with neither restrict nor any shielding, since no incidence of beams on the secondary barriers is existent

  2. Nuclear shields

    International Nuclear Information System (INIS)

    Linares, R.C.; Nienart, L.F.; Toelcke, G.A.

    1976-01-01

    A process is described for preparing melt-processable nuclear shielding compositions from chloro-fluoro substituted ethylene polymers, particularly PCTFE and E-CTFE, containing 1 to 75 percent by weight of a gadolinium compound. 13 claims, no drawings

  3. Neutron shielding material based on colemanite and epoxy resin

    International Nuclear Information System (INIS)

    Okuno, K.

    2005-01-01

    In recent years, there has been a need for compact shielding design such as self-shielding of a PET cyclotron or up-gradation of radiation machinery in existing facilities. In these cases, high performance shielding materials are needed. Concrete or polyethylene have been used for a neutron shield. However, for compact shielding, they fall short in terms of performance or durability. Therefore, a new type of neutron shielding material based on epoxy resin and colemanite has been developed. Slab attenuation experiments up to 40 cm for the new shielding material were carried out using a 252 Cf neutron source. Measurement was carried out using a REM-counter, and compared with calculation. The results show that the shielding performance is better than concrete and polyethylene mixed with 10 wt% boron oxide. From the result, we confirmed that the performance of the new material is suitable for practical use. (authors)

  4. Structure of steel reactor building and construction method therefor

    International Nuclear Information System (INIS)

    Yamakawa, Toshikimi.

    1997-01-01

    The building of the present invention contains a reactor pressure vessel, and has double steel plate walls endurable to elevation of inner pressure and keeping airtightness, and shielding concretes are filled between the double steel plate walls. It also has empty double steel plate walls not filled with concretes and has pipelines, vent ducts, wirings and a support structures for attaching them between the double steel plate walls. It is endurable to a great inner pressure satisfactory and keeps airtightness by the two spaced steel plates. It can be greatly reduced in the weight, and can be manufactured efficiently with high quality in a plant by so called module construction, and the dimension of the entire of the reactor building can be reduced. It is constructed in a dock, transported on the sea while having the space between the two steel plate walls as a ballast tanks, placed in the site, and shielding concretes are filled between the double steel plate walls. The term for the construction can be reduced, and the cost for the construction can be saved. (N.H.)

  5. Analysis of Shield Construction in Spherical Weathered Granite Development Area

    Science.gov (United States)

    Cao, Quan; Li, Peigang; Gong, Shuhua

    2018-01-01

    The distribution of spherical weathered bodies (commonly known as "boulder") in the granite development area directly affects the shield construction of urban rail transit engineering. This paper is based on the case of shield construction of granite globular development area in Southern China area, the parameter control in shield machine selection and shield advancing during the shield tunneling in this special geological environment is analyzed. And it is suggested that shield machine should be selected for shield construction of granite spherical weathered zone. Driving speed, cutter torque, shield machine thrust, the amount of penetration and the speed of the cutter head of shield machine should be controlled when driving the boulder formation, in order to achieve smooth excavation and reduce the disturbance to the formation.

  6. Method of constructing shielding wall

    International Nuclear Information System (INIS)

    Nagao, Tetsuya.

    1990-01-01

    For instance, surfaces of lead particles each formed into a sphere of about 0.5 to 0.3 mm grain size are coated with a coating material of a synthetic resin comprising a polymeric material such as teflon. Subsequently, the floated lead particle are kneaded with concrete materials and then poured into a molding die by way of a hose. After coagulation, the molding die is removed to complete shielding walls in which lead particles are scattered substantially at an equal distance. In this way, since the lead particles are mixed into the shielding walls, shielding effects can be improved by so much as the lead particles are mixed, thereby enabling to reduce the thickness of the shielding walls. Further, since the lead particles are coated with the coating material, the lead particles are insulated from the concrete materials, thereby enabling to prevent the corrosion of the lead particles. Furthermore, since the lead particles and the concrete materials can be transported with ease, operation labors can be reduced. (T.M.)

  7. Shield cost minimization using SWAN

    International Nuclear Information System (INIS)

    Watkins, E.F.; Annese, C.E.; Greenspan, E.

    1993-01-01

    The common approach to the search for minimum cost shield designs is open-quotes trial-and-errorclose quotes; it proceeds as follows: 1. Based on prior experience and intuition, divide the shield into zones and assume their composition. 2. Solve the transport equation and calculate the relevant performance characteristics. 3. Change the composition or the geometry of one or a few of the zones and repeat step 2. 4. Repeat step 3 many times until the shield design appears to be optimal. 5. Select a different set of constituents and repeat steps 2,3, and 4. 6. Repeate step 5 a few or many times until the designer can point to the most cost-effective design

  8. Gravity Scaling of a Power Reactor Water Shield

    International Nuclear Information System (INIS)

    Reid, Robert S.; Pearson, J. Boise

    2008-01-01

    Water based reactor shielding is being considered as an affordable option for potential use on initial lunar surface reactor power systems. Heat dissipation in the shield from nuclear sources must be rejected by an auxillary thermal hydraulic cooling system. The mechanism for transferring heat through the shield is natural convection between the core surface and an array of thermosyphon radiator elements. Natural convection in a 100 kWt lunar surface reactor shield design has been previously evaluated at lower power levels (Pearson, 2006). The current baseline assumes that 5.5 kW are dissipated in the water shield, the preponderance on the core surface, but with some volumetric heating in the naturally circulating water as well. This power is rejected by a radiator located above the shield with a surface temperature of 370 K. A similarity analysis on a water-based reactor shield is presented examining the effect of gravity on free convection between a radiation shield inner vessel and a radiation shield outer vessel boundaries. Two approaches established similarity: 1) direct scaling of Rayleigh number equates gravity-surface heat flux products, 2) temperature difference between the wall and thermal boundary layer held constant on Earth and the Moon. Nussult number for natural convection (laminar and turbulent) is assumed of form Nu = CRa n . These combined results estimate similarity conditions under Earth and Lunar gravities. The influence of reduced gravity on the performance of thermosyphon heat pipes is also examined

  9. The assembly of the disk shielding is finished.

    CERN Multimedia

    Vincent Hedberg

    At the end of March, the shielding project engineer, Jan Palla, could draw a sigh of relief when the fourth and final rotation of the disk shielding was carried out without incident. The two 80-ton heavy shielding assemblies were built in a horizontal position and they had to be first turned upside-down and then rotated to a vertical position during the assembly. The relatively thin disk plate with a diameter of 9 meters, made this operation quite delicate and a lot of calculation work and strengthening of the shielding was carried out before the rotations could take place. The disk shielding is being turned upside-down. The stainless steel cylinder in the centre supports the shielding as well as the small muon wheel. The two disk shielding assemblies consist of different materials such as bronze, gray steel, cast iron, stainless steel, boron doped polyethylene and lead. The project is multinational with the major pieces having been made by companies in Armenia, Serbia, Spain, Bulgaria, Italy, Slovaki...

  10. Shielding device for control rod in nuclear reactor

    International Nuclear Information System (INIS)

    Sakamaki, Kazuo; Tomatsu, Tsutomu.

    1995-01-01

    The device of the present invention shields radiation emitted from control rods to greatly reduce an operator's radiation exposure even if reactor water level is lowered and the upper portion of the control rod is exposed upon inspection of a BWR type reactor. Namely, a shield assembly has a structure comprising a set of four columnar shields in a two-row and two-column arrangement, which can be inserted into a control rod guide tube. Upon conducting inspection, the control rod is lowered into the control rod guide tube, and in this state, the columnar shields of the shield assembly are inserted to the control rod in the control rod guide tube. With such procedures, the upper portion of the control rod protruded from the control rod guide tube is covered with the shield assembly. As a result, radiation leaked from the control rod is shielded. Accordingly, irradiation in the reactor due to leaked radiation can be prevented thereby enabling to reduce an operator's radiation exposure. (I.S.)

  11. Thick Galactic Cosmic Radiation Shielding Using Atmospheric Data

    Science.gov (United States)

    Youngquist, Robert C.; Nurge, Mark A.; Starr, Stanley O.; Koontz, Steven L.

    2013-01-01

    NASA is concerned with protecting astronauts from the effects of galactic cosmic radiation and has expended substantial effort in the development of computer models to predict the shielding obtained from various materials. However, these models were only developed for shields up to about 120 g!cm2 in thickness and have predicted that shields of this thickness are insufficient to provide adequate protection for extended deep space flights. Consequently, effort is underway to extend the range of these models to thicker shields and experimental data is required to help confirm the resulting code. In this paper empirically obtained effective dose measurements from aircraft flights in the atmosphere are used to obtain the radiation shielding function of the earth's atmosphere, a very thick shield. Obtaining this result required solving an inverse problem and the method for solving it is presented. The results are shown to be in agreement with current code in the ranges where they overlap. These results are then checked and used to predict the radiation dosage under thick shields such as planetary regolith and the atmosphere of Venus.

  12. Radiation shield for PWR reactors

    International Nuclear Information System (INIS)

    Esenov, Amra; Pustovgar, Andrey

    2013-01-01

    One of the chief structures of a reactor pit is a 'dry' shield. Setting up a 'dry' shield includes the technologically complex process of thermal processing of serpentinite concrete. Modern advances in the area of materials technology permit avoiding this complex and demanding procedure, and this significantly decreases the duration, labor intensity, and cost of setting it up. (orig.)

  13. Concrete shielding exterior to iron

    International Nuclear Information System (INIS)

    Yurista, P.; Cossairt, D.

    1983-08-01

    A rule of thumb at Fermilab has been to use 3 feet of concrete exterior to iron shielding. A recent design of a shield with a severe dimensional constraint has prompted a re-evaluation of this rule of thumb and has led to the following calculations of the concrete thickness required to nullify this problem. 4 references, 4 figures

  14. 209-E Building -- Response to ventilation failure evaluation

    International Nuclear Information System (INIS)

    Foust, D.J.

    1998-01-01

    This document provides an evaluation and recommendations for radiological workplace air monitoring and response to ventilation failure for the Critical Mass Laboratory, 209-E Building. The Critical Mass Laboratory, part of the 209-E Building, was designed to provide a heavily shielded room where plutonium and uranium liquid solutions could be brought into various critical configurations under readily controlled and monitored conditions. The facility is contained within a one-story L-shaped concrete block and reinforced concrete building. One wing houses offices, a control room, shops, and a common area while the other wing includes an equipment room, the change room, work areas, and the two-story Critical Assembly Room (CAR). Three of the rooms contain radiologically contaminated equipment and materials

  15. Radiation shielding activities at the OECD/Nuclear Energy Agency

    International Nuclear Information System (INIS)

    Sartori, Enrico; Vaz, Pedro

    2000-01-01

    The OECD Nuclear Energy Agency (NEA) has devoted considerable effort over the years to radiation shielding issues. The issues are addressed through international working groups. These activities are carried out in close co-ordination and co-operation with the Radiation Safety Information Computational Center (RSICC). The areas of work include: basic nuclear data activities in support of radiation shielding, computer codes, shipping cask shielding applications, reactor pressure vessel dosimetry, shielding experiments database. The method of work includes organising international code comparison exercises and benchmark studies. Training courses on radiation shielding computer codes are organised regularly including hands-on experience in modelling skills. The scope of the activity covers mainly reactor shields and spent fuel transportation packages, but also fusion neutronics and in particular shielding of accelerators and irradiation facilities. (author)

  16. Shielded cells transfer automation

    International Nuclear Information System (INIS)

    Fisher, J.J.

    1984-01-01

    Nuclear waste from shielded cells is removed, packaged, and transferred manually in many nuclear facilities. Radiation exposure is absorbed by operators during these operations and limited only through procedural controls. Technological advances in automation using robotics have allowed a production waste removal operation to be automated to reduce radiation exposure. The robotic system bags waste containers out of glove box and transfers them to a shielded container. Operators control the system outside the system work area via television cameras. 9 figures

  17. Radiation shielding method for pipes, etc

    International Nuclear Information System (INIS)

    Nagao, Tetsuya; Takahashi, Shuichi.

    1988-01-01

    Purpose: To constitute shielding walls of a dense structure around pipes and enable to reduce the wall thickness thereof upon periodical inspection, etc. for nuclear power plants. Constitution: For those portions of pipes requring shieldings, cylindrical vessels surrounding the portions are disposed and connected to a mercury supply system, a mercury discharge system and a freezing system for solidifying mercury. After charging mercury in a tank by way of a supply hose to the cylindrical vessels, the temperature of the mercury is lowered below the freezing point thereof to solidify the mercury while circulating cooling medium, to thereby form dense cylindrical radioactive-ray shielding walls. The specific gravity of mercury is greater than that of lead and, accordingly, the thickness of the shielding walls can be reduced as compared with the conventional wall thickness of the entire laminates. (Takahashi, M.)

  18. Testing of the PELSHIE shielding code using Benchmark problems and other special shielding models

    International Nuclear Information System (INIS)

    Language, A.E.; Sartori, D.E.; De Beer, G.P.

    1981-08-01

    The PELSHIE shielding code for gamma rays from point and extended sources was written in 1971 and a revised version was published in October 1979. At Pelindaba the program is used extensively due to its flexibility and ease of use for a wide range of problems. The testing of PELSHIE results with the results of a range of models and so-called Benchmark problems is desirable to determine possible weaknesses in PELSHIE. Benchmark problems, experimental data, and shielding models, some of which were resolved by the discrete-ordinates method with the ANISN and DOT 3.5 codes, were used for the efficiency test. The description of the models followed the pattern of a classical shielding problem. After the intercomparison with six different models, the usefulness of the PELSHIE code was quantitatively determined [af

  19. Shield verification and validation action matrix summary

    International Nuclear Information System (INIS)

    Boman, C.

    1992-02-01

    WSRC-RP-90-26, Certification Plan for Reactor Analysis Computer Codes, describes a series of action items to be completed for certification of reactor analysis computer codes used in Technical Specifications development and for other safety and production support calculations. Validation and verification are integral part of the certification process. This document identifies the work performed and documentation generated to satisfy these action items for the SHIELD, SHLDED, GEDIT, GENPRT, FIPROD, FPCALC, and PROCES modules of the SHIELD system, it is not certification of the complete SHIELD system. Complete certification will follow at a later date. Each action item is discussed with the justification for its completion. Specific details of the work performed are not included in this document but can be found in the references. The validation and verification effort for the SHIELD, SHLDED, GEDIT, GENPRT, FIPROD, FPCALC, and PROCES modules of the SHIELD system computer code is completed

  20. Integrating Army Aviation into the Combined Arms Team: Operational Art in Desert Shield and Desert Storm

    Science.gov (United States)

    2017-05-25

    King of Saudi Arabia. The conversation took place prior to an Organization of the Petroleum Exporting Countries (OPEC) meeting of Arab Gulf members...Blumberg and Christopher C. French, eds., The Persian Gulf War: Views from the Social and Behavioral Sciences (Lanham, MD: University Press of America...1994), 17. 72 Blumberg and French, The Persian Gulf War, 29. 20 building up forces in northeast Saudi Arabia during Operation Desert Shield, in

  1. Scale-4 shipping cask shielding applications

    International Nuclear Information System (INIS)

    Broadhead, B.L.; Parks, C.V.

    1991-01-01

    This paper reports the application of the SCALE-4 shielding sequences SAS1 and SAS4 to the problem set distributed by the Organization for Economic Cooperation and Development (OECD) Working Group on Shielding Assessment of Transportation Packages. In many cases, additional comparison are made with MCNP and QADS solutions to provide a complete cross-check of methods, cross sections, geometry, etc. The results from this effort permit the evaluation of a number of approximations and effects that must be considered in a typical shielding analysis of a transportation cask

  2. Radiation shielding for TFTR DT diagnostics

    International Nuclear Information System (INIS)

    Ku, L.P.; Johnson, D.W.; Liew, S.L.

    1994-01-01

    The authors illustrate the designs of radiation shielding for the TFTR DT diagnostics using the ACX and TVTS systems as specific examples. The main emphasis here is on the radiation transport analyses carried out in support of the designs. Initial results from the DT operation indicate that the diagnostics have been functioning as anticipated and the shielding designs are satisfactory. The experience accumulated in the shielding design for the TFTR DT diagnostics should be useful and applicable to future devices, such as TPX and ITER, where many similar diagnostic systems are expected to be used

  3. Optimization of a partially non-magnetic primary radiation shielding for the triple-axis spectrometer PANDA at the Munich high-flux reactor FRM-II

    CERN Document Server

    Pyka, N M; Rogov, A

    2002-01-01

    Monte Carlo simulations have been used to optimize the monochromator shielding of the polarized cold-neutron triple-axis spectrometer PANDA at the Munich high-flux reactor FRM-II. By using the Monte Carlo program MCNP-4B, the density of the total spectrum of incoming neutrons and gamma radiation from the beam tube SR-2 has been determined during the three-dimensional diffusion process in different types of heavy concrete and other absorbing material. Special attention has been paid to build a compact and highly efficient shielding, partially non-magnetic, with a total biological radiation dose of less than 10 mu Sv/h at its outsides. Especially considered was the construction of an albedo reducer, which serves to reduce the background in the experiment outside the shielding. (orig.)

  4. Using natural local materials for developing special radiation shielding concretes, and deduction of its shielding characteristics

    International Nuclear Information System (INIS)

    Kharita, M. H.; Takeyeddin, M.; Al-Nassar, M.; Yousef, S.

    2006-06-01

    Concrete is considered as the most important material to be used for radiation shielding in facilities contain radioactive sources and radiation generating machines. The concrete shielding properties may vary depending on the construction of the concrete, which is highly relative to the composing aggregates i.e. aggregates consist about 70 - 80% of the total weight of normal concrete. In this project tow types of concrete used in Syria (in Damascus and Aleppo) had been studied and their shielding properties were defined for gamma ray from Cs-137 and Co-60 sources, and for neutrons from Am-Be source. About 10% reduction in HVL was found in the comparison between the tow concrete types for both neutrons and gammas. Some other types of concrete were studied using aggregates from different regions in Syria, to improve the shielding properties of concrete, and another 10% of reduction was achieved in comparison with Damascene concrete (20% in comparison with the concrete from Aleppo) for both neutrons and gamma rays. (author)

  5. [Trial manufacture of a plunger shield for a disposable plastic syringe].

    Science.gov (United States)

    Murakami, Shigeki; Emoto, Takashi; Mori, Hiroshige; Fujita, Katsuhisa; Kubo, Naoki

    2008-08-20

    A syringe-type radiopharmaceutical being supplied by a manufacturer has a syringe shield and a plunger shield, whereas an in-hospital labeling radiopharmaceutical is administered by a disposable plastic syringe without the plunger shield. In cooperation with Nihon Medi-Physics Co. Ltd., we have produced a new experimental plunger shield for the disposable plastic syringe. In order to evaluate this shielding effect, we compared the leaked radiation doses of our plunger shield with those of the syringe-type radiopharmaceutical (Medi shield type). Our plunger shield has a lead plate of 21 mm in diameter and 3 mm thick. This shield is equipped with the plunger-end of a disposal plastic syringe. We sealed 99mTc solution into a plastic syringe (Terumo Co.) of 5 ml with our plunger shield and Medi shield type of 2 ml. We measured leaked radiation doses around syringes using fluorescent glass dosimeters (Dose Ace). The number of measure points was 18. The measured doses were converted to 70 microm dose equivalent at 740 MBq of radioactivity. The results of our plunger shield and the Medi shield type were as follows: 4-13 microSv/h and 3-14 microSv/h at shielding areas, 3-545 microSv/h and 6-97 microSv/h at non-shielding areas, 42-116 microSv/h and 88-165 microSv/h in the vicinity of the syringe shield, and 1071 microSv/h and 1243 microSv/h at the front of the needle. For dose rates of shielding areas around the syringe, the shielding effects were approximately the same as those of the Medi shield type. In conclusion, our plunger shield may be useful for reducing finger exposure during the injection of an in-hospital labeled radiopharmaceutical.

  6. Thermal testing of solid neutron shielding materials

    International Nuclear Information System (INIS)

    Boonstra, R.H.

    1992-09-01

    Two legal-weight truck casks the GA-4 and GA-9, will carry four PWR and nine BWR spent fuel assemblies, respectively. Each cask has a solid neutron shielding material separating the steel body and the outer steel skin. In the thermal accident specified by NRC regulations in 10CFR Part 71, the cask is subjected to an 800 degree C environment for 30 minutes. The neutron shield need not perform any shielding function during or after the thermal accident, but its behavior must not compromise the ability of the cask to contain the radioactive contents. In May-June 1989 the first series of full-scale thermal tests was performed on three shielding materials: Bisco Products NS-4-FR, and Reactor Experiments RX-201 and RX-207. The tests are described in Thermal Testing of Solid Neutron Shielding Materials, GA-AL 9897, R. H. Boonstra, General Atomics (1990), and demonstrated the acceptability of these materials in a thermal accident. Subsequent design changes to the cask rendered these materials unattractive in terms of weight or adequate service temperature margin. For the second test series, a material specification was developed for a polypropylene based neutron shield with a softening point of at least 280 degree F. The neutron shield materials tested were boronated (0.8--4.5%) polymers (polypropylene, HDPE, NS-4). The Envirotech and Bisco materials are not polypropylene, but were tested as potential backup materials in the event that a satisfactory polypropylene could not be found

  7. Development of neutron shielding material for cask

    International Nuclear Information System (INIS)

    Najima, K.; Ohta, H.; Ishihara, N.; Matsuoka, T.; Kuri, S.; Ohsono, K.; Hode, S.

    2001-01-01

    Since 1980's Mitsubishi Heavy Industries, Ltd (MHI) has established transport and storage cask design 'MSF series' which makes higher payload and reliability for long term storage. MSF series transport and storage cask uses new-developed neutron shielding material. This neutron shielding material has been developed for improving durability under high condition for long term. Since epoxy resin contains a lot of hydrogen and is comparatively resistant to heat, many casks employ epoxy base neutron shielding material. However, if the epoxy base neutron shielding material is used under high temperature condition for a long time, the material deteriorates and the moisture contained in it is released. The loss of moisture is in the range of several percents under more than 150 C. For this reason, our purpose was to develop a high durability epoxy base neutron shielding material which has the same self-fire-extinction property, high hydrogen content and so on as conventional. According to the long-time heating test, the weight loss of this new neutron shielding material after 5000 hours heating has been lower than 0.04% at 150 C and 0.35% at 170 C. A thermal test was also performed: a specimen of neutron shielding material covered with stainless steel was inserted in a furnace under condition of 800 C temperature for 30 minutes then was left to cool down in ambient conditions. The external view of the test piece shows that only a thin layer was carbonized

  8. Radiation shielding for fission reactors

    Energy Technology Data Exchange (ETDEWEB)

    Oka, Yoshiaki [Tokyo Univ., Nuclear Engineering Research Laboratory, Tokyo (Japan)

    2000-03-01

    Radiation shielding aspects relating fission reactors have been reviewed. Domestic activities in the past five years have been mainly described concerning nuclear data, calculation methods, shielding and skyshine experiments, Advanced Boiling Water Reactor (ABWR), Advanced Pressurized Water Reactor (APWR), High Temperature Engineering Test Reactor (HTTR), Experimental and Prototype Fast Reactors (JOYO, MONJU), Demonstration FBR, core shroud replacement of BWR, and spent fuel transportation cask and vessel. These studies have valuable information in safety and cost reduction issues of fission reactor design for not only existing reactors but also new reactor concepts in the next century. It has been concluded that we should maintain existing shielding technologies and improve these data and methods for coming generations in the next millennium. (author)

  9. Gonadal shield.

    Science.gov (United States)

    Purdy, J A; Stiteler, R D; Glasgow, G P; Mill, W B

    1975-10-01

    A secondary gonadal shield for use in the pelvic irradiation of males was designed and built using material and apparatus available with the Cerrobend blocking system. The gonadal dose was reduced to approximately 1.5 to 2.5% of the given dose.

