WorldWideScience

Sample records for shi yong xin

  1. [Textual research on Guang dong xin yu (New Sayings of Guangdong) quoted in Ben cao gang mu shi yi (Supplements to Compendium of Materia Medica].

    Zhang, Ruixian; Zhang, Wei; Li, Jian; Liang, Fei

    2014-05-01

    Altogether 15 terms for Guang dong xin yu (New Sayings of Guangdong) were used in Ben cao gang mu shi yi (Supplements to Compendium of Materia Medica), including Yue yu (Cantonese sayings), Chong yu (Sayings from Insect Drug), Jie yu (Sayings from Crustacean Drug), Xin yu (New Sayings), Yue hai xiang yu (Fragrant Sayings from Cantonese Region), Yue zhi mu yu (Sayings from Plants in Cantonese Annals), Guang dong suo yu (Trivial Sayings from Guangdong), Yue shan lu (Records of Cantonese Mountains), Yue lu (Cantonese Records), Jiao guang lu (Joint Guangdong Records), Yue cao zhi (Records of Cantonese Grasses), Guang guo lu (Records of Guangdong Fruits), Nan yue suo ji (Trivial Records of Southern Canton), Guang zhi (Guangdong Records), Yue zhi (Cantonese Records) etc. dealing with 57 sorts of drugs (with individual overlapping ones), the author of Xin yu was Qu Dajun, a surviving fogy of the Ming Dynasty actively involved in the activities to restore the old dynasty and resist the Qing Dynasty, and was persecuted in the literary inquisition in which his works were burnt so that Zhao Xuemin, when quoting his texts, had to go in a roundabout way.

  2. Individual Differences in Zhong-Yong tendency and Processing Capacity

    Ting-Yun eChang

    2014-11-01

    Full Text Available The present study investigated how an individual’s Zhong-Yong tendency is related to his/her perceptual processing capacity. In two experiments, participants completed a Zhong-Yong Thinking Style Scale and performed a redundant-target detection task. Processing capacity was assessed with a nonparametric approach (systems factorial technology, SFT and a parametric (linear ballistic accumulator model, LBA approach. Results converged to suggest a positive correlation between Zhong-Yong tendency and processing capacity. High middle-way thinkers had larger processing capacity in multiple-signal processing compared with low middle-way thinkers, indicating that they processed information more efficiently and in an integrated fashion. Zhong-Yong tendency positively correlates with the processing capacity. These findings suggest that the individual differences in processing capacity can account for the reasons why high middle-way thinkers tend to adopt a global and flexible processing strategy to deal with the external world. Furthermore, the influence of culturally dictated thinking style on cognition can be revealed in a perception task.

  3. Zhong-Yong as Dynamic Balancing Between Yin-Yang Opposites

    Li, Xin

    2018-01-01

    of Zhong-Yong balancing being incorrect and incomplete, the author proposes an alternative perspective on Zhong-Yong as dynamic balancing between Yin-Yang opposites. Design/methodology/approach: The author first explain why Peter P. Li’s “asymmetry” and “superiority” arguments are flawed by referring...... to the original text of the classical book of Zhong-Yong (中庸) and a comparison between Zhong-Yong and Aristotle’s doctrine of the mean. The author then propose an alternative approach to Zhong-Yong balancing that is embedded in the original text Zhong-Yong but somehow has been neglected by many Chinese scholars...

  4. Women stereotypes in Shi Zhecun's short stories.

    Rosenmeier, Christopher

    2010-01-01

    This article analyses the representation of women in two 1933 short story collections by Shi Zhecun: An Evening of Spring Rain and Exemplary Conduct of Virtuous Women. It discusses how the New Woman image was a site of contestation in Republican China, and argues that Shi Zhecun’s short stories contain four basic stereotypes: the enigmatic woman, the estranged wife, the prostitute, and the inhibited woman. Using these narratives of women and how they were perceived by men, Shi Zhecun deconstructed the New Woman image by subverting the various ways modernity was projected onto women.

  5. Dr. Shi Hanzhang's Experience in Treating Andropathy

    2007-01-01

    @@ Dr. Shi Hanzhang (施汉章) of Dongzhimen Hospital affiliated to Beijing University of Traditional Chinese Medicine is experienced in both teaching and clinical practice, especially in treating andropathy, such as sexual disorder, infertility, and hyperplasia of the prostate. The author has the honour to follow him for study and really learned a lot from him. A brief introduction to Dr. Shi's way of thinking in treatment is as follows.

  6. [Analysis of Xin'an imperial medical officials in the Ming and Qing Dynasties].

    Wan, S M; Liu, B S; Lu, X

    2017-01-28

    Xin'an imperial medical officials of the Ming and Qing Dynasties was a special group of Xin'an doctors. It had exerted a positive and active impact on the development of traditional Chinese medicine. Rooted in the Xin'an region, with higher literacy and noble medical ethics and medical knowhow, through the imperial enlistment, examination, and other ways to enter the palace as imperial medical officials. During their tenure, they wrote books and communicated and merged with the folk medicine actively. After retiring, they were still involved actively in folk medicine activities, thus promoting and influencing the development of local medicine. The formation of Xin'an community of imperial medical officials in the Ming and Qing Dynasties was closely related to the prosperity of regional culture and commerce, and the development of medicine in Xin'an region.

  7. Lin-Na and Yong-Xiu Afr J Tradit Complement Altern Med. (2014) 11 ...

    cadewumi

    Evaluation of anti-athletic fatigue activity of Schizandra chinensis aqueous extracts in mice. Afr J Pharm Pharmacol 3: 593-597. 4. Cao, Y., Hu, Y., Liu, P., Zhao, H.X., Zhou, X.J., and Wei, Y.M. (2012). Effects of a Chinese traditional formula Kai Xin San (KXS) on chronic fatigue syndrome mice induced by forced wheel running ...

  8. Zhong-Yong as Dynamic Balancing Between Yin-Yang Opposites

    Li, Xin

    2017-01-01

    Purpose The purpose of this paper is to comment on Peter Ping Li’s understanding of Zhong-Yong balancing, presented in his article titled “Global implications of the indigenous epistemological system from the East: How to apply Yin-Yang balancing to paradox management.” Seeing his understanding....... Originality/value This commentary contributes to the “West meets East” discourse by debunking Peter P. Li’s assertion that Yin-Yang balancing is superior as a solution to paradox management and his prescription that balancing between Yin-Yang opposites must be asymmetric. It also contributes to the Chinese...

  9. Civil Engineering for the SHiP facility

    Osborne, John Andrew

    2015-01-01

    The enlarged scope of the recently proposed experiment to search for Heavy Neutral Leptons, SPSC-EOI-010, is a general purpose fixed target facility which in the initial phase is aimed at a general Search for Hidden Particles (SHiP) as well as tau neutrino physics. This report represents an annex to the SHiP Technical Proposal summarizing the civil engineering considerations for SHiP.

  10. Radiation protection studies for the SHiP facility

    Strabel, Claudia Christina; Vincke, Helmut

    2015-01-01

    The enlarged scope of the recently proposed experiment to search for Heavy Neutral Leptons, SPSC-EOI-010, is a general purpose fixed target facility which in the initial phase is aimed at a general Search for Hidden Particles (SHiP) as well as tau neutrino physics. This report summarizes radiation protection considerations for the SHiP facility and the primary beam extraction for SHiP.

  11. Dicty_cDB: SHI251 [Dicty_cDB

    Full Text Available SH (Link to library) SHI251 (Link to dictyBase) - - - Contig-U11819-1 - (Link to Or...iginal site) SHI251F 125 - - - - - - Show SHI251 Library SH (Link to library) Clone ID SHI251 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11819-1 Original site URL http://dictycdb.b...XX sequence update 2002.10.25 Translated Amino Acid sequence ilfqilkistnk**IKNYYVNRVYEIIIIINICT...YKKK--- Translated Amino Acid sequence (All Frames) Frame A: ilfqilkistnk**IKNYYVNRVYEIIIIINICT

  12. Dicty_cDB: SHI867 [Dicty_cDB

    Full Text Available SH (Link to library) SHI867 (Link to dictyBase) - - - Contig-U11503-1 - (Link to Or...iginal site) SHI867F 646 - - - - - - Show SHI867 Library SH (Link to library) Clone ID SHI867 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Original site URL http://dictycdb.b...fsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICTSLKDAVSRAFLLISNNSRVCIGIIGNINVTSEQITLGNYCGA...l*lsif--- Frame C: qkkqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICT

  13. Dicty_cDB: SHI777 [Dicty_cDB

    Full Text Available SH (Link to library) SHI777 (Link to dictyBase) - - - Contig-U12085-1 - (Link to Or...iginal site) SHI777F 332 - - - - - - Show SHI777 Library SH (Link to library) Clone ID SHI777 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12085-1 Original site URL http://dictycdb.b...IKEIIQHAKEYGIRVELEIDMPGHAYSWGIGYPS VLPANFSHSIQCQPSICTNK***ikknk*kk*kniylkikkkx*kk...IKEIIQHAKEYGIRVELEIDMPGHAYSWGIGYPS VLPANFSHSIQCQPSICTNK***ikknk*kk*kniylkikkkx*kk

  14. Dark matter at the SHiP experiment

    Timiryasov, Inar

    2016-01-01

    We study prospects of dark matter searches in the SHiP experiment. SHiP (Search for Hidden Particles) is the recently proposed fixed target experiment which will exploit the high-intensity beam of 400 GeV protons from the CERN SPS. In addition to the hidden sector detector, SHiP will be equipped with the ν_τ detector, which presumably would be sensitive to dark matter particles. We describe appropriate production and detection channels and estimate SHiP’s sensitivity for a scalar dark matter coupled to the Standard model through the vector mediator

  15. Valores, Creencias Y Objectivos: Base del programa de la Escuela Experimental P.K. Yonge. (Values, Beliefs and Objectives: The Basis of Experimental Schools P.K. Yonge's Program.)

    Florida Univ., Gainesville. Coll. of Education.

    The values, beliefs, and objectives that form the core of the program at the Experimental School P.K. Yonge in the University of Florida are presented in this paper which is written in Spanish. This experimental school serves approximately 900 students from grades one through twelve. The function of the school is to conduct research to solve…

  16. The SHiP physics program

    De Lellis, Giovanni

    2018-05-01

    The discovery of the Higgs boson has fully confirmed the Standard Model of particles and fields. Nevertheless, there are still fundamental phenomena, like the existence of dark matter and the baryon asymmetry of the Universe, which deserve an explanation that could come from the discovery of new particles. The SHiP experiment at CERN meant to search for very weakly coupled particles in the few GeV mass domain has been recently proposed. The existence of such particles, foreseen in different theoretical models beyond the Standard Model, is largely unexplored. A beam dump facility using high intensity 400 GeV protons is a copious source of such unknown particles in the GeV mass range. The beam dump is also a copious source of neutrinos and in particular it is an ideal source of tau neutrinos, the less known particle in the Standard Model. Indeed, tau anti-neutrinos have not been directly observed so far. We report the physics potential of such an experiment including the tau neutrino magnetic moment.

  17. Why investors shy away from coal

    Roling, D.A.

    1994-01-01

    Why do investors shy away from coal? This may sound like a strange question given the change in ownership of many major coal companies in recent years, but the ongoing consolidation within the coal industry is quite different from any actual new investment in the industry. To begin to understand why, one must return to the early '70s, a time of low-cost, abundant energy. The price of oil was about $2-4/bbl until 1973. The price of natural gas was about 60 cents/M ft 3 , and coal was approximately $7/st. This, however, was before the first Organization of the Petroleum Exporting Countries (OPEC) shock. The price of coal declined throughout the 1980s, and continues its downward path in some markets. Many coal investments have not achieved their expected return, such as the case of a 1M st/yr mine in West Virginia, which was developed in the early '80s only to be put immediately on a care-and-maintenance basis, where it languished until it was sold in 1990. Other mines, such as the large open-pit mines in the Powder River Basin in Wyoming, never reached their targeted production rates. Some of these large mines had equipment that remained in crates for years, only later to be sold at a loss. The extent of losses on investments in coal mines is discussed

  18. The SHiP project at CERN

    De Lellis, G.; SHiP Collaboration

    2016-07-01

    The discovery of the Higgs boson has fully confirmed the Standard Model of particles and fields. Nevertheless, there are still fundamental phenomena, like the existence of dark matter and the baryon asymmetry, which deserve an explanation that could come from the discovery of new particles. Searches for new physics with accelerators are performed at the LHC, looking for high massive particles coupled to matter with ordinary strength. A new experimental facility at CERN meant to search for very weakly coupled particles in the few GeV mass domain has been recently proposed. The existence of such particles, foreseen in different theoretical models beyond the Standard Model, is largely unexplored. A beam dump facility using 400 GeV protons is a copious factory of charmed hadrons and could be used to probe the existence of such particles. The beam dump is also a copious source of neutrinos and in particular it is an ideal source of tau neutrinos, the less known particle in the Standard Model. Indeed, tau anti-neutrinos have not been directly observed so far. We report the physics potential of such an experiment. Resistive Plate Chambers could play a role in the SHiP detector.

  19. The SHiP experiment at CERN

    Bonivento, Walter M.

    2017-07-01

    The discovery of the Higgs boson has fully confirmed the Standard Model of particles and fields. Nevertheless, there are still fundamental phenomena, like the existence of dark matter and the baryon asymmetry of the Universe, deserving an explanation that could come from the discovery of new particles. Searches for new physics with accelerators are performed at the LHC, looking for high massive particles coupled to matter with ordinary strength. A new experiment at CERN meant to search for very weakly coupled particles in the few GeV mass domain has been recently proposed. The existence of such particles, foreseen in different theoretical models beyond the Standard Model, is largely unexplored. A beam dump facility using high intensity 400 GeV protons is a copious source of such unknown particles in the GeV mass range. The beam dump is also a copious source of neutrinos and in particular it is an ideal source of tau neutrinos, the less known particle in the Standard Model. The neutrino detector can also search for dark matter through its scattering off the electrons. We report the physics potential of the SHiP experiment.

  20. Kandelia obovata (S., L.) Yong tolerance mechanisms to Cadmium: Subcellular distribution, chemical forms and thiol pools

    Weng Bosen; Xie Xiangyu; Weiss, Dominik J.; Liu Jingchun; Lu Haoliang; Yan Chongling

    2012-01-01

    Highlights: ► Cadmium tolerance mechanisms of Kandelia obovata was investigated systematacially. ► Thiol pool can play roles in cadmium detoxification mechanisms. ► Increasing cadmium treatment strength caused proportional increase of cadmium uptake. ► More than half of cadmium was localized in cell walls, and lowest in membranes. ► Sodium chloride and acetic acid extractable fractions were dominant. - Abstract: In order to explore the detoxification mechanisms adopted by mangrove under cadmium (Cd) stress, we investigated the subcellular distribution and chemical forms of Cd, in addition to the change of the thiol pools in Kandelia obovata (S., L.) Yong, which were cultivated in sandy culture medium treated with sequential Cd solution. We found that Cd addition caused a proportional increase of Cd in the organs of K. obovata. The investigation of subcellular distribution verified that most of the Cd was localized in the cell wall, and the lowest was in the membrane. Results showed sodium chloride and acetic acid extractable Cd fractions were dominant. The contents of non-protein thiol compounds, Glutathione and phytochelatins in K. obovata were enhanced by the increasing strength of Cd treatment. Therefore, K. obovata can be defined as Cd tolerant plant, which base on cell wall compartmentalization, as well as protein and organic acids combination.

  1. Kim Wŏn-haeng’s Intellectual Influences on Hong Tae-yong: The Case of Relations between

    Login Lok-yin Law

    2015-08-01

    Full Text Available In the 18th century Chosŏn (1392-1910, some scholars, such as Hong Tae-yong (1731-1783 advocated that Chosŏn should learn the advantages of the Qing (1644-1912 society to reform the social structure and government of Chosŏn. The school of these advocates has been known as Pukhak by historians. The intellectual factors of the school of Pukhak’s formation and development have been overlooked by the academia of Chosŏn intellectual history. In fact, Pukhak was closely related to the idea of the school of Nakhak which believed that nature of things was equivalent to humans. Kim Wŏn-haeng, was one of the supporters of Nakhak and Hong Tae-yong was one of the students of Kim. Hong’s thought and writing exposed that his thought was profoundly influenced by Kim Wŏn-haeng. Hong was deemed to be the first prominent scholar of the Pukhak School during the 18th century Chosŏn. Hong and other scholars of Pukhak advocated learning the new knowledge from Qing China even though it was a barbarian society. Therefore, this paper will investigate the intellectual relationships between Hong Tae-yong and Kim Wŏn-haeng to reveal how intellectuals of Nakhak shaped the formation of Pukhak School and exposed the idea of learning from Qing China.

  2. Changing patient safety culture in China: a case study of an experimental Chinese hospital from a comparative perspective

    Xu XP; Deng DN; Gu YH; Ng CS; Cai X; Xu J; Zhang XS; Ke DG; Yu QH; Chan CK

    2018-01-01

    Xiao Ping Xu,* Dong Ning Deng,* Yong Hong Gu, Chui Shan Ng, Xiao Cai, Jun Xu, Xin Shi Zhang, Dong Ge Ke, Qian Hui Yu, Chi Kuen Chan Clinical Service Department, The University of Hong Kong - Shenzhen Hospital, Shenzhen, Guangdong, People’s Republic of China *These authors contributed equally to this work Background: The World Health Organization highlights that patient safety interventions are not lacking but that the local context affects their successful implementation. Increasing att...

  3. An Inquiry of Intentions in Kim Hye-yong's 'First Meeting': A North Korean Short Story in Korea Today (2007).

    Alzo David-West

    2013-01-01

    This paper examines the problem of the intentional fallacy in the North Korean short story 'First Meeting' by Kim Hye-yong. Serially published in Korea Today in 2007, the nationalist allegory centres on Shin Ch'ong-mi, a young female journalist in Pyongyang, who falls in love with her penfriend Song-u, a soldier in the Korean People's Army, and struggles to remain devoted to him when he suddenly stops writing. With the literary-critical method of counterintuitive reading, the inquiry analyses...

  4. Brothers or Rivals? Iran and the Shi'a of Iraq

    Hunter, Robert C

    2006-01-01

    This thesis examines the loyalty of the Shi a of Iraq. While some Sunni Arab leaders have recently accused the Shi a of Iraq of pledging loyalty to Iran, in fact the Iraqi Shi a are loyal to their own nation...

  5. Extraction and beam transfer for the SHiP facility

    Goddard, Brennan; Borburgh, Jan; Balhan, Bruno; Le Godec, Gilles; Zerlauth, Markus; Tommasini, Davide; Kain, Verena; Cornelis, Karel; Wenninger, Jorg; Jensen, Lars; Todd, Benjamin; Bauche, Jeremie; Puccio, Bruno

    2015-01-01

    This document summarises the key feasibility issues associated with the SPS extraction and beam transfer systems required for the SHiP facility. It describes the expected performance limits of the electrostatic septa, the expected beam losses during extraction and consequences, the design of the new beamline geometry and equipment systems and the expected extracted spill structure.

  6. Effects of Dao De Xin Xi Exercise on Balance and Quality of Life in Thai Elderly Women

    Intarakamhang, Patrawut; Chintanaprawasee, Pantipa

    2012-01-01

    The objective of this study was to evaluate the effects of a 12-week Dao De Xin Xi exercise, modified short forms of Tai Chi, on balance and quality of life in Thai elderly population. Quasi-Experimental research, pretest-posttest one group design was done at Physical Medicine and Rehabilitation Department, Phramongkutklao Hospital. Thai healthy elderly women over the age of 60, requiring regular Dao De Xin Xi exercise were recruited from either patients or workers in the hospital. A 60-minut...