  10. SU-F-E-13: Design and Fabrication of Gynacological Brachytherapy Shielding & Non Shielding Applicators Using Indigenously Developed 3D Printing Machine

    International Nuclear Information System (INIS)

    Shanmugam, S

    2016-01-01

    Purpose: In this innovative work we have developed Gynecological Brachytherapy shielding & Non Shielding Applicators and compared with the commercially available applicators by using the indigenously developed 3D Printing machine. Methods: We have successfully indigenously developed the 3D printing machine. Which contain the 3 dimensional motion platform, Heater unit, base plate, ect… To fabricate the Gynecological Brachytherapy shielding & non shielding applicators the 3D design were developed in the computer as virtual design. This virtual design is made in a CAD computer file using a 3D modeling program. Separate programme for the shielding & non shielding applicators. We have also provided the extra catheter insert provision in the applicator for the multiple catheter. The DICOM file of the applicator were then converted to stereo Lithography file for the 3D printer. The shielding & Non Shielding Applicators were printed on a indigenously developed 3D printer material. The same dimensions were used to develop the applicators in the acrylic material also for the comparative study. A CT scan was performed to establish an infill-density calibration curve as well as characterize the quality of the print such as uniformity and the infill pattern. To commission the process, basic CT and dose properties of the printing materials were measured in photon beams and compared against water and soft tissue. Applicator were then scanned to confirm the placement of multiple catheter position. Finally dose distributions with rescanned CTs were compared with those computer-generated applicators. Results: The doses measured from the ion Chamber and X-Omat film test were within 2%. The shielded applicator reduce the rectal dose comparatively with the non shielded applicator. Conclusion: As of submission 3 unique cylinders have been designed, printed, and tested dosimetrically. A standardizable workflow for commissioning custom 3D printed applicators was codified and will be

  11. SU-F-E-13: Design and Fabrication of Gynacological Brachytherapy Shielding & Non Shielding Applicators Using Indigenously Developed 3D Printing Machine

    Energy Technology Data Exchange (ETDEWEB)

    Shanmugam, S

    2016-06-15

    Purpose: In this innovative work we have developed Gynecological Brachytherapy shielding & Non Shielding Applicators and compared with the commercially available applicators by using the indigenously developed 3D Printing machine. Methods: We have successfully indigenously developed the 3D printing machine. Which contain the 3 dimensional motion platform, Heater unit, base plate, ect… To fabricate the Gynecological Brachytherapy shielding & non shielding applicators the 3D design were developed in the computer as virtual design. This virtual design is made in a CAD computer file using a 3D modeling program. Separate programme for the shielding & non shielding applicators. We have also provided the extra catheter insert provision in the applicator for the multiple catheter. The DICOM file of the applicator were then converted to stereo Lithography file for the 3D printer. The shielding & Non Shielding Applicators were printed on a indigenously developed 3D printer material. The same dimensions were used to develop the applicators in the acrylic material also for the comparative study. A CT scan was performed to establish an infill-density calibration curve as well as characterize the quality of the print such as uniformity and the infill pattern. To commission the process, basic CT and dose properties of the printing materials were measured in photon beams and compared against water and soft tissue. Applicator were then scanned to confirm the placement of multiple catheter position. Finally dose distributions with rescanned CTs were compared with those computer-generated applicators. Results: The doses measured from the ion Chamber and X-Omat film test were within 2%. The shielded applicator reduce the rectal dose comparatively with the non shielded applicator. Conclusion: As of submission 3 unique cylinders have been designed, printed, and tested dosimetrically. A standardizable workflow for commissioning custom 3D printed applicators was codified and will be

  12. Space nuclear reactor shields for manned and unmanned applications

    International Nuclear Information System (INIS)

    McKissock, B.I.; Bloomfield, H.S.

    1990-01-01

    Missions which use nuclear reactor power systems require radiation shielding of payload and/or crew areas to predetermined dose rates. Since shielding can become a significant fraction of the total mass of the system, it is of interest to show the effect of various parameters on shield thickness and mass for manned and unmanned applications. Algorithms were developed to give the thicknesses needed if reactor thermal power, separation distances and dose rates are given as input. The thickness algorithms were combined with models for four different shield geometries to allow tradeoff studies of shield volume and mass for a variety of manned and unmanned missions. The shield design tradeoffs presented in this study include the effects of: higher allowable dose rates; radiation hardened electronics; shorter crew exposure times; shield geometry; distance of the payload and/or crew from the reactor; and changes in the size of the shielded area. Specific NASA missions that were considered in this study include unmanned outer planetary exploration, manned advanced/evolutionary space station and advanced manned lunar base. (author)

  13. Space nuclear reactor shields for manned and unmanned applications

    International Nuclear Information System (INIS)

    Mckissock, B.I.; Bloomfield, H.S.

    1989-01-01

    Missions which use nuclear reactor power systems require radiation shielding of payload and/or crew areas to predetermined dose rates. Since shielding can become a significant fraction of the total mass of the system, it is of interest to show the effect of various parameters on shield thickness and mass for manned and unmanned applications. Algorithms were developed to give the thicknesses needed if reactor thermal power, separation distances, and dose rates are given as input. The thickness algorithms were combined with models for four different shield geometries to allow tradeoff studies of shield volume and mass for a variety of manned and unmanned missions. Shield design tradeoffs presented in this study include the effects of: higher allowable dose rates; radiation hardened electronics; shorter crew exposure times; shield geometry; distance of the payload and/or crew from the reactor; and changes in the size of the shielded area. Specific NASA missions that were considered in this study include unmanned outer planetary exploration, manned advanced/evolutionary space station, and advanced manned lunar base

  14. Effect of Gamma Ray Energies and Steel Fiber addition by Weight on some Shielding Properties of Limestone Concrete

    International Nuclear Information System (INIS)

    Abd El-Latifa, A.A.; Ikraiam, F.A.; Abd El-Latifa, A.A.; Abd Elazziz, A.; Abd Elazziz, A.

    2010-01-01

    The mass attenuation coefficient , the build up factor , the half value thickness X 1/2 , and tenth value thickness X 1/10 of fiber concrete , 0% , 1% , 2%, 3%, and 4% by weight fiber content were measured at different gamma ray energies in MeV, 0.511,1.274 from Na-22 ,1.17 ,1.33 from Co-60 and 0.662 from Cs-137 . Appreciable variations were noted in the former nuclear parameters, due to the changes in the fiber content and gamma ray energies .A comparison of shielding properties of concrete with fiber content and reference sample(concrete without fiber ) have proven that the addition of steel fibers by weight to concrete have a potential application as a radiation shielding

  15. Severe hypovitaminosis D correlates with increased inflammatory markers in HIV infected patients

    Directory of Open Access Journals (Sweden)

    Ansemant Thiphaine

    2013-01-01

    Full Text Available Abstract Background Even though it has been suggested that antiretroviral therapy has an impact on severe hypovitaminosis D (SHD in HIV infected patients, it could be speculated that the different levels of residual inflammation on HAART (Highly Active Anti Retroviral Therapy could contribute to SHD and aggravate bone catabolism in these patients. Methods A cross-sectional study was carried out in an unselected cohort of 263 HIV infected outpatients consulting during Spring 2010. Clinical examinations were performed and medical history, food habits, sun exposure and addictions were collected. Fasting blood samples were taken for immunological, virological, inflammation, endocrine and bone markers evaluations. Results Ninety-five (36% patients had SHD. In univariate analysis, a significant and positive association was found between SHD and IL6 (p = 0.001, hsCRP (p = 0.04, increased serum C-Telopeptides X (CTX (p = 0.005 and Parathyroid Hormon (PTH (p Conclusions SHD is frequent and correlates with inflammation in HIV infected patients. Since SHD is also associated with falls and increased bone catabolism, it may be of interest to take into account not only the type of antiretroviral therapy but also the residual inflammation on HAART in order to assess functional and bone risks. This finding also suggests that vitamin D supplementation may be beneficial in these HIV-infected patients.

  16. Radiation shielding fiber and its manufacturing method

    Energy Technology Data Exchange (ETDEWEB)

    Tanaka, Koji; Ono, Hiroshi.

    1988-08-17

    Purpose: To manufacture radiation shielding fibers of excellent shielding effects. Method: Fibers containing more than 1 mmol/g of carboxyl groups are bonded with heavy metals, or they are impregnated with an aqueous solution containing water-soluble heavy metal salts dissolved therein. Fibers as the substrate may be any of forms such as short fibers, long fibers, fiber tows, webs, threads, knitting or woven products, non-woven fabrics, etc. It is however necessary that fibers contain more than 1 mmol/g, preferably, from 2 to 7 mmol/g of carboxylic groups. Since heavy metals having radiation shielding performance are bonded to the outer layer of the fibers and the inherent performance of the fibers per se is possessed, excellent radiation shielding performance can be obtained, as well as they can be applied with spinning, knitting or weaving, stitching, etc. thus can be used for secondary fiber products such as clothings, caps, masks, curtains, carpets, cloths, etc. for use in radiation shieldings. (Kamimura, M.).

  17. Mars Exploration Rover Heat Shield Recontact Analysis

    Science.gov (United States)

    Raiszadeh, Behzad; Desai, Prasun N.; Michelltree, Robert

    2011-01-01

    The twin Mars Exploration Rover missions landed successfully on Mars surface in January of 2004. Both missions used a parachute system to slow the rover s descent rate from supersonic to subsonic speeds. Shortly after parachute deployment, the heat shield, which protected the rover during the hypersonic entry phase of the mission, was jettisoned using push-off springs. Mission designers were concerned about the heat shield recontacting the lander after separation, so a separation analysis was conducted to quantify risks. This analysis was used to choose a proper heat shield ballast mass to ensure successful separation with low probability of recontact. This paper presents the details of such an analysis, its assumptions, and the results. During both landings, the radar was able to lock on to the heat shield, measuring its distance, as it descended away from the lander. This data is presented and is used to validate the heat shield separation/recontact analysis.

  18. Repository Waste Package Transporter Shielding Weight Optimization

    International Nuclear Information System (INIS)

    C.E. Sanders; Shiaw-Der Su

    2005-01-01

    The Yucca Mountain repository requires the use of a waste package (WP) transporter to transport a WP from a process facility on the surface to the subsurface for underground emplacement. The transporter is a part of the waste emplacement transport systems, which includes a primary locomotive at the front end and a secondary locomotive at the rear end. The overall system with a WP on board weights over 350 metric tons (MT). With the shielding mass constituting approximately one-third of the total system weight, shielding optimization for minimal weight will benefit the overall transport system with reduced axle requirements and improved maneuverability. With a high contact dose rate on the WP external surface and minimal personnel shielding afforded by the WP, the transporter provides radiation shielding to workers during waste emplacement and retrieval operations. This paper presents the design approach and optimization method used in achieving a shielding configuration with minimal weight

  19. Development of neutron shielding material using metathesis-polymer matrix

    Energy Technology Data Exchange (ETDEWEB)

    Sakurai, Yoshinori E-mail: ysakurai@rri.kyoto-u.ac.jp; Sasaki, Akira; Kobayashi, Tooru

    2004-04-21

    A neutron shielding material using a metathesis-polymer matrix, which is a thermosetting resin, was developed. This shielding material has characteristics that can be controlled for different mixing ratios of neutron absorbers and for formation in the laboratory. Additionally, the elastic modulus can be changed at the hardening process, from a flexible elastoma to a mechanically tough solid. Experiments were performed at the Kyoto University Research Reactor in order to determine the important characteristics of this metathesis-polymer shielding material, such as neutron shielding performance, secondary gamma-ray generation and activation. The metathesis-polymer shielding material was shown to be practical and as effective as the other available shielding materials, which mainly consist of thermoplastic resin.

  20. Shielding evaluation of moving bed onion irradiator by radiometry

    International Nuclear Information System (INIS)

    Venkataramani, R.; Sangurdekar, P.R.; Sarangapani, R.; Raipurkar, D.R.; Mehta, S.K.; Shastri, S.P.; Patil, K.B.; Bongirwar, D.R.

    1994-01-01

    A moving bed onion irradiator made from m.s. cladded lead slab shields designed to hold 20 kCi of 60 Co source was evaluated by radiometry with an 8 Ci 60 Co source from CRC-2 radiography camera. Some shielding losses in the irradiator noted by radiometry could be visualized by a thermocole model of the complex shielding assembly. These were rectified by appropriate lead filling. Significant shielding losses noted at cladding layer positions of slabs were attributed to lack of interlocking features in the slabs. These had to be rectified by provision of 3 TVL of additional all round shielding supplemented by local shielding at some positions. (author). 1 fig., 1 tab

  1. Status report of shielding investigation in Japan

    International Nuclear Information System (INIS)

    Shindo, M.

    1964-01-01

    The Japan Atomic Energy Research Institute (JAERI) was established in 1954, and immediately proceeded with the construction of a research reactor. The first symposium in Japan on nuclear energy was held in 1957. Most of the papers presented in the field of reactor shielding were limited to shielding materials and their fabrication. In the first stage of our investigations, our efforts were devoted to practical design studies of reactor shielding. As a result of these studies, it was found that the formulae at hand for calculations were inadequate, but at that time no electronic computer was available in Japan nor were theoretical calculations very actively undertaken. Problems on nuclear ship shielding had been investigated at the Ship Research Institute, since 1956 and many fruitful results had been obtained. About that time the Japan Atomic Industry Forum started activities and took the initiative in organizing shielding research. Research workers in the shipbuilding industry in particular have been seriously studying shielding problems. Few years after the first symposium, problems concerning more fundamental studies were treated by many research workers. Shielding experiments using radioisotopes were carried out and many fruitful results were obtained. They are described in the this paper. Medium size electronic computers became available in Japan, permitting a theoretical study group to make an active contribution. They produced some codes, and their results are also described in the following sections. This constituted the second stage of our investigations. A swimming-pool reactor, JRR-4 (Japan Research Reactor-4), has been under construction at JAERI since 1962 and will become critical in autumn 1964. After characteristic tests it will be a very powerful tool for the shielding investigations. This id the beginning of the third stage of investigations

  2. ANALISIS KESELAMATAN TERMOHIDROLIK BULK SHIELDING REAKTOR KARTINI

    Directory of Open Access Journals (Sweden)

    Azizul Khakim

    2015-10-01

    Full Text Available ABSTRAK ANALISIS KESELAMATAN TERMOHIDROLIK BULK SHIELDING REAKTOR KARTINI. Bulk shielding merupakan fasilitas yang terintegrasi dengan reaktor Kartini yang berfungsi sebagai penyimpanan sementara bahan bakar bekas. Fasilitas ini merupakan fasilitas yang termasuk dalam struktur, sistem dan komponen (SSK yang penting bagi keselamatan. Salah satu fungsi keselamatan dari sistem penanganan dan penyimpanan bahan bakar adalah mencegah kecelakaan kekritisan yang tak terkendali dan membatasi naiknya temperatur bahan bakar. Analisis keselamatan paling kurang harus mencakup analisis keselamatan dari sisi neutronik dan termo hidrolik Bulk shielding. Analisis termo hidrolik ditujukan untuk memastikan perpindahan panas dan proses pendinginan bahan bakar bekas berjalan baik dan tidak terjadi akumulasi panas yang mengancam integritas bahan bakar. Code tervalidasi PARET/ANL digunakan untuk analisis pendinginan dengan mode konveksi alam. Hasil perhitungan menunjukkan bahwa mode pendinginan konvekasi alam cukup memadai dalam mendinginkan panas sisa tanpa mengakibatkan kenaikan temperatur bahan bakar yang signifikan. Kata kunci: Bulk shielding, bahan bakar bekas, konveksi alam, PARET.   ABSTRACT THERMAL HYDRAULIC SAFETY ANALYSIS OF BULK SHIELDING KARTINI REACTOR. Bulk shielding is an integrated facility to Kartini reactor which is used for temporary spent fuels storage. The facility is one of the structures, systems and components (SSCs important to safety. Among the safety functions of fuel handling and storage are to prevent any uncontrolable criticality accidents and to limit the fuel temperature increase. Safety analyses should, at least, cover neutronic and thermal hydraulic calculations of the bulk shielding. Thermal hydraulic analyses were intended to ensure that heat removal and the process of the spent fuels cooling takes place adequately and no heat accumulation that challenges the fuel integrity. Validated code, PARET/ANL was used for analysing the

  3. Tungsten-based composite materials for fusion reactor shields

    International Nuclear Information System (INIS)

    Greenspan, E.; Karni, Y.

    1985-01-01

    Composite tungsten-based materials were recently proposed for the heavy constituent of compact fusion reactor shields. These composite materials will enable the incorporation of tungsten - the most efficient nonfissionable inelastic scattering (as well as good neutron absorbing and very good photon attenuating) material - in the shield in a relatively cheap way and without introducing voids (so as to enable minimizing the shield thickness). It is proposed that these goals be achieved by bonding tungsten powder, which is significantly cheaper than high-density tungsten, with a material having the following properties: good shielding ability and relatively low cost and ease of fabrication. The purpose of this work is to study the effectiveness of the composite materials as a function of their composition, and to estimate the economic benefit that might be gained by the use of these materials. Two materials are being considered for the binder: copper, second to tungsten in its shielding ability, and iron (or stainless steel), the common fusion reactor shield heavy constituent

  4. An attenuation Layer for Electromagnetic Shielding in X- Band Frequency

    Directory of Open Access Journals (Sweden)

    Vida Zaroushani

    2015-06-01

    Full Text Available Uncontrolled exposure to X-band frequency leads to health damage. One of the principles of radiation protection is shielding. But, conventional shielding materials have disadvantages. Therefore, studies of novel materials, as an alternative to conventional shielding materials, are required to obtain new electromagnetic shielding material. Therefore, this study investigated the electromagnetic shielding of two component epoxy thermosetting resin for the X - band frequency with workplace approach. Two components of epoxy resin mixed according to manufacturing instruction with the weight ratio that was 100:10 .Epoxy plates fabricated in three different thicknesses (2, 4 and 6mm and shielding effectiveness measured by Vector Network Analyzer. Then, shielding effectiveness measured by the scattering parameters.The results showed that 6mm thickness of epoxy had the highest and 2mm had the lowest average of shielding effectiveness in X-band frequency that is 4.48 and 1.9 dB, respectively. Also, shielding effectiveness increased by increasing the thickness. But this increasing is useful up to 4mm. Percentage shielding effectiveness of attenuation for 6, 4 and 2mm thicknesses is 64.35%, 63.31% and 35.40%. Also, attenuation values for 4mm and 6mm thicknesses at 8.53 GHz and 8.52 GHz frequency are 77.15% and 82.95%, respectively, and can be used as favourite shields for the above frequency. 4mm-Epoxy is a suitable candidate for shielding application in X-band frequency range but, in the lower section, 6mm thickness is recommended. Finely, the shielding matrix can be used for selecting the proper thickness for electromagnetic shielding in X- Band frequency.

  5. Using the Monte Carlo Coupling Technique to Evaluate the Shielding Ability of a Modular Shielding House to Accommodate Spent-Fuel Transportable Storage Casks

    International Nuclear Information System (INIS)

    Ueki, Kohtaro; Kawakami, Kazuo; Shimizu, Daisuke

    2003-01-01

    The Monte Carlo coupling technique with the coordinate transformation is used to evaluate the shielding ability of a modular shielding house that accommodates four spent-fuel transportable storage casks for two units. The effective dose rate distributions can be obtained as far as 300 m from the center of the shielding house. The coupling technique is created with the Surface Source Write (SSW) card and the Surface Source Read/Coordinate Transformation (SSR/CRT) card in the MCNP 4C continuous energy Monte Carlo code as the 'SSW-SSR/CRT calculation system'. In the present Monte Carlo coupling calculation, the total effective dose rates 100, 200, and 300 m from the center of the shielding house are estimated to be 1.69, 0.285, and 0.0826 (μSv/yr per four casks), respectively. Accordingly, if the distance between the center of the shielding house and the site boundary of the storage facility is kept at >300 m, approximately 2400 casks are able to be accommodated in the modular shielding houses, under the Japanese severe criterion of 50 μSv/yr at the site boundary. The shielding house alone satisfies not only the technical conditions but also the economic requirements.It became evident that secondary gamma rays account for >60% of the effective total dose rate at all the calculated points around the shielding house, most of which are produced from the water in the steel-water-steel shielding system of the shielding house. The remainder of the dose rate comes mostly from neutrons; the fission product and 60 Co activation gamma rays account for small percentages. Accordingly, reducing the secondary gamma rays is critical to improving not only the shielding ability but also the radiation safety of the shielding house

  6. Study on box shield tunneling method in trial field operation; Box shield koho jissho seko ni kansuru kosatsu

    Energy Technology Data Exchange (ETDEWEB)

    Tada, K.; Taniguchi, T. [Toda Corp., Tokyo, (Japan); Furukawa, K.; Nakagawa, K. [Yamaguchi University, Yamaguchi (Japan). Faculty of Engineering

    1997-03-20

    This paper describes a rectangular section shield tunneling method as a part of developments of non-circular section shield tunneling methods. The non-circular shield is drawing attention because of need of excavation in small land available in urban areas and between congested existing structures, as well as reduction in the excavated soil amount. A full-scale machine was fabricated to perform a natural ground excavation experiment. The cutter units comprising two each of drum cutters and ring cutters were arranged above and below, by which two tunnels of 40 m long with a cross section of 2.85 m {times} 2.85 m were excavated. The natural ground was supported safely by holding mud water pressures at cutting points constant, thus stability of the cutting points was ensured. Back-filling has made complete filling of tail void (clearance between a segment and the ground) possible, resulting in suppression in conditional change of the surrounding ground. Attitude control has been performed properly as a result of correct selection of shield jacks and use of deflection jacks. Broken-type over-cutters were used to have constructed tunnels with curve radius of 80 and 100 m with high accuracy. Thrust and propulsion speed of the shield do not differ from those of circular shields. Possibilities of this construction method were verified. 8 refs., 26 figs., 2 tabs.

  7. Shielding effectiveness of a unit of neuro physiology against electromagnetic interference

    International Nuclear Information System (INIS)

    Febles Santana, V.; Miguel Bilbao, S. de; Lubary Rodriguez, C. S.; Melian del Castillo, M. R.; Herraz Gomez, J. G.; Ramos Gonzalez, V.; Fernandez de Aldecoa, J. C.

    2011-01-01

    During construction of the new building Ambulatory Activity in the Hospital Universitario de Canarias (HUC), was designed and implemented the shield in the form of Faraday cage, five rooms adjacent to the Unit of Neuro physiology, located at the northeast corner 3C plant of the building, in order to sufficiently attenuate radio signals present in the medium and thus enable correct functionality of electro medical equipment free of artifacts caused by external electromagnetic fields. The experience held, once finished the work and commissioning the unit, is that interference is undesirable in some cases even hinder the proper development of medical diagnostic studies. Therefore, technical staff of the Engineering Branch of HUC, initiated a program of measures to determine the effectiveness of the Faraday cage constructed, checking the attenuation levels achieved for frequencies of interest and, if necessary, the deficiencies identified in the design and execution of it, and proposed improvements to minimize interference problems exist.

  8. use of the RESRAD-BUILD code to calculate building surface contamination limits

    International Nuclear Information System (INIS)

    Faillace, E.R.; LePoire, D.; Yu, C.

    1996-01-01

    Surface contamination limits in buildings were calculated for 226 Ra, 230 Th, 232 Th, and natural uranium on the basis of 1 mSv y -1 (100 mrem y -1 ) dose limit. The RESRAD-BUILD computer code was used to calculate these limits for two scenarios: building occupancy and building renovation. RESRAD-BUILD is a pathway analysis model designed to evaluate the potential radiological dose incurred by individuals working or living inside a building contaminated with radioactive material. Six exposure pathways are considered in the RESRAD-BUILD code: (1) external exposure directly from the source; (2) external exposure from materials deposited on the floor; (3) external exposure due to air submersion; (4) inhalation of airborne radioactive particles; (5) inhalation of aerosol indoor radon progeny; and (6) inadvertent ingestion of radioactive material, either directly from the sources or from materials deposited on the surfaces. The code models point, line, area, and volume sources and calculates the effects of radiation shielding, building ventilation, and ingrowth of radioactive decay products. A sensitivity analysis was performed to determine how variations in input parameters would affect the surface contamination limits. In most cases considered, inhalation of airborne radioactive particles was the primary exposure pathway. However, the direct external exposure contribution from surfaces contaminated with 226 Ra was in some cases the dominant pathway for building occupancy depending on the room size, ventilation rates, and surface release fractions. The surface contamination limits are most restrictive for 232 Th, followed by 230 Th, natural uranium, and 226 Ra. The results are compared with the surface contamination limits in the Nuclear Regulatory Commission's Regulatory Guide 1.86, which are most restrictive for 226 Ra and 230 Th, followed by 232 Th, and are least restrictive for natural uranium

  9. The construction of radiation shielding for baby ebm

    International Nuclear Information System (INIS)

    Mohd Rizal Md Chulan; Leo Kwee Wah; Lee Chee Huei; Muhamad Zahidee Taat; Fadzlie Nordin; Abu Bakar Mhd Ghazali; Mohd Yusof Ali; Mohd Rizal Mamat Ibrahim; Syed Nasaruddin Syed Idris; Mahmud Hamid; Mohd Khairi Mohd Said

    2005-01-01

    The construction of radiation shielding for electron beam machine, Baby EBM is necessary for prevention from x-ray (Bremstrahlung) that produced when electron bombarded the target material. The strength of produced x-ray is depending on electron energy and the atomic number of target material. In the construction process of radiation shielding, a few aspects need to be considered such as shielding material and its thickness to be used, mainframe for radiation shielding and the way fabrication to be done. In this project, the thickness of radiation shielding is calculated manually following the NCRP 51 guidelines whereas for frame design, shielding walls and fabrication is considered that the accelerator devices (accelerating tube, focusing device and neck) is vertically and the whole weight of Baby EBM. From the calculations, the thickness and the material for radiation shielding is to be used are 6mm lead. This radiation shielding has been tested (using the parameters that have been considered) to know the leak of radiation (at all surfaces) and direct radiation below 5 cm from the window. The value of high voltage that applied at accelerating tube is 80 kV and the voltage, current supply at electron gun is 3.0 V, 7.1 A respectively. The result of the testing found that dose rate under the window foil is more than 2000 mSv/hr and at all shielding surfaces are less than 0.5 mSv/hr, which is background reading and this is acceptable as compared to the theoretical calculation. The measurement was done using a survey meter typed Ludlum-model 3. (Author)

  10. The Fabrication of Internal Shielding using Provil and Cerrobend

    International Nuclear Information System (INIS)

    Kim Jong Hwa; Lee, Kang Hyun; Son, Jeong Hye

    1996-01-01

    The skin cancer is a highly curable disease which frequently occurs in the head and neck region exposed to the sun. When the eyelid is treated usually eye shield made of lead is used to protect the eyeball as a internal shield. For the same reason on internal shield should be used when the nose is treated when electron to protect the nasal mucosa. Our hospital made an internal shield for the treatment of the skin cancer on the nose using provil and cerrobend. The characteristics of the internal shield were examined.

  11. Design of radiation shielding for the proton therapy facility at the National Cancer Center in Korea

    International Nuclear Information System (INIS)

    Kim, J. W.; Kwon, J. W.; Lee, J.

    2005-01-01

    The design of radiation shielding was evaluated for a proton therapy facility being established at the National Cancer Center in Korea. The proton beam energy from a 230 MeV cyclotron is varied for therapy using a graphite target. This energy variation process produces high radiation and thus thick shielding walls surround the region. The evaluation was first carried out using analytical expressions at selected locations. Further detailed evaluations have been performed using the Monte Carlo method. Dose equivalent values were calculated to be compared with analytical results. The analytical method generally yielded more conservative values. With consideration of adequate occupancy factors annual dose equivalent rates are kept -1 in all areas. Construction of the building is expected to be completed near the end of 2004 and the installation of therapy equipments will begin a few months later. (authors)

  12. Cosmic Ray Interactions in Shielding Materials

    International Nuclear Information System (INIS)

    Aguayo Navarrete, Estanislao; Kouzes, Richard T.; Ankney, Austin S.; Orrell, John L.; Berguson, Timothy J.; Troy, Meredith D.

    2011-01-01

    This document provides a detailed study of materials used to shield against the hadronic particles from cosmic ray showers at Earth's surface. This work was motivated by the need for a shield that minimizes activation of the enriched germanium during transport for the MAJORANA collaboration. The materials suitable for cosmic-ray shield design are materials such as lead and iron that will stop the primary protons, and materials like polyethylene, borated polyethylene, concrete and water that will stop the induced neutrons. The interaction of the different cosmic-ray components at ground level (protons, neutrons, muons) with their wide energy range (from kilo-electron volts to giga-electron volts) is a complex calculation. Monte Carlo calculations have proven to be a suitable tool for the simulation of nucleon transport, including hadron interactions and radioactive isotope production. The industry standard Monte Carlo simulation tool, Geant4, was used for this study. The result of this study is the assertion that activation at Earth's surface is a result of the neutronic and protonic components of the cosmic-ray shower. The best material to shield against these cosmic-ray components is iron, which has the best combination of primary shielding and minimal secondary neutron production.

  13. Self-Shielding Of Transmission Lines

    Energy Technology Data Exchange (ETDEWEB)

    Christodoulou, Christos [Univ. of New Mexico, Albuquerque, NM (United States)

    2017-03-01

    The use of shielding to contend with noise or harmful EMI/EMR energy is not a new concept. An inevitable trade that must be made for shielding is physical space and weight. Space was often not as much of a painful design trade in older larger systems as they are in today’s smaller systems. Today we are packing in an exponentially growing number of functionality within the same or smaller volumes. As systems become smaller and space within systems become more restricted, the implementation of shielding becomes more problematic. Often, space that was used to design a more mechanically robust component must be used for shielding. As the system gets smaller and space is at more of a premium, the trades starts to result in defects, designs with inadequate margin in other performance areas, and designs that are sensitive to manufacturing variability. With these challenges in mind, it would be ideal to maximize attenuation of harmful fields as they inevitably couple onto transmission lines without the use of traditional shielding. Dr. Tom Van Doren proposed a design concept for transmission lines to a class of engineers while visiting New Mexico. This design concept works by maximizing Electric field (E) and Magnetic Field (H) field containment between operating transmission lines to achieve what he called “Self-Shielding”. By making the geometric centroid of the outgoing current coincident with the return current, maximum field containment is achieved. The reciprocal should be true as well, resulting in greater attenuation of incident fields. Figure’s 1(a)-1(b) are examples of designs where the current centroids are coincident. Coax cables are good examples of transmission lines with co-located centroids but they demonstrate excellent field attenuation for other reasons and can’t be used to test this design concept. Figure 1(b) is a flex circuit design that demonstrate the implementation of self-shielding vs a standard conductor layout.

  14. Preliminary radiation shielding design for BOOMERANG

    International Nuclear Information System (INIS)

    Donahue, Richard J.

    2002-01-01

    Preliminary radiation shielding specifications are presented here for the 3 GeV BOOMERANG Australian synchrotron light source project. At this time the bulk shield walls for the storage ring and injection system (100 MeV Linac and 3 GeV Booster) are considered for siting purposes

  15. Shielding Effectiveness of a Thin Film Window

    National Research Council Canada - National Science Library

    Johnson, Eric

    1998-01-01

    .... The predicted shielding effectiveness was 29 dB based on theoretical calculations. The error analysis of the shielding effectiveness showed that this predicted value was within the measurement error...

  16. Superconducting magnetic shields for neutral beam injectors. Final report

    International Nuclear Information System (INIS)

    1985-04-01

    Large high energy deuterium neutral beams which must be made from negative ions require extensive magnetic shielding against the intense fringe fields surrounding a magnetic fusion power plant. The feasibility of shielding by multilayer sheets of copper-superconducting laminated material was investigated. It was found that, if necessary fabrication techniques are developed, intrinsically stable type II superconductors will be able to shield against the magnetic fields of the fusion reactors. Among the immediate benefits of this research is better magnetic shields for neutral beam injectors in support of DOE's fusion program. Another application may be in the space vehicles, where difficulties in transporting heavy μ-metal sections may make a comparatively light superconducting shield attractive. Also, as high-field superconducting magnets find widespread applications, the need for high-intensity magnetic shielding will increase. As a result, the commercial market for the magnetic shields should expand along with the market for superconducting magnets

  17. Radiation shielding structure for concrete structure

    International Nuclear Information System (INIS)

    Oya, Hiroshi

    1998-01-01

    Crack inducing members for inducing cracks in a predetermined manner are buried in a concrete structure. Namely, a crack-inducing member comprises integrally a shielding plate and extended plates situated at the center of a wall and inducing plates vertically disposed to the boundary portion between them with the inducing plates being disposed each in a direction perforating the wall. There are disposed integrally a pair of the inducing plate spaced at a predetermined horizontal distance on both sides of the shielding plate so as to form a substantially crank-shaped cross section and extended plates formed in the extending direction of the shielding plate, and the inducing plates are disposed each in a direction perforating the wall. Then, cracks generated when stresses are exerted can be controlled, and generation of cracks passing through the concrete structure can be prevented reliably. The reliability of a radiation shielding effect can be enhanced remarkably. (N.H.)

  18. Evaluation of syringe shield effectiveness in handling radiopharmaceuticals

    Directory of Open Access Journals (Sweden)

    Cho Yong-In

    2015-01-01

    Full Text Available The purpose of this study was to evaluate the effectiveness of the radiation shield of radionuclide syringes and the personal dose equivalent by performing a simulation of radionuclides used in nuclear medicine diagnosis. In order to evaluate the dose depending on the distance between the radiation source and the ICRU sphere against the thickness of the shielding device, the distance at which a nuclear medicine worker may inadvertently come into contact with radiation from the radiation source was set at 0 cm to 30 cm according to the thickness of the shield, thus fixing the ICRU sphere. For a dose evaluation, Hp(10, Hp(3, and Hp(0.07 measurable in specific depth of the ICRU were evaluated. It was found that a dose measured on skin surface of nuclear medicine workers was relatively higher, that the dose varied in relation to the thickness of the radiation shield, and that the shielding effect decreased for some radiation sources such as 67Ga and 111In. It proved necessary to increase thickness of shielding device to the radiation sources such as 67Ga and 111In. It is also considered that a study of proper shielding thickness will be needed in future.

  19. Cooling Performance of TBM-shield Designed for Manufacturability

    International Nuclear Information System (INIS)

    Park, Seong Dae; Lee, Dong Won; Kim, Dong Jun; Yoon, Jae Sung; Ahn, Mu Young

    2016-01-01

    Helium cooled ceramic reflector (HCCR) test blanket module (TBM) is composed of four sub-modules and a common back manifold (BM). The associated shield is a water-cooled 316L(N)-IG block with internal cooling channels. The purpose of the TBM-shield is to make the condition with the allowable neutron flux and dose rate level. The radially continuous layers of water and structure were configured. The main purpose of the shield is to reduce the neutron flux by absorbing the neutron in the structure. The water could act as the moderator and cool down the structure which is heated due to the reaction with the neutrons. The moderated neutrons are easily absorbed by the structure. It could meet the criteria for the minimum neutron flux by increasing the thickness of structure. The formation of inside cooling channel in the TBM-shield should be considered while maintaining the allowable temperature range. In this work, a manufacturing process including the formation of inside cooling channel was presented. Current design and thermal analysis results for the TBM-shield were presented. The geometry of the shield blocks was considerably changed. The coolant channel was exposed to the outer surface of the TBM-shield. The overall manufacturing process is simplified compared with the previous process of CD model

  20. Cooling Performance of TBM-shield Designed for Manufacturability

    Energy Technology Data Exchange (ETDEWEB)

    Park, Seong Dae; Lee, Dong Won; Kim, Dong Jun; Yoon, Jae Sung [KAERI, Daejeon (Korea, Republic of); Ahn, Mu Young [NFRI, Daejeon (Korea, Republic of)

    2016-05-15

    Helium cooled ceramic reflector (HCCR) test blanket module (TBM) is composed of four sub-modules and a common back manifold (BM). The associated shield is a water-cooled 316L(N)-IG block with internal cooling channels. The purpose of the TBM-shield is to make the condition with the allowable neutron flux and dose rate level. The radially continuous layers of water and structure were configured. The main purpose of the shield is to reduce the neutron flux by absorbing the neutron in the structure. The water could act as the moderator and cool down the structure which is heated due to the reaction with the neutrons. The moderated neutrons are easily absorbed by the structure. It could meet the criteria for the minimum neutron flux by increasing the thickness of structure. The formation of inside cooling channel in the TBM-shield should be considered while maintaining the allowable temperature range. In this work, a manufacturing process including the formation of inside cooling channel was presented. Current design and thermal analysis results for the TBM-shield were presented. The geometry of the shield blocks was considerably changed. The coolant channel was exposed to the outer surface of the TBM-shield. The overall manufacturing process is simplified compared with the previous process of CD model.

  1. Poor Utility of Gonadal Shielding for Pediatric Pelvic Radiographs.

    Science.gov (United States)

    Lee, Mark C; Lloyd, Jessica; Solomito, Matthew J

    2017-07-01

    Plain pelvic radiographs are commonly used for a variety of pediatric orthopedic disorders. Lead shielding is typically placed over the gonads to minimize radiation exposure to these sensitive tissues. However, misplaced shielding can sabotage efforts to protect patients from excessive radiation exposure either by not covering radiosensitive tissues or by obscuring anatomic areas of interest, prompting repeat radiographic examinations. The goal of this study was to determine the incidence of misplaced shielding for pelvic radiographs obtained for pediatric orthopedic evaluation. Children 8 to 16 years old who had an anteroposterior or frog lateral pelvic radiograph between 2008 and 2014 were included. A total of 3400 patients met the inclusion criteria, and 84 boys and 84 girls were randomly selected for review. For both boys and girls, the percentage of incorrectly positioned or missing shields was calculated. Chi-square testing was used to compare the frequency of missing or incorrectly placed shields between sexes and age groups. Pelvic shields were misplaced in 49% of anteroposterior and 63% of frog lateral radiographs. Shielding was misplaced more frequently for girls than for boys on frog lateral radiographs (76% vs 51%; P<.05). Pelvic bony landmarks were often obscured by pelvic shielding, with a frequency of 7% to 43%, depending on the specific landmark. The femoral head and acetabulum were obscured by shielding in up to 2% of all images. The findings suggest that accepted pelvic shielding protocols are ineffective. Consideration should be given to alternative protocols or abandonment of this practice. [Orthopedics. 2017; 40(4):e623-e627.]. Copyright 2017, SLACK Incorporated.

  2. Development of special radiation shielding concretes using natural local materials and evaluation of their shielding characteristics

    International Nuclear Information System (INIS)

    Kharita, M. H.; Takeyeddin, M.; Al-Nassri, M.; Yousef, S.

    2008-01-01

    Concrete is one of the most important materials used for radiation shielding in facilities containing radioactive sources and radiation generating machines. The concrete shielding properties may vary depending on the composite of the concrete. Aggregates is the largest constituent (about 70-80% of the total weight of normal concrete). The aim of this work is to develop special concrete with good shielding properties for gamma and neutrons, using natural local materials. For this reason two types of typical concrete widely used in Syria (in Damascus and Aleppo) and four other types of concrete, using aggregates from different regions, have been prepared. The shielding properties of these six types were studied for gamma ray (from Cs-137 and Co-60 sources)and for neutrons (from am-Be source). A reduction of about 10% in the HVL was obtained for the concrete from Damascus in comparison with that from Aleppo, for both neutrons and gammas. One of the other four types of concrete (from Rajo site, mostly Hematite), was found to further reduce the HVL by about 10% for both neutrons and gamma rays.(author)

  3. Irrigoscopy - irrigography method, dosimetry and radiation shielding

    International Nuclear Information System (INIS)

    Zubanov, Z.; Kolarevic, G.

    1999-01-01

    Use of patient's radiation shielding during radiology diagnostic procedures in our country is insufficiently represent, so patients needlessly receive very high entrance skin doses in body areas which are not in direct x-ray beam. During irrigoscopy, patient's radiation shielding is very complex problem, because of the organs position. In the future that problem must be solved. We hope that some of our suggestions about patient's radiation shielding during irrigoscopy, can be a small step in that way. (author)

  4. Shielding reproductive organs of orthopaedic patients during pelvic radiography.

    Science.gov (United States)

    Wainwright, A. M.

    2000-01-01

    The use of gonadal shielding has been advocated for patients undergoing pelvic radiography before and during the reproductive years. The aim of this study is to look at the adequacy of gonadal shielding used in a district general hospital for young patients having pelvic radiographs. A total of 200 radiographs were reviewed of 49 patients below the age of 45 years. Full coverage was achieved in only 36% of cases. Amongst females, only 22% received adequate shielding. None of the patients in their reproductive years (16-45 years) had gonad shields. The reasons for inadequate coverage were, in order of frequency: (i) no shielding was used; (ii) malposition of the shielding device; and (iii) the use of inappropriately shaped or sized devices. Suggestions for improvement are proposed. Images Figure 3 Figure 4 PMID:11041029

  5. Shielding benchmark test

    International Nuclear Information System (INIS)

    Kawai, Masayoshi

    1984-01-01

    Iron data in JENDL-2 have been tested by analyzing shielding benchmark experiments for neutron transmission through iron block performed at KFK using CF-252 neutron source and at ORNL using collimated neutron beam from reactor. The analyses are made by a shielding analysis code system RADHEAT-V4 developed at JAERI. The calculated results are compared with the measured data. As for the KFK experiments, the C/E values are about 1.1. For the ORNL experiments, the calculated values agree with the measured data within an accuracy of 33% for the off-center geometry. The d-t neutron transmission measurements through carbon sphere made at LLNL are also analyzed preliminarily by using the revised JENDL data for fusion neutronics calculation. (author)

  6. Neutron shielding material

    International Nuclear Information System (INIS)

    Suzuki, Shigenori; Iimori, Hiroshi; Kobori, Junzo.

    1980-01-01

    Purpose: To provide a neutron shielding material which incorporates preferable shielding capacity, heat resistance, fire resistance and workability by employing a mixture of thermosetting resin, polyethylene and aluminium hydroxide in special range ratio and curing it. Constitution: A mixture containing 20 to 60% by weight of thermosetting resin having preferable heat resistance, 10 to 40% by weight of polyethylene powder having high hydrogen atom density and 1000 to 60000 of molecular weight, and 15 to 55% by weight of Al(OH) 3 for imparting fire resistance and self-fire extinguishing property thereto is cured. At this time approx. 0.5 to 5% of curing catalyst of the thermosetting resin is contained in 100 parts by weight of the mixture. (Sekiya, K.)

  7. Safety evaluation for packaging (onsite) for the concrete-shielded RH TRU drum for the 327 Postirradiation Testing Laboratory

    International Nuclear Information System (INIS)

    Smith, R.J.

    1998-01-01

    This safety evaluation for packaging authorizes onsite transport of Type B quantities of radioactive material in the Concrete Shielded Remote-Handled Transuranic Waste (RH TRU) Drum per HNF-PRO-154, Responsibilities and Procedures for all Hazardous Material Shipments. The drum will be used for transport of 327 Building legacy waste from the 300 Area to a solid waste storage facility on the Hanford Site

  8. SP-100 GES/NAT radiation shielding systems design and development testing

    International Nuclear Information System (INIS)

    Disney, R.K.; Kulikowski, H.D.; McGinnis, C.A.; Reese, J.C.; Thomas, K.; Wiltshire, F.

    1991-01-01

    Advanced Energy Systems (AES) of Westinghouse Electric Corporation is under subcontract to the General Electric Company to supply nuclear radiation shielding components for the SP-100 Ground Engineering System (GES) Nuclear Assembly Test to be conducted at Westinghouse Hanford Company at Richland, Washington. The radiation shielding components are integral to the Nuclear Assembly Test (NAT) assembly and include prototypic and non-prototypic radiation shielding components which provide prototypic test conditions for the SP-100 reactor subsystem and reactor control subsystem components during the GES/NAT operations. W-AES is designing three radiation shield components for the NAT assembly; a prototypic Generic Flight System (GFS) shield, the Lower Internal Facility Shield (LIFS), and the Upper Internal Facility Shield (UIFS). This paper describes the design approach and development testing to support the design, fabrication, and assembly of these three shield components for use within the vacuum vessel of the GES/NAT. The GES/NAT shields must be designed to operate in a high vacuum which simulates space operations. The GFS shield and LIFS must provide prototypic radiation/thermal environments and mechanical interfaces for reactor system components. The NAT shields, in combination with the test facility shielding, must provide adequate radiation attenuation for overall test operations. Special design considerations account for the ground test facility effects on the prototypic GFS shield. Validation of the GFS shield design and performance will be based on detailed Monte Carlo analyses and developmental testing of design features. Full scale prototype testing of the shield subsystems is not planned

  9. Experimental analysis of an MIM capacitor with a concave shield

    International Nuclear Information System (INIS)

    Liu Lintao; Yu Mingyan; Wang Jinxiang

    2009-01-01

    A novel shielding scheme is developed by inserting a concave shield between a metal-insulator-metal (MIM) capacitor and the silicon substrate. Chip measurements reveal that the concave shield improves the quality factor by 11% at 11.8 GHz and 14% at 18.8 GHz compared with an unshielded MIM capacitor. It also alleviates the effect on shunt capacitance between the bottom plate of the MIM capacitor and the shield layer. Moreover, because the concave shields simplify substrate modeling, a simple circuit model of the MIM capacitor with concave shield is presented for radio frequency applications.

  10. Safety guide data on radiation shielding in a reprocessing facility

    International Nuclear Information System (INIS)

    Sekiguchi, Noboru; Naito, Yoshitaka

    1986-04-01

    In a reprocessing facility, various radiation sources are handled and have many geometrical conditions. To aim drawing up a safety guidebook on radiation shielding in order to evaluate shielding safety in a reprocessing facility with high reliability and reasonableness, JAERI trusted investigation on safety evaluation techniques of radiation shielding in a reprocessing facility to Nuclear Safety Research Association. This report is the collection of investigation results, and describes concept of shielding safety design principle, radiation sources in reprocessing facility and estimation of its strength, techniques of shielding calculations, and definite examples of shielding calculation in reprocessing facility. (author)

  11. Shielding modefication and safety review on Mutsu

    International Nuclear Information System (INIS)

    Osanai, Masao

    1978-01-01

    The Japan Atomic Energy Commission requests strongly to repair the shielding and make general safety inspection on Mutsu after an accident of radiation leakage from the reactor. The content and procedure of this repair of shielding and general safety inspection are outlined. The neutron leakage location in the reactor proper, technical shielding investigation, conceptual design of relating shielding repair, the mock up test of the shielding on the neutron streaming, the final conceptual design of repair, the relating research and development experiment and the detailed basic design of repair are explained, comparing the original design and the modified one. The modified design depends on the experimental results of neutron streaming test between the reactor vessel and the primary shield. As for the general safety inspection, the functional test of control rod driving mechanism and other main components, the flaw detection for heat transfer tubes of the steam generator and primary cooling pipings are carried out in hardwares, and the integrity analysis of fuel assemblies, stress corrosion cracking of fuel claddings and primary cooling pipings, the natural circulation analysis of primary cooling system, and integrity check of the heat transfer tubes of steam generator are carried out in softwares. The burst test and the strength test after high temperature oxidation for fuel claddings made of stainless steel were carried out. (Nakai, Y.)