  7. [Doctor HUANG Shi-ping's acupuncture with golden needles].

    Chen, Teng-Fei; Ma, Zeng-Bin; Xin, Si-Yuan; Zhu, Jiang

    2013-08-01

    Taking Doctor HUANG Shi-ping as the representative, the school of Huang's golden needle is based on Chinese martial art. Golden needles are adopted as main tool. Attaching great importance on the combination of acupuncture and moxibustioin, it is also characterized with penetrating needling with long needles. Through the development of three generations, it once outshone other schools in the field of acupuncture, and became famous all over the world. It made great contribution to the development of the course of acupuncture. However, with the development of the history, the form of acupuncture education as well as apparatus were all undergone an unified reform. Therefore, Doctor HUANG Shi-ping's acupuncture school be lost gradually.

  8. A SHiP to explore new routes

    Antonella Del Rosso

    2015-01-01

    SHiP (Search for Hidden Particles) is a proposed new facility for CERN's SPS accelerator. Its challenging goals include a direct search for hidden non-Standard-Model particles. Predicted by a large number of theoretical models, such particles could have slipped under the radar of the LHC experiments because of their specific features. In its first symposium held at CERN on 2 July, SHiP scientists showed the broader scientific community how they plan to unveil the hidden world.     The SHiP experiment is designed to be installed next to the SPS North Area.  Powerful accelerators like the LHC allow physicists to explore extensively the primordial phenomena at energy densities equivalent to those that existed just a few moments after the Big Bang. In this way, thanks to the high precision of the LHC experiments, scientists have been able to comprehensively confirm the predictions of the Standard Model (SM), including the existence of a Higgs boson. However, new...

  9. An Inquiry of Intentions in Kim Hye-yong's 'First Meeting': A North Korean Short Story in Korea Today (2007.

    Alzo David-West

    2013-11-01

    Full Text Available This paper examines the problem of the intentional fallacy in the North Korean short story 'First Meeting' by Kim Hye-yong. Serially published in Korea Today in 2007, the nationalist allegory centres on Shin Ch'ong-mi, a young female journalist in Pyongyang, who falls in love with her penfriend Song-u, a soldier in the Korean People's Army, and struggles to remain devoted to him when he suddenly stops writing. With the literary-critical method of counterintuitive reading, the inquiry analyses the structural relations of the narrative, its discourse on desire, its apparent intentions, and its contravening elements, revealing an incidental unstable narrative that is symbolically protesting of the moral of the story to affectionately embrace the political authority of the North Korean party-army regime in the military-first (songun era.

  10. Art as a Political Act: Expression of Cultural Identity, Self-Identity, and Gender by Suk Nam Yun and Yong Soon Min

    Caruso, Hwa Young Choi

    2005-01-01

    This cross-cultural study explored the lives of two contemporary Korean/Korean American women artists--Suk Nam Yun and Yong Soon Min--who live in Seoul, South Korea, and Los Angeles, California. The author's research focused on the artists' identity formation, artistic expression, professional achievements, and the role of art as a political act.…

  11. R and D of tritium technology as SHI (Sumitomo Heavy Industries)

    Yokogawa, N.

    1997-01-01

    Sumitomo Heavy Industries (SHI) participated in an R and D programme on tritium processing for the first time in 1967 by joining the advanced thermal reactor project. (The thermal reactor is cooled by light water and moderated by heavy water.) From that time SHI has developed various kind of tritium handling technologies. On the basis of cooperation with Sulzer (Sulzer Chemtech Ltd. Switzerland), SHI developed a system for removing waste water for fuel reprocessing plants by water distillation technology. In the field of fusion technology, SHI has developed a hydrogen isotope separation system by cryogenic distillation and thermal diffusion methods, and a tritium storage bed. Fundamental data required for the system design were obtained through the production and operation of the above prototype systems. Recently, SHI has also been taking part in the design and planning of ITER. In the future, along with ITER design, SHI will aim at developing tritium measuring technology. (author)

  12. $\\mu$-flux measurements for SHiP using NA61/SHINE

    Dijkstra, H; Korzenev, A; Mermod, P

    2016-01-01

    A major concern for the design of the SHiP experiment is the lack of a precise knowledge of the muon flux. This is a proposal to measure the expected muon flux in the SHiP experiment by installing a replica of the SHiP target in a 400 GeV/c proton beam in front of the NA61/SHINE spectrometer. We propose to do a first measurement in june 2017.

  13. Calibrating the SHiP muon-flux using NA61/SHINE

    Van Herwijnen, Eric; Korzenev, Alexander; Mermod, Philippe

    2016-01-01

    A major concern for the design of the SHiP experiment is the lack of a precise knowledge of the muon flux. This is a proposal to measure the expected muon flux in the SHiP experiment by installing a replica of the SHiP target in a 400 GeV proton beam in front of the NA61/SHINE spectrometer. We propose to do a first measurement in 2017.

  14. SHI induced irradiation effect on Mo/Si interface

    Agarwal, Garima; Agarwal, Shivani; Jain, Rajkumar; Lal, Chhagan; Jain, I.P.; Kabiraj, D.; Pandey, Akhilesh

    2006-01-01

    Present parametric study investigates the characteristics of SHI induced mixed molybdenum silicide film with various ion fluences. The deposition of molybdenum thin films onto the Silicon substrate was performed using e-beam evaporation, while the heavy Au ion irradiation with energy 120 MeV was subsequently applied to form molybdenum silicide. The samples have been characterized by grazing incidence X-ray diffraction (GIXRD) for the identification of phase formation at the interface. Formation of t-Mo 5 Si 3 mixed molybdenum silicide was observed on increasing the ion irradiation fluences. (author)

  15. Search for New Physics in SHiP and at future colliders

    AUTHOR|(CDS)2080890; Serra, Nicola; Storaci, Barbara

    2015-01-01

    SHiP is a newly proposed fixed-target experiment at the CERN SPS with the aim of searching for hidden particles that interact very weakly with SM particles. The work presented in this document investigates SHiP's physics reach in the parameter space of the Neutrino Minimal Standard Model ($\

  16. First steps towards geometry optimization for Spectrometer Straw Tracker of SHiP detector

    Solovev, Vladimir

    2017-01-01

    This report contains details of CERN Summer Student project which was performed for SHiP experiment (Search for Hidden Particles). The main aim of the project is optimization of Spectrometer Straw Tracker (SST) geometry implemented in FairSHiP simulation program.

  17. Interaction and conflict between Sufism and Shi`ism during Safavid era

    E Naghibi

    2017-10-01

    Full Text Available 14th century was considered as the conciliation of Imami Shi`ism and Sufism. But, the relation at the beginning of Safavid dynasty developed to the extent that concepts such as guardianship in a mixture of Shi’ite and Sufi themes made the situation prone to political functions. Imami Shi`ism became official for the first time by Safavids however, their reliance on the support of Turkmen to acquire power urged them to make Sufism superior to Shi`ism. Thus, Ghezelbash people representing Sufism depicted a great kinglike image of the Absent Imam which did not comply with religion and was against the claim of jurists. The perspective did not remain stable after Safavid dynasty was completely established. The idea was in conflict with the interests of the ruling authority, so Safavid rulers turned to Shi`ism from Sufism. The issue not only made Shi`ism and jurists superior to Sufism but also caused Shi`ites confront Sufism for several centuries. The aim of the present article is to investigate the process of peace and conflict between Sufism and Shi`ism during Safavid dynasty.

  18. Neuroprotective mechanism of Kai Xin San: upregulation of hippocampal insulin-degrading enzyme protein expression and acceleration of amyloid-beta degradation

    Na Wang

    2017-01-01

    Full Text Available Kai Xin San is a Chinese herbal formula composed of Radix Ginseng , Poria , Radix Polygalae and Acorus Tatarinowii Rhizome . It has been used in China for many years for treating amnesia. Kai Xin San ameliorates amyloid-β (Aβ-induced cognitive dysfunction and is neuroprotective in vivo , but its precise mechanism remains unclear. Expression of insulin-degrading enzyme (IDE, which degrades Aβ, is strongly correlated with cognitive function. Here, we injected rats with exogenous Aβ42 (200 μM, 5 μL into the hippocampus and subsequently administered Kai Xin San (0.54 or 1.08 g/kg/d intragastrically for 21 consecutive days. Hematoxylin-eosin and Nissl staining revealed that Kai Xin San protected neurons against Aβ-induced damage. Furthermore, enzyme-linked immunosorbent assay, western blot and polymerase chain reaction results showed that Kai Xin San decreased Aβ42 protein levels and increased expression of IDE protein, but not mRNA, in the hippocampus. Our findings reveal that Kai Xin San facilitates hippocampal Aβ degradation and increases IDE expression, which leads, at least in part, to the alleviation of hippocampal neuron injury in rats.

  19. Social surrogacy and adjustment: exploring the correlates of having a "social helper" for shy and non-shy young adolescents.

    Markovic, Andrea; Bowker, Julie C

    2015-01-01

    A social surrogate is an individual who offers help and comfort in social situations or makes social events more exciting. In this study of 157 young adolescents (55% female; Mage = 13.84 years, SD = 0.75 years), the authors examined whether the linear and curvilinear associations between self-reported social surrogate use and adjustment outcomes (social problems, loneliness, anxiety symptoms, depressive symptoms) varied as a function of shyness and gender, after accounting for the effects of positive friendship quality. Regression analyses revealed that low and high levels of social surrogate use were related to greater social problems for all adolescents. In addition, shyness emerged as a moderator for several curvilinear effects. Specifically, results indicated that (a) high levels of social surrogate use were associated with greater anxiety for adolescents high in shyness; and (b) low levels of social surrogate use were associated with greater depressive symptoms for adolescents low in shyness. Findings highlight the developmental importance of specific types of relationship experiences during early adolescence and point to different implications of social surrogate use for shy and non-shy young adolescents.

  20. Search for hidden particles with the SHiP experiment

    Hagner, Caren; Bick, Daniel; Bieschke, Stefan; Ebert, Joachim; Schmidt-Parzefall, Walter [Universitaet Hamburg, Institut fuer Experimentalphysik, Luruper Chaussee 149, 22761 Hamburg (Germany)

    2016-07-01

    Many theories beyond the standard model predict long lived neutral (hidden) particles. There might be a whole Hidden Sector (HS) of weakly interacting particles, which cannot be detected in existing high energy experiments. The SHiP experiment (Search for Hidden Particles) requires a high intensity beam dump, which could be realized by a new facility at the CERN SPS accelerator. New superweakly interacting particles with masses below O(10) GeV could be produced in the beam dump and detected in a general purpose Hidden Sector (HS) detector. In addition there will be a dedicated tau neutrino subdetector. I present the major requirements and technical challenges for the HS detector and discuss how the HS can be accessed through several portals: neutrino portal, scalar portal, vector portal and many more.

  1. The computer-assisted interview In My Shoes can benefit shy preschool children's communication

    Salari, Raziye; Eriksson, Maria; Sarkadi, Anna

    2017-01-01

    Interviewing children is a cognitively, socially, and emotionally challenging situation, especially for young and shy children. Thus, finding methods that aid rapport and increase these children’s communication is important. The present study investigated whether children’s verbal and non-verbal communicative behavior developed differently during the rapport phase, depending on whether children were situationally shy or not, and whether the interview was conducted using the computer-assisted interview In My Shoes (IMS) or a Standard verbal interview. The sample consisted of 60 children aged 4 to 5-years-old. The results showed that for the shy children in the IMS group their talkativeness increased and their answer latency decreased including the amount of encouragement the child needed to talk, while no changes were observed for the shy children in the Standard verbal interview group. There were no significant differences in the non-verbal behavior for the shy children regardless of the interview method used. For the non-shy children, overall, the interview method did not affect either the verbal or the non-verbal outcomes. Our findings indicate that IMS can be a useful tool during the rapport-building phase with shy children as it helps these children to improve their verbal communication. PMID:28813534

  2. Revolution, Modernity and (Trans)National Shi`i Islam: Rethinking Religious Conversion in Senegal.

    Leichtman, Mara A

    2009-07-01

    The establishment of a Shi`i Islamic network in Senegal is one alternative to following the country's dominant Sufi orders. I examine Senegalese conversion narratives and the central role played by the Iranian Revolution, contextualizing life stories (trans)nationally in Senegal's political economy and global networks with Iran and Lebanon. Converts localize foreign religious ideologies into a 'national' Islam through the discourse that Shi`i education can bring peace and economic development to Senegal. Senegalese Shi`a perceive that proselytizing, media technologies, and Muslim networking can lead to social, cultural and perhaps even political change through translating the Iranian Revolution into a non-violent reform movement.

  3. Impact assessment of projected climate change on diffuse phosphorous loss in Xin'anjiang catchment, China.

    Zhai, Xiaoyan; Zhang, Yongyong

    2018-02-01

    Diffuse nutrient loss is a serious threat to water security and has severely deteriorated water quality throughout the world. Xin'anjiang catchment, as a main drinking water source for Hangzhou City, has been a national concern for water environment protection with payment for watershed services construction. Detection of diffuse phosphorous (DP) pollution dynamics under climate change is significant for sustainable water quality management. In this study, the impact of projected climate change on DP load was analyzed using SWAT to simulate the future changes of diffuse components (carriers: water discharge and sediment; nutrient: DP) at both station and sub-catchment scales under three climate change scenarios (RCP2.6, RCP4.5, and RCP8.5). Results showed that wetting and warming years were expected with increasing tendencies of both precipitation and temperature in the two future periods (2020s: 2021~2030, 2030s: 2031~2040) except in the 2020s in the RCP2.6 scenario, and the annual average increasing ratios of precipitation and temperature reached - 1.79~3.79% and 0.48~1.27 °C, respectively, comparing with those in the baseline (2000s: 2001~2010). Climate change evidently altered annual and monthly average water discharge and sediment load, while it has a remarkable impact on the timing and monthly value of DP load at station scale. DP load tended to increase in the non-flood season at Yuliang due to strengthened nutrient flushing from rice land into rivers with increasing precipitation and enhanced phosphorous cycle in soil layers with increasing temperature, while it tended to decrease in the flood season at Yuliang and in most months at Tunxi due to restricted phosphorous reaction with reduced dissolved oxygen content and enhanced dilution effect. Spatial variability existed in the changes of sediment load and DP load at sub-catchment scale due to climate change. DP load tended to decrease in most sub-catchments and was the most remarkable in the RCP8

  4. Improving the Xin'anjiang hydrological model based on mass–energy balance

    Y.-H. Fang

    2017-07-01

    Full Text Available Conceptual hydrological models are preferable for real-time flood forecasting, among which the Xin'anjiang (XAJ model has been widely applied in humid and semi-humid regions of China. Although the relatively simple mass balance scheme ensures a good performance of runoff simulation during flood events, the model still has some defects. Previous studies have confirmed the importance of evapotranspiration (ET and soil moisture content (SMC in runoff simulation. In order to add more constraints to the original XAJ model, an energy balance scheme suitable for the XAJ model was developed and coupled with the original mass balance scheme of the XAJ model. The detailed parameterizations of the improved model, XAJ-EB, are presented in the first part of this paper. XAJ-EB employs various meteorological forcing and remote sensing data as input, simulating ET and runoff yield using a more physically based mass–energy balance scheme. In particular, the energy balance is solved by determining the representative equilibrium temperature (RET, which is comparable to land surface temperature (LST. The XAJ-EB was evaluated in the Lushui catchment situated in the middle reach of the Yangtze River basin for the period between 2004 and 2007. Validation using ground-measured runoff data proves that the XAJ-EB is capable of reproducing runoff comparable to the original XAJ model. Additionally, RET simulated by XAJ-EB agreed well with moderate resolution imaging spectroradiometer (MODIS-retrieved LST, which further confirms that the model is able to simulate the mass–energy balance since LST reflects the interactions among various processes. The validation results prove that the XAJ-EB model has superior performance compared with the XAJ model and also extends its applicability.

  5. Muon-flux measurements for SHiP at H4

    van Herwijnen, E

    2017-01-01

    A major concern for the design of the SHiP experiment is the lack of a precise knowledge of the muon flux. This is a proposal to measure the expected muon flux in the SHiP experiment by installing a replica of the SHiP target in a 400 GeV/c proton beam at H4. We intend building a spectrometer using the drift tube prototypes that were constructed for OPERA. A muon tagger will be built using RPCs, which will also serve as a module-0 for SHiP. We propose to do this measurement in early 2018. Accumulating $\\sim 10^{11}$ 400 GeV/c POT will enable us to make a more realistic design of the muon shield. With some modifications, this setup can also be used to measure the charm cross section (including the cascade production). We intend to test this setup after the measurement of the muon flux.

  6. The Best Friendships of Shy/Withdrawn Children: Prevalence, Stability, and Relationship Quality

    Rubin, Kenneth H.; Wojslawowicz, Julie C.; Rose-Krasnor, Linda; Booth-LaForce, Cathryn; Burgess, Kim B.

    2013-01-01

    The mutual best friendships of shy/withdrawn and control children were examined for prevalence, stability, best friend’s characteristics, and friendship quality. Using peer nominations of shy/socially withdrawn and aggressive behaviors, two groups of children were identified from a normative sample of fifth-grade children: shy/withdrawn (n = 169) and control (nonaggressive/nonwithdrawn; n = 163). Friendship nominations, teacher reports, and friendship quality data were gathered. Results revealed that shy/withdrawn children were as likely as control children to have mutual stable best friendships. Withdrawn children’s friends were more withdrawn and victimized than were the control children’s best friends; further, similarities in social withdrawal and peer victimization were revealed for withdrawn children and their friends. Withdrawn children and their friends reported lower friendship quality than did control children. Results highlight the importance of both quantitative and qualitative measures of friendship when considering relationships as risk and/or protective factors. PMID:16485175

  7. Why I Am Not SHY: A Reply to Tononi and Cirelli

    Marcos Gabriel Frank

    2013-01-01

    Full Text Available In a recent article I reviewed an influential theory of sleep function, the “synaptic homeostasis hypothesis (SHY.” According to SHY, sleep renormalizes synapses that are potentiated during prior wakefulness. I concluded that while SHY is a seminal theory with important implications about sleep function and the brain, its underlying mechanisms are poorly defined. In an accompanying article, the authors of SHY responded at length. Their reply is thoughtful and provocative, but unfortunately many of the points I raised were not accurately represented or addressed. In this brief commentary, I attempt to clarify some points of confusion. I also explain why any theory of sleep function is incomplete without an understanding of the underlying cellular mechanisms.

  8. Sensitivity of the SHiP experiment to a light scalar particle mixing with the Higgs

    Lanfranchi, Gaia

    2017-01-01

    This conceptual study shows the ultimate sensitivity of the SHiP experiment for the search of a light scalar particle mixing with the Higgs for a dataset corresponding to 5-years of SHiP operation at a nominal intensity of 4 1013 protons on target per second. The sensitivity as a function of the length of the vessel and of its distance from the target as well as a function of the background contamination is also studied.

  9. Neutrino scattering physics with the SHiP Experiment

    AUTHOR|(CDS)2083090

    2015-01-01

    SHiP (Search for Hidden Particles) is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In its initial phase the 400 GeV protons beam will be dumped on a heavy target with the aim of integrating 2 × 1020 pot in five years. A dedicated detector downstream the target will allow to probe a variety of models with the light long-lived exotic particles and masses below O(10) GeV/c2. Another dedicated detector will allow the study of active neutrino cross-sections and angular distributions. In particular, the neutrino deep-inelastic cross-sections will be performed with a statistics 1000 times larger than currently available, with the extraction of the F4 and F5 structure functions, never measured so far. Tau neutrinos will be distinguished by anti-neutrinos, thus providing the first observation of the tau anti-neutrino. With muon neutrinos it will be possible to study the strangeness content of the nucleon.