  12. Radiation protection and shielding design - Strengthening the link

    International Nuclear Information System (INIS)

    Hobson, J.; Cooper, A.

    2005-01-01

    The improvement in quality and flexibility of shielding methods and data has been progressive and beneficial in opening up new opportunities for optimising radiation protection in design. The paper describes how these opportunities can best be seized by taking a holistic view of radiation protection, with shielding design being an important component part. This view is best achieved by enhancing the role of 'shielding assessors' so that they truly become 'radiation protection designers'. The increase in speed and efficiency of shielding calculations has been enormous over the past decades. This has raised the issue of how the assessor's time now can be best utilised; pursuing ever greater precision and accuracy in shielding/dose assessments, or improving the contribution that shielding assessment makes to radiological protection and cost-effective design. It is argued in this paper that the latter option is of great importance and will give considerable benefits. Shielding design needs to form part of a larger radiation protection perspective based on a deep understanding/appreciation of the opportunities and constraints of operators and designers, enabling minimal design iterations, cost optimisation of alternative designs (with a 'lifetime' perspective) and improved realisation of design intent in operations. The future of shielding design development is argued to be not in improving the 'tool-kit', but in enhanced understanding of the 'product' and the 'process' for achieving it. The holistic processes being developed in BNFL to realise these benefits are described in the paper and will be illustrated by case studies. (authors)

  13. An experimental study on a superconducting generator with dual machine shield system

    International Nuclear Information System (INIS)

    Ishigohka, T.; Ninomiya, A.; Okada, T.; Nitta, T.; Shintani, T.; Mukai, E.

    1988-01-01

    The authors have studied the optimal machine shield system through experiments on a 20kVa superconducting generator. The first experiment is carried out on a fully iron-less aluminum-shield machine which has only an aluminum eddy current machine shield in the stator. The second experiment is carried out on a generator with a dual-shield system which has both an aluminum eddy current shield and an iron magnetic shield. From the first one, the authors have got an experimental result that the aluminum-shield machine exhibits so large eddy current loss in the shield that it would be difficult to operate the machine continuously. On the other hand, the second experiment shows that the dual-shield machine exhibits much smaller loss in the shielding system, and that it has higher output power than the aluminum-shield machine. From these experiments, it becomes clear that insertion of a very thin iron shield between the armature winding and the eddy current shield can improve the machine performance eminently without large weight increase even if the iron shield were saturated

  14. GUI2QAD, Graphical Interface for QAD-CGPIC, Point Kernel for Shielding Calculations

    International Nuclear Information System (INIS)

    2001-01-01

    1 - Description of program or function: GUI2QAD is an aid in preparation of input for the included QAD-CGPIC program, which is based on CCC-493/QAD-CGGP and PICTURE. QAD-CGPIC, which is included in this distribution, is a Fortran code for neutron and gamma-ray shielding calculations by the point kernel method. Provision is available to interactively view the geometry of the system. QAD-CG calculates fast-neutron and gamma-ray penetration through various shield configurations defined by combinatorial geometry specifications. The code can use the ANS-6.4.3 1990 buildup factor compilation (26 materials). 2 - Methods:The code QAD-CGPIC is based on point kernel method and has a provision to select either GP or Capo's build up factors. 3 - Restrictions on the complexity of the problem: Details on restrictions and limitations are available in the RSICC code manual CCC-493/QAD-CGGP. Because CCC-493 was obsoleted by CCC-645/QAD-CGGP-A, the CCC-493 documentation is not online but is included with this package. This package includes a Graphical User Interface to facilitate use

  15. Radiation shield for nuclear reactors

    International Nuclear Information System (INIS)

    Weissenfluh, J.A.

    1980-01-01

    A reusable radiation shield for use in a reactor installation comprises a thin-walled, flexible and resilient container, made of plastic or elastomeric material, containing a hydrogenous fluid with boron compounds in solution. The container can be filled and drained in position and the fluid can be recirculated if required. When not in use the container can be folded and stored in a small space. The invention relates to a shield to span the top of the annular space between a reactor vessel and the primary shield. For this purpose a continuous toroidal container or a series of discrete segments is used. Other forms can be employed for different purposes, e.g. mattress- or blanket-like forms can be draped over potential sources of radiation or suspended from a mobile carrier and placed between a worker and a radiation source. (author)

  16. Shielding of the contralateral breast during tangential irradiation.

    Science.gov (United States)

    Goffman, Thomas E; Miller, Michael; Laronga, Christine; Oliver, Shelly; Wong, Ping

    2004-08-01

    The purpose of this study was to investigate both optimal and practical contralateral breast shielding during tangential irradiation in young patients. A shaped sheet of variable thickness of lead was tested on a phantom with rubber breasts, and an optimized shield was created. Testing on 18 consecutive patients 50 years or younger showed shielding consistently reduced contralateral breast dose to at least half, with small additional reduction after removal of the medial wedge. For younger patients in whom radiation exposure is of considerable concern, a simple shield of 2 mm lead thickness proved practical and effective.

  17. Early test facilities and analytic methods for radiation shielding: Proceedings

    International Nuclear Information System (INIS)

    Ingersoll, D.T.; Ingersoll, J.K.

    1992-11-01

    This report represents a compilation of eight papers presented at the 1992 American Nuclear Society/European Nuclear Society International Meeting. The meeting is of special significance since it commemorates the fiftieth anniversary of the first controlled nuclear chain reaction. The papers contained in this report were presented in a special session organized by the Radiation Protection and Shielding Division in keeping with the historical theme of the meeting. The paper titles are good indicators of their content and are: (1) The origin of radiation shielding research: The Oak Ridge experience, (2) Shielding research at the hanford site, (3) Aircraft shielding experiments at General Dynamics Fort Worth, 1950-1962, (4) Where have the neutrons gone?, a history of the tower shielding facility, (5) History and evolution of buildup factors, (6) Early shielding research at Bettis atomic power laboratory, (7) UK reactor shielding: then and now, (8) A very personal view of the development of radiation shielding theory

  18. Shielding design study of the demonstration fast breeder reactor. 2. Shielding design on the basis of the JASPER analysis

    International Nuclear Information System (INIS)

    Suzuoki, Zenro; Tabayashi, Masao; Handa, Hiroyuki; Iida, Masaaki; Takemura, Morio

    2000-01-01

    Conceptual shielding design has been performed for the Demonstration Fast Breeder Reactor (DFBR) to achieve further optimization and reduction of the plant construction cost. The design took into account its implications in overall plant configuration such as reduction of shields in the core, adoption of fission gas plenum in the lower portion of fuel assemblies, and adoption of gas expansion modules. Shielding criteria applied for the design are to secure fast neutron fluence on in-vessel structures as well as responses of the nuclear instrumentation system and to restrict secondary sodium activation. The design utilized the cross sections and the one- and two-dimensional discrete ordinates transport codes, whose verification had been performed by the JASPER experiment analysis. Correction factors yielded by the JASPER analysis were applied to the design calculations to obtain design values with improved accuracy. Design margins, which are defined by the ratios of the design criteria to the design values, were more than two for all shielding issues of interest, showing the adequacy of the shielding design of the DFBR. (author)

  19. Development of Neutron Shielding Material for Cask and Accelerator

    International Nuclear Information System (INIS)

    Kang, Hee Young; Seo, Ki Seog; Lee, Byung Chul; Park, Chang Jae; Kim, Ho Dong

    2008-01-01

    The neutron shielding materials are used as a neutron shield for spent fuel shipping cask, beam accelerators and neutron generators. At early stage, the neutron attenuations of materials were evaluated with the cross sections. After that, benchmark or mock-up experiments on the multi-layer problem to confirm the shielding characteristics or to evaluate analysis accuracy were reported. Recently, the need to transport spent nuclear fuels is increasing due to the current limited storage capacity. The on-site storage capacity at some of nuclear power plants is expected to be full in near future. With a growing inventory of spent fuels at power plants, these spent fuels need to be transported to other storage facilities. Shipping casks have been developed to safely transport spent fuels that emit high neutrons and gamma-ray radiation. The external radiation level of the shipping cask from the spent fuel must be limited to meet the standards specified by the IAEA radioactive material package regulation, so it is important to develop a proper neutron shielding material for a shipping cask. Neutron shielding experiments and analyses on the shielding effects of materials have been conducted, and some experiments have been performed to examine the shielding effects of selected materials. The shielding experiments consist of evaluating not only the shielding effects of a material alone but also the effects of the material thickness. The experimental results were compared with those obtained by using the MCNP-5c code

  20. Safety shield for vacuum/pressure-chamber windows

    Science.gov (United States)

    Shimansky, R. A.; Spencer, R.

    1980-01-01

    Optically-clear shatter-resistant safety shield protects workers from implosion and explosion of vacuum and pressure windows. Plastic shield is inexpensive and may be added to vacuum chambers, pressure chambers, and gas-filling systems.

  1. Analysis of shield for the nuclear ship MUTSU

    International Nuclear Information System (INIS)

    Fuse, Takayoshi; Takeuchi, Kiyoshi; Yamaji, Akio

    1975-01-01

    On the nuclear ship MUTSU, a higher-than-expected level of radiation was found, with output raised to 1.4 per cent. To investigate the radiation leakage, the analysis of the shielding problem utilized a four-step sequence of PALLAS-2DCY cylindrical r-z calculations with fixed sources distributions in the core. The neutron dose contours show the importance of streaming in the gap between the reactor vessel and the primary shield. Dominant consideration of thermal insulation exclude shielding from this area resulting in an imbalance in the shielding effectiveness. The neutron dose rate at the upper part of the reactor vessel is increased by neutrons incident on the head from cavity scattering. The calculation indicates that the neutron dose rate at the top of the primary shield is 5 rem/hr at 100 per cent output. (auth.)

  2. Calculation of parameters for an iron shield experiment

    International Nuclear Information System (INIS)

    Gavazza, S.

    1986-01-01

    In this text is carreid out the evaluation of radiation transport methodology, comparying the calculated reactions and dose rates, for neutrons and gama-rays, with the experimental measurements obtained on iron shield, irradiated in YAYOI reactor. Were employed the ENDF/B-IV and VITAMIN-C libraries and the AMPX-II modular system for generation of cross sections, collapsed by the ANISN code. The tranpsort calculations were made by using the DOT 3.5 code, adjusting the spectrum of the iron shield boundary source to the reaction and doses rates, measured at the beginning of shield. The distributions calculated for neutrons and gamma-rays, on iron shield, presented reasonable concordance with the experimental measurements. Finally, is presented a proposal for setting up of an experimental arrangement, using the IEA-R1 reactor, with the purpose of lay down a shielding benchmark. (Author) [pt

  3. General Corrosion and Localized Corrosion of the Drip Shield

    Energy Technology Data Exchange (ETDEWEB)

    F. Hua

    2004-09-16

    The repository design includes a drip shield (BSC 2004 [DIRS 168489]) that provides protection for the waste package both as a barrier to seepage water contact and a physical barrier to potential rockfall. The purpose of the process-level models developed in this report is to model dry oxidation, general corrosion, and localized corrosion of the drip shield plate material, which is made of Ti Grade 7. This document is prepared according to ''Technical Work Plan For: Regulatory Integration Modeling and Analysis of the Waste Form and Waste Package'' (BSC 2004 [DIRS 171583]). The models developed in this report are used by the waste package degradation analyses for TSPA-LA and serve as a basis to determine the performance of the drip shield. The drip shield may suffer from other forms of failure such as the hydrogen induced cracking (HIC) or stress corrosion cracking (SCC), or both. Stress corrosion cracking of the drip shield material is discussed in ''Stress Corrosion Cracking of the Drip Shield, the Waste Package Outer Barrier, and the Stainless Steel Structural Material'' (BSC 2004 [DIRS 169985]). Hydrogen induced cracking of the drip shield material is discussed in ''Hydrogen Induced Cracking of Drip Shield'' (BSC 2004 [DIRS 169847]).

  4. General Corrosion and Localized Corrosion of the Drip Shield

    International Nuclear Information System (INIS)

    F. Hua

    2004-01-01

    The repository design includes a drip shield (BSC 2004 [DIRS 168489]) that provides protection for the waste package both as a barrier to seepage water contact and a physical barrier to potential rockfall. The purpose of the process-level models developed in this report is to model dry oxidation, general corrosion, and localized corrosion of the drip shield plate material, which is made of Ti Grade 7. This document is prepared according to ''Technical Work Plan For: Regulatory Integration Modeling and Analysis of the Waste Form and Waste Package'' (BSC 2004 [DIRS 171583]). The models developed in this report are used by the waste package degradation analyses for TSPA-LA and serve as a basis to determine the performance of the drip shield. The drip shield may suffer from other forms of failure such as the hydrogen induced cracking (HIC) or stress corrosion cracking (SCC), or both. Stress corrosion cracking of the drip shield material is discussed in ''Stress Corrosion Cracking of the Drip Shield, the Waste Package Outer Barrier, and the Stainless Steel Structural Material'' (BSC 2004 [DIRS 169985]). Hydrogen induced cracking of the drip shield material is discussed in ''Hydrogen Induced Cracking of Drip Shield'' (BSC 2004 [DIRS 169847])

  5. Development and application of high performance liquid shielding materials

    International Nuclear Information System (INIS)

    Miura, Toshimasa; Omata, Sadao; Otano, Naoteru; Hirao, Yoshihiro; Kanai, Yasuji

    1998-01-01

    Development of liquid shielding material with good performance for neutron and γ-ray was investigated. Lead, hydrogen and boron were selected as the elements of shielding materials which were made by the ultraviolet curing method. Good performance shielding materials with about 1 mm width to neutron and gamma ray were produced by mixing lead, boron compound and ultraviolet curing monomer with many hydrogens. The shielding performance was the same as a concrete with two times width. The activation was very small such as 1/10 6 -1/10 8 of the standard concrete. The weight and the external appearance did not charged from room temperature to 100degC. Polyfunctional monomer had good thermal resistance. This shielding material was applied to double bending cylindrical duct and annulus ring duct. The results proved the shielding materials developed had good performance. (S.Y.)

  6. Important aspects of radiation shielding for fusion reactor tokamaks

    International Nuclear Information System (INIS)

    Abdou, M.A.

    1977-01-01

    Radiation shielding is a key subsystem in tokamak reactors. Design of this shield must evolve from economic and technological trade-off studies that account for the strong interrelations among the various components of the reactor system. These trade-offs are examined for the bulk shield on the inner side of the torus and for the special shields of major penetrations. Results derived are applicable for a large class of tokamak-type reactors

  7. Neutron shield analysis and design for the PDX fusion facility

    International Nuclear Information System (INIS)

    Grimesey, R.A.; Nigg, D.W.; Scott, A.J.; Wheeler, F.J.; Jassby, D.L.; Perry, E.D.

    1979-01-01

    The basic component of the biological shield for PDX is an existing 81 cm thick high-density concrete shielding wall surrounding the machine. The principal additional shielding requirement is a roof shield over the machine to reduce air-scattered skyshine dose into the PDX control room and to the site boundary. The roof shield is designed in removable sections on a steel support structure permitting overhead crane access to major PDX components. After analysis of a number of alternate concepts, a roof shield consisting of 50 cm of water in polyethylene tanks was selected to meet design objectives of effectiveness, weight, removability, and cost

  8. A study on the shielding element using Monte Carlo simulation

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Ki Jeong [Dept. of Radiology, Konkuk University Medical Center, Seoul (Korea, Republic of); Shim, Jae Goo [Dept. of Radiologic Technology, Daegu Health College, Daegu (Korea, Republic of)

    2017-06-15

    In this research, we simulated the elementary star shielding ability using Monte Carlo simulation to apply medical radiation shielding sheet which can replace existing lead. In the selection of elements, mainly elements and metal elements having a large atomic number, which are known to have high shielding performance, recently, various composite materials have improved shielding performance, so that weight reduction, processability, In consideration of activity etc., 21 elements were selected. The simulation tools were utilized Monte Carlo method. As a result of simulating the shielding performance by each element, it was estimated that the shielding ratio is the highest at 98.82% and 98.44% for tungsten and gold.

  9. SU-E-T-400: Evaluation of Shielding and Activation at Two Pencil Beam Scanning Proton Facilities

    International Nuclear Information System (INIS)

    Remmes, N; Mundy, D; Classic, K; Beltran, C; Kruse, J; Herman, M; Stoker, J; Nelson, K; Bues, M

    2015-01-01

    Purpose: To verify acceptably low dose levels around two newly constructed identical pencil beam scanning proton therapy facilities and to evaluate accuracy of pre-construction shielding calculations. Methods: Dose measurements were taken at select points of interest using a WENDI-2 style wide-energy neutron detector. Measurements were compared to pre-construction shielding calculations. Radiation badges with neutron dose measurement capabilities were worn by personnel and also placed at points throughout the facilities. Seven neutron and gamma detectors were permanently installed throughout the facility, continuously logging data. Potential activation hazards have also been investigated. Dose rates near water tanks immediately after prolonged irradiation have been measured. Equipment inside the treatment room and accelerator vault has been surveyed and/or wipe tested. Air filters from air handling units, sticky mats placed outside of the accelerator vault, and water samples from the magnet cooling water loops have also been tested. Results: All radiation badges have been returned with readings below the reporting minimum. Measurements of mats, air filters, cooling water, wipe tests and surveys of equipment that has not been placed in the beam have all come back at background levels. All survey measurements show the analytical shielding calculations to be conservative by at least a factor of 2. No anomalous events have been identified by the building radiation monitoring system. Measurements of dose rates close to scanning water tanks have shown dose rates of approximately 10 mrem/hr with a half-life less than 5 minutes. Measurements around the accelerator show some areas with dose rates slightly higher than 10 mrem/hr. Conclusion: The shielding design is shown to be adequate. Measured dose rates are below those predicted by shielding calculations. Activation hazards are minimal except in certain very well defined areas within the accelerator vault and for objects

  10. Shielding in ungated field emitter arrays

    Energy Technology Data Exchange (ETDEWEB)

    Harris, J. R. [U.S. Navy Reserve, Navy Operational Support Center New Orleans, New Orleans, Louisiana 70143 (United States); Jensen, K. L. [Code 6854, Naval Research Laboratory, Washington, D.C. 20375 (United States); Shiffler, D. A. [Directed Energy Directorate, Air Force Research Laboratory, Albuquerque, New Mexico 87117 (United States); Petillo, J. J. [Leidos, Billerica, Massachusetts 01821 (United States)

    2015-05-18

    Cathodes consisting of arrays of high aspect ratio field emitters are of great interest as sources of electron beams for vacuum electronic devices. The desire for high currents and current densities drives the cathode designer towards a denser array, but for ungated emitters, denser arrays also lead to increased shielding, in which the field enhancement factor β of each emitter is reduced due to the presence of the other emitters in the array. To facilitate the study of these arrays, we have developed a method for modeling high aspect ratio emitters using tapered dipole line charges. This method can be used to investigate proximity effects from similar emitters an arbitrary distance away and is much less computationally demanding than competing simulation approaches. Here, we introduce this method and use it to study shielding as a function of array geometry. Emitters with aspect ratios of 10{sup 2}–10{sup 4} are modeled, and the shielding-induced reduction in β is considered as a function of tip-to-tip spacing for emitter pairs and for large arrays with triangular and square unit cells. Shielding is found to be negligible when the emitter spacing is greater than the emitter height for the two-emitter array, or about 2.5 times the emitter height in the large arrays, in agreement with previously published results. Because the onset of shielding occurs at virtually the same emitter spacing in the square and triangular arrays, the triangular array is preferred for its higher emitter density at a given emitter spacing. The primary contribution to shielding in large arrays is found to come from emitters within a distance of three times the unit cell spacing for both square and triangular arrays.

  11. Health and Safety Research Division manual for the x-ray facility in Building 2008

    International Nuclear Information System (INIS)

    Stansbury, P.S.

    1977-11-01

    The facility in the east end of Building 2008, ORNL, consists of an x-ray machine and a shielded enclosure. The x-ray machine is of the constant potential type and can be operated continuously at generating potentials up to 125 kVcp with tube currents ranging from 0.1 μA to 10 mA. Both the generating potential and the tube current are highly regulated and stabilized. The machine is installed and operated within a large shielded enclosure. In addition to the x-ray machine and its ancillary equipment, the shielded enclosure contains many of the features of a general chemistry and physics laboratory including work benches, sinks, storage space, and electrical and gas service. This manual contains instructions for the safe operation of the x-ray machine

  12. Alignment modification for pencil eye shields

    International Nuclear Information System (INIS)

    Evans, M.D.; Pla, M.; Podgorsak, E.B.

    1989-01-01

    Accurate alignment of pencil beam eye shields to protect the lens of the eye may be made easier by means of a simple modification of existing apparatus. This involves drilling a small hole through the center of the shield to isolate the rayline directed to the lens and fabricating a suitable plug for this hole

  13. Shielding of the child's head during x-ray studies

    International Nuclear Information System (INIS)

    Tolmach, Eh.U.

    1985-01-01

    Three devices for X-ray shielding of child's head are suggested; the first one is a protective attachment for shielding a child being in horizontal position on an X-ray table; the second one is a protective stand for shielding head and body at roentgenofraphy of upper extremities of a child sitting near the X-ray table; the third one is a prot ctive suspension for shielding the head of a child being in vertical position

  14. The clinical testing of male gonad shields. Technical report

    International Nuclear Information System (INIS)

    Church, W.W.; Burnett, B.M.

    1975-11-01

    Two types of male gonad shields, designed for use with support garments, were tested in a number of hospitals and clinics throughout the United States. The clinical evaluation consisted of: (1) measuring dose reduction with thermoluminescent dosimeters; and (2) determining acceptability of the shields for routine use in x-ray facilities, through the use of survey forms completed by patients, technologists, and facilities. The shields proved to provide a basis for a very satisfactory male gonad shield program

  15. The clinical testing of male gonad shields. Technical report

    Energy Technology Data Exchange (ETDEWEB)

    Church, W.W.; Burnett, B.M.

    1975-11-01

    Two types of male gonad shields, designed for use with support garments, were tested in a number of hospitals and clinics throughout the United States. The clinical evaluation consisted of: (1) measuring dose reduction with thermoluminescent dosimeters; and (2) determining acceptability of the shields for routine use in x-ray facilities, through the use of survey forms completed by patients, technologists, and facilities. The shields proved to provide a basis for a very satisfactory male gonad shield program. (GRA)

  16. ASOP, Shield Calculation, 1-D, Discrete Ordinates Transport

    International Nuclear Information System (INIS)

    1993-01-01

    1 - Nature of physical problem solved: ASOP is a shield optimization calculational system based on the one-dimensional discrete ordinates transport program ANISN. It has been used to design optimum shields for space applications of SNAP zirconium-hydride-uranium- fueled reactors and uranium-oxide fueled thermionic reactors and to design beam stops for the ORELA facility. 2 - Method of solution: ASOP generates coefficients of linear equations describing the logarithm of the dose and dose-weight derivatives as functions of position from data obtained in an automated sequence of ANISN calculations. With the dose constrained to a design value and all dose-weight derivatives required to be equal, the linear equations may be solved for a new set of shield dimensions. Since changes in the shield dimensions may cause the linear functions to change, the entire procedure is repeated until convergence is obtained. The detailed calculations of the radiation transport through shield configurations for every step in the procedure distinguish ASOP from other shield optimization computer code systems which rely on multiple component sources and attenuation coefficients to describe the transport. 3 - Restrictions on the complexity of the problem: Problem size is limited only by machine size

  17. Uranium-lead shielding for nuclear material transportation systems

    International Nuclear Information System (INIS)

    Lusk, E.C.; Miller, N.E.; Basham, S.J. Jr.

    1978-01-01

    The basis for the selection of shielding materials for spent fuel shipping containers is described with comments concerning the favorable and unfavorable aspects of steel, lead, and depleted uranium. A concept for a new type of material made of depleted uranium and lead is described which capitalizes on the best cask shielding characteristics of both materials. This cask shielding is made by filling the shielding cavity with pieces of depleted uranium and then backfilling the interstitial voids with lead. The lead would be bonded to the uranium and also to the cask shells if desired. Shielding density approaching 80 percent of that of solid uranium could be achieved, while a density of 65 percent is readily obtainable. This material should overcome the problems of the effect of lead melting in the fire accident, high thermal gradients at uranium-stainless steel interfaces and at a major reduction in cost over that of a solid uranium shielded cask. A development program is described to obtain information on the properties of the composite material to aid in design analysis and licensing and to define the fabrication techniques

  18. Application of a dummy eye shield for electron treatment planning

    International Nuclear Information System (INIS)

    Kang, Sei-Kwon; Park, Soah; Hwang, Taejin; Cheong, Kwang-Ho; Han, Taejin; Kim, Haeyoung; Lee, Me-Yeon; Kim, Kyoung Ju; Oh, Do Hoon; Bae, Hoonsik

    2013-01-01

    Metallic eye shields have been widely used for near-eye treatments to protect critical regions, but have never been incorporated into treatment plans because of the unwanted appearance of the metal artifacts on CT images. The purpose of this work was to test the use of an acrylic dummy eye shield as a substitute for a metallic eye shield during CT scans. An acrylic dummy shield of the same size as the tungsten eye shield was machined and CT scanned. The BEAMnrc and the DOSXYZnrc were used for the Monte Carlo (MC) simulation, with the appropriate material information and density for the aluminum cover, steel knob and tungsten body of the eye shield. The Pinnacle adopting the Hogstrom electron pencil-beam algorithm was used for the one-port 6-MeV beam plan after delineation and density override of the metallic parts. The results were confirmed with the metal oxide semiconductor field effect transistor (MOSFET) detectors and the Gafchromic EBT2 film measurements. For both the maximum eyelid dose over the shield and the maximum dose under the shield, the MC results agreed with the EBT2 measurements within 1.7%. For the Pinnacle plan, the maximum dose under the shield agreed with the MC within 0.3%; however, the eyelid dose differed by -19.3%. The adoption of the acrylic dummy eye shield was successful for the treatment plan. However, the Pinnacle pencil-beam algorithm was not sufficient to predict the eyelid dose on the tungsten shield, and more accurate algorithms like MC should be considered for a treatment plan. (author)

  19. Neutron shielding properties of boron-containing ore and epoxy composites

    International Nuclear Information System (INIS)

    Li Zhifu; Xue Xiangxin

    2011-01-01

    Using the boron-containing iron ore concentrate and boron-rich slag as studying object, the starting materials were got after the specific green ore containing boron dressing in China and blast furnace separation respectively. Monte-Carlo method was used to study the effect of the boron-containing iron ore concentrate and boron-rich slag and their composites with epoxy on the neutron shielding abilities. The reasons that affecting the shielding materials properties was discussed and the suitable proportioning of boron-containing ore to epoxy composites was confirmed; the 14.1 MeV fast neutron removal cross section and the total thermal neutron attenuation coefficient were obtained and compared with that of the common used concrete. The results show that the shielding property of 14.1 MeV fast neutron is mainly concerned with the low-Z elements in the shielding materials, the thermal neutron shielding ability is mainly concerned with boron concentrate in the composite, the attenuation of the accompany γ-ray photon is mainly concerned with the high atom number elements content in the ore and the density of the shielding material. The optimum Janume fractions of composites are in the range of 0.4-0.6 and the fast neutron shielding properties are similar to concrete while the thermal neutron shielding properties are higher than concrete. The composites are expected to be used as biological concrete shields crack injection and filling of the anomalous holes through the concrete shields around the radiation fields or directly to be prepared as shielding materials.(authors)

  20. Onboard radiation shielding estimates for interplanetary manned missions

    International Nuclear Information System (INIS)

    Totemeier, A.; Jevremovic, T.; Hounshel, D.

    2004-01-01

    The main focus of space related shielding design is to protect operating systems, personnel and key structural components from outer space and onboard radiation. This paper summarizes the feasibility of a lightweight neutron radiation shield design for a nuclear powered, manned space vehicle. The Monte Carlo code MCNP5 is used to determine radiation transport characteristics of the different materials and find the optimized shield configuration. A phantom torso encased in air is used to determine a dose rate for a crew member on the ship. Calculation results indicate that onboard shield against neutron radiation coming from nuclear engine can be achieved with very little addition of weight to the space vehicle. The selection of materials and neutron transport analysis as presented in this paper are useful starting data to design shield against neutrons generated when high-energy particles from outer space interact with matter on the space vehicle. (authors)

  1. Analytic flux formulas and tables of shielding functions

    International Nuclear Information System (INIS)

    Wallace, O.J.

    1981-06-01

    Hand calculations of radiation flux and dose rates are often useful in evaluating radiation shielding and in determining the scope of a problem. The flux formulas appropriate to such calculations are almost always based on the point kernel and allow for at most the consideration of laminar slab shields. These formulas often require access to tables of values of integral functions for effective use. Flux formulas and function tables appropriate to calculations involving homogeneous source regions with the shapes of lines, disks, slabs, truncated cones, cylinders, and spheres are presented. Slab shields may be included in most of these calculations, and the effect of a cylindrical shield surrounding a cylindrical source may be estimated. Detector points may be located axially, laterally, or interior to a cylindrical source. Line sources may be tilted with respect to a slab shield. All function tables are given for a wide range of arguments

  2. Shielding design for positron emission tomography facility

    International Nuclear Information System (INIS)

    Abdallah, I.I.

    2007-01-01

    With the recent advent of readily available tracer isotopes, there has been marked increase in the number of hospital-based and free-standing positron emission tomography (PET) clinics. PET facilities employ relatively large activities of high-energy photon emitting isotopes, which can be dangerous to the health of humans and animals. This coupled with the current dose limits for radiation worker and members of the public can result in shielding requirements. This research contributes to the calculation of the appropriate shielding to keep the level of radiation within an acceptable recommended limit. Two different methods were used including measurements made at selected points of an operating PET facility and computer simulations by using Monte Carlo Transport Code. The measurements mainly concerned the radiation exposure at different points around facility using the survey meter detectors and Thermoluminescent Dosimeters (TLD). Then the set of manual calculation procedures were used to estimate the shielding requirements for a newly built PEF facility. The results from the measurement and the computer simulation were compared to the results obtained from the set manual calculation procedure. In general, the estimated weekly dose at the points of interest is lower than the regulatory limits for the little company of Mary Hospital. Furthermore, the density and the HVL for normal strength concrete and clay bricks are almost similar. In conclusion, PET facilities present somewhat different design requirements and are more likely to require additional radiation shielding. Therefore, existing shields at the little Company of Mary Hospital are in general found to be adequate and satisfactory and additional shielding was found necessary at the new PET facility in the department of Nuclear Medicine of the Dr. George Mukhari Hospital. By use of appropriate design, by implying specific shielding requirements and by maintaining good operating practices, radiation doses to

  3. Hydrogen-Induced Cracking of the Drip Shield

    International Nuclear Information System (INIS)

    F. Hua

    2004-01-01

    Hydrogen-induced cracking is characterized by the decreased ductility and fracture toughness of a material due to the absorption of atomic hydrogen in the metal crystal lattice. Corrosion is the source of hydrogen generation. For the current design of the engineered barrier without backfill, hydrogen-induced cracking may be a concern because the titanium drip shield can be galvanically coupled to rock bolts (or wire mesh), which may fall onto the drip shield, thereby creating conditions for hydrogen production by electrochemical reaction. The purpose of this report is to analyze whether the drip shield will fail by hydrogen-induced cracking under repository conditions within 10,000 years after emplacement. Hydrogen-induced cracking is a scenario of premature failure of the drip shield. This report develops a realistic model to assess the form of hydrogen-induced cracking degradation of the drip shield under the hydrogen-induced cracking. The scope of this work covers the evaluation of hydrogen absorbed due to general corrosion and galvanic coupling to less noble metals (e.g., Stainless Steel Type 316 and carbon steels) under the repository conditions during the 10,000-year regulatory period after emplacement and whether the absorbed hydrogen content will exceed the critical hydrogen concentration value, above which the hydrogen-induced cracking is assumed to occur. This report also provides the basis for excluding the features, events, and processes (FEPs) related to hydrogen-induced cracking of the drip shield with particular emphasis on FEP 2.1.03.04.OB, hydride cracking of drip shields (DTN: M00407SEPFEPLA.000 [DIRS 170760]). This report is prepared according to ''Technical Work Plan (TWP) for: Regulatory Integration Modeling and Analysis of the Waste Form and Waste Package'' (BSC 2004 [DIRS 169944])

  4. Design of radiation shields in nuclear reactor core

    International Nuclear Information System (INIS)

    Mousavi Shirazi, A.; Daneshvar, Sh.; Aghanajafi, C.; Jahanfarnia, Gh.; Rahgoshay, M.

    2008-01-01

    This article consists of designing radiation shields in the core of nuclear reactors to control and restrain the harmful nuclear radiations in the nuclear reactor cores. The radiation shields protect the loss of energy. caused by nuclear radiation in a nuclear reactor core and consequently, they cause to increase the efficiency of the reactor and decrease the risk of being under harmful radiations for the staff. In order to design these shields, by making advantages of the O ppenheim Electrical Network m ethod, the structure of the shields are physically simulated and by obtaining a special algorithm, the amount of optimized energy caused by nuclear radiations, is calculated

  5. Simulation of divertor targets shielding during transients in ITER

    Energy Technology Data Exchange (ETDEWEB)

    Pestchanyi, Sergey, E-mail: serguei.pestchanyi@kit.edu [KIT, Hermann-von-Helmholtz-Platz 1, Eggenstein-Leopoldshafen (Germany); Pitts, Richard; Lehnen, Michael [ITER Organization,Route de Vinon-sur-Verdon, CS 90 046, 13067 St. Paul Lez Durance Cedex (France)

    2016-11-01

    Highlights: • We simulated plasma shielding effect during disruption in ITER using the TOKES code. • It has been found that vaporization is unavoidable under action of ITER transients, but plasma shielding drastically reduces the divertor target damage: the melt pool and the vaporization region widths reduced 10–15 times. • A simplified 1D model describing the melt pool depth and the shielded heat flux to the divertor targets have been developed. • The results of the TOKES simulations have been compared with the analytic model when the model is valid. - Abstract: Direct extrapolation of the disruptive heat flux on ITER conditions predicts severe melting and vaporization of the divertor targets causing their intolerable damage. However, tungsten vaporized from the target at initial stage of the disruption can create plasma shield in front of the target, which effectively protects the target surface from the rest of the heat flux. Estimation of this shielding efficiency has been performed using the TOKES code. The shielding effect under ITER conditions is found to be very strong: the maximal depth of the melt layer reduced 4 times, the melt layer width—more than 10 times and vaporization region shrinks 10–15 times due to shielding for unmitigated disruption of 350 MJ discharge. The simulation results show complex, 2D plasma dynamics of the shield under ITER conditions. However, a simplified analytic model, valid for rough estimation of the maximum value for the shielded flux to the target and for the melt depth at the target surface has been developed.

  6. Monte Carlo based demonstration of sufficiently dimensioned shielding for a Co-60 testing facility

    International Nuclear Information System (INIS)

    Wind, Michael; Beck, Peter; Latocha, Marcin

    2015-01-01

    The electrical properties of electronic equipment can be changed in an ionized radiation field. The knowledge of these changes is necessary for applications in space, in air traffic and nuclear medicine. Experimental tests will be performed in Co-60 radiation fields in the irradiation facility (TEC facility) of the Seibersdorf Labor GmbH that is in construction. The contribution deals with a simulation that is aimed to calculate the local dose rate within and outside the building for demonstration of sufficient dimensioning of the shielding in compliance with the legal dose rate limits.

  7. Fire preparedness measures in buildings with hot laboratories

    International Nuclear Information System (INIS)

    Oberlaender, B.C.

    2003-01-01

    Important hot laboratory safety issues are the general design/construction of the building with respect to fire, fire prevention, fire protection, administrative controls, and risk assessment. Within the network of the European Working Group Hot Laboratories and Remote Handling items concerning 'fire preparedness measures in hot laboratories' were screened and studied. Two questionnaires were sent to European hot laboratories; the first in November 2002 on 'fire preparedness measures, fire detection and fire suppression/extinguishing in lead shielded cells, concrete shielded cells' and the second in June 2003 on 'Fire preparedness measures in buildings with hot laboratories'. The questionnaires were filled in by a total of ten hot laboratories in seven European countries. On request of participants the answers were evaluated and 'anonymised' for presentation and discussion at the plenary meeting. The answers showed that many European hot laboratories are implementing improvements to their fire protection programmes to comply with more stringent requirements of the national authorities. The recommendations ('International guidelines for the fire protection of Nuclear Power Plants') given by the insurance pools are followed up with national variations. An ISO standard (ISO 17873) is in progress giving criteria for the design and the operation of ventilation systems as well as fire hazard management in nuclear installations others than reactors

  8. Semi-analytic flux formulas for shielding calculations

    International Nuclear Information System (INIS)

    Wallace, O.J.

    1976-06-01

    A special coordinate system based on the work of H. Ono and A. Tsuro has been used to derive exact semi-analytic formulas for the flux from cylindrical, spherical, toroidal, rectangular, annular and truncated cone volume sources; from cylindrical, spherical, truncated cone, disk and rectangular surface sources; and from curved and tilted line sources. In most of the cases where the source is curved, shields of the same curvature are allowed in addition to the standard slab shields; cylindrical shields are also allowed in the rectangular volume source flux formula. An especially complete treatment of a cylindrical volume source is given, in which dose points may be arbitrarily located both within and outside the source, and a finite cylindrical shield may be considered. Detector points may also be specified as lying within spherical and annular source volumes. The integral functions encountered in these formulas require at most two-dimensional numeric integration in order to evaluate the flux values. The classic flux formulas involving only slab shields and slab, disk, line, sphere and truncated cone sources become some of the many special cases which are given in addition to the more general formulas mentioned above

  9. MOSFET Dosimetry for Evaluation of Gonad Shielding during Radiotherapy

    International Nuclear Information System (INIS)

    Kim, Hwi Young; Choi, Yun Seok; Park, So Yeon; Park, Yang Kyun; Ye, Sung Joon

    2011-01-01

    In order to confirm feasibility of MOSFET modality in use of in vivo dosimetry, evaluation of gonad shielding in order to minimize gonadal dose of patients undergoing radiotherapy by using MOSFET modality was performed. Gonadal dose of patients undergoing radiotherapy for rectal cancer in the department of radiation oncology of Seoul National University Hospital since 2009 was measured. 6 MV and 15 MV photon beams emitted from Varian 21EX LINAC were used for radiotherapy. In order to minimize exposed dose caused by the scattered ray not only from collimator of LINAC but also from treatment region inside radiation field, we used box.shaped lead shielding material. The shielding material was made of the lead block and consists of 7.5 cm x 9.5 cm x 5.5 cm sized case and 9 cm x 9.5 cm x 1 cm sized cover. Dosimetry for evaluation of gonad shielding was done with MOSFET modality. By protecting with gonad shielding material, average gonadal dose of patients was decreased by 23.07% compared with reference dose outside of the shielding material. Average delivered gonadal dose inside the shielding material was 0.01 Gy. By the result of MOSFET dosimetry, we verified that gonadal dose was decreased by using gonad shielding material. In compare with TLD dosimetry, we could measure the exposed dose easily and precisely with MOSFET modality

  10. MOSFET Dosimetry for Evaluation of Gonad Shielding during Radiotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Hwi Young; Choi, Yun Seok; Park, So Yeon; Park, Yang Kyun [Seoul National University College of Medicine, Seoul (Korea, Republic of); Ye, Sung Joon [Seoul National University, Seoul (Korea, Republic of)

    2011-03-15

    In order to confirm feasibility of MOSFET modality in use of in vivo dosimetry, evaluation of gonad shielding in order to minimize gonadal dose of patients undergoing radiotherapy by using MOSFET modality was performed. Gonadal dose of patients undergoing radiotherapy for rectal cancer in the department of radiation oncology of Seoul National University Hospital since 2009 was measured. 6 MV and 15 MV photon beams emitted from Varian 21EX LINAC were used for radiotherapy. In order to minimize exposed dose caused by the scattered ray not only from collimator of LINAC but also from treatment region inside radiation field, we used box.shaped lead shielding material. The shielding material was made of the lead block and consists of 7.5 cm x 9.5 cm x 5.5 cm sized case and 9 cm x 9.5 cm x 1 cm sized cover. Dosimetry for evaluation of gonad shielding was done with MOSFET modality. By protecting with gonad shielding material, average gonadal dose of patients was decreased by 23.07% compared with reference dose outside of the shielding material. Average delivered gonadal dose inside the shielding material was 0.01 Gy. By the result of MOSFET dosimetry, we verified that gonadal dose was decreased by using gonad shielding material. In compare with TLD dosimetry, we could measure the exposed dose easily and precisely with MOSFET modality.

  11. Study of neutron and gamma shielding by lead borate and bismuth lead borate glasses: transparent radiation shielding

    International Nuclear Information System (INIS)

    Singh, Vishwanath P.; Badiger, N.M.

    2013-01-01

    Radiation shielding for gamma and neutron is the prominent area in nuclear reactor technology, medical application, dosimetry and other industries. Shielding of these types of radiation requires an appropriate concrete with mixture of low-to-high Z elements which is an opaque medium. The transparent radiation shielding in visible light for gamma and neutron is also extremely essential in the nuclear facilities as lead window. Presently various types of lead equivalent glass oxides have been invented which are transparent as well as provide protection from radiation. In our study we have assessment of effectiveness of neutron and gamma radiation shielding of xPbO.(1-x) B 2 O 3 (x=0.15 to 0.60) and xBi 2 O 3 .(0.80-x) PbO.0.20 B 2 O 3 (x=0.10 to 0.70) transparent borate and bismuth glasses by NXCOM program. The neutron effective mass removal cross section, Σ R /ρ (cm 2 /g) of the lead, bismuth and boron oxides are given. We found invariable Σ R /ρ of various combinations of the lead borate glass for x=0.15 to 0.60 and bismuth lead borate glass for x=0.10 to 0.70. It is observed that the effective removal cross-section for fast neutron (cm -1 ) of lead borate reduces significantly whereas roughly constant for bismuth borate. The gamma mass attenuation coefficients (μ/ρ) of the glasses were also compared with possible experimental values and found comparable. High (μ/ρ) for gamma radiation of the bismuth glasses shows that it is better gamma shielding compared with lead containing glass. However lead borate glasses are better neutron shielding as the neutron removal coefficient are higher. Our investigation is very useful for nuclear reactor technology where prompt neutron of energy 17 MeV and gamma photon up to 10 MeV produced. (author)

  12. Neutron activation of building materials used in the reactor shield

    International Nuclear Information System (INIS)

    Hernandez, A.T.; Perez, G.; D'Alessandro, K.

    1993-01-01

    Cuban concretes and their main components (mineral aggregates and cement) were investigated through long-lived activation products induced by neutrons from a reactor. The multielemental content in the materials studied was obtained by neutron activation analysis in an IBR-2 reactor and gamma activation analysis in an MT-25 microtron from Join Institute of Nuclear Research of Dubna. After irradiation of building materials for 30 years by a neutron flow of unitary density, induced radioactivity was calculated according to experimental data. The comparative evaluation of different concretes aggregates and two types of cement related to the activation properties is discussed

  13. Normalization of shielding structure quality and the method of its studying

    International Nuclear Information System (INIS)

    Bychkov, Ya.A.; Lavdanskij, P.A.

    1987-01-01

    Method for evaluation of nuclear facility radiation shield quality is suggested. Indexes of shielding structure radiation efficiency and face efficiency are used as the shielding structure quality indexes. The first index is connected with radiation dose rate during personnel irradiation behind the shield, and the second one - with the stresses in shielding structure introduction of the indexes presented allows to evaluate objectively the quality of nuclear facility shielding structure quality design construction and operation and to economize labour and material resources

  14. Preliminary shielding analysis of VHTR reactors

    International Nuclear Information System (INIS)

    Flaspoehler, Timothy M.; Petrovic, Bojan

    2011-01-01

    Over the last 20 years a number of methods have been established for automated variance reduction in Monte Carlo shielding simulations. Hybrid methods rely on deterministic adjoint and/or forward calculations to generate these parameters. In the present study, we use the FWCADIS method implemented in MAVRIC sequence of the SCALE6 package to perform preliminary shielding analyses of a VHTR reactor. MAVRIC has been successfully used by a number of researchers for a range of shielding applications, including modeling of LWRs, spent fuel storage, radiation field throughout a nuclear power plant, study of irradiation facilities, and others. However, experience in using MAVRIC for shielding studies of VHTRs is more limited. Thus, the objective of this work is to contribute toward validating MAVRIC for such applications, and identify areas for potential improvement. A simplified model of a prismatic VHTR has been devised, based on general features of the 600 MWt reactor considered as one of the NGNP options. Fuel elements have been homogenized, and the core region is represented as an annulus. However, the overall mix of materials and the relatively large dimensions of the spatial domain challenging the shielding simulations have been preserved. Simulations are performed to evaluate fast neutron fluence, dpa, and other parameters of interest at relevant positions. The paper will investigate and discuss both the effectiveness of the automated variance reduction, as well as applicability of physics model from the standpoint of specific VHTR features. (author)

  15. Hydrogen Induced Cracking of Drip Shield

    Energy Technology Data Exchange (ETDEWEB)

    G. De

    2003-02-24

    One potential failure mechanism for titanium and its alloys under repository conditions is via the absorption of atomic hydrogen in the metal crystal lattice. The resulting decreased ductility and fracture toughness may lead to brittle mechanical fracture called hydrogen-induced cracking (HIC) or hydrogen embrittlement. For the current design of the engineered barrier without backfill, HIC may be a problem since the titanium drip shield can be galvanically coupled to rock bolts (or wire mesh), which may fall onto the drip shield, thereby creating conditions for hydrogen production by electrochemical reaction. The purpose of this scientific analysis and modeling activity is to evaluate whether the drip shield will fail by HIC or not under repository conditions within 10,000 years of emplacement. This Analysis and Model Report (AMR) addresses features, events, and processes related to hydrogen induced cracking of the drip shield. REV 00 of this AMR served as a feed to ''Waste Package Degradation Process Model Report'' and was developed in accordance with the activity section ''Hydrogen Induced Cracking of Drip Shield'' of the development plan entitled ''Analysis and Model Reports to Support Waste Package PMR'' (CRWMS M&O 1999a). This AMR, prepared according to ''Technical Work Plan for: Waste Package Materials Data Analyses and Modeling'' (BSC 2002), is to feed the License Application.