  10. The SHiP experiment at CERN SPS

    Di Crescenzoon, A

    2016-01-01

    SHiP is a new general purpose fixed target facility, whose Technical Proposal has been recently submitted to the CERN SPS Committee. In its initial phase, the 400 GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating 2 × 1020 pot in 5 years. A dedicated detector located downstream of the target, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below a few GeV/c2. The beam dump is also an ideal source of tau neutrinos, the less known particle in the Standard Model. Another dedicated detector, based on the Emulsion Cloud Chamber technology already used in the OPERA experiment, will allow to perform for the first time measurements of the tau neutrino deep inelastic scattering cross section. Tau neutrinos will be distinguished from tau anti-neutrinos, thus providing the first observation of the tau anti-neutrino.

  11. Neutrino scattering physics with the SHiP Experiment

    Di Crescenzo, Antonia

    2016-01-01

    SHiP (Search for Hidden Particles) is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In its initial phase the 400 GeV protons beam will be dumped on a heavy target with the aim of integrating $2 \\times 10^{20}$ pot in five years. A dedicated detector downstream the target will allow to probe a variety of models with the light long-lived exotic particles and masses below O(10) GeV/c2. Another dedicated detector will allow the study of active neutrino cross-sections and angular distributions. In particular, the neutrino deep-inelastic cross-sections will be performed with a statistics 1000 times larger than currently available, with the extraction of the F4 and F5 structure functions, never measured so far. Tau neutrinos will be distinguished by anti-neutrinos, thus providing the first observation of the tau anti-neutrino. With muon neutrinos it will be possible to study the strangeness content of the nucleon.

  12. Neutrino physics with the SHiP experiment

    AUTHOR|(SzGeCERN)759942

    2015-01-01

    Despite the Standard Model (SM) has been strongly confirmed by the Higgs discovery, several experimental facts are still not explained. The SHiP experiment (Search for Hidden Particles), a beam dump experiment at CERN, aims at the observation of long lived particles very weakly coupled with ordinary matter. These particles of the GeV mass scale, foreseen in many extensions of the SM, might come from the decay of charmed hadrons produced in the collision of a 400 GeV proton beam on a target. High rates of all the three active neutrinos are also expected. For the first time the properties and the cross section of the ντ will be studied thanks to a detector based on nuclear emulsions, with the micrometric resolution needed to identify the tau lepton produced in neutrino interactions. Measuring the charge of the tau daughters, will enable the first observation of the ν ̄τ and the study of its cross section.

  13. Different Influences on Tacrolimus Pharmacokinetics by Coadministrations of Zhi Ke and Zhi Shi in Rats

    Shiuan-Pey Lin

    2011-01-01

    Full Text Available Tacrolimus, an immunosuppressant with narrow therapeutic window, has been used widely in transplant patients. Grapefruit juice and pomelo have been reported to increase the blood levels of tacrolimus. Zhi Ke and Zhi Shi, the ripe peels and unripe fruits of Citrus aurantium which is chemotaxonomically related to grapefruit and pomelo, are in wide use in clinical Chinese medicine. To investigate the possible interaction of these two Citrus herbs with tacrolimus, male Sprague-Dawley rats were orally given tacrolimus (1.5 mg/kg with and without Zhi Ke and Zhi Shi decoctions in a cross-over design. Blood samples were withdrawn via cardiopuncture at specific time and quantitated by a microparticle enzyme immunoassay. In addition, to explore the mechanism of interaction, LS 180 cell line was used for the transport study of rhodamine 123, a typical substrate of P-glycoprotein (P-gp. The results showed that Zhi Shi significantly decreased the Cmax⁡ and AUC0-t of tacrolimus by 72.4% and 72.0%, respectively, whereas Zhi Ke did not affect tacrolimus pharmacokinetics. LS 180 cell line study indicated that Zhi Shi increased the efflux activity of P-gp, enabling us to explain the decreased oral bioavailability of tacrolimus caused by Zhi Shi. Hence, we suggest that Zhi Shi be contraindicated for transplant patients treated with tacrolimus to reduce the risk of allograft rejection.

  14. Different Influences on Tacrolimus Pharmacokinetics by Coadministrations of Zhi Ke and Zhi Shi in Rats

    Lin, Shiuan-Pey; Wu, Ping-Ping; Hou, Yu-Chi; Tsai, Shang-Yuan; Wang, Meng-Ju; Fang, Shih-Hua; Chao, Pei-Dawn Lee

    2011-01-01

    Tacrolimus, an immunosuppressant with narrow therapeutic window, has been used widely in transplant patients. Grapefruit juice and pomelo have been reported to increase the blood levels of tacrolimus. Zhi Ke and Zhi Shi, the ripe peels and unripe fruits of Citrus aurantium which is chemotaxonomically related to grapefruit and pomelo, are in wide use in clinical Chinese medicine. To investigate the possible interaction of these two Citrus herbs with tacrolimus, male Sprague-Dawley rats were orally given tacrolimus (1.5 mg/kg) with and without Zhi Ke and Zhi Shi decoctions in a cross-over design. Blood samples were withdrawn via cardiopuncture at specific time and quantitated by a microparticle enzyme immunoassay. In addition, to explore the mechanism of interaction, LS 180 cell line was used for the transport study of rhodamine 123, a typical substrate of P-glycoprotein (P-gp). The results showed that Zhi Shi significantly decreased the C max and AUC0−t of tacrolimus by 72.4% and 72.0%, respectively, whereas Zhi Ke did not affect tacrolimus pharmacokinetics. LS 180 cell line study indicated that Zhi Shi increased the efflux activity of P-gp, enabling us to explain the decreased oral bioavailability of tacrolimus caused by Zhi Shi. Hence, we suggest that Zhi Shi be contraindicated for transplant patients treated with tacrolimus to reduce the risk of allograft rejection. PMID:21318106

  15. Land cover of oases and forest in XinJiang, China retrieved from ASTER data

    Buhe, Aosier; Tsuchiya, K.; Kaneko, M.; Ohtaishi, N.; Halik, Mahmut

    ASTER aboard NASA’s satellite Terra is a high-resolution multispectral radiometer of 14 bands. The spatial resolution is 15 m in VNIR, 30 m in SWIR and 90 m in TIR spectra, respectively. With the data observed with ASTER, the land cover classification is produced for the Tarim Diversifolious Poplar Protection Area along the Tarim River in the northern Tarim Basin (Taklamakan Desert) in XinJiang, China. The classification of the vegetation (plants) in the arid and semiarid regions using remote-sensing technology is very difficult. Because the cause has low vegetable cover density and the influence of reflection from background soil is large. ASTER data are effective in studying the spectrum characteristics of land cover in arid and semiarid regions. The sensor has several bands in the shortwave infrared wavelength region that is designed for exploration of earth resources and study of the arid and semiarid region natural environment. However, we are not clear combination of which band is the most effective in research of the arid region like the Taklamakan desert in the data of 14 bands of ASTER. The optimum index factor (OIF), based on total variance within bands and correlation coefficient between bands, is a statistical approach to rank all possible three-band combinations. In the process of analyzing the data, the pixel sizes of all the data are converted (layer stacking and re-sampling) into consistent same size of 15 m. The three-band composite with the largest OIF value will have most information (as measured by variance) with the least amount of duplication (as measured by correlation). We used the OIF technique to rank all three-band combinations of ASTER original 14-band data over Tarim River Poplar Protection Area. Our study indicates that RGB color overlay using atmospheric corrected ASTER original bands 2, 3 (VNIR), and 6 (SWIR) has the highest OIF. When NDVI is considered as one ASTER band, highest OIF will have by carrying out bands 3 (VNIR), 4

  16. [Contribution of Professor SHI Xue-min's academic thoughts to treatment of stroke].

    Liu, Jian; Fan, Xiao-Nong; Wang, Shu

    2014-01-01

    Based on the thought of Zhishen (a kind of mind regulation), Professor SHI Xue-min, academician of the China Academy of Engineering, found the Xingnao Kaiqiao (to refresh the mind and to cause resuscitation) acupuncture method, which still plays an important role in the acupuncture treatment of wind stroke nowadays. Meanwhile, great importance is attached to the comprehensive treatment of wind stroke. Danqi Piantan capsule (see text) is developed and "wind stroke unit" is set up. In recent years, Professor SHI shifts the center of research to the treatment of hypertension, the risk factor of wind stroke. Taking Renying (ST 9) as the major acupoint, acupuncture with standard measurement and manipulations is established. And good clinical effect has been obtained as well. Therefore, this article focuses on the introduction of Professor SHI Xue-min's contribution to wind stroke treatment.

  17. The SPS beam parameters, the operational cycle, and proton sharing with the SHiP facility

    Arduini, Gianluigi; Gatignon, Lau; Cornelis, Karel

    2015-01-01

    The SHiP experiment aims at acquiring a total of 4×1019 protons on target per year. Based on demonstrated SPS performance for CNGS, the expected proton sharing between the TCC2 targets and SHiP is estimated taking into account the constraints in the super-cycle composition. We review the SPS beam parameters, the operational cycles taking into account the concurrent operation of the SPS as LHC injector and for the TCC2 experiments and the limitations on the maximum possible power dissipation and the expected sharing of the protons on target of the SHiP facility with the TCC2 targets. As a typical example this aim could be achieved while maintaining a duty cycle for the other fixed target experiments of about 18%.

  18. TianShuiShi space breeding current situation and developing trend

    Wang Fuquan; Song Jianrong; Zhang Zhongping; Guo Zhenfang

    2011-01-01

    TianShuiShi is located in xian to lanzhou among two big cities, the five space launch, has vegetables, food, grasses, flowers, rape, melon and fruit, Chinese traditional medicine, amount of 8 categories of crops, such as the 22 new material after carrying the ground breeding work. Only vegetables on identified 23 aerospace new varieties. After ten years of space breeding, summarizes the present situation of TianShuiShi space breeding, development experience, characteristic, trends, and puts forward the development space breeding TianShuiShi organization and breeding of talent from the matching policy and grow up incentive mechanism, strengthen the cooperation and all over the country, establishing fiscal policy support from the aspects such as advice. (authors)

  19. Taiwanese Composers and Piano Works in the XX Century: Traditional Chinese Culture and the Taiwan Xin Yinyue

    Luca Pisano

    2005-01-01

    Full Text Available The paper will try to prove how piano music can be considered a main tool for understanding the evolution of XX century Taiwanese New Music. Starting from the first generation of Taiwanese composers and on the basis of their piano works, the meaning of "xin yinyue" will be analysed; the paper will then try to identify the influences of both so-called "traditional culture" and western music in the development of the new music written by the subsequent generations of composers. The role of Xuanyin yaji (Atelier de creation musicale "Formusica" in the spreading of new piano works in the 90s will be also taken into consideration, as it allows us to draw out an outline of present-day piano music trends in Taiwan.

  20. [Research on Japanese monograph of comprehensive dietetic materia medica, the Pao chu bei yong wo ming ben cao (Japanese Materia Medica Prepared for Kitchen)].

    Zhou, M; Ye, J

    2017-11-28

    Japanese physicians of Edo Period (1603-1867) wrote many dietetic books, by combining the knowledge system (content and compiling style) and thoughts of diet therapy from China with local condition in Japan. Among them, the Pao chu bei yong wo ming ben cao ( Japanese Materia Medica Prepared for Kitchen ), written by Mukai Genshou, a physician in the early Edo, is the earliest comprehensive work of dietetic materia medica. In this book, the choice and usage of Japanese dietetic materia medica reveals obvious Japanese local color, including the name, morphology, cultivation, collection, identification, nature and flavor, and indication etc., reflecting the sprouting idea of edible herbal plant at the beginning of Edo period and the characteristic of absorbing Chinese diet thoughts by Japanese physician. This is the important first-hand historical material to understand the development of Japanese dietetic herbalism in early Edo and its dietotherapy culture.

  1. Spontaneous hemoperitoneum in pregnancy (SHiP) and endometriosis - A systematic review of the recent literature.

    Lier, Marit C I; Malik, Romana F; Ket, Johannes C F; Lambalk, Cornelis B; Brosens, Ivo A; Mijatovic, Velja

    2017-12-01

    Spontaneous Hemoperitoneum in Pregnancy (SHiP), an unprovoked (nontraumatic) intraperitoneal bleeding in pregnancy (up to 42days postpartum), is associated with serious adverse pregnancy outcomes. To evaluate the clinical consequences of SHiP and its association with endometriosis, a systematic review was conducted according to the PRISMA guidelines. PubMed, Embase.com and Thomson Reuters/Web of Science were searched for articles published since the latest review (August 2008) until September 2016. After assessment for eligibility, forty-four articles were included in this systematic review, describing 59 cases of SHiP. Endometriosis was present in 33/59 cases (55.9%), most often diagnosed prior to pregnancy. An association between the severity of SHiP and the stage of endometriosis could not be found. In the majority of cases, SHiP occurred in the third trimester of pregnancy (30/59 cases (50.8%)); women presented with (sub)acute abdominal pain (56/59 cases (94.9%)), hypovolemic shock (28/59 cases (47.5%)) and/or a decreased level of hemoglobin (37/59 cases (62.7%)). Signs of fetal distress were observed in 24/59 cases (40.7%). Imaging confirmed free peritoneal fluid in (37/59 cases (62.7%)). At time of surgery active bleeding was revealed in 51/56 cases (91,1%), originating from endometriotic implants (11/51 cases (21.6%)), ruptured utero-ovarian vessels (29/51 cases (56.8%)), hemorrhagic nodules of decidualized cells (1/51 cases (2.0%)) or a combination (10/51 cases (19.6%)). Median amount of hemoperitoneum was 1600mL (IQR 1000mL-2500mL). From the 45/59 cases (76.3%) in which surgical interventions was carried out during pregnancy, 7/45 cases (15.6%) reported a successful continuation of pregnancy. 5/59 cases reported recurrence of SHiP (recurrence rate 8.5%). The perinatal mortality rate was 26.9% (18/67 fetus), one maternal death was reported (1/59 cases (1,7%)). In conclusion, SHiP is a very serious complication of pregnancy, highly associated with adverse

  2. Preliminary Evaluation of a Social Skills Training and Facilitated Play Early Intervention Programme for Extremely Shy Young Children in China

    Li, Yan; Coplan, Robert J.; Wang, Yuemin; Yin, Jingtong; Zhu, Jingjing; Gao, Zhuqing; Li, Linhui

    2016-01-01

    The goal of this study was to provide a preliminary evaluation of a social skills and facilitated play early intervention programme to promote social interaction, prosocial behaviours and socio-communicative skills among young extremely shy children in China. Participants were a sample of n = 16 extremely shy young children attending kindergarten…

  3. Defining According to Its Essence: An Analysis on the Concept of Tong Shi Education (General Education) in the Native Chinese Context

    Lu, Yi; Xu, Yuan

    2018-01-01

    The authors review the concept of Tong Shi (Chinese characters omitted) in ancient Chinese philosophical texts, illustrate the Chinese cultural attributes unique to the characters Tong and Shi, and confirm that the name and essence of Tong Shi Education has a clear directivity and irreplaceable coverage to university general education in…

  4. Etude linguistique chez les Baráshi/Banyaambo du Rwanda ...

    Among the main African Languages spoken in Rwanda besides Kinyarwaanda: amashí in the South, olucigá in the North and ikiráshi/ikinyaambo in the East, only olucigá has been particularly described: J.-B. Murekezi (1984), F.-X. Bangamwabo (1989); others are just mentioned in global sociolinguistic studies: B.

  5. Interface reactions between Pd thin films and SiC by thermal annealing and SHI irradiation

    Njoroge, E.G., E-mail: eric.njoroge@up.ac.za [Department of Physics, University of Pretoria, Pretoria (South Africa); Theron, C.C. [Department of Physics, University of Pretoria, Pretoria (South Africa); Skuratov, V.A. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Wamwangi, D. [School of Physics, University of Witwatersrand, Johannesburg (South Africa); Hlatshwayo, T.T. [Department of Physics, University of Pretoria, Pretoria (South Africa); Comrie, C.M. [MRD, iThemba LABS, P.O. Box 722, Somerset West 7129 (South Africa); Malherbe, J.B. [Department of Physics, University of Pretoria, Pretoria (South Africa)

    2016-03-15

    The solid-state reactions between Pd thin films and 6H-SiC substrates induced by thermal annealing, room temperature swift heavy ion (SHI) irradiation and high temperature SHI irradiation have been investigated by in situ and real-time Rutherford backscattering spectrometry (RBS) and Grazing incidence X-ray diffraction (GIXRD). At room temperature, no silicides were detected to have formed in the Pd/SiC samples. Two reaction growth zones were observed in the samples annealed in situ and analysed by real time RBS. The initial reaction growth region led to formation of Pd{sub 3}Si or (Pd{sub 2}Si + Pd{sub 4}Si) as the initial phase(s) to form at a temperature of about 450 °C. Thereafter, the reaction zone did not change until a temperature of 640 °C was attained where Pd{sub 2}Si was observed to form in the reaction zone. Kinetic analysis of the initial reaction indicates very fast reaction rates of about 1.55 × 10{sup 15} at cm{sup −2}/s and the Pd silicide formed grew linear with time. SHI irradiation of the Pd/SiC samples was performed by 167 MeV Xe{sup 26+} ions at room temperature at high fluences of 1.07 × 10{sup 14} and 4 × 10{sup 14} ions/cm{sup 2} and at 400 °C at lower fluences of 5 × 10{sup 13} ions/cm{sup 2}. The Pd/SiC interface was analysed by RBS and no SHI induced diffusion was observed for room temperature irradiations. The sample irradiated at 400 °C, SHI induced diffusion was observed to occur accompanied with the formation of Pd{sub 4}Si, Pd{sub 9}Si{sub 2} and Pd{sub 5}Si phases which were identified by GIXRD analysis.

  6. Overexpression of the AtSHI gene in poinsettia, Euphorbia pulcherrima, results in compact plants.

    M Ashraful Islam

    Full Text Available Euphorbia pulcherrima, poinsettia, is a non-food and non-feed vegetatively propagated ornamental plant. Appropriate plant height is one of the most important traits in poinsettia production and is commonly achieved by application of chemical growth retardants. To produce compact poinsettia plants with desirable height and reduce the utilization of growth retardants, the Arabidopsis SHORT INTERNODE (AtSHI gene controlled by the cauliflower mosaic virus 35S promoter was introduced into poinsettia by Agrobacterium-mediated transformation. Three independent transgenic lines were produced and stable integration of transgene was verified by PCR and Southern blot analysis. Reduced plant height (21-52% and internode lengths (31-49% were obtained in the transgenic lines compared to control plants. This correlates positively with the AtSHI transcript levels, with the highest levels in the most dwarfed transgenic line (TL1. The indole-3-acetic acid (IAA content appeared lower (11-31% reduction in the transgenic lines compared to the wild type (WT controls, with the lowest level (31% reduction in TL1. Total internode numbers, bract numbers and bract area were significantly reduced in all transgenic lines in comparison with the WT controls. Only TL1 showed significantly lower plant diameter, total leaf area and total dry weight, whereas none of the AtSHI expressing lines showed altered timing of flower initiation, cyathia abscission or bract necrosis. This study demonstrated that introduction of the AtSHI gene into poinsettia by genetic engineering can be an effective approach in controlling plant height without negatively affecting flowering time. This can help to reduce or avoid the use of toxic growth retardants of environmental and human health concern. This is the first report that AtSHI gene was overexpressed in poinsettia and transgenic poinsettia plants with compact growth were produced.

  7. Comparative analysis of the main bioactive components of Xin-Sheng-Hua granule and its single herbs by ultrahigh performance liquid chromatography with tandem mass spectrometry.