  16. Development of shielding design analysis system

    International Nuclear Information System (INIS)

    Tada, Keiko; Shiraki, Takako

    2001-03-01

    The aim of this work is to develop insufficient auxiliary routines which manage input and output data and interface the main codes and to establish a shielding design analysis system on work stations (SUN, DEC). In shielding design analyses, one- and two- dimensional (1-D and 2-D) transport Sn codes are used mainly with some auxiliary codes which generate input data of Sn calculation and edit Sn calculation outputs. The main transport calculation codes can be obtained from the Code Center of RIST (Research Organization for Information Science and Technology). In this work, peripheral codes are developed to generate cross sections, produce Sn quadrature sets, edit calculation outputs or draw contour figures. In shielding calculations around a reactor, the boot-strapping technique is often employed to treat a large area extending from the core to the biological shield to improve the calculation accuracy. When a three-dimensional (3-D) calculation for a complex geometry with shielding defects, 2-D and 3-D coupling calculation is employed frequently. To use this coupling method conversion cods are prepared which read flux file from DORT and prepare an external boundary source file for the 2-D or the 3-D calculation codes. For further conveniences well used data such as the Sn quadrature sets, the dose rate conversion factors, the reaction cross section sets are stored as a data base and code manuals including sample inputs of typical problems are prepared which are comprehensible to beginners. (author)

  17. The design study of the JT-60SU device. No.8. Nuclear shielding and safety design

    Energy Technology Data Exchange (ETDEWEB)

    Miya, Naoyuki; Kikuchi, Mitsuru; Ushigusa, Kenkichi [Japan Atomic Energy Research Inst., Naka, Ibaraki (Japan). Naka Fusion Research Establishment] [and others

    1998-03-01

    Results of nuclear shielding design study and safety analysis for the steady-state tokamak device JT-60SU are described. D-T operation (option) for two years is adopted in addition to ten years operation using deuterium. Design work has been done in accordance with general laws for radioisotopes handling in Japan as a guideline of safety evaluation, which is applied to the operation of present JT-60U device. Optimization of the shielding design for the device structure including vacuum vessel has been presented to meet with allowable limits of biological shielding determined in advance. It is shown that JT-60SU can be operated safely in the present JT-60 experimental building. It is planed to use 100g/year of tritium in D-T operation phase. A concept of multiple -barrier system is applied to the facility design to prevent propagation of tritium, in which the torus hall and the tritium removal room provide the tertiary confinement. From the design of atmosphere detritiation system for accidental tritium release, it is shown that tritium concentration level can be reduced to the allowable level after two weeks with reasonable compact size components. Safety assessment related to activation of coolant/air, and atmospheric tritium effluents are discussed. (author)

  18. Muon shielding for PEP

    International Nuclear Information System (INIS)

    Jenkins, T.M.; Thomas, R.H.

    1974-01-01

    The first stage of construction of PEP will consist of electron and positron storage rings. At a later date a 200 GeV proton storage ring may be added. It is judicious therefore, to ensure that the first and second phases of construction are compatible with each other. One of several factors determining the elevation at which the storage rings will be constructed is the necessity to provide adequate radiation shielding. The overhead shielding of PEP is determined by the reproduction of neutrons in the hadron cascade generated by primary protons lost from the storage ring. The minimum overburden planned for PEP is 5.5 meters of earth (1100 gm cm/sup /minus/2/). To obtain a rough estimate of the magnitude of the muon radiation problem this note presents some preliminary calculations. Their purpose is intended merely to show that the presently proposed design for PEP will present no major shielding problems should the protons storage ring be installed. More detailed calculations will be made using muon yield computer codes developed at CERN and NAL and muon transport codes developed at SLAC, when details of the proton storage ring become settled. 9 refs., 4 figs

  19. A study on radiation shield design of storage facility for low and intermediate level radioactive waste in Bangladesh

    International Nuclear Information System (INIS)

    Khan, JJahirul Haque

    2005-02-01

    Ilmenite-Magnetite Concrete (IMC) or 58 cm thickness of Ordinary Reinforced Concrete (ORC) for the floor of the proposed storage facility building, (II) 5 cm thickness of Iron + 36 cm thickness of IMC for the surrounding wall of this installation, (III) 10 cm thickness of Iron + 5 cm thickness of Lead for the door of this installation (IV) 23 cm thickness of IMC + 5 cm thickness of Iron + 2 cm Lead for the roof of the proposed storage facility building. In this study, the shielding efficiency results (by MCNP4C) of IMC vs. ORC at different locations of this installation show that Ilmenite-Magnetite Concrete (IMC) reduces the equivalent dose rate by a factors of at least 2.45, 3.39 and 1.80 times approximately at surrounding wall, floor and roof positions of this installation respectively compared to Ordinary Reinforced Concrete (ORC). In addition, the objective of this study is to acquire the radiation shielding information that can assist in the detail design of storage facility for LILW in future by carrying out the radiation shielding analysis, which is an essential part of the radiation safety analysis of storage facility that Bangladesh had no experience in construction and operation

  20. Female gonadal shielding with automatic exposure control increases radiation risks

    Energy Technology Data Exchange (ETDEWEB)

    Kaplan, Summer L.; Zhu, Xiaowei [Children' s Hospital of Philadelphia, Department of Radiology, Philadelphia, PA (United States); University of Pennsylvania, Perelman School of Medicine, Philadelphia, PA (United States); Magill, Dennise; Felice, Marc A. [University of Pennsylvania, Environmental Health and Radiation Safety, Philadelphia, PA (United States); Xiao, Rui [University of Pennsylvania, Department of Biostatistics and Epidemiology, Philadelphia, PA (United States); Ali, Sayed [Temple University Hospital, Department of Radiology, Philadelphia, PA (United States)

    2018-02-15

    Gonadal shielding remains common, but current estimates of gonadal radiation risk are lower than estimated risks to colon and stomach. A female gonadal shield may attenuate active automatic exposure control (AEC) sensors, resulting in increased dose to colon and stomach as well as to ovaries outside the shielded area. We assess changes in dose-area product (DAP) and absorbed organ dose when female gonadal shielding is used with AEC for pelvis radiography. We imaged adult and 5-year-old equivalent dosimetry phantoms using pelvis radiograph technique with AEC in the presence and absence of a female gonadal shield. We recorded DAP and mAs and measured organ absorbed dose at six internal sites using film dosimetry. Female gonadal shielding with AEC increased DAP 63% for the 5-year-old phantom and 147% for the adult phantom. Absorbed organ dose at unshielded locations of colon, stomach and ovaries increased 21-51% in the 5-year-old phantom and 17-100% in the adult phantom. Absorbed organ dose sampled under the shield decreased 67% in the 5-year-old phantom and 16% in the adult phantom. Female gonadal shielding combined with AEC during pelvic radiography increases absorbed dose to organs with greater radiation sensitivity and to unshielded ovaries. Difficulty in proper use of gonadal shields has been well described, and use of female gonadal shielding may be inadvisable given the risks of increasing radiation. (orig.)

  1. Female gonadal shielding with automatic exposure control increases radiation risks

    International Nuclear Information System (INIS)

    Kaplan, Summer L.; Zhu, Xiaowei; Magill, Dennise; Felice, Marc A.; Xiao, Rui; Ali, Sayed

    2018-01-01

    Gonadal shielding remains common, but current estimates of gonadal radiation risk are lower than estimated risks to colon and stomach. A female gonadal shield may attenuate active automatic exposure control (AEC) sensors, resulting in increased dose to colon and stomach as well as to ovaries outside the shielded area. We assess changes in dose-area product (DAP) and absorbed organ dose when female gonadal shielding is used with AEC for pelvis radiography. We imaged adult and 5-year-old equivalent dosimetry phantoms using pelvis radiograph technique with AEC in the presence and absence of a female gonadal shield. We recorded DAP and mAs and measured organ absorbed dose at six internal sites using film dosimetry. Female gonadal shielding with AEC increased DAP 63% for the 5-year-old phantom and 147% for the adult phantom. Absorbed organ dose at unshielded locations of colon, stomach and ovaries increased 21-51% in the 5-year-old phantom and 17-100% in the adult phantom. Absorbed organ dose sampled under the shield decreased 67% in the 5-year-old phantom and 16% in the adult phantom. Female gonadal shielding combined with AEC during pelvic radiography increases absorbed dose to organs with greater radiation sensitivity and to unshielded ovaries. Difficulty in proper use of gonadal shields has been well described, and use of female gonadal shielding may be inadvisable given the risks of increasing radiation. (orig.)

  2. Female gonadal shielding with automatic exposure control increases radiation risks.

    Science.gov (United States)

    Kaplan, Summer L; Magill, Dennise; Felice, Marc A; Xiao, Rui; Ali, Sayed; Zhu, Xiaowei

    2018-02-01

    Gonadal shielding remains common, but current estimates of gonadal radiation risk are lower than estimated risks to colon and stomach. A female gonadal shield may attenuate active automatic exposure control (AEC) sensors, resulting in increased dose to colon and stomach as well as to ovaries outside the shielded area. We assess changes in dose-area product (DAP) and absorbed organ dose when female gonadal shielding is used with AEC for pelvis radiography. We imaged adult and 5-year-old equivalent dosimetry phantoms using pelvis radiograph technique with AEC in the presence and absence of a female gonadal shield. We recorded DAP and mAs and measured organ absorbed dose at six internal sites using film dosimetry. Female gonadal shielding with AEC increased DAP 63% for the 5-year-old phantom and 147% for the adult phantom. Absorbed organ dose at unshielded locations of colon, stomach and ovaries increased 21-51% in the 5-year-old phantom and 17-100% in the adult phantom. Absorbed organ dose sampled under the shield decreased 67% in the 5-year-old phantom and 16% in the adult phantom. Female gonadal shielding combined with AEC during pelvic radiography increases absorbed dose to organs with greater radiation sensitivity and to unshielded ovaries. Difficulty in proper use of gonadal shields has been well described, and use of female gonadal shielding may be inadvisable given the risks of increasing radiation.

  3. The Spallation Neutron Source (SNS) conceptual design shielding analysis

    International Nuclear Information System (INIS)

    Johnson, J.O.; Odano, N.; Lillie, R.A.

    1998-03-01

    The shielding design is important for the construction of an intense high-energy accelerator facility like the proposed Spallation Neutron Source (SNS) due to its impact on conventional facility design, maintenance operations, and since the cost for the radiation shielding shares a considerable part of the total facility costs. A calculational strategy utilizing coupled high energy Monte Carlo calculations and multi-dimensional discrete ordinates calculations, along with semi-empirical calculations, was implemented to perform the conceptual design shielding assessment of the proposed SNS. Biological shields have been designed and assessed for the proton beam transport system and associated beam dumps, the target station, and the target service cell and general remote maintenance cell. Shielding requirements have been assessed with respect to weight, space, and dose-rate constraints for operating, shutdown, and accident conditions. A discussion of the proposed facility design, conceptual design shielding requirements calculational strategy, source terms, preliminary results and conclusions, and recommendations for additional analyses are presented

  4. Magnetic field shielding effect for CFETR TF coil-case

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Weiwei; Liu, Xufeng, E-mail: Lxf@ipp.ac.cn; Du, Shuangsong; Zheng, Jinxing

    2017-05-15

    Highlights: • The eddy current of CFETR vacuum vessel can be calculated by using a series of ideal current loops. • The shielding effect with different eddy current is studied by decomposing the exciting magnetic field as two orthogonal components. • The shielding effect can be determined from the rate of eddy current magnetic field to the external magnetic field. - Abstract: The operation of superconducting magnet for fusion device is under the complex magnetic field condition, which affect the stabilization of superconductor. The coil-case of TF coil can shield the magnetic field to some extent. The shielding effect is related to the eddy current of coil-case. The shielding effect with different eddy current is studied by decomposing the exciting magnetic field as two orthogonal components, respectively. The results indicate that the shielding effect of CFETR TF coil-case has obvious different with the different directional magnetic field, and it’s larger for tangential magnetic compared with that for normal field.

  5. RESRAD-BUILD: A computer model for analyzing the radiological doses resulting from the remediation and occupancy of buildings contaminated with radioactive material

    International Nuclear Information System (INIS)

    Yu, C.; LePoire, D.J.; Jones, L.G.

    1994-11-01

    The RESRAD-BUILD computer code is a pathway analysis model designed to evaluate the potential radiological dose incurred by an individual who works or lives in a building contaminated with radioactive material. The transport of radioactive material inside the building from one compartment to another is calculated with an indoor air quality model. The air quality model considers the transport of radioactive dust particulates and radon progeny due to air exchange, deposition and resuspension, and radioactive decay and ingrowth. A single run of the RESRAD-BUILD code can model a building with up to: three compartments, 10 distinct source geometries, and 10 receptor locations. A shielding material can be specified between each source-receptor pair for external gamma dose calculations. Six exposure pathways are considered in the RESRAD-BUILD code: (1) external exposure directly from the source; (2) external exposure to materials deposited on the floor; (3) external exposure due to air submersion; (4) inhalation of airborne radioactive particulates; (5) inhalation of aerosol indoor radon progeny; and (6) inadvertent ingestion of radioactive material, either directly from the sources or from materials deposited on the surfaces of the building compartments

  6. Upgrade of the LHC magnet interconnections thermal shielding

    Energy Technology Data Exchange (ETDEWEB)

    Musso, Andrea; Barlow, Graeme; Bastard, Alain; Charrondiere, Maryline; Deferne, Guy; Dib, Gaëlle; Duret, Max; Guinchard, Michael; Prin, Hervé; Craen, Arnaud Vande; Villiger, Gilles [CERN European Organization for Nuclear Research, Meyrin 1211, Geneva 23, CH (Switzerland); Chrul, Anna [The Henryk Niewodniczanski Institute of Nuclear Physics, Polish Academy of Sciences, ul.Radzikowskiego 152, 31-324 Krakow (Poland); Damianoglou, Dimitrios [NTUA National Technical University of Athens, Heeron Polytechniou 9, 15780 Zografou (Greece); Strychalski, Michał [Wroclaw University of Technology, Faculty of Mechanical and Power Engineering, Wyb. Wyspianskiego 27, Wroclaw, 50-370 (Poland); Wright, Loren [Lancaster University, Bailrigg, Lancaster, LA1 4YW (United Kingdom)

    2014-01-29

    The about 1700 interconnections (ICs) between the Large Hadron Collider (LHC) superconducting magnets include thermal shielding at 50-75 K, providing continuity to the thermal shielding of the magnet cryostats to reduce the overall radiation heat loads to the 1.9 K helium bath of the magnets. The IC shield, made of aluminum, is conduction-cooled via a welded bridge to the thermal shield of the adjacent magnets which is actively cooled. TIG welding of these bridges made in the LHC tunnel at installation of the magnets induced a considerable risk of fire hazard due to the proximity of the multi-layer insulation of the magnet shields. A fire incident occurred in one of the machine sectors during machine installation, but fortunately with limited consequences thanks to prompt intervention of the operators. LHC is now undergoing a 2 years technical stop during which all magnet's ICs will have to be opened to consolidate the magnet electrical connections. The IC thermal shields will therefore have to be removed and re-installed after the work is completed. In order to eliminate the risk of fire hazard when re-welding, it has been decided to review the design of the IC shields, by replacing the welded bridges with a mechanical clamping which also preserves its thermal function. An additional advantage of this new solution is the ease in dismantling for maintenance, and eliminating weld-grinding operations at removal needing radioprotection measures because of material activation after long-term operation of the LHC. This paper describes the new design of the IC shields and in particular the theoretical and experimental validation of its thermal performance. Furthermore a status report of the on-going upgrade work in the LHC is given.

  7. Upgrade of the LHC magnet interconnections thermal shielding

    Science.gov (United States)

    Musso, Andrea; Barlow, Graeme; Bastard, Alain; Charrondiere, Maryline; Chrul, Anna; Damianoglou, Dimitrios; Deferne, Guy; Dib, Gaëlle; Duret, Max; Guinchard, Michael; Prin, Hervé; Strychalski, Michał; Craen, Arnaud Vande; Villiger, Gilles; Wright, Loren

    2014-01-01

    The about 1700 interconnections (ICs) between the Large Hadron Collider (LHC) superconducting magnets include thermal shielding at 50-75 K, providing continuity to the thermal shielding of the magnet cryostats to reduce the overall radiation heat loads to the 1.9 K helium bath of the magnets. The IC shield, made of aluminum, is conduction-cooled via a welded bridge to the thermal shield of the adjacent magnets which is actively cooled. TIG welding of these bridges made in the LHC tunnel at installation of the magnets induced a considerable risk of fire hazard due to the proximity of the multi-layer insulation of the magnet shields. A fire incident occurred in one of the machine sectors during machine installation, but fortunately with limited consequences thanks to prompt intervention of the operators. LHC is now undergoing a 2 years technical stop during which all magnet's ICs will have to be opened to consolidate the magnet electrical connections. The IC thermal shields will therefore have to be removed and re-installed after the work is completed. In order to eliminate the risk of fire hazard when re-welding, it has been decided to review the design of the IC shields, by replacing the welded bridges with a mechanical clamping which also preserves its thermal function. An additional advantage of this new solution is the ease in dismantling for maintenance, and eliminating weld-grinding operations at removal needing radioprotection measures because of material activation after long-term operation of the LHC. This paper describes the new design of the IC shields and in particular the theoretical and experimental validation of its thermal performance. Furthermore a status report of the on-going upgrade work in the LHC is given.

  8. 30 CFR 56.14213 - Ventilation and shielding for welding.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Ventilation and shielding for welding. 56.14213... Equipment Safety Practices and Operational Procedures § 56.14213 Ventilation and shielding for welding. (a) Welding operations shall be shielded when performed at locations where arc flash could be hazardous to...

  9. Geology of the Arabian Peninsula; shield area of western Saudi Arabia

    Science.gov (United States)

    Brown, Glen F.; Schmidt, Dwight L.; Huffman, A. Curtis

    1989-01-01

    Western Arabia lies within the low-latitude desert of north Africa and the Middle East, the core being the Arabian segment of the African Shield. The core of complex basement rocks accounts for about 670,000 km2, or one-third of the Arabian Peninsula. Reconnaissance mapping of these crystalline rocks, together with bordering sedimentary rocks and volcanic flows, begun in 1950, resulted during the next 13 years in a series of geologic and geographic maps without extensive texts. The maps served as general guides for development of natural resources, including water supplies, ore deposits, and building materials. An intensive exploration program that began in 1963 and involved numerous geologists has vastly increased geologic information.

  10. Radiation protection and shielding standards for the 1980s

    International Nuclear Information System (INIS)

    Trubey, D.K.

    1982-01-01

    The American Nuclear Society (ANS) is a standards-writing organization member of the American National Standards Institute (ANSI). The ANS Standards Committee has a subcommittee denoted ANS-6, Radiation Protection and Shielding, whose charge is to develop standards for radiation protection and shield design, to provide shielding information to other standards-writing groups, and to develop standard reference shielding data and test problems. This paper is a progress report of this subcommittee. Significant progress has been made since the last comprehensive report to the Society

  11. Current status of methods for shielding analysis

    International Nuclear Information System (INIS)

    Engle, W.W.

    1980-01-01

    Current methods used in shielding analysis and recent improvements in those methods are discussed. The status of methods development is discussed based on needs cited at the 1977 International Conference on Reactor Shielding. Additional areas where methods development is needed are discussed

  12. Collection shield for ion separation apparatus

    International Nuclear Information System (INIS)

    Ford, K.L.; Pugh, R.A.

    1981-01-01

    The ion separation electrodes in isotope separation apparatus are provided with removable collection shields to collect neutral particles which would normally pass through the ionization region. A preferred collection shield comprises a u-shaped section for clipping onto the leading edge of an electrode and a pair of flanges projecting substantially perpendicular to the clipping section for collecting neutral particles

  13. Magnetic shielding for MRI superconducting magnets

    International Nuclear Information System (INIS)

    Ishiyama, A.; Hirooka, H.

    1991-01-01

    This paper describes an optimal design of a highly homogeneous superconducting coil system with magnetic shielding for Magnetic Resonance Imaging (MRI). The presented optimal design method; which is originally proposed in our earlier papers, is a combination of the hybrid finite element and boundary element method for analysis of an axially symmetric nonlinear open boundary magnetic field problem, and the mathematical programming method for solving the corresponding optimization problem. In this paper, the multi-objective goal programming method and the nonlinear least squares method have been adopted. The optimal design results of 1.5- and 4.7-Tesla-magnet systems with different types of magnetic shielding for whole-body imaging are compared and the advantages of a combination of active and yoke shields are shown

  14. Light shielding apparatus

    Science.gov (United States)

    Miller, Richard Dean; Thom, Robert Anthony

    2017-10-10

    A light shielding apparatus for blocking light from reaching an electronic device, the light shielding apparatus including left and right support assemblies, a cross member, and an opaque shroud. The support assemblies each include primary support structure, a mounting element for removably connecting the apparatus to the electronic device, and a support member depending from the primary support structure for retaining the apparatus in an upright orientation. The cross member couples the left and right support assemblies together and spaces them apart according to the size and shape of the electronic device. The shroud may be removably and adjustably connectable to the left and right support assemblies and configured to take a cylindrical dome shape so as to form a central space covered from above. The opaque shroud prevents light from entering the central space and contacting sensitive elements of the electronic device.

  15. Thermal shield support degradation in pressurized water reactors

    International Nuclear Information System (INIS)

    Sweeney, F.J.; Fry, D.N.

    1986-01-01

    Damage to the thermal shield support structures of three pressurized water reactors (PWRs) due to flow-induced vibrations was recently discovered during refueling. In two of the reactors, severe damage occurred to the thermal shield, and in one reactor the core support barrel (CSB) was damaged, necessitating extended outages for repairs. In all three reactors, several of the thermal shield supports were either loose, damaged, or missing. The three plants had been in operation for approximately 10 years before the damage was apparent by visual inspection. Because each of the three US PWR manufacturers have experienced thermal shield support degradation, the Nuclear Regulatory Commission requested that Oak Ridge National Laboratory analyze ex-core neutron detector noise data to determine the feasibility of detecting incipient thermal shield support degradation. Results of the noise data analysis indicate that thermal shield support degradation probably began early in the life of both severely damaged plants. The degradation was characterized by shifts in the resonant frequencies of core internal structures and the appearance of new resonances in the ex-core neutron detector noise. Both the data analyses and the finite element calculations indicate that these changes in resonant frequencies are less than 3 Hz. 11 refs., 16 figs

  16. Thyroid shields and neck exposures in cephalometric radiography

    International Nuclear Information System (INIS)

    Hujoel, Philippe; Hollender, Lars; Bollen, Anne-Marie; Young, John D; Cunha-Cruz, Joana; McGee, Molly; Grosso, Alex

    2006-01-01

    The thyroid is among the more radiosensitive organs in the body. The goal of this study was twofold: (1) to evaluate age-related changes in what is exposed to ionizing radiation in the neck area, and (2) to assess thyroid shield presence in cephalometric radiographs Cephalometric radiographs at one academic setting were sampled and neck exposure was related to calendar year and patient's gender and age. In the absence of shields, children have more vertebrae exposed than adults (p < 0.0001) and females have more neck tissue exposed inferior to the hyoid bone than males (p < 0.0001). The hyoid bone-porion distance increased with age (p <0.01). Thyroid shields were visible in 19% of the radiographs and depended strongly on the calendar year during which patient was seen (p-value <0.0001). Compared to adults, children were less likely to wear thyroid shields, particularly between 1973 and 1990 (1.8% versus 7.3% – p-value < 0.05) and between 2001 and 2003 (7.1% versus 42.9% – p-value < 0.05). In the absence of a thyroid shield, children have more neck structure exposed to radiation than adults. In agreement with other reports, thyroid shield utilization in this study was low, particularly in children

  17. Pre-evaluation of fusion shielding benchmark experiment

    International Nuclear Information System (INIS)

    Hayashi, K.; Handa, H.; Konno, C.

    1994-01-01

    Shielding benchmark experiment is very useful to test the design code and nuclear data for fusion devices. There are many types of benchmark experiments that should be done in fusion shielding problems, but time and budget are limited. Therefore it will be important to select and determine the effective experimental configurations by precalculation before the experiment. The authors did three types of pre-evaluation to determine the experimental assembly configurations of shielding benchmark experiments planned in FNS, JAERI. (1) Void Effect Experiment - The purpose of this experiment is to measure the local increase of dose and nuclear heating behind small void(s) in shield material. Dimension of the voids and its arrangements were decided as follows. Dose and nuclear heating were calculated both for with and without void(s). Minimum size of the void was determined so that the ratio of these two results may be larger than error of the measurement system. (2) Auxiliary Shield Experiment - The purpose of this experiment is to measure shielding properties of B 4 C, Pb, W, and dose around superconducting magnet (SCM). Thickness of B 4 C, Pb, W and their arrangement including multilayer configuration were determined. (3) SCM Nuclear Heating Experiment - The purpose of this experiment is to measure nuclear heating and dose distribution in SCM material. Because it is difficult to use liquid helium as a part of SCM mock up material, material composition of SCM mock up are surveyed to have similar nuclear heating property of real SCM composition

  18. A history of radiation shielding of x-ray therapy rooms

    International Nuclear Information System (INIS)

    McGinley, P.H.; Miner, M.S.

    1996-01-01

    In this report the history of shielding for radiation treatment rooms is traced from the time of the discovery of x rays to the present. During the early part of the twentieth century the hazards from ionizing radiation were recognized and the use of lead and other materials became common place for shielding against x rays. Techniques for the calculation of the shield thickness needed for x ray protection were developed in the 1920's, and shielding materials were characterized in terms of the half value layer or simple exponential factors. At the same time, better knowledge of the interaction between radiation and matter was acquired. With the development of high energy medical accelerators after 1940, new and more complex shielding problems had to be addressed. Recently, shielding requirements have become more stringent as standards for exposure of personnel and the general public have been reduced. The art of shielding of radiation treatment facilities is still being developed, and the need for a revision of the reports on shielding of medical accelerators from the National Council on Radiation Protection and Measurements is emphasized in this article. (author). 61 Refs., 3 Tabs

  19. The evaluation of radiation dose to embryo/fetus and the design of shielding in the treatment of brain tumors

    Energy Technology Data Exchange (ETDEWEB)

    Cho, Woong; Huh, Soon Nyung; Chie, Eui Kyu; Ha, Sung Whan; Park, Yang Gyun; Park, Jong Min [Seoul National Univ., Seoul (Korea, Republic of); Park, Suk Won [Chungang Univ., Seoul (Korea, Republic of)

    2006-12-15

    Purpose : To estimate the dose to the embryo/fetus of a pregnant patient with brain tumors, and to design an shielding device to keep the embryo/fetus dose under acceptable levels. Materials and Methods : A shielding wall with the dimension of 1.55 m height, 0.9 m width, and 30 mm thickness is fabricated with 4 trolleys under the wall. It is placed between a patient and the treatment head of a linear accelerator to attenuate the leakage radiation effectively from the treatment head, and is placed 1 cm below the lower margin of the treatment field in order to minimize the dose to a patient from the treatment head. An anti-patient scattering neck supporters with 2 cm thick Cerrobend metal is designed to minimize the scattered radiation from the treatment fields and it is divided into 2 section. They are installed around the patient neck by attach from right and left sides. A shielding bridge for anti-room scattered radiation is utilized to place 2 sheets of 3 mm lead plates above the abdomen to setup three detectors under the lead sheets. Humanoid phantom is irradiated with the same treatment parameters, and with and without shielding devices using TLD, and ionization chambers with and without a build-up cap. Results : The dose to the embryo/fetus without shielding was 3.20, 3.21, 1.44, 0.90 cGy at off-field distances of 30, 40, 50, and 60 cm. With shielding, the dose to embryo/fetus was reduced to 0.88, 0.60, 0.35, 0.25, cGy, and the ratio of the shielding effect varied from 70% to 80%. TLD results were 1.8, 1.2, 0.8, 1.2, and 0.8 cGy. The dose measured by the survey meter was 10.9 mR/h at the patient's surface of abdomen. The dose to the embryo/fetus was estimated to be about 1 cGy during the entire treatment.

  20. Magma chamber history related to the shield building stage of Piton des Neiges volcano, La Réunion Island

    Science.gov (United States)

    Berthod, Carole; Michon, Laurent; Famin, Vincent; Bascou, Jérôme; Bachelery, Patrick

    2016-04-01

    Piton des Neiges volcano (La Réunion hotspot) experienced a long-lasting shield building stage before entering its degenerative stage 0.4 my ago. The deep edifice incision due to the intense tropical erosion allowed the description for several decades of a layered gabbroic complex interpreted as a piece of magma chamber, which has been tectonically displaced (Chevallier & Vatin-Perignon, 1982; Upton & Wadsworth, 1972). Here, we combine field investigations, petrographic, mineralogical, geochemical and anisotropy of magnetic susceptibility (AMS) studies to constrain the spatial distribution of the plutonic complex, to identify the physical and chemical processes and to integrate this complex in the evolution of Piton des Neiges (PdN). Field investigations allowed us to discover three additional massifs of gabbro and peridotite along the Mât River. The four massifs are overlaid by a pile of basic sills and a breccia interpreted as a debris avalanche deposit. Albeit spatially disconnected, the massifs show a relatively constant dip of the magnetic foliation toward the current summit of the volcano (i.e. toward the SSE). The two massifs cropping in the upper Mât River are exclusively composed of massive dunite and wherlite units with a cumulate texture and no visible dynamic structures. The two massifs located in the lower Mât River are made of olivine-gabbro, ferrogabbro and gabbro showing numerous flow structures and synmagmatic faults that indicates instabilities which trend NNW-SSE. Minerals (olivine, clinopyroxene and oxide) present primitive compositions in the two upper massifs and slightly differentiated ones in the lower massif. Given the consistency of our dataset, we propose that the four massifs correspond to outcrops of a unique chemically stratified magma chamber, whose center would have been located about 4 km North of the current summit of PdN. The existence of an initial PdN, North of the current edifice, is supported by morphological

  1. Improved Metal-Polymeric Laminate Radiation Shielding, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — In this proposed Phase I program, a multifunctional lightweight radiation shield composite will be developed and fabricated. This structural radiation shielding will...

  2. A practical neutron shielding design based on data-base interpolation

    International Nuclear Information System (INIS)

    Jiang, S.H.; Sheu, R.J.

    1993-01-01

    Neutron shielding design is an important part of the construction of nuclear reactors and high-energy accelerators. Neutron shielding design is also indispensable in the packaging and storage of isotopic neutron sources. Most efforts in the development of neutron shielding design have been concentrated on nuclear reactor shielding because of its huge mass and strict requirement of accuracy. Sophisticated computational tools, such as transport and Monte Carlo codes and detailed data libraries have been developed. In principle, now, neutron shielding, in spite of its complexity, can be designed in any detail and with fine accuracy. However, in most practical cases, neutron shielding design is accomplished with simplified methods. Unlike practical gamma-ray shielding design, where exponential attenuation coupled with buildup factors has been applied effectively and accurately, simplified neutron shielding design, either by using removal cross sections or by applying charts or tables of transmission factors such as the National Council on Radiation Protection and Measurements (NCRP) 38 (Ref. 1) for general neutron protection or to NCRP 51 (Ref. 2) for accelerator neutron shielding, is still very primitive and not well established. The available data are limited in energy range, materials, and thicknesses, and the estimated results are only roughly accurate. It is the purpose of this work to establish a simple, convenient, and user-friendly general-purpose computational tool for practical preliminary neutron shielding design that is reasonably accurate. A wide-range (energy, material, and thickness) data base of dose transmission factors has been generated by applying one-dimensional transport calculations in slab geometry

  3. Subsurface Shielding Source Term Specification Calculation

    International Nuclear Information System (INIS)

    S.Su

    2001-01-01

    The purpose of this calculation is to establish appropriate and defensible waste-package radiation source terms for use in repository subsurface shielding design. This calculation supports the shielding design for the waste emplacement and retrieval system, and subsurface facility system. The objective is to identify the limiting waste package and specify its associated source terms including source strengths and energy spectra. Consistent with the Technical Work Plan for Subsurface Design Section FY 01 Work Activities (CRWMS M and O 2001, p. 15), the scope of work includes the following: (1) Review source terms generated by the Waste Package Department (WPD) for various waste forms and waste package types, and compile them for shielding-specific applications. (2) Determine acceptable waste package specific source terms for use in subsurface shielding design, using a reasonable and defensible methodology that is not unduly conservative. This calculation is associated with the engineering and design activity for the waste emplacement and retrieval system, and subsurface facility system. The technical work plan for this calculation is provided in CRWMS M and O 2001. Development and performance of this calculation conforms to the procedure, AP-3.12Q, Calculations

  4. Shielding methods development in the United States

    International Nuclear Information System (INIS)

    Mynatt, F.R.

    1977-01-01

    A generalized shielding methodology has been developed in the U.S.A. that is adaptable to the shielding analyses of all reactor types. Thus far used primarily for liquid-metal fast breeder reactors, the methodology includes several component activities: (1) developing methods for calculating radiation transport through reactor-shield systems; (2) processing cross-section libraries; (3) performing design calculations for specific systems; (4) performing and analyzing pertinent integral experiments; (5) performing sensitivity studies on both the design calculations and the experimental analyses; and, finally, (6) calculating shield design parameters and their uncertainties. The criteria for the methodology are a 5 to 10 percent accuracy for responses at locations near the core and a factor of 2 accuracy for responses at distant locations. The methodology has been successfully adapted to most in-vessel and ex-vessel problems encountered in the shield analyses of the Fast Flux Test Facility and the Fast Flux Test Facility and the Clinch River Breeder Reactor; however, improved techniques are needed for calculating regions in which radiation streaming is dominant. Areas of the methodology in which significant progress has recently been made are those involving the development of cross-section libraries, sensitivity analysis methods, and transport codes

  5. Shielding design to obtain compact marine reactor

    International Nuclear Information System (INIS)

    Yamaji, Akio; Sako, Kiyoshi

    1994-01-01

    The marine reactors equipped in previously constructed nuclear ships are in need of the secondary shield which is installed outside the containment vessel. Most of the weight and volume of the reactor plants are occupied by this secondary shield. An advanced marine reactor called MRX (Marine Reactor X) has been designed to obtain a more compact and lightweight marine reactor with enhanced safety. The MRX is a new type of marine reactor which is an integral PWR (The steam generator is installed in the pressure vessel.) with adopting a water-filled containment vessel and a new shielding design method of no installation of the secondary shield. As a result, MRX is considerably lighter in weight and more compact in size as compared with the reactors equipped in previously constructed nuclear ships. For instance, the plant weight and volume of the containment vessel of MRX are about 50% and 70% of those of the Nuclear Ship MUTSU, in spite of the power of MRX is 2.8 times as large as the MUTSU's reactor. The shielding design calculation was made using the ANISN, DOT3.5, QAD-CGGP2 and ORIGEN codes. The computational accuracy was confirmed by experimental analyses. (author)

  6. Calculation and design for SSRF's bulk shield

    Energy Technology Data Exchange (ETDEWEB)

    Fang, K.M. [Shanghai Institute of Applied Physics, Chinese Academy of Science (China)]. E-mail: fangkm@sinap.ac.cn; Xu, X.J. [Shanghai Institute of Applied Physics, Chinese Academy of Science (China); Cai, J.H. [Shanghai Institute of Applied Physics, Chinese Academy of Science (China)

    2006-12-15

    Shielding design objectives for the SSRF are chosen, assumptions for beam loss rates are given, the methods used on the APS by Moe are summarized and introduced to make calculation and design on bulk shield, the factor of skyshine is also considered, design thicknesses for SSRF's bulk shield are presented.

  7. Comparison of eye shields in radiotherapeutic beams

    International Nuclear Information System (INIS)

    Currie, B.E.; Wellington Hospital, Wellington; Johnson, A.D.

    2004-01-01

    Full text: Both MeV electrons and kV photons are used in the treatment of superficial cancers. The advantages and disadvantages for each of these modalities have been widely reported in the literature (See for example [1-2]). Of particular note in the literature is the use of lead and tungsten eye shields to protect ocular structures during radiotherapy. An investigation addressing issues raised in the literature that are relevant to the Wellington Cancer Centre method of treatment of lesions near the eye shall be summarised. Various small sized fields were irradiated to determine depth dose and profile curves in a water phantom shielded by various commercially available eye shields. Transmission factors relevant to critical ocular structures and particle distribution theories are used to further elucidate the comparison between the use of MeV electrons and kV photons in the treatment of superficial cancers. Superficial X-rays from a Pantak Therapax unit SXT 150 model of HVL 4.90mm Al were used for the lead eye shield measurements and electrons from a Varian Clinac 2100C nominal energies 6MeV and 9MeV (R p 3.00cm and 4.34cm respectively) were used for the tungsten eye shield measurements. For the photon measurements circular applicators of 3cm, 4cm and 5cm diameter were used and for the electrons standard 6x6cm and 10x 10cm applicators were used, with no custom inserts. A Scanditronix RFA-300 water phantom and Scanditronix RFAplus version 5.3 software application were used to collect and collate all data. The eye shields were the Radiation Products Design Inc. medium lead eye shield (item 934-014) and the MED-TEC tungsten eye shields MT-T-45 M and MT-T-45 S. It is demonstrated that electron fields have appreciably greater scatter into the area directly under the eye shields than the photon fields. Similarly at the region of d max for the electron fields the relative dose is appreciably greater than the photon fields at similar depth. The relative merits for

  8. Annotated references on shielding experiment and calculation of high energy particles

    International Nuclear Information System (INIS)

    Hirayama, H.; Ban, S.; Nakamura, T.

    1990-12-01

    The literature on shielding experiment and calculation of high energy particles above 20 MeV has been surveyed. The survey covers thirteen journals, from 1965 up to 1989. For each paper, applicable information is listed on type and energy of the projectile, the accelerator used, composition and thickness of the target and shielding materials, shielding geometry, the experimental and calculational methods, and the quantities obtained. The references on shielding experiment and on shielding calculation are accessed through two indices which list the projectile-target and shielding material combination, shielding geometry and the projectile energy range. The literature on neutron, photon and hadron production from thick target bombarded by charged particles has been surveyed mainly from 1984 as a complement of the previous work. (author)

  9. A Micromachined Piezoresistive Pressure Sensor with a Shield Layer

    Science.gov (United States)

    Cao, Gang; Wang, Xiaoping; Xu, Yong; Liu, Sheng

    2016-01-01

    This paper presents a piezoresistive pressure sensor with a shield layer for improved stability. Compared with the conventional piezoresistive pressure sensors, the new one reported in this paper has an n-type shield layer that covers p-type piezoresistors. This shield layer aims to minimize the impact of electrical field and reduce the temperature sensitivity of piezoresistors. The proposed sensors have been successfully fabricated by bulk-micromachining techniques. A sensitivity of 0.022 mV/V/kPa and a maximum non-linearity of 0.085% FS are obtained in a pressure range of 1 MPa. After numerical simulation, the role of the shield layer has been experimentally investigated. It is demonstrated that the shield layer is able to reduce the drift caused by electrical field and ambient temperature variation. PMID:27529254

  10. Heavy metal oxide glasses as gamma rays shielding material

    International Nuclear Information System (INIS)

    Kaur, Preet; Singh, Devinder; Singh, Tejbir

    2016-01-01

    The gamma rays shielding parameters for heavy metal oxide glasses and concrete samples are comparable. However, the transparent nature of glasses provides additional feature to visualize inside the shielding material. Hence, different researchers had contributed in computing/measuring different shielding parameters for different configurations of heavy metal oxide glass systems. In the present work, a detailed study on different heavy metal (_5_6Ba, _6_4Gd, _8_2Pb, _8_3Bi) oxide glasses has been presented on the basis of different gamma rays shielding parameters as reported by different researchers in the recent years. It has been observed that among the selected heavy metal oxide glass systems, Bismuth based glasses provide better gamma rays shielding. Hence, Bismuth based glasses can be better substitute to concrete walls at nuclear reactor sites and nuclear labs.

  11. Heavy metal oxide glasses as gamma rays shielding material

    Energy Technology Data Exchange (ETDEWEB)

    Kaur, Preet; Singh, Devinder; Singh, Tejbir, E-mail: dr.tejbir@gmail.com

    2016-10-15

    The gamma rays shielding parameters for heavy metal oxide glasses and concrete samples are comparable. However, the transparent nature of glasses provides additional feature to visualize inside the shielding material. Hence, different researchers had contributed in computing/measuring different shielding parameters for different configurations of heavy metal oxide glass systems. In the present work, a detailed study on different heavy metal ({sub 56}Ba, {sub 64}Gd, {sub 82}Pb, {sub 83}Bi) oxide glasses has been presented on the basis of different gamma rays shielding parameters as reported by different researchers in the recent years. It has been observed that among the selected heavy metal oxide glass systems, Bismuth based glasses provide better gamma rays shielding. Hence, Bismuth based glasses can be better substitute to concrete walls at nuclear reactor sites and nuclear labs.

  12. Evaluating healthcare resource utilization and outcomes for surgical hip dislocation and hip arthroscopy for femoroacetabular impingement.

    Science.gov (United States)

    de Sa, Darren; Horner, Nolan S; MacDonald, Austin; Simunovic, Nicole; Slobogean, Gerard; Philippon, Marc J; Belzile, Etienne L; Karlsson, Jon; Ayeni, Olufemi R

    2016-12-01

    Surgical hip dislocation (SHD) and hip arthroscopy are surgical methods used to correct deformity associated with femoroacetabular impingement (FAI). Though both of these approaches appear to benefit patients, no studies exist comparing healthcare resource utilization of the two surgical approaches. This systematic review examines the literature and the records of two surgeons to evaluate the resource utilization associated with treating symptomatic FAI via these two methods. EMBASE, MEDLINE and PubMed were searched for relevant articles. The articles were systematically screened, and data was abstracted in duplicate. To further supplement resource utilization data, a retrospective chart review of two surgeon's patient data (one using SHD and another using an arthroscopic approach) was completed. Experts in pharmacy, physiotherapy, radiology, anaesthesia, physiatry and the local hospital finance department were also consulted. There were 52 studies included with a total of 460 patients (535 hips) and 3886 patients (4147 hips) who underwent SHD and arthroscopic surgery for FAI, respectively. Regardless of approach, most patients treated for symptomatic FAI improved across various outcomes measures with low complication rates. Surgical time across all approaches was similar, averaging 118 ± 2 min. On a per patient basis, hip arthroscopy ($10,976) uses approximately 41 % of the resources of SHD ($24,379). There were no significant differences in outcomes for FAI treated with SHD or arthroscopy. However, with regard to healthcare resource utilization based on the OHIP healthcare system, hip arthroscopy uses substantially less resources than SHD within the first post-operative year. Systematic Review of Level IV Studies, Level IV.

  13. CORPORATE SOCIAL RESPONSIBILITY IMPACTS ON SUSTAINABLE HUMAN DEVELOPMENT

    Directory of Open Access Journals (Sweden)

    Kerstin Anstätt

    2016-06-01

    Full Text Available The goal of this article is to critically analyze the findings of the first, recently published, studies about Corporate Social Responsibility (CSR impacts on Sustainable Human Development (SHD. We aim at deriving conclusions for effective CSR strategies and at identifying consequences for management and research. As CSR claims to create value for corporations and for society, we argue that the people-centered Capability Approach (CA is promising to provide neglected and much needed insights how corporate activities affect individuals and communities. Based on a survey of recent literature addressing CSR impacts on SHD, we highlight CSR potentials to improve average well-being in multiple dimensions of SHD. Moreover, we critically assess challenges and limitations of CSR as a strategy to preserve and foster SHD. For instance, studies have shown that, despite CSR-driven well-being increases, social capital, relational capabilities and collective agency may become challenged by corporate strategies. Moreover, corporate environmental impacts have been found to be less often addressed by both, companies and SHD researchers. Resulting inequality and fairness issues have been identified as causes of violence against corporations even in the presence of total well-being improvements. We conclude that companies should strategically take into account a comprehensive range of factors driving and hampering SHD to account for their whole portfolio of corporate opportunities and risks. This requires evaluating CSR impacts instead of only focusing on CSR inputs and outputs. Thereby, corporations can mitigate their risks, improve their stakeholder trust and strengthen their competitiveness.

  14. A Combined Shielding Design for a Neutron Generator and a Linear Accelerator at Soreq NRC

    International Nuclear Information System (INIS)

    Epstein, L.

    2014-01-01

    A new radiography facility is designed at Soreq NRC. The facility will hold a neutron generator that produces 1.73·109 n/s with an energy of 14 MeV and a linear accelerator that accelerates electrons to an energy of 9 MeV. The two radiation sources will be installed in 2 separate laboratories that will be built in an existing building. Each laboratory will have its own machine and control room. The dose rates around the sources were calculated using the FLUKA Monte Carlo code(1,2). The annual doses were calculated in several regions around the generator and the accelerator laboratories in accordance with the occupancy in each area. The calculated annual doses were compared with the dose limits specified in the Safety at Work Regulations(3) and the IAEC Standard for Protection against Ionizing Radiation. The shielding was designed to comply with the following dose constraints: 0.3 mSv/y for members of the public and 2 mSv/y for radiation workers. Each radiation source is planned to produce radiation for a maximum of 500 hours per year. The dose rate in the direct beam of the accelerator is 30 Gy/min at 1 m from the source and it will be surrounded by a collimator with an opening of 30N-tilde horizontally and 2 mm vertically, 3 m from the radiation source. The leakage radiation dose will not be greater than 1.5 mGy/min (0.005% of the direct beam, according to the manufacturer). The leakage radiation will be produced isotropically. The neutron generator will be surrounded by a shielding made of a 10 cm iron cylinder (density 7.87 g/cm3), surrounded by 50 cm of borated polyethylene (atomic percent: H (13.8%), C (82.2%), B (4%), density: 0.92 g/cm3) and 5 cm of lead (density 11.35 g/cm3). The neutron generator shielding was not designed or required in the present shielding design but was considered in the shielding calculations

  15. Shield structure for a nuclear reactor

    International Nuclear Information System (INIS)

    Rouse, C.A.; Simnad, M.T.

    1979-01-01

    An improved nuclear reactor shield structure is described for use where there are significant amounts of fast neutron flux above an energy level of approximately 70 keV. The shield includes structural supports and neutron moderator and absorber systems. A portion at least of the neutron moderator material is magnesium oxide either alone or in combination with other moderator materials such as graphite and iron. (U.K.)

  16. Safety evaluation for packaging (onsite) for concrete-shielded RHTRU waste drum for the 327 postirradiation testing laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Adkins, H.E.

    1996-10-29

    This safety evaluation for packaging authorizes onsite transport of Type B quantities of radioactive material in the Concrete- Shielded Remote-Handled Transuranic Waste (RH TRU) Drum per WHC-CM-2-14, Hazardous Material Packaging and Shipping. The drum will be used for transport of 327 Building legacy waste from the 300 Area to the Transuranic Waste Storage and Assay Facility in the 200 West Area and on to a Solid Waste Storage Facility, also in the 200 Area.

  17. Actively shielded low level gamma - spectrometric system

    International Nuclear Information System (INIS)

    Mrdja, D.; Bikit, I.; Forkapic, S.; Slivka, J.; Veskovic, M.

    2005-01-01

    The results of the adjusting and testing of the actively shielded low level gamma-spectrometry system are presented. The veto action of the shield reduces the background in the energy region of 50 keV to the 2800 keV for about 3 times. (author) [sr

  18. Eye-lens bismuth shielding in paediatric head CT: artefact evaluation and reduction

    International Nuclear Information System (INIS)

    Raissaki, Maria; Perisinakis, Kostas; Damilakis, John; Gourtsoyiannis, Nicholas

    2010-01-01

    CT scans of the brain, sinuses and petrous bones performed as the initial imaging test for a variety of indications have the potential to expose the eye-lens, considered among the most radiosensitive human tissues, to a radiation dose. There are several studies in adults discussing the reduction of orbital dose resulting from the use of commercially available bismuth-impregnated latex shields during CT examinations of the head. To evaluate bismuth shielding-induced artefacts and to provide suggestions for optimal eye-lens shielding in paediatric head CT. A bismuth shield was placed over the eyelids of 60 consecutive children undergoing head CT. Images were assessed for the presence and severity of artefacts with regard to eye-shield distance and shield wrinkling. An anthropomorphic paediatric phantom and thermoluminescence dosimeters (TLDs) were used to study the effect of eye lens-to-shield distance on shielding efficiency. Shields were tolerated by 56/60 children. Artefacts were absent in 45% of scans. Artefacts on orbits, not affecting and affecting orbit evaluation were noted in 39% and 14% of scans, respectively. Diagnostically insignificant artefacts on intracranial structures were noted in 1 case (2%) with shield misplacement. Mean eye-lens-to-shield distance was 8.8 mm in scans without artefacts, and 4.3 mm and 2.2 mm in scans with unimportant and diagnostically important artefacts, respectively. Artefacts occurred in 8 out of 9 cases with shield wrinkling. Dose reduction remained unchanged for different shield-to-eye distances. Bismuth shielding-related artefacts occurring in paediatric head CT are frequent, superficial and diagnostically insignificant when brain pathology is assessed. Shields should be placed 1 cm above the eyes when orbital pathology is addressed. Shield wrinkling should be avoided. (orig.)