    Pang, Hanqing; Wang, Jun; Tang, Yuping; Xu, Huiqin; Wu, Liang; Jin, Yi; Zhu, Zhenhua; Guo, Sheng; Shi, Xuqin; Huang, Shengliang; Sun, Dazheng; Duan, Jin-Ao

    2016-11-01

    Xin-Sheng-Hua granule, a representative formula for postpartum hemorrhage, has been used clinically to treat postpartum diseases. Its main bioactive components comprise aromatic acids, phthalides, alkaloids, flavonoids, and gingerols among others. To investigate the changes in main bioactive constituents in its seven single herbs before and after compatibility, a rapid, simple, and sensitive method was developed for comparative analysis of 27 main bioactive components by using ultrahigh-performance liquid chromatography with triple quadrupole electrospray tandem mass spectrometry for the first time. The sufficient separation of 27 target constituents was achieved on a Thermo Scientific Hypersil GOLD column (100 mm × 3 mm, 1.9 μm) within 20 min under the optimized chromatographic conditions. Compared with the theoretical content, the observed content of each analyte showed remarkable differences in Xin-Sheng-Hua granule except thymine, p-coumaric acid, senkyunolide I, senkyunolide H, and ligustilide; the total contents of 27 components increased significantly, and the content variation degrees for the different components were gingerols > flavonoids > aromatic acids > alkaloids > phthalides. The results could provide a good reference for the quality control of Xin-Sheng-Hua granule and might be helpful to interpret the drug interactions based on variation of bioactive components in formulae. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  8. Design of a detector to study associated charm production in the SHiP beam dump facility

    Iuliano, Antonio; Di Crescenzo, Antonia

    A dedicated experiment has been proposed by the SHiP Collaboration, to study associated charm production and decay of charmed hadrons. In this thesis we report the first design of such an experiment. This work has been carried out within the Naples neutrino group that participates to the SHiP experiment. The aim of the experiment designed in this thesis is to measure the differential associated charm production cross sections with respect to the angular and energy spectra of charmed particles. This measurement could give the acceptance of the SHiP detector for hidden particles and tau neutrinos, which are produced from charmed hadron decays.

  9. Variations in Volatile Oil Yield and Composition of "Xin-yi" (Magnolia biondii Pamp. Flower Buds) at Different Growth Stages.

    Hu, Mingli; Bai, Mei; Ye, Wei; Wang, Yaling; Wu, Hong

    2018-06-01

    Dried flower buds of Magnolia biondii Pamp. are the main ingredient in "Xin-yi" in China, and the volatile oils of M. biondii flower buds are the principal medicinal component. Gas chromatographymass spectrometry (GC-MS) and microscopic techniques were employed to detect the volatile yields of M. biondii flowers at various growth stages. The volatile oil yields of M. biondii flowers differed significantly at different growth stages and were closely related to flower dry weight, oil cell density and degree of oil accumulation. In February 2016, flower buds had the highest dry weight, the maximum percentage of oil cells at the oil saturation stage and the highest density of oil cells, which coincided with the highest oil yield. In March 2016, flower buds had a lower dry weight, a higher percentage of oil cells at the oil-degrading stage and the lowest oil cell density, resulting in decreased oil yields. The total amounts of the major medicinal components in the M. biondii flower also showed regular changes at different growth stages. In January and February of 2016, M. biondii flowers had a higher dry weight, volatile oil yield and total content of medicinal ingredients, which was the best time for harvesting high-quality medicinal components. Our study reveals that volatile oil content and chemical composition are closely related to the growth stage of M. biondii flower buds. The results provide a scientific morphology and composition index for evaluating the medicinal value and harvesting of high-quality M. biondii medicinal herbs.

  10. Donor states in a semimagnetic Cd1 -xinMnxin Te /Cd1 -xoutMnxout Te Double Quantum Well

    Kalpana, Panneer Selvam; Nithiananthi, Perumal; Jayakumar, Kalyanasundaram

    2017-02-01

    The theoretical investigation has been carried out on the binding energy of donor associated with the electrons confined in a Cd1 -xinMnxin Te /Cd1 -xoutMnxout Te Double Quantum Well (DQW) as a function of central barrier width for various well dimensions and impurity locations in the barrier and the well. The magnetic field can act as a tool to continuously change the interwell coupling inside this DQW systems and its effect on donor binding has also been studied. Moreover, the polaronic corrections, which is due to the strong exchange interaction between the magnetic moment of Mn2+ ion and the spin of the confined carrier, to the binding energy of the hydrogenic donor impurity has also been estimated with and without the application of magnetic field. The binding energy of the donor impurity is determined by solving the Schrodinger equation variationally in the effective mass approximation and the effect due to Bound Magnetic Polaron (BMP) is included using mean field theory with the modified Brillouin function. The results are reported and discussed.

  11. Hybridizing scholastic psychology with Chinese medicine: a seventeenth-century Chinese Catholic's conceptions of xin (mind and heart).

    Zhang, Qiong

    2008-01-01

    This paper explores the dynamics of cultural interactions between early modern China and Europe initiated by the Jesuits and other Catholic missionaries through a case study of Wang Honghan, a seventeenth-century Chinese Catholic who systematically sought to integrate European learning introduced by the missionaries with pre-modern Chinese medicine. Focusing on the ways in which Wang combined his Western and Chinese sources to develop and articulate his views on xin (mind and heart), this paper argues that Wang arrived at a peculiar hybrid between scholastic psychology and Chinese medicine, not so much through a course of haphazard misunderstanding as through his conscious and patterned use and abuse of his Western sources, which was motivated most possibly by a wish to define a theoretical position that most suited his social roles as a Catholic convert and a Chinese medical doctor. Thus, rather than seeing Wang as an epitome of"transmission failure," this paper offers it as a showcase for the tremendous dynamism and creativity occurring at this East-West "contact zone as representatives of both cultures sought to appropriate and transform the symbolic and textual resources of the other side.

  12. Effect of kai xin san on learning and memory in a rat model of paradoxical sleep deprivation.

    Hu, Yuan; Liu, Ming; Liu, Ping; Yan, Juan-Juan; Liu, Ming-Yue; Zhang, Gang-Qiang; Zhou, Xiao-Jiang; Yu, Bing-Ying

    2013-04-01

    The present study aimed to evaluate the effect of kai xin san (KXS, at doses of 500, 250, and 125 mg/kg body weight per day), a well-known traditional Chinese medicine, on learning and memory in paradoxical sleep deprivation (PSD)-induced cognition deficit rats. Two behavior tests (the Open Field test and the Morris water maze task) were used for testing the effects of KXS on a PSD-induced learning and memory deficit model. Furthermore, its effect on the glutamic acid (GLU) and γ-amino-butyric acid (GABA) levels in the brain tissue, brain-derived neurotrophic factor (BDNF), cyclic AMP response element binding protein (CREB), and phosphorylated-CREB (p-CREB) expression in the hippocampus was also tested. KXS exerted the greatest cognition against the 48 h PSD-induced cognitive deficit and these effects may be mediated by decreasing the GLU and GABA levels and increasing the levels of BDNF, CREB, and p-CREB. This study indicates that the effect of KXS on learning and memory in a rat model of PSD could be associated with the modulation of neurotransmitter levels and the expression of some genes in the brain that contribute to memory functions.

  13. Fault geometry and fluid-rock reaction: Combined controls on mineralization in the Xinli gold deposit, Jiaodong Peninsula, China

    Yang, Lin; Zhao, Rui; Wang, Qingfei; Liu, Xuefei; Carranza, Emmanuel John M.

    2018-06-01

    The structures and fluid-rock reaction in the Xinli gold deposit, Jiaodong Peninsula, were investigated to further understand their combined controls on the development of permeability associated with ore-forming fluid migration. Orebodies in this deposit are hosted by the moderately SE-to S-dipping Sanshandao-Cangshang fault (SCF). Variations in both dip direction and dip angle along the SCF plane produced fault bends, which controlled the fluid accumulation and ore-shoot formation. Gold mineralizations occurred in early gold-quartz-pyrite and late gold-quartz-polymetallic sulphide stages following pervasive sericitization and silicification alterations. Theoretical calculation indicates that sericitization caused 8-57% volume decrease resulting in the development/enlargement of voids, further increase of grain-scale permeability, and resultant precipitation of the early gold-quartz-pyrite pods, which destroyed permeability. The rock softening produced by alterations promoted activities of SCF secondary faults and formation of new fractures, which rebuilt the permeability and controlled the late gold-quartz-polymetallic sulfide veins. Quantitative studies on permeability distributions show that the southwestern and northeastern bend areas with similar alteration and mineralization have persistent and anti-persistent permeability networks, respectively. These were likely caused by different processes of rebuilding permeability due to different stress states resulting from changes in fault geometry.

  14. From State-controlled to Polycentric Governance in Forest Landscape Restoration: The Case of the Ecological Forest Purchase Program in Yong'an Municipality of China.

    Long, Hexing; Liu, Jinlong; Tu, Chengyue; Fu, Yimin

    2018-07-01

    Forest landscape restoration is emerging as an effective approach to restore degraded forests for the provision of ecosystem services and to minimize trade-offs between conservation and rural livelihoods. Policy and institutional innovations in China illustrate the governance transformation of forest landscape restoration from state-controlled to polycentric governance. Based on a case study of the Ecological Forest Purchase Program in Yong'an municipality, China's Fujian Province, this paper explores how such forest governance transformation has evolved and how it has shaped the outcomes of forest landscape restoration in terms of multi-dimensionality and actor configurations. Our analysis indicates that accommodating the participation of multiple actors and market-based instruments facilitate a smoother transition from state-centered to polycentric governance in forest landscape restoration. Governance transitions for forest landscape restoration must overcome a number of challenges including ensurance of a formal participation forum, fair participation, and a sustainable legislative and financial system to enhance long-term effectiveness.

  15. ν{sub τ}-physics with the SHiP experiment

    Bick, Daniel; Bieschke, Stefan; Ebert, Joachim; Hagner, Caren; Schmidt-Parzefall, Walter [Universitaet Hamburg, Institut fuer Experimentalphysik, Luruper Chaussee 149, 22761 Hamburg (Germany)

    2016-07-01

    SHiP stands for Search for Hidden Particles and is a recently proposed new general-purpose fixed target facility at the SPS at CERN. The main aim is the search for hidden particles predicted by different models capable of explaining dark matter, neutrino masses or the origin of baryon asymmetry in the Universe. Furthermore, a huge number of (τ-)neutrinos will be produced at such a facility making it an ideal place for ν{sub τ}-physics and thus giving the opportunity for a measurement of the τ-neutrino cross-sections or a first-time experimental evidence of the anti-τ-neutrino. This talk will give an overview of the neutrino experiment at the SHiP experiment. An emphasis is given to the reconstruction of muons from interactions in the neutrino target using a magnetic spectrometer.

  16. Overexpression of the AtSHI gene in poinsettia, Euphorbia pulcherrima, results in compact plants

    Islam, M. Ashraful; Lütken, Henrik Vlk; Haugslien, Sissel

    2013-01-01

    of the AtSHI gene into poinsettia by genetic engineering can be an effective approach in controlling plant height without negatively affecting flowering time. This can help to reduce or avoid the use of toxic growth retardants of environmental and human health concern. This is the first report that At......Euphorbia pulcherrima, poinsettia, is a non-food and non-feed vegetatively propagated ornamental plant. Appropriate plant height is one of the most important traits in poinsettia production and is commonly achieved by application of chemical growth retardants. To produce compact poinsettia plants...... integration of transgene was verified by PCR and Southern blot analysis. Reduced plant height (21–52%) and internode lengths (31–49%) were obtained in the transgenic lines compared to control plants. This correlates positively with the AtSHI transcript levels, with the highest levels in the most dwarfed...

  17. Addendum to Technical Proposal: A Facility to Search for Hidden Particles (SHiP) at the CERN SPS

    SHiP Collaboration

    2015-01-01

    With the Technical Proposal submitted to the SPSC committee in April 2015, the SHiP collaboration declared its interest in proceeding towards a Comprehensive Design Study phase with the aim of preparing for the Technical Design Reports pending an approval by the CERN committees. Following the recommendation by the SPSC, it has been decided to complement the TP with this addendum that provides an update of the key aspects for the review of the SHiP project.

  18. Study of nu-tau properties with the SHiP experiment

    AUTHOR|(CDS)2209555

    The SHiP experiment (Search for Hidden Particles) is a beam dump experiment proposed at the CERN SPS with the submission of a Technical Proposal in April 2015. SHiP aims at the observation of long lived particles very weakly coupled with ordinary matter. These particles are mostly produced in the decay of charmed hadrons whose production is therefore enhanced through the definition of the characteristics of both the beam and the proton target. This makes the SHiP experiment a Standard Model neutrino factory too, in particular of tau neutrinos produced by the Ds decay chain. My studies have mainly focused on the design of the neutrino detector and on the evaluation of its performances. The Neutrino Detector is placed in a magnetic field and it exploits the Emulsion Cloud Chamber Technology with the micrometric position resolution needed to disentangle the tau lepton decay vertex from the neutrino interaction vertex. This peculiarity, together with the high electron identification efficiency, makes this det...

  19. Development of a Summarized Health Index (SHI for use in predicting survival in sea turtles.

    Tsung-Hsien Li

    Full Text Available Veterinary care plays an influential role in sea turtle rehabilitation, especially in endangered species. Physiological characteristics, hematological and plasma biochemistry profiles, are useful references for clinical management in animals, especially when animals are during the convalescence period. In this study, these factors associated with sea turtle surviving were analyzed. The blood samples were collected when sea turtles remained alive, and then animals were followed up for surviving status. The results indicated that significantly negative correlation was found between buoyancy disorders (BD and sea turtle surviving (p < 0.05. Furthermore, non-surviving sea turtles had significantly higher levels of aspartate aminotranspherase (AST, creatinine kinase (CK, creatinine and uric acid (UA than surviving sea turtles (all p < 0.05. After further analysis by multiple logistic regression model, only factors of BD, creatinine and UA were included in the equation for calculating summarized health index (SHI for each individual. Through evaluation by receiver operating characteristic (ROC curve, the result indicated that the area under curve was 0.920 ± 0.037, and a cut-off SHI value of 2.5244 showed 80.0% sensitivity and 86.7% specificity in predicting survival. Therefore, the developed SHI could be a useful index to evaluate health status of sea turtles and to improve veterinary care at rehabilitation facilities.

  20. Pramana – Journal of Physics | Indian Academy of Sciences

    Home; Journals; Pramana – Journal of Physics; Volume 73; Issue 6. Magnons interaction of spinor Bose–Einstein condensates in an optical lattice. Yong-Qing Liu. Volume 73 Issue 6 ... Author Affiliations. Yong-Qing Liu1. Department of Physics and Electronics, XinZhou Teachers University, XinZhou, 034000, China ...

  1. The pedagogical value of a student-run community-based experiential learning project: The Yong Loo Lin School of Medicine Public Health Screening.

    Wee, Liang En; Yeo, Wei Xin; Tay, Clifton M; Lee, Jeannette J M; Koh, Gerald C H

    2010-09-01

    We assessed the pedagogical value of a student-led community-based experiential learning project called the Public Health Screening (PHS) run by medical and nursing students of the National University of Singapore's Yong Loo Lin School of Medicine (NUS YLLSoM). We conducted a cross-sectional study using a self-administered anonymised questionnaire on medical and nursing students who participated in PHS using the Fund for the Improvement of Postsecondary Education (FIPSE) Survey Instrument. Participants also gave an overall score for their learning experience at the PHS. The participation rate was 93.1% (576/619) for medical students and 100% (37/37) for nursing students. All participants gave the PHS learning experience a high rating (median = 8 out of maximum of 10, inter-quartile range, 7 to 9). A majority of participants felt that PHS had helped them to improve across all domains surveyed. For medical students, those in preclinical years and females were independently more likely to feel that PHS had helped them to improve in communication skills, teamwork, ability to identify social issues, taking action, and gaining and applying their knowledge than those in clinical years and males. Improved ability to interact with patients (β=1.64, 95%CI, 1.01-2.27), appreciation of challenges to healthcare faced by Singaporeans from lower income groups (β=0.93, 95%CI, 0.49-1.37), thinking of others (β=0.70, 95%CI, 0.04-1.37) and tolerance of different people (β =0.63, 95%CI, 0.17-1.10) were strongly associated with the overall rating score. PHS was a positive learning experience in a wide range of domains for all students involved. This suggests that student-organised community-based experiential learning projects have potential educational value for both medical and nursing students.

  2. [A review for a traditional Chinese medical journal Shou Shi Yi Bao].

    Xiao, Mei-Hua; Sun, Wen-Zhong

    2009-06-01

    Shou Shi Yi Bao was a journal of traditional Chinese medicine (TCM) during the period from 1935 to 1937, and was originated by Chen Huan-yun, a TCM physician in Suzhou. It is mainly to transmit the knowledge of TCM and to promote the epidemic prevention capacity of local public. The editorial characteristics and historical value of the journal were explored in initial background, staff writers, editorial policies, contents and the Editor Chen's medical ideas. Shou Shi Yi Bao was supported by many famous TCM physicians, although the journal was originated from the civil society. It was an academic TCM journal with perfect practicability for orientating to the public and highlighting the academic spirit. Chen Huan-yun was a resolute defender of TCM, and had many opinions on clinical practice and lots of scientific suggestions on TCM development. Shou Shi Yi Bao reflected the main characteristics of TCM journals in 1930s. The journal was one of the important documents to study the TCM history during the period of the Republic of China in Jiangsu Province, and it also set a stage for the struggle between TCM and Western medicine at that time. The documentary information of the journal has literature and history values in reflecting the historical process of TCM self-improvement. The success of the journal was due to not only the broken-up sectarian bias and cooperation of the TCM practitioners but also the preponderant geographic and cultural circumstances of Suzhou as well as Chen Huan-yun's profound knowledge in traditional Chinese culture and medicine.

  3. SHiP: a new facility to search for heavy neutrinos and study $\

    De Serio, Marilisa

    2016-01-01

    SHiP (Search for Hidden Particles) is a newly designed fixed target facility, proposed at the CERN SPS accelerator, with the aim of complementing searches for New Physics at LHC by searching for light long-lived exotic particles with masses below a few GeV/c2. The sensitivity to Heavy Neutrinos will allow for the first time probing a region of the parameter space where Baryogenesis and active neutrino masses and oscillation could also be explained. A dedicated detector, based on OPERA-like bricks, will provide the first observation of the tau anti-neutrino. Moreover, $\

  4. [Shi Weishan, the pioneer of the western medicine in Hubei in the Late Qing Dynasty].

    Liu, F W

    2017-07-28

    The Englishman Shi Weishan (Frederick Porter Smith) is the first Christianity medical missionary sent to Central China, who is also the founder of the first mission hospital named 'Hospital of Universal Love' in Hubei. Arrived at Hankou in May 1864, he started medical work in July, and left Hankou in December 1870 because of health problem. In addition to medical mission, he tried to communicate with Chinese doctors in Hankou, then enlightened local people with health knowledge by written several books and articles, which brought some success. He also devoted to the translation of Chinese proper names and also wrote related book.

  5. Etude linguistique chez les Baráshi/Banyaambo du Rwanda

    User

    ont quitté le Nkóle et ont gagné le Mutára, puis le Mubarí qui est une large bande frontalière située au nord du lac Ihema jouxtant la région tanzanienne de Karágwe. Puis le mouvement s'est poursuivi vers le sud, ce qui explique donc la présence aujourd'hui d'une communauté Baráshi/Banyaambo au. Gisaká autour des ...