  19. Thyroid shields and neck exposures in cephalometric radiography

    Directory of Open Access Journals (Sweden)

    Cunha-Cruz Joana

    2006-06-01

    Full Text Available Abstract Background The thyroid is among the more radiosensitive organs in the body. The goal of this study was twofold: (1 to evaluate age-related changes in what is exposed to ionizing radiation in the neck area, and (2 to assess thyroid shield presence in cephalometric radiographs Methods Cephalometric radiographs at one academic setting were sampled and neck exposure was related to calendar year and patient's gender and age. Results In the absence of shields, children have more vertebrae exposed than adults (p Conclusion In the absence of a thyroid shield, children have more neck structure exposed to radiation than adults. In agreement with other reports, thyroid shield utilization in this study was low, particularly in children.

  20. Magnetic shielding tests for MFTF-B neutral beamlines

    International Nuclear Information System (INIS)

    Kerns, J.; Fabyan, J.; Wood, R.; Koger, P.

    1983-01-01

    A test program to determine the effectiveness of various magnetic shielding designs for MFTF-B beamlines was established at Lawrence Livermore National Laboratory (LLNL). The proposed one-tenth-scale shielding-design models were tested in a uniform field produced by a Helmholtz coil pair. A similar technique was used for the MFTF source-injector assemblies, and the model test results were confirmed during the Technology Demonstration in 1982. The results of these tests on shielding designs for MFTF-B had an impact on the beamline design for MFTF-B. The iron-core magnet and finger assembly originally proposed were replaced by a simple, air-core, race-track-coil, bending magnet. Only the source injector needs to be magnetically shielded from the fields of approximately 400 gauss

  1. Thermal testing of solid neutron shielding materials

    International Nuclear Information System (INIS)

    Boonstra, R.H.

    1990-03-01

    The GA-4 and GA-9 spent fuel shipping casks employ a solid neutron shielding material. During a hypothetical thermal accident, any combustion of the neutron shield must not compromise the ability of the cask to contain the radioactive contents. A two-phase thermal testing program was carried out to assist in selecting satisfactory shielding materials. In the first phase, small-scale screening tests were performed on nine candidate materials using ASTM procedures. From these initial results, three of the nine candidates were chosen for inclusion in the second phase of testing, These materials were Bisco Products NS-4-FR, Reactor Experiments 201-1, and Reactor Experiments 207. In the second phase, each selected material was fabricated into a test article which simulated a full-scale of neutron shield from the cask. The test article was heated in an environmental prescribed by NRC regulations. Results of this second testing phase showed that all three materials are thermally acceptable

  2. Thermal testing of solid neutron shielding materials

    International Nuclear Information System (INIS)

    Boonstra, R.N.

    1990-01-01

    The GA-4 and GA-9 spent fuel shipping casks employ a solid neutron shielding material. During a hypothetical thermal accident, any combustion of the neutron shield must not compromise the ability of the cask to contain the radioactive contents. A two-phase thermal testing program was carried out to assist in selecting satisfactory shielding materials. In the first phase, small-scale screening tests were performed on nine candidate materials using ASTM procedures. From these initial results, three of the nine candidates were chosen for inclusion in the second phase of testing. These materials were Bisco Products NS-4-FR, Reactor Experiments 201-1, and Reactor Experiments 207. In the second phase, each selected material was fabricated into a test article which simulated a full-scale section of neutron shield from the cask. The test article was heated in an environment prescribed by NRC regulations. Results of this second testing phase show that all three materials are thermally acceptable

  3. Development of radiation shielding standards in the American Nuclear Society

    International Nuclear Information System (INIS)

    Trubey, D.K.

    1975-11-01

    The American Nuclear Society (ANS) is a standards-writing organization-member of the American National Standards Institute (ANSI). The ANS Standards Committee has a subcommittee denoted ANS-6, Shielding, whose charge is to establish standards in connection with radiation protection and shielding, to provide shielding information to other standards writing groups, and to prepare recommended sets of shielding data and test problems. This paper is a progress report of this subcommittee

  4. Evaluation of the room shielding thickness of Hi-Art tomotherapy system

    International Nuclear Information System (INIS)

    Liu Haikuan; Wu Jinhai; Gu Naigu; Gao Yiming; Wang Li; Huang Weiqin; Wang Fengxian

    2010-01-01

    In this paper, we calculate and evaluate the room shielding thickness of a Hi-Art tomotherapy system, which is a new type of radiotherapy facility. Due to the self-shielding of the accelerator,only scattered beam and beam leakage were considered in calculating the room shielding thickness. The radiation field of the tomotherapy system was used as the basic data to calculate the shielding thickness of every 15 degree solid angle. The maximum shielding thickness required of each shielding wall was at the position with the angle of 15 degree, and the calculated shielding thickness were 1023, 975, 917, 1460, 1147 and 1189 mm for the east wall,south wall,west wall, north wall, the roof and the floor,respectively. According to the calculation results, all shielding walls, ceiling and floor could meet the requirement of the radiation protection, but the north wall thickness of 1200 mm was a little thinner. (authors)

  5. Multihelix rotating shield brachytherapy for cervical cancer

    Energy Technology Data Exchange (ETDEWEB)

    Dadkhah, Hossein [Department of Biomedical Engineering, University of Iowa, 1402 Seamans Center for the Engineering Arts and Sciences, Iowa City, Iowa 52242 (United States); Kim, Yusung; Flynn, Ryan T., E-mail: ryan-flynn@uiowa.edu [Department of Radiation Oncology, University of Iowa, 200 Hawkins Drive, Iowa City, Iowa 52242 (United States); Wu, Xiaodong [Department of Radiation Oncology, University of Iowa, 200 Hawkins Drive, Iowa City, Iowa 52242 and Department of Electrical and Computer Engineering, University of Iowa, 4016 Seamans Center for the Engineering Arts and Sciences, Iowa City, Iowa 52242 (United States)

    2015-11-15

    Purpose: To present a novel brachytherapy technique, called multihelix rotating shield brachytherapy (H-RSBT), for the precise angular and linear positioning of a partial shield in a curved applicator. H-RSBT mechanically enables the dose delivery using only linear translational motion of the radiation source/shield combination. The previously proposed approach of serial rotating shield brachytherapy (S-RSBT), in which the partial shield is rotated to several angular positions at each source dwell position [W. Yang et al., “Rotating-shield brachytherapy for cervical cancer,” Phys. Med. Biol. 58, 3931–3941 (2013)], is mechanically challenging to implement in a curved applicator, and H-RSBT is proposed as a feasible solution. Methods: A Henschke-type applicator, designed for an electronic brachytherapy source (Xoft Axxent™) and a 0.5 mm thick tungsten partial shield with 180° or 45° azimuthal emission angles and 116° asymmetric zenith angle, is proposed. The interior wall of the applicator contains six evenly spaced helical keyways that rigidly define the emission direction of the partial radiation shield as a function of depth in the applicator. The shield contains three uniformly distributed protruding keys on its exterior wall and is attached to the source such that it rotates freely, thus longitudinal translational motion of the source is transferred to rotational motion of the shield. S-RSBT and H-RSBT treatment plans with 180° and 45° azimuthal emission angles were generated for five cervical cancer patients with a diverse range of high-risk target volume (HR-CTV) shapes and applicator positions. For each patient, the total number of emission angles was held nearly constant for S-RSBT and H-RSBT by using dwell positions separated by 5 and 1.7 mm, respectively, and emission directions separated by 22.5° and 60°, respectively. Treatment delivery time and tumor coverage (D{sub 90} of HR-CTV) were the two metrics used as the basis for evaluation and

  6. Open Rotor Noise Shielding by Blended-Wing-Body Aircraft

    Science.gov (United States)

    Guo, Yueping; Czech, Michael J.; Thomas, Russell H.

    2015-01-01

    This paper presents an analysis of open rotor noise shielding by Blended Wing Body (BWB) aircraft by using model scale test data acquired in the Boeing Low Speed Aeroacoustic Facility (LSAF) with a legacy F7/A7 rotor model and a simplified BWB platform. The objective of the analysis is the understanding of the shielding features of the BWB and the method of application of the shielding data for noise studies of BWB aircraft with open rotor propulsion. By studying the directivity patterns of individual tones, it is shown that though the tonal energy distribution and the spectral content of the wind tunnel test model, and thus its total noise, may differ from those of more advanced rotor designs, the individual tones follow directivity patterns that characterize far field radiations of modern open rotors, ensuring the validity of the use of this shielding data. Thus, open rotor tonal noise shielding should be categorized into front rotor tones, aft rotor tones and interaction tones, not only because of the different directivities of the three groups of tones, but also due to the differences in their source locations and coherence features, which make the respective shielding characteristics of the three groups of tones distinctly different from each other. To reveal the parametric trends of the BWB shielding effects, results are presented with variations in frequency, far field emission angle, rotor operational condition, engine installation geometry, and local airframe features. These results prepare the way for the development of parametric models for the shielding effects in prediction tools.

  7. The UK shielding Forum. Best Practice through consensus

    International Nuclear Information System (INIS)

    Hobson, J.; Gunston, K.; Gunston, K.

    2000-01-01

    The UK national shielding Forum has been established to represent all key industry groups in the UK (including the Nuclear Installations Inspectorate (NII), the national regulatory authority). The Forum's aim is to increase awareness and confidence in the range of professional practice within the UK shielding community, with a view to having a coherent and dynamic role within the international shielding community. In the past, no comprehensive representative body covering the whole UK nuclear industry has existed, and the different industry shielding groups have developed local ways of working to address their particular requirements. Inevitably, there are common issues arising from these requirements which benefit from a wider consensus. As a result of the formation of the Forum (initiated by the NII and subsequently chaired by BNFL as an industry key player), expertise, experience and best working practice are now being actively shared between shielding professionals, and there has been a strong and successful drive to achieving consensus on key issues, which is also reflected in the increasing quality of industry-regulator relationships. (author)

  8. Water and Regolith Shielding for Surface Reactor Missions

    Science.gov (United States)

    Poston, David I.; Ade, Brian J.; Sadasivan, Pratap; Leichliter, Katrina J.; Dixon, David D.

    2006-01-01

    This paper investigates potential shielding options for surface power fission reactors. The majority of work is focused on a lunar shield that uses a combination of water in stainless-steel cans and lunar regolith. The major advantage of a water-based shield is that development, testing, and deployment should be relatively inexpensive. This shielding approach is used for three surface reactor concepts: (1) a moderated spectrum, NaK cooled, Hastalloy/UZrH reactor, (2) a fast-spectrum, NaK-cooled, SS/UO2 reactor, and (3) a fast-spectrum, K-heat-pipe-cooled, SS/UO2 reactor. For this study, each of these reactors is coupled to a 25-kWt Stirling power system, designed for 5 year life. The shields are designed to limit the dose both to the Stirling alternators and potential astronauts on the surface. The general configuration used is to bury the reactor, but several other options exist as well. Dose calculations are presented as a function of distance from reactor, depth of buried hole, water boron concentration (if any), and regolith repacked density.

  9. Water and Regolith Shielding for Surface Reactor Missions

    International Nuclear Information System (INIS)

    Poston, David I.; Sadasivan, Pratap; Dixon, David D.; Ade, Brian J.; Leichliter, Katrina J.

    2006-01-01

    This paper investigates potential shielding options for surface power fission reactors. The majority of work is focused on a lunar shield that uses a combination of water in stainless-steel cans and lunar regolith. The major advantage of a water-based shield is that development, testing, and deployment should be relatively inexpensive. This shielding approach is used for three surface reactor concepts: (1) a moderated spectrum, NaK cooled, Hastalloy/UZrH reactor, (2) a fast-spectrum, NaK-cooled, SS/UO2 reactor, and (3) a fast-spectrum, K-heat-pipe-cooled, SS/UO2 reactor. For this study, each of these reactors is coupled to a 25-kWt Stirling power system, designed for 5 year life. The shields are designed to limit the dose both to the Stirling alternators and potential astronauts on the surface. The general configuration used is to bury the reactor, but several other options exist as well. Dose calculations are presented as a function of distance from reactor, depth of buried hole, water boron concentration (if any), and regolith repacked density

  10. Method of measurement on materials shielding effectiveness test in time domain

    International Nuclear Information System (INIS)

    Liu Shunkun; Han Jun; Chen Xiangyue

    2009-01-01

    Windows method is a measurement of slot coupling effect in nature when it is used to measure material's shielding effectiveness. The error of measurement will become serious when it is used to measure material's shielding effectiveness in low frequency band. It is difficult to measure material's shielding effectiveness of electromagnetic pulse with Windows method. Device under test method (DUT method) was presented in this paper to overcome the limitations of Windows method in material's shielding effectiveness test. The method can be used to measure any material's shielding Effectiveness effectively through the design and the test of the DUT.The method was used to measure shielding effectiveness of special cement .Compared with theoretical analysis,the measurement result prove the DUT method to be very efficient in material's shielding effectiveness test. (authors)

  11. WASTE TREATMENT BUILDING SYSTEM DESCRIPTION DOCUMENT

    Energy Technology Data Exchange (ETDEWEB)

    F. Habashi

    2000-06-22

    The Waste Treatment Building System provides the space, layout, structures, and embedded subsystems that support the processing of low-level liquid and solid radioactive waste generated within the Monitored Geologic Repository (MGR). The activities conducted in the Waste Treatment Building include sorting, volume reduction, and packaging of dry waste, and collecting, processing, solidification, and packaging of liquid waste. The Waste Treatment Building System is located on the surface within the protected area of the MGR. The Waste Treatment Building System helps maintain a suitable environment for the waste processing and protects the systems within the Waste Treatment Building (WTB) from most of the natural and induced environments. The WTB also confines contaminants and provides radiological protection to personnel. In addition to the waste processing operations, the Waste Treatment Building System provides space and layout for staging of packaged waste for shipment, industrial and radiological safety systems, control and monitoring of operations, safeguards and security systems, and fire protection, ventilation and utilities systems. The Waste Treatment Building System also provides the required space and layout for maintenance activities, tool storage, and administrative facilities. The Waste Treatment Building System integrates waste processing systems within its protective structure to support the throughput rates established for the MGR. The Waste Treatment Building System also provides shielding, layout, and other design features to help limit personnel radiation exposures to levels which are as low as is reasonably achievable (ALARA). The Waste Treatment Building System interfaces with the Site Generated Radiological Waste Handling System, and with other MGR systems that support the waste processing operations. The Waste Treatment Building System interfaces with the General Site Transportation System, Site Communications System, Site Water System, MGR

  12. WASTE TREATMENT BUILDING SYSTEM DESCRIPTION DOCUMENT

    International Nuclear Information System (INIS)

    Habashi, F.

    2000-01-01

    The Waste Treatment Building System provides the space, layout, structures, and embedded subsystems that support the processing of low-level liquid and solid radioactive waste generated within the Monitored Geologic Repository (MGR). The activities conducted in the Waste Treatment Building include sorting, volume reduction, and packaging of dry waste, and collecting, processing, solidification, and packaging of liquid waste. The Waste Treatment Building System is located on the surface within the protected area of the MGR. The Waste Treatment Building System helps maintain a suitable environment for the waste processing and protects the systems within the Waste Treatment Building (WTB) from most of the natural and induced environments. The WTB also confines contaminants and provides radiological protection to personnel. In addition to the waste processing operations, the Waste Treatment Building System provides space and layout for staging of packaged waste for shipment, industrial and radiological safety systems, control and monitoring of operations, safeguards and security systems, and fire protection, ventilation and utilities systems. The Waste Treatment Building System also provides the required space and layout for maintenance activities, tool storage, and administrative facilities. The Waste Treatment Building System integrates waste processing systems within its protective structure to support the throughput rates established for the MGR. The Waste Treatment Building System also provides shielding, layout, and other design features to help limit personnel radiation exposures to levels which are as low as is reasonably achievable (ALARA). The Waste Treatment Building System interfaces with the Site Generated Radiological Waste Handling System, and with other MGR systems that support the waste processing operations. The Waste Treatment Building System interfaces with the General Site Transportation System, Site Communications System, Site Water System, MGR

  13. Coal-tar-based parking lot sealcoat: An unrecognized source of PAH to settled house dust

    Science.gov (United States)

    Mahler, B.J.; Van Metre, P.C.; Wilson, J.T.; Musgrove, M.; Burbank, T.L.; Ennis, T.E.; Bashara, T.J.

    2010-01-01

    Despite much speculation, the principal factors controlling concentrations of polycyclic aromatic hydrocarbons (PAH) in settled house dust (SHD) have not yet been identified. In response to recent reports that dust from pavement with coaltar-based sealcoat contains extremely high concentrations of PAH, we measured PAH in SHD from 23 apartments and in dust from their associated parking lots, one-half of which had coal-tar-based sealcoat (CT). The median concentration of total PAH (T-PAH) in dust from CT parking lots (4760 ??g/g, n = 11) was 530 times higher than that from parking lots with other pavement surface types (asphalt-based sealcoat, unsealed asphalt, concrete [median 9.0 ??g/g, n = 12]). T-PAH in SHD from apartments with CT parking lots (median 129 ??g/g) was 25 times higher than that in SHD from apartments with parking lots with other pavement surface types (median 5.1 ??g/g). Presence or absence of CT on a parking lot explained 48% of the variance in log-transformed T-PAH in SHD. Urban land-use intensity near the residence also had a significant but weaker relation to T-PAH. No other variables tested, including carpeting, frequency of vacuuming, and indoor burning, were significant. ?? 2010 American Chemical Society.

  14. Shielding calculations for NET

    International Nuclear Information System (INIS)

    Verschuur, K.A.; Hogenbirk, A.

    1991-05-01

    In the European Fusion Technology Programme there is only a small activity on research and development for fusion neutronics. Never-the-less, looking further than blanket design now, as ECN is getting involved in design of radiation shields for the coils and biological shields, it becomes apparent that fusion neutronics as a whole still needs substantial development. Existing exact codes for calculation of complex geometries like MCNP and DORT/TORT are put over the limits of their numerical capabilities, whilst approximate codes for complex geometries like FURNACE and MERCURE4 are put over the limits of their modelling capabilities. The main objective of this study is just to find out how far we can get with existing codes in obtaining reliable values for the radiation levels inside and outside the cryostat/shield during operation and after shut-down. Starting with a 1D torus model for preliminary parametric studies, more dimensional approximation of the torus or parts of it including the main heterogeneities should follow. Regular contacts with the NET-Team are kept, to be aware of main changes in NET design that might affect our calculation models. Work on the contract started 1 July 1990. The technical description of the contract is given. (author). 14 refs.; 4 figs.; 1 tab

  15. Radioprotection shielding for neutrons induced by the reaction (2H (40 MeV, 12C

    Directory of Open Access Journals (Sweden)

    Fadil M.

    2017-01-01

    Full Text Available In the framework of design studies for SPIRAL2, the simulation of the neutron flux generated by 40 MeV deuterons on a thick 12C target was performed and compared to experimental data. The calculation of the dose rate of these neutrons allowed to compare four materials being considered for radioprotection shielding: barites, gypsum, ordinary concrete and heavy concrete. The simulated map of the neutron dose rate in the production building shows a very high dose rate around the neutron source and in the environment of some of the accelerator equipment.

  16. Radiation shielding material

    International Nuclear Information System (INIS)

    Kawakubo, Takamasa; Yamada, Fumiyuki; Nakazato, Kenjiro.

    1976-01-01

    Purpose: To provide a material, which is used for printing a samples name and date on an X-ray photographic film at the same time an X-ray radiography. Constitution: A radiation shielding material of a large mass absorption coefficient such as lead oxide, barium oxide, barium sulfate, etc. is added to a solution of a radiation permeable substance capable of imparting cold plastic fluidity (such as microcrystalline wax, paraffin, low molecular polyethylene, polyvinyl chloride, etc.). The resultant system is agitated and then cooled, and thereafter it is press fitted to or bonded to a base in the form of a film of a predetermined thickness. This radiation shielding layer is scraped off by using a writing tool to enter information to be printed in a photographic film, and then it is laid over the film and exposed to X-radiation to thereby print the information on the film. (Seki, T.)

  17. Multilayer radiation shield

    Science.gov (United States)

    Urbahn, John Arthur; Laskaris, Evangelos Trifon

    2009-06-16

    A power generation system including: a generator including a rotor including a superconductive rotor coil coupled to a rotatable shaft; a first prime mover drivingly coupled to the rotatable shaft; and a thermal radiation shield, partially surrounding the rotor coil, including at least a first sheet and a second sheet spaced apart from the first sheet by centripetal force produced by the rotatable shaft. A thermal radiation shield for a generator including a rotor including a super-conductive rotor coil including: a first sheet having at least one surface formed from a low emissivity material; and at least one additional sheet having at least one surface formed from a low emissivity material spaced apart from the first sheet by centripetal force produced by the rotatable shaft, wherein each successive sheet is an incrementally greater circumferential arc length and wherein the centripetal force shapes the sheets into a substantially catenary shape.

  18. Efficacy of corneal eye shields in protecting patients' eyes from laser irradiation.

    Science.gov (United States)

    Russell, S W; Dinehart, S M; Davis, I; Flock, S T

    1996-07-01

    The continuing development of new types and applications of lasers has appeared to surpass the development of specific eye protection for these lasers. There are a variety of eye shields on the market, but few are specifically designed for laser protection. Our purpose was to test a variety of eye shields by two parameters, light transmission and temperature rise, and to determine from these measurements the most protective shield for patients. We tested four plastic shields, one metal shield, and two sets of tanning goggles for temperature rise and light transmission when irradiated with a beam from a flashlamp-pumped, pulsed-dye laser. The temperature rise at the surface of the shield opposite the laser impacts was no more than 0.2 degree C in any case. White light was transmitted at significant levels through several of the shields, but yellow light transmittance was noted only through the green eye shield. Our measurements indicate that all except the green shield appeared safe from transmission of the 585-nm radiant energy. However, the optimal laser eye shield, in our opinion, would be a composite of several different shields' characteristics.

  19. Where have the neutrons gone: A history of the Tower Shielding Facility

    International Nuclear Information System (INIS)

    Muckenthaler, F.J.

    1992-01-01

    In the early 1950's, the concept of the unit shield for the nuclear powered aircraft reactor changed to one of the divided shield concept where the reactor and crew compartment shared the shielding load. Design calculations for the divided shield were being made based on data obtained in studies for the, unit shield. It was believed that these divided shield designs were subject to error, the magnitude of which could not be estimated. This belief led to the design of the Tower Shielding Facility where divided-shield-type measurements could be made without interference from ground or structural scattering. This paper discusses that facility, its reactors, and some chosen experiments from the list of many that were performed at that facility during the past 38 years

  20. Nuclear reactor shield including magnesium oxide

    International Nuclear Information System (INIS)

    Rouse, C.A.; Simnad, M.T.

    1981-01-01

    An improvement is described for nuclear reactor shielding of a type used in reactor applications involving significant amounts of fast neutron flux. The reactor shielding includes means providing structural support, neutron moderator material, neutron absorber material and other components, wherein at least a portion of the neutron moderator material is magnesium in the form of magnesium oxide either alone or in combination with other moderator materials such as graphite and iron