  6. Influence of nonmagnetic disorder on specific heat and electrical resistivity in Kondo lattice system CePd{sub 1−x}Ge{sub x}In

    Gnida, D., E-mail: d.gnida@int.pan.wroc.pl [Institute of Low Temperature and Structure Research, Polish Academy of Sciences, 50-950 Wrocław (Poland); Dominyuk, N.; Zaremba, V. [Inorganic Chemistry Department, Ivan Franko Lviv National University, Kyryla and Mephodiya Str. 6, 79005 Lviv (Ukraine); Kaczorowski, D. [Institute of Low Temperature and Structure Research, Polish Academy of Sciences, 50-950 Wrocław (Poland)

    2015-02-15

    Highlights: • Interplay of Kondo and RKKY interactions in the presence of nonmagnetic disorder. • Suppression of the coherent Kondo state by nonmagnetic impurities. • Observation of quantum interference phenomena in Ce-based Kondo system. • Coexistence of incoherent Kondo effect and Altshuler-Aronov quantum correction. - Abstract: The alloy system CePd{sub 1−x}Ge{sub x}In with 0.1⩽x⩽0.4 was investigated by means of heat capacity and electrical resistivity measurements. Its low-temperature behavior has been found to be governed by the interplay of Kondo effect and Ruderman-Kittel-Kasuya-Yosida (RKKY) interactions in the presence of atomic disorder in nonmagnetic atoms sublattice. The coherent Kondo state, observed for CePdIn, gradually vanishes with increasing the Ge-content. The incoherent Kondo state, which characterizes Ge-rich alloys, appears very sensitive to applied magnetic field. The observed systematic changes in the temperature- and field-dependent electrical transport in CePd{sub 1−x}Ge{sub x}In manifest the important role of quantum correction due to electron-electron interactions in weakly localized regime.

  7. Synthesis and Physical Properties of Nanocomposites (SnO2x(In2O31-x (x = 0 – 1 for Gas Sensors and Optoelectronics

    Stanislav REMBEZA

    2010-11-01

    Full Text Available Experimental results on synthesis of thin film (< 1 μm nanocomposites (SnO2x(In2O31-x in the whole range of x = (0 – 1 mass. % are presented. Film nanocomposites were prepared by high-frequency magnetron sputtering of metal oxide targets in the controlled ambient Ar+O2. Films were deposited on the hot substrate (400 0C and investigated by X-ray phase analysis, atomic-force microscopy, optical and electrical methods. Influence of synthesis regimes and film composition on the grain size of crystals, the band-gap width, the transparency in the visible range of light, concentration and mobility of free charge carriers were determined. It was shown that films with composition (SnO2x(In2O31-x x = 0.9 are perspective for using as gas sensors, films of the same composition but with x = 0.1 can be applied as transparent current conducting electrodes for solar cells.

  8. Do temperamentally shy children process emotion differently than nonshy children? Behavioral, psychophysiological, and gender differences in reticent preschoolers.

    Theall-Honey, Laura A; Schmidt, Louis A

    2006-04-01

    We examined regional brain electrical activity (EEG), heart rate, and subjective responses at rest and during the presentation of videoclips designed to elicit a range of emotions (e.g., sadness, anger, happiness, fear) among a sample of healthy 4-year-old children selected for temperamental shyness. We found that shy children exhibited significantly greater relative right central EEG activation at rest and during the presentation of the fear-eliciting videoclip than nonshy children. Shy females displayed greater relative right mid-frontal EEG activation during the sad, happy, and fear videoclips than shy males who displayed greater relative left mid-frontal EEG activation. These results (1) suggest that recent frontal EEG activation/emotion models might be gender-specific and (2) appear to provide the first empirical evidence for recent theoretical notions linking the origins and maintenance of temperamental shyness in children to difficulty in regulating fear responses. Copyright (c) 2006 Wiley Periodicals, Inc.

  9. SHiP: a new multipurpose beam-dump experiment at the SPS.

    AUTHOR|(SzGeCERN)387671

    2016-01-01

    SHiP is an experiment to look for very weakly interacting particles at a new to be constructed beam-dum p facility at the CERN SPS. The SHiP Technical Proposal has been submitted to the CERN SPS Committee in April 2015. The 400 GeV/c proton beam extracted from the SPS will be dumped on a heavy target with the aim of integ rating $2\\times 10^{20}$ proton on target in five years. A detector located downstream of the target, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below a few GeV/c$^2$. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutral Leptons (HNL). The sensitivity to HNL will allow for the first time to probe, in the mass range between the kaon and the charm meson mass, a coupling range for which Baryogenesis and active neutrino masses could also be explained...

  10. Personality Development Within a Generational Context: Life Course Outcomes of Shy Children.

    Schmidt, Louis A; Tang, Alva; Day, Kimberly L; Lahat, Ayelet; Boyle, Michael H; Saigal, Saroj; Van Lieshout, Ryan J

    2017-08-01

    Studies have shown that shy children born in the 1920s and 1950s had delayed marriage and parenthood, less stable careers, and lower occupational attainment as adults than other children. Do these effects still hold true? We examined demographic and social outcomes of children born between 1977 and 1982 in a prospective longitudinal study. We assessed shyness in childhood (age 8), adolescence (age 12-16), young adulthood (age 22-26), and adulthood (age 30-35), and derived three shyness trajectories (i.e., decreasing, increasing, and low-stable). Social and demographic outcomes for shy children who outgrew their shyness (i.e., decreasing trajectory) were indistinguishable from those who were consistently low on shyness measures. However, a shyness trajectory beginning in adolescence and increasing to adulthood was associated with poorer outcomes, similar to previous studies. These findings highlight the importance of multiple assessments in long-term longitudinal studies and the need to consider personality development within a generational context.

  11. [Brief discussion on acupuncture technique "controlling Qihai to regulate blood pressure" proposed by academician SHI Xuemin].

    Yu, Liang; Xu, Xifa; Liu, Jian; Fan, Xiaonong

    2017-08-12

    According to Qihai theory, academician SHI Xuemin established the acupuncture technique "controlling Qihai to regulate blood pressure" which focused on Renying (ST 9), and achieved favorable effects in clinical application. In this paper, based on the Qihai theory, from aspects of Yuan qi , Zong qi , Ying qi and Wei qi and relations among qi , blood and veins in TCM, and cardiac output, sympathetic nerve activity and blood vessels in modern medicine, the understanding on hypertension was explained. As a result, both TCM and modern medicine had consistency in the understanding of hypertension, reflecting the scientificity and practicability of this acupuncture technique. Besides, according to Qihai theory and "wind leading to vertigo" theory, academician SHI Xuemin brought forward the key pathogenesis of hypertension was "dysfunction of Qihai ", and the acupoint selected Renying (ST 9), Quchi (LI 11), Hegu (LI 4), Zusanli (ST 36) and Taichong (LR 3). At the same time, the operation specification of each acupoint was mainly discussed, and the references of acupoint selection was explained based on TCM theory and modern clinical research.

  12. 辛弃疾的“事功派”思想及在稼轩词中的体现%Xin Qi-ji’s Utilitarianism Ethics Thought And influence on Jiaxuan Ci-poems

    宋学达

    2013-01-01

    事功派哲学家陈亮与辛弃疾私交甚厚,其哲学思想必然会对辛弃疾产生影响,而历来对辛弃疾的研究中,似乎很少关注其思想哲学的相关问题。本文旨在论证辛弃疾的哲学思想乃是以陈亮为代表的事功派哲学一脉,并探讨事功派哲学对稼轩词艺术特质及词史地位所产生的深刻影响。%Chen Liang, the philosopher of Utilitarianism Ethics Thought, has a good relationship with Xin Qi-ji. So his philosophical thoughts certainly would have an influence on Xin Qiji. But in the past, on the study of Xin Qi-ji, we can seldom found researches concerning his thought of philosophy. This dissertation is aimed to argue that Xin's philosophical thoughts is a brunch of Chen’s Utilitarianism Ethics Thought and the latter had great influence on Jiaxuan Ci-Poems, including its artistic particularities and the status in Ci-poetry history.

  13. A facility to search for hidden particles at the CERN SPS: the SHiP physics case.

    Alekhin, Sergey; Altmannshofer, Wolfgang; Asaka, Takehiko; Batell, Brian; Bezrukov, Fedor; Bondarenko, Kyrylo; Boyarsky, Alexey; Choi, Ki-Young; Corral, Cristóbal; Craig, Nathaniel; Curtin, David; Davidson, Sacha; de Gouvêa, André; Dell'Oro, Stefano; deNiverville, Patrick; Bhupal Dev, P S; Dreiner, Herbi; Drewes, Marco; Eijima, Shintaro; Essig, Rouven; Fradette, Anthony; Garbrecht, Björn; Gavela, Belen; Giudice, Gian F; Goodsell, Mark D; Gorbunov, Dmitry; Gori, Stefania; Grojean, Christophe; Guffanti, Alberto; Hambye, Thomas; Hansen, Steen H; Helo, Juan Carlos; Hernandez, Pilar; Ibarra, Alejandro; Ivashko, Artem; Izaguirre, Eder; Jaeckel, Joerg; Jeong, Yu Seon; Kahlhoefer, Felix; Kahn, Yonatan; Katz, Andrey; Kim, Choong Sun; Kovalenko, Sergey; Krnjaic, Gordan; Lyubovitskij, Valery E; Marcocci, Simone; Mccullough, Matthew; McKeen, David; Mitselmakher, Guenakh; Moch, Sven-Olaf; Mohapatra, Rabindra N; Morrissey, David E; Ovchynnikov, Maksym; Paschos, Emmanuel; Pilaftsis, Apostolos; Pospelov, Maxim; Reno, Mary Hall; Ringwald, Andreas; Ritz, Adam; Roszkowski, Leszek; Rubakov, Valery; Ruchayskiy, Oleg; Schienbein, Ingo; Schmeier, Daniel; Schmidt-Hoberg, Kai; Schwaller, Pedro; Senjanovic, Goran; Seto, Osamu; Shaposhnikov, Mikhail; Shchutska, Lesya; Shelton, Jessie; Shrock, Robert; Shuve, Brian; Spannowsky, Michael; Spray, Andy; Staub, Florian; Stolarski, Daniel; Strassler, Matt; Tello, Vladimir; Tramontano, Francesco; Tripathi, Anurag; Tulin, Sean; Vissani, Francesco; Winkler, Martin W; Zurek, Kathryn M

    2016-12-01

    This paper describes the physics case for a new fixed target facility at CERN SPS. The SHiP (search for hidden particles) experiment is intended to hunt for new physics in the largely unexplored domain of very weakly interacting particles with masses below the Fermi scale, inaccessible to the LHC experiments, and to study tau neutrino physics. The same proton beam setup can be used later to look for decays of tau-leptons with lepton flavour number non-conservation, [Formula: see text] and to search for weakly-interacting sub-GeV dark matter candidates. We discuss the evidence for physics beyond the standard model and describe interactions between new particles and four different portals-scalars, vectors, fermions or axion-like particles. We discuss motivations for different models, manifesting themselves via these interactions, and how they can be probed with the SHiP experiment and present several case studies. The prospects to search for relatively light SUSY and composite particles at SHiP are also discussed. We demonstrate that the SHiP experiment has a unique potential to discover new physics and can directly probe a number of solutions of beyond the standard model puzzles, such as neutrino masses, baryon asymmetry of the Universe, dark matter, and inflation.

  14. Understanding Relations among Children's Shy and Antisocial/Aggressive Behaviors and Mothers' Parenting: The Role of Maternal Beliefs

    Evans, Cortney A.; Nelson, Larry J.; Porter, Christin L.; Nelson, David A.; Hart, Craig H.

    2012-01-01

    This study assesses the relationships between children's shy and antisocial/aggressive behaviors and maternal beliefs, and concomitant parenting behaviors. Structural equation models examined 199 mothers' perceptions of aggression and shyness in their preschool-age children (average age = 59.63 months); maternal beliefs (i.e., locus of control,…

  15. First reliability test of a surface micromachined microengine using SHiMMeR

    Tanner, D.M.; Smith, N.F.; Bowman, D.J. [and others

    1997-08-01

    The first-ever reliability stress test on surface micromachined microengines developed at Sandia National Laboratories (SNL) has been completed. We stressed 41 microengines at 36,000 RPM and inspected the functionality at 60 RPM. We have observed an infant mortality region, a region of low failure rate (useful life), and no signs of wearout in the data. The reliability data are presented and interpreted using standard reliability methods. Failure analysis results on the stressed microengines are presented. In our effort to study the reliability of MEMS, we need to observe the failures of large numbers of parts to determine the failure modes. To facilitate testing of large numbers of micromachines. The Sandia High Volume Measurement of Micromachine Reliability (SHiMMeR) system has computer controlled positioning and the capability to inspect moving parts. The development of this parallel testing system is discussed in detail.

  16. Effects of Climate Change and Fisheries Bycatch on Shy Albatross (Thalassarche cauta) in Southern Australia.

    Thomson, Robin B; Alderman, Rachael L; Tuck, Geoffrey N; Hobday, Alistair J

    2015-01-01

    The impacts of climate change on marine species are often compounded by other stressors that make direct attribution and prediction difficult. Shy albatrosses (Thalassarche cauta) breeding on Albatross Island, Tasmania, show an unusually restricted foraging range, allowing easier discrimination between the influence of non-climate stressors (fisheries bycatch) and environmental variation. Local environmental conditions (rainfall, air temperature, and sea-surface height, an indicator of upwelling) during the vulnerable chick-rearing stage, have been correlated with breeding success of shy albatrosses. We use an age-, stage- and sex-structured population model to explore potential relationships between local environmental factors and albatross breeding success while accounting for fisheries bycatch by trawl and longline fisheries. The model uses time-series of observed breeding population counts, breeding success, adult and juvenile survival rates and a bycatch mortality observation for trawl fishing to estimate fisheries catchability, environmental influence, natural mortality rate, density dependence, and productivity. Observed at-sea distributions for adult and juvenile birds were coupled with reported fishing effort to estimate vulnerability to incidental bycatch. The inclusion of rainfall, temperature and sea-surface height as explanatory variables for annual chick mortality rate was statistically significant. Global climate models predict little change in future local average rainfall, however, increases are forecast in both temperatures and upwelling, which are predicted to have detrimental and beneficial effects, respectively, on breeding success. The model shows that mitigation of at least 50% of present bycatch is required to offset losses due to future temperature changes, even if upwelling increases substantially. Our results highlight the benefits of using an integrated modeling approach, which uses available demographic as well as environmental data

  17. Effects of Climate Change and Fisheries Bycatch on Shy Albatross (Thalassarche cauta in Southern Australia.

    Robin B Thomson

    Full Text Available The impacts of climate change on marine species are often compounded by other stressors that make direct attribution and prediction difficult. Shy albatrosses (Thalassarche cauta breeding on Albatross Island, Tasmania, show an unusually restricted foraging range, allowing easier discrimination between the influence of non-climate stressors (fisheries bycatch and environmental variation. Local environmental conditions (rainfall, air temperature, and sea-surface height, an indicator of upwelling during the vulnerable chick-rearing stage, have been correlated with breeding success of shy albatrosses. We use an age-, stage- and sex-structured population model to explore potential relationships between local environmental factors and albatross breeding success while accounting for fisheries bycatch by trawl and longline fisheries. The model uses time-series of observed breeding population counts, breeding success, adult and juvenile survival rates and a bycatch mortality observation for trawl fishing to estimate fisheries catchability, environmental influence, natural mortality rate, density dependence, and productivity. Observed at-sea distributions for adult and juvenile birds were coupled with reported fishing effort to estimate vulnerability to incidental bycatch. The inclusion of rainfall, temperature and sea-surface height as explanatory variables for annual chick mortality rate was statistically significant. Global climate models predict little change in future local average rainfall, however, increases are forecast in both temperatures and upwelling, which are predicted to have detrimental and beneficial effects, respectively, on breeding success. The model shows that mitigation of at least 50% of present bycatch is required to offset losses due to future temperature changes, even if upwelling increases substantially. Our results highlight the benefits of using an integrated modeling approach, which uses available demographic as well as

  18. Effect of swift heavy ion (SHI) irradiation on transparent conducting oxide electrodes for dye-sensitized solar cell applications

    Singh, Hemant Kr.; Avasthi, D.K.; Aggarwal, Shruti

    2015-01-01

    Highlights: •The objective is to study the effect of swift heavy ion (SHI) irradiation on photoanode of DSSC for better efficiency. •This work presents the effect of SHI irradiation on various Transparent conducting oxides (TCOs). •Effects are studied in terms of conductivity and transmittance of TCOs. •ITO-PET gives best results in comparison to ITO and FTO for DSSC application under SHI irradiation. -- Abstract: Transparent conducting oxides (TCOs) are used as electrodes in dye-sensitized solar cells (DSSCs) because of their properties such as high transmittance and low resistivity. In the present work, the effects of swift heavy ion (SHI) irradiation on various types of TCOs are presented. The objective of this study is to investigate the effect of SHI on TCOs. For the present study, three different types of TCOs are considered, namely, (a) FTO (fluorine-doped tin oxide, SnO 2 :F) on a Nippon glass substrate, (b) ITO (indium tin oxide, In 2 O 3 :Sn) coated on polyethylene terephthalate (PET) on a Corning glass substrate, and (c) ITO on a Corning glass substrate. These films are irradiated with 120 MeV Ag +9 ions at fluences ranging from 3.0 × 10 11 ions/cm 2 to 3.0 × 10 13 ions/cm 2 . The structural, morphological, optical and electrical properties are studied via X-ray diffraction (XRD), atomic force microscopy (AFM), UV–Vis absorption spectroscopy and four-probe resistivity measurements, respectively. The ITO-PET electrode is found to exhibit superior conductivity and transmittance properties in comparison with the others after irradiation and, therefore, to be the most suitable for solar cell applications

  19. Effect of swift heavy ion (SHI) irradiation on transparent conducting oxide electrodes for dye-sensitized solar cell applications

    Singh, Hemant Kr. [University School of Basic and Applied Sciences, Guru Gobind Singh Indraprastha University, New Delhi (India); Avasthi, D.K. [Inter University Accelerator Center, Post Box 10502, New Delhi (India); Aggarwal, Shruti, E-mail: shruti.al@gmail.com [University School of Basic and Applied Sciences, Guru Gobind Singh Indraprastha University, New Delhi (India)

    2015-06-15

    Highlights: •The objective is to study the effect of swift heavy ion (SHI) irradiation on photoanode of DSSC for better efficiency. •This work presents the effect of SHI irradiation on various Transparent conducting oxides (TCOs). •Effects are studied in terms of conductivity and transmittance of TCOs. •ITO-PET gives best results in comparison to ITO and FTO for DSSC application under SHI irradiation. -- Abstract: Transparent conducting oxides (TCOs) are used as electrodes in dye-sensitized solar cells (DSSCs) because of their properties such as high transmittance and low resistivity. In the present work, the effects of swift heavy ion (SHI) irradiation on various types of TCOs are presented. The objective of this study is to investigate the effect of SHI on TCOs. For the present study, three different types of TCOs are considered, namely, (a) FTO (fluorine-doped tin oxide, SnO{sub 2}:F) on a Nippon glass substrate, (b) ITO (indium tin oxide, In{sub 2}O{sub 3}:Sn) coated on polyethylene terephthalate (PET) on a Corning glass substrate, and (c) ITO on a Corning glass substrate. These films are irradiated with 120 MeV Ag{sup +9} ions at fluences ranging from 3.0 × 10{sup 11} ions/cm{sup 2} to 3.0 × 10{sup 13} ions/cm{sup 2}. The structural, morphological, optical and electrical properties are studied via X-ray diffraction (XRD), atomic force microscopy (AFM), UV–Vis absorption spectroscopy and four-probe resistivity measurements, respectively. The ITO-PET electrode is found to exhibit superior conductivity and transmittance properties in comparison with the others after irradiation and, therefore, to be the most suitable for solar cell applications.

  20. SHI/STY Genes Affect Pre- and Post-meiotic Anther Processes in Auxin Sensing Domains in Arabidopsis

    Leandro H. Estornell

    2018-02-01

    Full Text Available In flowering plants, mature sperm cells are enclosed in pollen grains formed in structures called anthers. Several cell layers surrounding the central sporogenous cells of the anther are essential for directing the developmental processes that lead to meiosis, pollen formation, and the subsequent pollen release. The specification and function of these tissues are regulated by a large number of genetic factors. Additionally, the plant hormone auxin has previously been shown to play important roles in the later phases of anther development. Using the R2D2 auxin sensor system we here show that auxin is sensed also in the early phases of anther cell layer development, suggesting that spatiotemporal regulation of auxin levels is important for early anther morphogenesis. Members of the SHI/STY transcription factor family acting as direct regulators of YUC auxin biosynthesis genes have previously been demonstrated to affect early anther patterning. Using reporter constructs we show that SHI/STY genes are dynamically active throughout anther development and their expression overlaps with those of three additional downstream targets, PAO5, EOD3 and PGL1. Characterization of anthers carrying mutations in five SHI/STY genes clearly suggests that SHI/STY transcription factors affect anther organ identity. In addition, their activity is important to repress periclinal cell divisions as well as premature entrance into programmed cell death and cell wall lignification, which directly influences the timing of anther dehiscence and the pollen viability. The SHI/STY proteins also prevent premature pollen germination suggesting that they may play a role in the induction or maintenance of pollen dormancy.

  1. Analysis of the Constituents in “Zhu She Yong Xue Shuan Tong” by Ultra High Performance Liquid Chromatography with Quadrupole Time-of-Flight Mass Spectrometry Combined with Preparative High Performance Liquid Chromatography

    Lin-Lin Wang

    2015-11-01

    Full Text Available “Zhu She Yong Xue Shuan Tong” lyophilized powder (ZSYXST, consists of a series of saponins extracted from Panax notoginseng, which has been widely used in China for the treatment of strokes. In this study, an ultra-high performance liquid chromatography with quadrupole time-of-flight mass spectrometry (UHPLC-Q-TOF/MS combined with preparative high performance liquid chromatography (PHPLC method was developed to rapidly identify both major and minor saponins in ZSYXST. Some high content components were removed through PHPLC in order to increase the sensitivity of the trace saponins. Then, specific characteristic fragment ions in both positive and negative mode were utilized to determine the types of aglycone, saccharide, as well as the saccharide chain linkages. As a result, 94 saponins, including 20 pairs of isomers and ten new compounds, which could represent higher than 98% components in ZSYXST, were identified or tentatively identified in commercial ZSYXST samples.

  2. A facility to Search for Hidden Particles at the CERN SPS: the SHiP physics case

    Alekhin, Sergey; Asaka, Takehiko; Batell, Brian; Bezrukov, Fedor; Bondarenko, Kyrylo; Boyarsky, Alexey; Choi, Ki-Young; Corral, Cristobal; Craig, Nathaniel; Curtin, David; Davidson, Sacha; de Gouvea, Andre; Dell'Oro, Stefano; deNiverville, Patrick; Bhupal Dev, P.S.; Dreiner, Herbi; Drewes, Marco; Eijima, Shintaro; Essig, Rouven; Fradette, Anthony; Garbrecht, Bjorn; Gavela, Belen; Giudice, Gian F.; Goodsell, Mark D.; Gorbunov, Dmitry; Gori, Stefania; Grojean, Christophe; Guffanti, Alberto; Hambye, Thomas; Hansen, Steen H.; Helo, Juan Carlos; Hernandez, Pilar; Ibarra, Alejandro; Ivashko, Artem; Izaguirre, Eder; Jaeckel, Joerg; Jeong, Yu Seon; Kahlhoefer, Felix; Kahn, Yonatan; Katz, Andrey; Kim, Choong Sun; Kovalenko, Sergey; Krnjaic, Gordan; Lyubovitskij, Valery E.; Marcocci, Simone; Mccullough, Matthew; McKeen, David; Mitselmakher, Guenakh; Moch, Sven-Olaf; Mohapatra, Rabindra N.; Morrissey, David E.; Ovchynnikov, Maksym; Paschos, Emmanuel; Pilaftsis, Apostolos; Pospelov, Maxim; Reno, Mary Hall; Ringwald, Andreas; Ritz, Adam; Roszkowski, Leszek; Rubakov, Valery; Ruchayskiy, Oleg; Schienbein, Ingo; Schmeier, Daniel; Schmidt-Hoberg, Kai; Schwaller, Pedro; Senjanovic, Goran; Seto, Osamu; Shaposhnikov, Mikhail; Shchutska, Lesya; Shelton, Jessie; Shrock, Robert; Shuve, Brian; Spannowsky, Michael; Spray, Andy; Staub, Florian; Stolarski, Daniel; Strassler, Matt; Tello, Vladimir; Tramontano, Francesco; Tripathi, Anurag; Tulin, Sean; Vissani, Francesco; Winkler, Martin W.; Zurek, Kathryn M.; CERN. Geneva. SPS and PS Experiments Committee; SPSC

    2016-10-24

    This paper describes the physics case for a new fixed target facility at CERN SPS. The SHiP (Search for Hidden Particles) experiment is intended to hunt for new physics in the largely unexplored domain of very weakly interacting particles with masses below the Fermi scale, inaccessible to the LHC experiments, and to study tau neutrino physics. The same proton beam setup can be used later to look for decays of tau-leptons with lepton flavour number non-conservation, $\\tau\\to 3\\mu$ and to search for weakly-interacting sub-GeV dark matter candidates. We discuss the evidence for physics beyond the Standard Model and describe interactions between new particles and four different portals - scalars, vectors, fermions or axion-like particles. We discuss motivations for different models, manifesting themselves via these interactions, and how they can be probed with the SHiP experiment and present several case studies. The prospects to search for relatively light SUSY and composite particles at SHiP are also discussed....

  3. THE SUNNI-SHI'ITE RIVALRY AND ITS INFLUENCE ON THE GEOPOLITICAL SITUATION OF THE MIDDLE EAST

    Alexander A. Kuznetsov

    2014-01-01

    Full Text Available The article "The Sunni-Shi'ite rivalry and its influence on the geopolitical situation of the Middle East" is dedicated to the sectarian conflicts in the Middle East region in last 30 years. Author considers the Islamic revolution of 1979 in Iran as the point of departure of this conflict. Author of the article makes a difference between the Shi'ite Islamic revolutionary doctrine of Khomeini and the Salafi Islamic fundamentalism of Saudi Arabia. Author realizes the analysis of the war between Iran and Iraq in 1980-1988. This analysis is emphasized on the regional geopolitical situation and positions of the outside actors (Saudi Arabia, USA, France, Germany. Then it is covered the American invasion of Iraq in 2003 and its geopolitical consequences. To the author's mind this aggression and further empowerment of the Shi'ite majority reduced to the civil war in Iraq and exacerbation of the sectarian conflict. Author of the article considers these events as a part of the geopolitical rivalry between Iran and Saudi Arabia to unfold in the areas of Iraq, Syria and Lebanon.

  4. The Sunni-Shi'ite Rivalry And Its Influence On The Geopolitical Situation Of The Middle East

    Alexander A. Kuznetsov

    2014-01-01

    Full Text Available The article "The Sunni-Shi'ite rivalry and its influence on the geopolitical situation of the Middle East" is dedicated to the sectarian conflicts in the Middle East region in last 30 years. Author considers the Islamic revolution of 1979 in Iran as the point of departure of this conflict. Author of the article makes a difference between the Shi'ite Islamic revolutionary doctrine of Khomeini and the Salafi Islamic fundamentalism of Saudi Arabia. Author realizes the analysis of the war between Iran and Iraq in 1980-1988. This analysis is emphasized on the regional geopolitical situation and positions of the outside actors (Saudi Arabia, USA, France, Germany. Then it is covered the American invasion of Iraq in 2003 and its geopolitical consequences. To the author's mind this aggression and further empowerment of the Shi'ite majority reduced to the civil war in Iraq and exacerbation of the sectarian conflict. Author of the article considers these events as a part of the geopolitical rivalry between Iran and Saudi Arabia to unfold in the areas of Iraq, Syria and Lebanon.

  5. SHI induced modification in structural, optical, dielectric and thermal properties of poly ethylene oxide films

    Patel, Gnansagar B.; Bhavsar, Shilpa [Department of Physics, The M.S. University of Baroda, Vadodara 390002 (India); Singh, N.L., E-mail: nl.singh-phy@msubaroda.ac.in [Department of Physics, The M.S. University of Baroda, Vadodara 390002 (India); Singh, F.; Kulriya, P.K. [Inter University Accelerator Centre, Aruna Asaf Ali Marg, New Delhi 110067 (India)

    2016-07-15

    Poly ethylene oxide (PEO) films were synthesized by solution cast method. These self-standing films were exposed with 60 MeV C{sup +5} ion and 100 MeV Ni{sup +7} ion at different fluences. SHI induced effect was investigated by employing various techniques. The crystalline size decreased upon irradiation as observed from XRD analysis. FTIR analysis reveals the decrement in the peak intensity upon irradiation. Tauc’s method was used to determine the optical band gap (E{sub g}), which shows decreasing trends with increase of fluence. The dielectric properties were investigated in the frequency range 10 Hz to 10 MHz for unirradiated and irradiated films. The dielectric constant remains same for the broad-spectrum of frequency and increases at lower frequency. The dielectric loss also moderately influence as a function of frequency due to irradiation. DSC analysis validated the results of XRD. Scanning electron microscopy (SEM) reveals that there is significant change in the surface morphology due to irradiation.

  6. Shi Cihang 航慈釋. The First Case of Mummified Buddhist in Taiwan

    Stefania Travagnin

    2006-01-01

    Full Text Available Shi Cihang 航慈釋 (1895-1954, is one of the eminent figures in the so-called Modern Buddhism in Taiwan. Engaged in improving education and training of Buddhist monks and nuns, and promoter of the so-called renjian fojiao 教佛間人 (Buddhism for the Human Realm, which refuses any sort of superstitious understanding and practice of Buddhism and calls for the return to the original and pure essence of the Dharma, Cihang is also the first Buddhist monk in Taiwan who attempted to, and eventually succeeded in, preserving his body afterdeath. Nowadays, the gilded relic-body of Cihang is enshrined and venerated in Xizhi, Taipei county, as well as being included in the list of the roushen pusa 薩菩身肉 (flesh-body Bodhisattvas who appeared in the history of Chinese Buddhism. This paper analyses Cihang’s relic-body as case-study of Chinese mummified Buddhist in the scene of contemporary Taiwan and modern Taiwanese Buddhim, discussing the Buddhist significance, sociological implications and eventual impact of mummification within the reality of the new renjian fojiao.

  7. The Variation of Riverbed Material due to Tropical Storms in Shi-Wen River, Taiwan

    Chin-Ping Lin

    2014-01-01

    Full Text Available Taiwan, because of its location, is a flood prone region and is characterised by typhoons which brings about two-thirds to three quarters of the annual rainfall amount. Consequently, enormous flows result in rivers and entrain some fractions of the grains that constitute the riverbed. Hence, the purpose of the study is to quantify the impacts of these enormous flows on the distribution of grain size in riverbeds. The characteristics of riverbed material prior to and after the typhoon season are compared in Shi-Wen River located at southern Taiwan. These include grain size variation, bimodality, and roughness coefficient. A decrease (65% and increase (50% in geometric mean size of grains were observed for subsurface and surface bed material, respectively. Geometric standard deviation decreased in all sites after typhoon. Subsurface material was bimodal prior to typhoons and polymodal after. For surface material, modal class is in the gravel class, while after typhoons it shifts towards cobble class. The reduction in geometric mean resulted to a decrease in roughness coefficient by up to 30%. Finally, the relationship of Shields and Froude numbers are studied and a change in the bed form to antidunes and transition form is observed, respectively.

  8. The variation of riverbed material due to tropical storms in Shi-Wen River, Taiwan.

    Lin, Chin-Ping; Wang, Yu-Min; Tfwala, Samkele S; Chen, Ching-Nuo

    2014-01-01

    Taiwan, because of its location, is a flood prone region and is characterised by typhoons which brings about two-thirds to three quarters of the annual rainfall amount. Consequently, enormous flows result in rivers and entrain some fractions of the grains that constitute the riverbed. Hence, the purpose of the study is to quantify the impacts of these enormous flows on the distribution of grain size in riverbeds. The characteristics of riverbed material prior to and after the typhoon season are compared in Shi-Wen River located at southern Taiwan. These include grain size variation, bimodality, and roughness coefficient. A decrease (65%) and increase (50%) in geometric mean size of grains were observed for subsurface and surface bed material, respectively. Geometric standard deviation decreased in all sites after typhoon. Subsurface material was bimodal prior to typhoons and polymodal after. For surface material, modal class is in the gravel class, while after typhoons it shifts towards cobble class. The reduction in geometric mean resulted to a decrease in roughness coefficient by up to 30%. Finally, the relationship of Shields and Froude numbers are studied and a change in the bed form to antidunes and transition form is observed, respectively.

  9. Neurologic deterioration with progressive CT changes in a child with Kearns-Shy syndrome

    Yoda, Satoru; Kitahara, Fuminori; Akabane, Taro; Terauchi, Akiko.

    1984-01-01

    A case of the rare juvenile form of Kearns-Shy syndrome with progressive external ophthalmoplegia and lid ptosis, carditis, skeletal muscle weakness, seizures, mental subnormality, short stature, EEG abnormality and deafness is presented. Electromyography revealed a myopathic pattern. Histochemical studies on quadriceps biopsy specimens showed atrophy of type II fibers and ''ragged-red fibers.'' On electron microscopy these muscle cells were seen to contain an increased amount of glycogen particles and abnormal mitochondria were increased in number and size. It is of interest that abrupt deterioration of neurological findings such as seizures, mental subnormality, speech disturbance and deafness was present in our case. Computed tomographic scanning showed progressive changes of cerebral atrophy, low density of cerebral white matter and basal ganglia calcification, which were well associated with the clinical deterioration. A review of the literature also indicated that some patients with this syndrome showed abrupt neurological deterioration in childhood. Involvement of the central nervous system in this syndrome has to be considered as the cause of sudden deterioration and death in childhood. (author)

  10. Prevalence of consanguineous marriages among shi'a populations of Lebanon.

    El-Kheshen, Ghadir; Saadat, Mostafa

    2013-09-01

    In genetics, a consanguineous marriage means union between couples who are related as second cousins or closer. The present cross-sectional study was carried out in order to illustrate the prevalence and types of consanguineous marriages in the Shi'a population living in widespread territories in Lebanon including the Bekaa Valley, the south of Lebanon and the southern suburb of Beirut. Data on types of marriages were collected using a simple questionnaire. The total number of couples in the study was 1203. Consanguineous marriage was classified by the degree of relationship between couples. The overall frequency of consanguinity was found to be 28.4%, with first cousin marriages (21.3%) being the most common type followed by first cousins once removed (5.5%), then double first cousins (0.8%). The frequencies of second cousin and beyond second cousin marriages were the same at 0.4% of all the marriages. The mean inbreeding coefficient (α) was estimated at about 0.0161 for the population. There were no significant differences between the three studied territories for frequencies of different types of marriages (p>0.1), nor were there significant differences between the rural and urban areas (p>0.1).

  11. CATS, continuous automated testing of seismological, hydroacoustic, and infrasound (SHI) processing software.

    Brouwer, Albert; Brown, David; Tomuta, Elena

    2017-04-01

    To detect nuclear explosions, waveform data from over 240 SHI stations world-wide flows into the International Data Centre (IDC) of the Comprehensive Nuclear-Test-Ban Treaty Organization (CTBTO), located in Vienna, Austria. A complex pipeline of software applications processes this data in numerous ways to form event hypotheses. The software codebase comprises over 2 million lines of code, reflects decades of development, and is subject to frequent enhancement and revision. Since processing must run continuously and reliably, software changes are subjected to thorough testing before being put into production. To overcome the limitations and cost of manual testing, the Continuous Automated Testing System (CATS) has been created. CATS provides an isolated replica of the IDC processing environment, and is able to build and test different versions of the pipeline software directly from code repositories that are placed under strict configuration control. Test jobs are scheduled automatically when code repository commits are made. Regressions are reported. We present the CATS design choices and test methods. Particular attention is paid to how the system accommodates the individual testing of strongly interacting software components that lack test instrumentation.

  12. arXiv Search for new physics with the SHiP experiment at CERN

    Lantwin, Oliver

    2017-12-01

    SHiP is a new general purpose fixed target experiment at the CERN SPS designed to complement LHC experiments in the search for new physics. In its initial phase, the $400$ GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating $2\\times10^{20}$ pot in 5 years. Shielded by an active muon shield, a dedicated detector, based on a long decay volume followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles with masses below $\\mathcal{O}(10)\\; \\mathrm{GeV}/{c^2}$. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutral Leptons. The sensitivity to Heavy Neutral Leptons will allow for the first time to probe, in the mass range above the kaon mass, a coupling range for which Baryogenesis and active neutrino masses could also be explained. A dedicated emulsion-based detector will allow detection of ...

  13. Migration, Displacement, and Movements in the Global Space: Ming-Yuen S. Ma’s Multi-Media Project Xin Lu: A Travelogue in Four Parts

    Xiaojing Zhou

    2012-06-01

    Full Text Available In her recent work, Sau-ling Cynthia Wong draws critical attention to the implications of the formation of an Asian American “diaporic community” in cyberspace, where race still operates as an organizing principle of power relations. Although cyberspace is not confined by national borders, Wong examines how subversion of and intervention in race- and sex-based hierarchies in cyberspace can articulate Asian American identities in relation to diasporas and the nation-state. This essay explores the politics of artistic invention in diasporas as embedded in the disruption, dislocation, and fragmentation in Ming-Yuen S. Ma’s multi-media project, Xin Lu: A Travelogue in Four Parts—a series of four experimental videos about Chinese diasporas. It argues that by moving outside the nation-space into the experiential and virtual “global space” of diasporas, Ma’s work addresses Wong’s concerns and enacts a viable “virtual mediation” that situates Chinese diasporas in the historical contexts of British colonialism and American racial exploitation and exclusion. This movement also entails confronting other forms of oppression, including sexism and heterosexism in both the East and West. While giving voice and visibility to the struggles of racial and sexual minorities across national borders, Ma demonstrates the possibilities of a historicized critical approach to diasporas, one which underlies Wong’s insistence in critiquing gendered and racialized power structures both within and outside the nation-state.

  14. A Standardized Chinese Herbal Decoction, Kai-Xin-San, Restores Decreased Levels of Neurotransmitters and Neurotrophic Factors in the Brain of Chronic Stress-Induced Depressive Rats

    Kevin Yue Zhu

    2012-01-01

    Full Text Available Kai-xin-san (KXS, a Chinese herbal decoction being prescribed by Sun Simiao in Beiji Qianjin Yaofang about 1400 years ago, contains Ginseng Radix et Rhizoma, Polygalae Radix, Acori tatarinowii Rhizoma, and Poria. KXS has been used to treat stress-related psychiatric disease with the symptoms of depression and forgetfulness in ancient China until today. However, the mechanism of its antidepression action is still unknown. Here, the chronic mild-stress-(CMS- induced depressive rats were applied in exploring the action mechanisms of KXS treatment. Daily intragastric administration of KXS for four weeks significantly alleviated the CMS-induced depressive symptoms displayed by enhanced sucrose consumption. In addition, the expressions of those molecular bio-markers relating to depression in rat brains were altered by the treatment of KXS. These KXS-regulated brain biomarkers included: (i the levels of dopamine, norepinephrine, and serotonin (ii the transcript levels of proteins relating to neurotransmitter metabolism; (iii the transcript levels of neurotrophic factors and their receptors. The results suggested that the anti-depressant-like action of KXS might be mediated by an increase of neurotransmitters and expression of neurotrophic factors and its corresponding receptors in the brain. Thus, KXS could serve as alternative medicine, or health food supplement, for patients suffering from depression.

  15. A Modified Chinese Herbal Decoction (Kai-Xin-San Promotes NGF-Induced Neuronal Differentiation in PC12 Cells via Up-Regulating Trk A Signaling

    Lu Yan

    2017-12-01

    Full Text Available Kai-Xin-San (KXS, a Chinese herbal decoction, has been applied to medical care of depression for thousands of years. It is composed of two functional paired-herbs: Ginseng Radix et Rhizoma (GR-Polygalae Radix (PR and Acori Tatarinowii Rhizoma (ATR-Poria (PO. The compatibility of the paired-herbs has been frequently changed to meet the criteria of syndrome differentiation and treatment variation. Currently, a modified KXS (namely KXS2012 was prepared by optimizing the combinations of GR-PR and ATR-PO: the new herbal formula was shown to be very effective in animal studies. However, the cellular mechanism of KXS2012 against depression has not been fully investigated. Here, the study on KXS2012-induced neuronal differentiation in cultured PC12 cells was analyzed. In PC12 cultures, single application of KXS2012 showed no effect on the neuronal differentiation, but which showed robust effects in potentiating nerve growth factor (NGF-induced neurite outgrowth and neurofilament expression. The potentiating effect of KXS2012 was mediated through NGF receptor, tropomyosin receptor kinase (Trk A: because the receptor expression and activity was markedly up-regulated in the presence of KXS2012, and the potentiating effect was blocked by k252a, an inhibitor of Trk A. Our current results in cell cultures fully support the therapeutic efficacy of KXS2012 against depression.

  16. Reclassification of Serpens flexibilis Hespell 1977 as Pseudomonas flexibilis comb. nov., with Pseudomonas tuomuerensis Xin et al. 2009 as a later heterotypic synonym.

    Shin, Su-Kyoung; Hwang, Chung Yeon; Cho, Yong-Joon; Yi, Hana

    2015-12-01

    Serpens flexibilis was proposed in 1977 and approved in 1980 without the 16S rRNA gene sequence information. The sequence of S. flexibilis became available in 2010, after the publication of Pseudomonas tuomuerensis in 2009. Our preliminary phylogenetic analyses indicated that these two strains share high sequence similarity and therefore showed strong potential to be united into a single species. To clarify the taxonomic status of the two species, a polyphasic taxonomy study was conducted including whole genome sequencing. The value of average nucleotide identity (ANI) and digital DNA-DNA hybridization (dDDH) between the genome sequences of S. flexibilis ATCC 29606(T) and P. tuomuerensis JCM 14085(T) were 98.1% and 89.0%, respectively. The phenotypic and chemotaxonomic properties including enzymatic activities, substrate utilization profiles, and fatty acids, supported that the two taxa have no pronounced difference and should thus constitute a single species. Therefore, we propose to transfer Serpens flexibilis Hespell 1977 to the genus Pseudomonas as Pseudomonas flexibilis comb. nov. (type strain=ATCC 29606(T)), with Pseudomonas tuomuerensis Xin et al. 2009 as a later heterotypic synonym of Pseudomonas flexibilis. Copyright © 2015 Elsevier GmbH. All rights reserved.

  17. A Standardized Chinese Herbal Decoction, Kai-Xin-San, Restores Decreased Levels of Neurotransmitters and Neurotrophic Factors in the Brain of Chronic Stress-Induced Depressive Rats

    Zhu, Kevin Yue; Mao, Qing-Qiu; Ip, Siu-Po; Choi, Roy Chi-Yan; Dong, Tina Ting-Xia; Lau, David Tai-Wai; Tsim, Karl Wah-Keung

    2012-01-01

    Kai-xin-san (KXS), a Chinese herbal decoction being prescribed by Sun Simiao in Beiji Qianjin Yaofang about 1400 years ago, contains Ginseng Radix et Rhizoma, Polygalae Radix, Acori tatarinowii Rhizoma, and Poria. KXS has been used to treat stress-related psychiatric disease with the symptoms of depression and forgetfulness in ancient China until today. However, the mechanism of its antidepression action is still unknown. Here, the chronic mild-stress-(CMS-) induced depressive rats were applied in exploring the action mechanisms of KXS treatment. Daily intragastric administration of KXS for four weeks significantly alleviated the CMS-induced depressive symptoms displayed by enhanced sucrose consumption. In addition, the expressions of those molecular bio-markers relating to depression in rat brains were altered by the treatment of KXS. These KXS-regulated brain biomarkers included: (i) the levels of dopamine, norepinephrine, and serotonin (ii) the transcript levels of proteins relating to neurotransmitter metabolism; (iii) the transcript levels of neurotrophic factors and their receptors. The results suggested that the anti-depressant-like action of KXS might be mediated by an increase of neurotransmitters and expression of neurotrophic factors and its corresponding receptors in the brain. Thus, KXS could serve as alternative medicine, or health food supplement, for patients suffering from depression. PMID:22973399

  18. Quality evaluation of Guan-Xin-Ning injection based on fingerprint analysis and simultaneous separation and determination of seven bioactive constituents by capillary electrophoresis.

    Xu, Liying; Chang, Ruimiao; Chen, Meng; Li, Lou; Huang, Yayun; Zhang, Hongfen; Chen, Anjia

    2017-12-01

    The purpose of this study was to develop a comprehensive, rapid and practical capillary electrophoresis (CE) method for quality control (QC) of Guan-Xin-Ning (GXN) injection based on fingerprint analysis and simultaneous separation and determination of seven constituents. In fingerprint analysis, a capillary zone electrophoresis (CZE) method with a running buffer of 30 mM borate solution (pH 9.3) was established. Meanwhile, ten batches of samples were used to establish the fingerprint electropherogram and 34 common peaks were obtained within 20 min. The RSD of relative migration times (RMT) and relative peak areas (RPA) were less than 5%. In order to further evaluate the quality of GXN injection, a micellar electrokinetic chromatography (MEKC) method was developed for simultaneous separation and determination of bioactive constituents. Seven components reached baseline separation with a running buffer containing 35 mM SDS and 45 mM borate solution (pH 9.3). A good linearity was obtained with correlation coefficients from 0.9906 to 0.9997. The LOD and LOQ ranged from 0.12 to 1.50 μg/mL and from 0.40 to 4.90 μg/mL, respectively. The recoveries ranged between 99.0 and 104.4%. Therefore, it was concluded that the proposed method can be used for full-scale quality analysis of GXN injection. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  19. Comparison of hyporheic flow and water quality in open and tree-covered banks downstream of Xin'an River dam, China

    Liu, D.

    2017-12-01

    Plants, especially trees, in the riparian zone may have a significant impact on the flow rate, temperature and chemical properties of groundwater. A field study was conducted in the downstream bank of the Xin'an River dam, Zhejiang, China. In the field, two areas of about 20 meters apart were chosen, of which one was a open place and the other was covered with many orange trees. Comparison of hyporheic flow and water quality in the open and tree-covered banks were made by monitoring the water level, water temperature, water chemistry (March, 2015) along the cross sections perpendicular to the river. The analyses indicated that water level around the trees was relatively low in the day and high in the evening, thus changed the direction and magnitude of the natural groundwater flow velocity, totally strengthened the hyporheic exchange between the groundwater and river. The trees also changed the temperature distribution of the natural river bank, and induced the wider infiltration range of the low-temperature water. The temperature around the trees was relatively low in the day, yet it was high in the evening. Dissolved oxygen (DO) and electricity conductivity (EC) around the trees were significantly increased, yet the pH was almost unaffected.

  20. Identification of the chemical constituents of Chinese medicine Yi-Xin-Shu capsule by molecular feature orientated precursor ion selection and tandem mass spectrometry structure elucidation.

    Wang, Hong-ping; Chen, Chang; Liu, Yan; Yang, Hong-Jun; Wu, Hong-Wei; Xiao, Hong-Bin

    2015-11-01

    The incomplete identification of the chemical components of traditional Chinese medicinal formula has been one of the bottlenecks in the modernization of traditional Chinese medicine. Tandem mass spectrometry has been widely used for the identification of chemical substances. Current automatic tandem mass spectrometry acquisition, where precursor ions were selected according to their signal intensity, encounters a drawback in chemical substances identification when samples contain many overlapping signals. Compounds in minor or trace amounts could not be identified because most tandem mass spectrometry information was lost. Herein, a molecular feature orientated precursor ion selection and tandem mass spectrometry structure elucidation method for complex Chinese medicine chemical constituent analysis was developed. The precursor ions were selected according to their two-dimensional characteristics of retention times and mass-to-charge ratio ranges from herbal compounds, so that all precursor ions from herbal compounds were included and more minor chemical constituents in Chinese medicine were identified. Compared to the conventional automatic tandem mass spectrometry setups, the approach is novel and can overcome the drawback for chemical substances identification. As an example, 276 compounds from the Chinese Medicine of Yi-Xin-Shu capsule were identified. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  1. Violence against women in the context of war: experiences of Shi'i women and Palestinian refugee women in Lebanon.

    Holt, Maria

    2013-03-01

    In times of war, women are likely to experience, in addition to the "normal" violence of peacetime, random cruelties perpetrated by the enemy against all members of the community. During research conducted with Palestinian refugees and Shi'i Muslims in Lebanon, women described various forms of violence and, in this article, I examine violence suffered by women in the context of conflict from three perspectives: victimization, trauma, and resistance. I argue that traumatic events have the effect of obliterating identity, but they can also strengthen the resolve to resist.

  2. Chromatographic isolation of nanoparticles from Ma-Xing-Shi-Gan-Tang decoction and their characterization.

    Zhou, Jianwu; Gao, Guanzhen; Chu, Qiuping; Wang, Huiqin; Rao, Pingfan; Ke, Lijing

    2014-02-12

    The herbal decoction is a complex dispersion system containing solutes, colloid, aggregates, emulsions and precipitates. In which phase bioactive phytochemicals are dispersed determines their delivery, action and metabolism. This study took ephedrine, a well-studied and widely used phytochemical, as an example to elucidate its exact distribution in the phases of Ma-Xing-Shi-Gan-Tang decoction (MXSGT), which is an Ephedra sinica Stapf. containing traditional Chinese medicinal formula, and the biological meaning of this distribution correspondingly. It may provide an important update to the safety and efficacy assessment of the herbal decoction and its active phytochemicals. In this study, the decoction was fractionated with size-exclusion chromatography coupled with multi-angle laser light scattering detector. The morphology of fractionated nanoparticles was observed with AFM and SEM. The bioactivities of the decoction, the ephedrine alkaloids loaded NPs (prepared by chromatography isolation) and the synthetic ephedrine were assessed by cell proliferation tests using five cell lines, namely Caco-2, L-02, Hep-G2, NR-8383, and Hela-229. Nanoparticles with radii of gyration ranged from 50 to 150 nm were isolated, in spherical shape. Further analysis of nanoparticles on the subsequent reversed phase chromatography revealed that the majority of ephedrine (99.7%) and pseudoephedrine (95.5%) were associated with these nanoparticles, rather than dispersed freely in the real solution. The addition of both the herbal decoction and the separated ephedrine-loaded nanoparticles reserved higher cell viability/proliferation than that of the sole synthetic ephedrine among the Caco-2, L-02, Hep-G2, and NR-8383 cells. In contrast, the nanoparticles reduced the proliferating power of ephedrine on Hela-229 cells. In general, the ephedrine-loaded NPs conducted the intermediate influences on the cell viability, in either way. The colloidal nanoparticles were separated from the decoction

  3. Qing-Xin-Jie-Yu Granules in addition to conventional treatment for patients with stable coronary artery disease (QUEST Trial): study protocol for a randomized controlled trial.

    Li, Shengyao; Guo, Ming; Mao, Huimin; Gao, Zhuye; Xu, Hao; Shi, Dazhuo

    2016-09-15

    Recurrent cardiovascular event remains high in stable coronary artery disease (SCAD), especially in patients with multiple risk factors, despite a high rate of use conventional treatment. Traditional Chinese Medicine (TCM) is a promising complementary and alternative medicine for treating SCAD, while evidence for its effect on long-term survival is limited. This study was designed to test if Chinese herbal medicine in addition to conventional treatment is more effective than conventional treatment alone in reducing major adverse cardiac event (MACE) for SCAD patients with multiple risk factors during a 1-year follow-up. This is a multicenter, placebo-controlled, double-blinded, randomized controlled clinical trial. A total of 1500 patients are randomized in a 1:1 ratio to receive the Qing-Xin-Jie-Yu Granules (QXJYG) or the placebo granules, twice daily for 6 months. The primary outcome is the combined outcomes including cardiac death, nonfatal myocardial infarction and revascularization. The secondary outcome is the combined outcomes including all-cause mortality, re-admission for acute coronary syndrome (ACS), heart failure, malignant supraventricular and ventricular arrhythmia influencing hemodynamics, ischemic stroke, and other thromboembolic events during 1-year follow-up. The assessment is performed at baseline (before randomization), 1, 3, 6, 9, and 12 months after randomization. This is the first multicenter trial sponsored by the national funding of China to evaluate TCM in combination with conventional treatment on 1-year survival in high-risk SCAD patients. If successful, it will provide an evidence-based complementary therapeutic approach for reducing MACE from SCAD. The trial was registered in the Chinese Clinical Trial Registry on December 28, 2013. The registration number is ChiCTR-TRC-13004370 .

  4. Up-Regulation of CYP2C19 Expression by BuChang NaoXinTong via PXR Activation in HepG2 Cells.

    Hong Sun

    Full Text Available Cytochrome P450 2C19 (CYP2C19 is an important drug-metabolizing enzyme (DME, which is responsible for the biotransformation of several kinds of drugs such as proton pump inhibitors, platelet aggregation inhibitors and antidepressants. Previous studies showed that Buchang NaoXinTong capsules (NXT increased the CYP2C19 metabolic activity in vitro and enhanced the antiplatelet effect of clopidogrel in vivo. However, the underlying molecular mechanism remained unclear. In the present study, we examined whether Pregnane X receptor (PXR plays a role in NXT-mediated regulation of CYP2C19 expression.We applied luciferase assays, real-time quantitative PCR (qPCR, Western blotting and cell-based analysis of metabolic activity experiments to investigate the NXT regulatory effects on the CYP2C19 promoter activity, the mRNA/ protein expression and the metabolic activity.Our results demonstrated that NXT significantly increased the CYP2C19 promoter activity when co-transfected with PXR in HepG2 cells. Mutations in PXR responsive element abolished the NXT inductive effects on the CYP2C19 promoter transcription. Additionally, NXT incubation (150 and 250μg/mL also markedly up-regulated endogenous CYP2C19 mRNA and protein levels in PXR-transfected HepG2 cells. Correspondingly, NXT leaded to a significant enhancement of the CYP2C19 catalytic activity in PXR-transfected HepG2 cells.In summary, this is the first study to suggest that NXT could induce CYP2C19 expression via PXR activation.

  5. San-Huang-Xie-Xin-Tang Prevents Rat Hearts from Ischemia/Reperfusion-Induced Apoptosis through eNOS and MAPK Pathways

    Shu-Fen Liou

    2011-01-01

    Full Text Available San-Huang-Xie-Xin-Tang (SHXT is a traditional Chinese medication consisting of three herbs, namely Coptidis rhizome, Scutellariae radix and Rhei rhizome. This study aimed to examine the cardioprotective effects of SHXT in a rat model of acute myocardial apoptosis induced by ischemia/reperfusion (I/R. Vehicle (intravenous saline or SHXT (intravenous or oral was administered prior to I/R (occlusion of left coronary artery for 45 min followed by reperfusion for 2 h. In the vehicle group, myocardial I/R caused myocardial infarction with increased plasma cardiac enzymes, severe arrhythmia and mortality. Myocardial apoptosis was induced by I/R as evidenced by DNA ladder and Bcl-2/Bax ratio. In the SHXT group, we found that SHXT significantly reduced plasma levels of cardiac enzymes, arrhythmia scores (from 5 ± 1 to 2 ± 1, P<.01 and mortality rate (from 53 to 0%, P<.01. In addition, pretreatment with intravenous SHXT reduced the infarct size dose-dependently when compared with the vehicle group (10 mg kg−1: 14.0 ± 0.2 versus 44.5 ± 5.0%, and 30 mg kg−1: 6.2 ± 1.2% versus 44.5 ± 5.0%, both P<.01. Similarly, oral administration of SHXT reduced the infarct size dose-dependently. Furthermore, SHXT markedly decreased the apoptosis induced by I/R with increased Bcl-2/Bax ratio. Finally, we found that SHXT counteracted the I/R-induced downstream signaling, resulting in increased myocardial eNOS expression and plasma nitrite, and decreased activation of ERK1/2, p38 and JNK. These data suggest that SHXT has cardioprotective effects against I/R-induced apoptosis, and that these effects are mediated, at least in part, by eNOS and MAPK pathways.

  6. Comparatively evaluating the pharmacokinetic of fifteen constituents in normal and blood deficiency rats after oral administration of Xin-Sheng-Hua Granule by UPLC-MS/MS.

    Pang, Han-Qing; Tang, Yu-Ping; Cao, Yu-Jie; Tan, Ya-Jie; Jin, Yi; Shi, Xu-Qin; Huang, Sheng-Liang; Sun, Da-Zheng; Sun, Jin; Tang, Zhi-Shu; Duan, Jin-Ao

    2017-09-01

    Xin-Sheng-Hua Granule (XSHG), a famous traditional Chinese medicine prescription, are clinically applied for the treatment of postpartum disease through nourishing blood and promoting blood circulation. In this investigation, a multi-constituents (trigonelline, stachydrine hydrochloride, hydroxysafflor yellow A, chlorogenic acid, amygdalin, leonurine, liquiritin, ferulic acid, senkyunolide I, senkyunolide H, glycyrrhizic acid, senkyunolide A, ligustilide, butylidenephthalide and glycyrrhetinic acid) pharmacokinetic study of XSHG was conducted for the first time. These fifteen constituents in both normal and blood deficiency rat plasma were monitored by using the established and validated ultra-high-performance liquid chromatography coupled with a triple quadrupole electrospray tandem mass spectrometry (UPLC-TQ-MS/MS) method. The samples were prepared through removing protein from plasma with three volumes of methanol. Sufficient separation of target constituents and internal standards (chloramphenicol and clarithromycin) was obtained on a Thermo Scientific Hypersil GOLD column (100mm×3mm, 1.9μm) within a 20min gradient elution (0.1% formic acid aqueous - acetonitrile). Multiple reaction monitoring (MRM) mode was applied to monitor target analytes in both positive and negative electrospray ionization. For the fifteen selected target analytes, this method was fully validated with excellent linearity (r≥0.9925), satisfactory intra- and inter-day precisions (RSD≤11.87%), as well as good accuracies (RE, between -12.84 and 11.69). And the stabilities, matrix effects and extraction recoveries of the rat plasma samples were also within acceptable limits (RSD<15%). Compared to normal group, the pharmacokinetics of major active constituents (except liquiritin and glycyrrhetinic acid) had significant differences (P<0.05) in the model rats, indicated that several metabolite enzymes activities could be altered at disease condition. Copyright © 2017 Elsevier B.V. All

  7. Electrophysiological effects of Chinese medicine Shen song Yang xin (SSYX) on Chinese miniature swine heart and isolated guinea pig ventricular myocytes.

    Feng, Li; Gong, Jing; Jin, Zhen-yi; Li, Ning; Sun, Li-ping; Wu, Yi-ling; Pu, Jie-lin

    2009-07-05

    Shen song Yang xin (SSYX) is a compound of Chinese medicine with the effect of increasing heart rate (HR). This study aimed to evaluate its electrophysiological properties at heart and cellular levels. The Chinese miniature swines were randomly assigned to two groups, administered with SSYX or placebo for 4 weeks (n = 8 per group). Cardiac electrophysiological study (EPS) was performed before and after drug administration. The guinea pig ventricular myocytes were enzymatically isolated and whole cell voltage-clamp technique was used to evaluate the effect of SSYX on cardiac action potential (AP). SSYX treatment accelerated the HR from (141.8 +/- 36.0) beats per minute to (163.0 +/- 38.0) beats per minute (P = 0.013) without changing the other parameters in surface electrocardiogram. After blockage of the autonomic nervous system with metoprolol and atropin, SSYX had no effect on intrinsic HR (IHR), but decreased corrected sinus node recovery time (CSNRT) and sinus atrium conducting time (SACT). Intra cardiac EPS showed that SSYX significantly decreased the A-H and A-V intervals as well as shortened the atrial (A), atrioventricular node (AVN) and ventricular (V) effective refractory period (ERP). In isolated guinea pig ventricular myocytes, the most obvious effect of SSYX on action potential was a shortening of the action potential duration (APD) without change in shape of action potential. The shortening rates of APD(30), APD(50) and APD(90) were 19.5%, 17.8% and 15.3%, respectively. The resting potential (Em) and the interval between the end of APD(30) and APD(90) did not significantly change. The present study demonstrates that SSYX increases the HR and enhances the conducting capacity of the heart in the condition of the intact autonomic nervous system. SSYX homogenously decreases the ERP of the heart and shortens the APD of the myocytes, suggesting its antiarrhythmic effect without proarrhythmia.

  8. When people in close relationships are not prepared to listen to emotional disclosures. The role of social constraints in shy people’s functioning

    Irena Dzwonkowska

    2007-12-01

    Full Text Available The following article comprises a presentation of research carried out on a group of 268 adults. The survey aimed at finding answers to questions posed about the meditative role played by social constraints in the relationship between shyness and certain aspects of emotional and social functioning. The results indicate that social constraints are a destructive factor in the everyday functioning of those facing everyday problems. Many shy people experience social constraints - people in close relationships: family, relatives, and friends react inadequately and negatively, demonstrating a lack of empathy, thus discouraging people who are shy from expressing their personal thoughts and emotions. Regression analyses, conducted in order to detect the meditative effects of social constraints, show that their destructive influence is particularly severe in the case of shy people leading to their low self-esteem, a high level of depressive symptoms and a low perception of social support.

  9. SHI induced effects on the electrical and optical properties of HfO_2 thin films deposited by RF sputtering

    Manikanthababu, N.; Dhanunjaya, M.; Nageswara Rao, S.V.S.; Pathak, A.P.

    2016-01-01

    The continuous downscaling of Metal Oxide Semiconductor (MOS) devices has reached a limit with SiO_2 as a gate dielectric material. Introducing high-k dielectric materials as a replacement for the conservative SiO_2 is the only alternative to reduce the leakage current. HfO_2 is a reliable and an impending material for the wide usage as a gate dielectric in semiconductor industry. HfO_2 thin films were synthesized by RF sputtering technique. Here, we present a study of Swift Heavy Ion (SHI) irradiation with100 MeV Ag ions for studying the optical properties as well as 80 MeV Ni ions for studying the electrical properties of HfO_2/Si thin films. Rutherford Backscattering Spectrometry (RBS), Field Emission Scanning Electron Microscope (FESEM), energy-dispersive X-ray spectroscopy (EDS), profilometer and I–V (leakage current) measurements have been employed to study the SHI induced effects on both the structural, electrical and optical properties.

  10. Effect of swift heavy ion (SHI) irradiation on transparent conducting oxide electrodes for dye-sensitized solar cell applications

    Singh, Hemant Kr.; Avasthi, D. K.; Aggarwal, Shruti

    2015-06-01

    Transparent conducting oxides (TCOs) are used as electrodes in dye-sensitized solar cells (DSSCs) because of their properties such as high transmittance and low resistivity. In the present work, the effects of swift heavy ion (SHI) irradiation on various types of TCOs are presented. The objective of this study is to investigate the effect of SHI on TCOs. For the present study, three different types of TCOs are considered, namely, (a) FTO (fluorine-doped tin oxide, SnO2:F) on a Nippon glass substrate, (b) ITO (indium tin oxide, In2O3:Sn) coated on polyethylene terephthalate (PET) on a Corning glass substrate, and (c) ITO on a Corning glass substrate. These films are irradiated with 120 MeV Ag+9 ions at fluences ranging from 3.0 × 1011 ions/cm2 to 3.0 × 1013 ions/cm2. The structural, morphological, optical and electrical properties are studied via X-ray diffraction (XRD), atomic force microscopy (AFM), UV-Vis absorption spectroscopy and four-probe resistivity measurements, respectively. The ITO-PET electrode is found to exhibit superior conductivity and transmittance properties in comparison with the others after irradiation and, therefore, to be the most suitable for solar cell applications.

  11. 新力正骨喷雾剂治疗踝关节扭挫伤65例的疗效分析%Efifcts Analysis of Xinli Orthopedic Sprays in the Treatment of 65 Cases of Ankle Sprain

    张兵; 褚福明

    2014-01-01

    Objective:To observe the clinical efficacy of Xinli Orthopedic Sprays in the treatment of ankle sprain.Methods:130 patients with ankle sprain in our hospital from May 2011 to May 2013 were randomly divided into treatment group and control group,each group had 65 cases respectively.The control group were given Yun Nan Bai Yao aerosol,while the experimental group were given Xinli Orthopedic Sprays,the clinical efficacy of treatment were evaluated.Results:There was no statistically significant difference between the cure rate,show efficiency rate,total efficiency rate and analgesic effective time,etc (P>0.05).Conclusion:The clinical efficacy of Xinli Orthopedic Sprays was equal as that of Yun Nan Bai Yao Aerosol.%目的:观察新力正骨喷雾剂治疗踝关节扭挫伤的临床疗效。方法:选择2011年5月~2013年5月期间我院收治的踝关节扭挫伤患者130例,随机分为试验组和对照组,各65例,对照组应用云南白药气雾剂,试验组应用新力正骨气雾剂,评价治疗后的临床疗效。结果:两组患者治疗后痊愈率,显效率,有效率,总有效率,及止痛显效时间等疗效比较差异均无统计学意义(P>0.05)。结论:新力正骨喷雾剂治疗踝关节扭挫伤的临床疗效与云南白药气雾剂相当。

  12. 新力正骨喷雾剂治疗踝关节扭挫伤的临床观察%Clinical Observation of Xin Li Orthopedic Spray in the Treatment of Ankle Sprain

    苟中生; 张丽文

    2013-01-01

    目的:观察新力正骨喷雾剂治疗踝关节扭挫伤的临床疗效。方法:入选2010年2月~2013年2月笔者所在科室就诊的140例踝关节扭挫伤患者,随机分为治疗组和对照组,各70例,治疗组患者应用新力正骨喷雾剂,对照组患者应用云南白药气雾剂。结果:治疗组患者经治疗后痊愈11例,显效46例,有效10例,无效3例,总有效率为95.71%,与对照组比较无统计学差异(P>0.05)。结论:新力正骨喷雾剂治疗踝关节扭挫伤临床疗效满意。%Objective:To observe the clinical efficacy of Xin Li orthopedic spray in the treatment of ankle sprain.Methods:140 patients with ankle sprain in the author department from February 2010 to February 2013 were selected and randomly divided into treatment group and control group.70 cases in the treatment group were given Xin Li orthopedic sprays, patients in the control group were given Yun Nan Bai Yao aerosol.Results:There were 11 cases recovered,46 cases effective,10 cases valid and 3 cases invalid after treatment. The total effective rate of the treatment group was 95.71%,there was no significant difference compared with the control group (P>0.05). Conclusion:The clinical efficacy of Xin Li orthopedic spray in the treatment of ankle sprain was desirable.

  13. El model de difusió de la llengua, la societat i la cultura xineses de l'Institut Confuci : El cas de la revista bilingüe xinès-espanyol

    Arroyo Viguer, Germà

    2016-01-01

    Estudi del model de difusió de la llengua, la cultura i la societat xineses de l'Institut Confuci (IC). Analitza, a més, el cas de l'Institut Confuci de la Universitat de València (ICUV), així com la revista bimestral "Instituto Confucio", que edita en versió bilingüe xinès-espanyol l'ICUV. Estudio del modelo de difusión de la lengua, la cultura y la sociedad chinas del Instituto Confucio (IC). Analiza, además, el caso del Instituto Confucio de la Universidad de Valencia (ICUV), así como l...

  14. Optoelectronic properties of XIn2S4 (X = Cd, Mg) thiospinels through highly accurate all-electron FP-LAPW method coupled with modified approximations

    Yousaf, Masood; Dalhatu, S.A.; Murtaza, G.; Khenata, R.; Sajjad, M.; Musa, A.; Rahnamaye Aliabad, H.A.; Saeed, M.A.

    2015-01-01

    Highlights: • Highly accurate all-electron FP-LAPW+lo method is used. • New physical parameters are reported, important for the fabrication of optoelectronic devices. • A comparative study that involves FP-LAPW+lo method and modified approximations. • Computed band gap values have good agreement with the experimental values. • Optoelectronic results of fundamental importance can be utilized for the fabrication of devices. - Abstract: We report the structural, electronic and optical properties of the thiospinels XIn 2 S 4 (X = Cd, Mg), using highly accurate all-electron full potential linearized augmented plane wave plus local orbital method. In order to calculate the exchange and correlation energies, the method is coupled with modified techniques such as GGA+U and mBJ-GGA, which yield improved results as compared to the previous studies. GGA+SOC approximation is also used for the first time on these compounds to examine the spin orbit coupling effect on the band structure. From the analysis of the structural parameters, robust character is predicted for both materials. Energy band structures profiles are fairly the same for GGA, GGA+SOC, GGA+U and mBJ-GGA, confirming the indirect and direct band gap nature of CdIn 2 S 4 and MgIn 2 S 4 materials, respectively. We report the trend of band gap results as: (mBJ-GGA) > (GGA+U) > (GGA) > (GGA+SOC). Localized regions appearing in the valence bands for CdIn 2 S 4 tend to split up nearly by ≈1 eV in the case of GGA+SOC. Many new physical parameters are reported that can be important for the fabrication of optoelectronic devices. Optical spectra namely, dielectric function (DF), refractive index n(ω), extinction coefficient k(ω), reflectivity R(ω), optical conductivity σ(ω), absorption coefficient α(ω) and electron loss function are discussed. Optical’s absorption edge is noted to be 1.401 and 1.782 for CdIn 2 S 4 and MgIn 2 S 4 , respectively. The prominent peaks in the electron energy spectrum

  15. Bu-Shen-Ning-Xin Decoction ameliorated the osteoporotic phenotype of ovariectomized mice without affecting the serum estrogen concentration or uterus

    Wang L

    2015-08-01

    Full Text Available Ling Wang,1,2,* Xue-Min Qiu,1,2,* Yu-Yan Gui,1,2 Ying-Ping Xu,1,2 Hans-Jürgen Gober,3 Da-Jin Li1 1Laboratory for Reproductive Immunology, Hospital and Institute of Obstetrics and Gynecology, IBS, Fudan University Shanghai Medical College, 2Shanghai Key Laboratory of Female Reproductive Endocrine Related Diseases, Shanghai, People’s Republic of China; 3Department of Pharmacy, Wagner Jauregg Hospital and Children’s Hospital, Linz, Austria *These authors contributed equally to this work Introduction: Bu-Shen-Ning-Xin Decoction (BSNXD, a traditional Chinese medicinal composition, has been used as a remedy for postmenopausal osteoporosis, but its effects on bone metabolism and the uterus have not been reported.Purpose: We aimed to determine the respective effects of BSNXD on the bones and the uterus of ovariectomized (OVX mice to evaluate the efficacy and safety of this herbal formula.Materials and methods: Postmenopausal osteoporosis animal models that were generated by ovariectomy were treated with BSNXD. Dual-energy X-ray absorptiometry was performed to analyze the bone mineral density, and histomorphometric analysis was performed to measure the parameters related to bone metabolism. Calcein labeling was performed to detect bone formation. The uteruses from the mice were weighed, and the histomorphometry was analyzed. Drug-derived serum was prepared to assess the 17-β-estradiol concentration via enzyme immunoassay.Results: BSNXD administration ameliorated the osteoporotic phenotype of OVX mice, as evidenced by an increase in the bone mineral density and bone volume; these effects could not be abolished by the administration of the aromatase inhibitor letrozole. Moreover, BSNXD had no effect on the serum estrogen concentration or uterus.Conclusion: These results suggest that BSNXD has ameliorating effects on bone loss due to estrogen deprivation without affecting the peripheral blood estrogen concentration or the uterus in OVX mice. Keywords

  16. Simultaneous determination of phenolic acids and diterpenoids and their comparative pharmacokinetic study in normal and acute blood stasis rats by UFLC-MS/MS after oral administration of Guan-Xin-Shu-Tong capsules.

    Gao, Xun; Mu, Jingqing; Guan, Shaoyi; Li, Qing; Du, Yiyang; Zhang, Huifen; Bi, Kaishun

    2018-01-01

    Guan-Xin-Shu-Tong capsules are one of the well-known and first-line Chinese traditional herbal formula for treating coronary heart disease. A validated and sensitive method via ultra fast liquid chromatography-tandem mass spectrometry (UFLC-MS/MS) was established to simultaneously determinate five phenolic acids and four diterpenoids in rats in order to investigate their pharmacokinetic profiles firstly. Analytes were extracted by ethyl acetate and determined via multiple reaction monitoring mode in both positive and negative ion modes. The values for limit of quantification were in range of 0.025-1.250ng/ml. Inter- and intra-day precisions were no more than 10.9% with accuracy of -11.0%-10.6%, meanwhile the stable and suitable extraction recoveries were also obtained. And finally such excellent method was used to compare the pharmacokinetics of nine compounds in normal and acute blood stasis rats after oral administration of Guan-Xin-Shu-Tong capsules. Copyright © 2017 Elsevier B.V. All rights reserved.

  17. Getting to "No": Locating Critical Peace Education within Resistance and Anti-Oppression Pedagogy at a Shi'a Islamic School in Lebanon

    Zakharia, Zeena

    2017-01-01

    This paper critically engages observations from a school that was aligned with a resistance movement in Lebanon during a post-war period of sustained political violence (2006-2007). Focusing on the pedagogical practices at one community-centered and community-led Shi'a Islamic urban school, the paper draws on extensive ethnographic data to…

  18. Ssang Yong 2014 Remote Sensing Experiment

    2016-05-25

    stems from multiple sources: the ocean waves reaching the sands, rivers...I ~ I I I I I 350 550 750 950 1150 1350 1550 1750 1950 2150 2350 Wavelength, nm G-8           Cll ... <: ’" 1:: Cll ...0.6 0.5 0.4 Cll a: 0.3 0 .2 0.1 0.6 0.5 0.4 Cll ... <: ’" 1:: Cll ;;::: Cll a: 0.3 0.2 0.1 DG-2-4 1 1 I I I I ’ I I 1 11 1 Il l I 1

  19. Treatment of Common Cold Patients with the Shi-Cha Capsule: A Multicenter, Double-Blind, Randomized, Placebo-Controlled, Dose-Escalation Trial

    Chang, Jing; Dong, Shou-Jin; She, Bin; Zhang, Rui-Ming; Meng, Mao-Bin; Xu, Yan-Ling; Wan, Li-Ling; Shi, Ke-Hua; Pan, Jun-Hun; Mao, Bing

    2012-01-01

    This study was designed to determine the therapeutic efficacy and safety of the Shi-cha capsule, a Chinese herbal formula, in the treatment of patients with wind-cold type common cold. In our multi-center, prospective, double-blind, randomized, placebo-controlled, dose-escalation trial, patients with wind-cold type common cold received 0.6 g of Shi-cha capsule plus 0.6 g placebo (group A), 1.2 g of Shi-cha capsule (group B), or 1.2 g placebo (group C), three times daily for 3 days and followed up to 10 days. The primary end point was all symptom duration. The secondary end points were main symptom duration, minor symptom duration, the changes in cumulative symptom score, main symptom score, and minor symptom score 4 days after the treatment, as well as adverse events. A total of 377 patients were recruited and 360 met the inclusive criteria; 120 patients constituted each treatment group. Compared with patients in group C, patients in groups A and B had significant improvement in the all symptom duration, main symptom duration, minor symptom duration, as well as change from baseline of cumulative symptom score, main symptom score, and minor symptom score at day 4. The symptom durations and scores showed slight superiority of group B over group A, although these differences were not statistically significant. There were no differences in adverse events. The Shi-cha capsule is efficacious and safe for the treatment of patients with wind-cold type common cold. Larger trials are required to fully assess the benefits and safety of this treatment for common cold. PMID:23346193

  20. See Religious Influences from Su Shi and John Milton's Memorial Poems%苏轼与弥尔顿悼亡诗中不同的宗教影响

    Liu Lili; Li Feng

    2008-01-01

    Based on comparative study between the poetic works of John Milton and Su Shi,this thesis takes the only love sonnet of John Milton Methought l Saw My Late EspouscM Saint(On His Deceased Wife)and Su Shi's first memorial poem Jiangchengzi(Riverside Town)as examples tries to analyze the different religious influences between the two memorial poems.

  1. SHiP: a new facility for searching for long-lived neutral particles and studying the tau neutrino properties

    AUTHOR|(SzGeCERN)658186

    2016-01-01

    SHiP (Search for Hidden Particles) is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In its initial phase, the 400 GeV proton beam will be dumped on a heavy target, integrating $2\\times 10^{20}$ protons on target in 5 years. A dedicated detector located downstream of the target, based on a long vacuum tank and a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived neutral and very weakly interacting particles and masses below 10 GeV. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutrinos. The sensitivity to Heavy Neutrinos will allow for the first time to probe, in the mass range between the kaon and the charm meson mass, a coupling range for which the baryon asymmetry of the Universe could be explained. Direct detection of light and long-lived SUSY particles, such as RPV neutralinos and pseudo-Dirac gauginos could als...

  2. Cumulative approaches to track formation under swift heavy ion (SHI) irradiation: Phenomenological correlation with formation energies of Frenkel pairs

    Crespillo, M.L., E-mail: mcrespil@utk.edu [Centro de Microanálisis de Materiales, CMAM-UAM, Cantoblanco, Madrid 28049 (Spain); Department of Materials Science & Engineering, University of Tennessee, Knoxville, TN 37996 (United States); Agulló-López, F., E-mail: fal@uam.es [Centro de Microanálisis de Materiales, CMAM-UAM, Cantoblanco, Madrid 28049 (Spain); Zucchiatti, A. [Centro de Microanálisis de Materiales, CMAM-UAM, Cantoblanco, Madrid 28049 (Spain)

    2017-03-01

    Highlights: • Extensive survey formation energies Frenkel pairs and electronic stopping thresholds. • Correlation: track formation thresholds and the energies for Frenkel pair formation. • Formation energies Frenkel pairs discussed in relation to the cumulative mechanisms. • Amorphous track formation mechanisms: defect accumulation models versus melting. • Advantages cumulative models to deal with new hot topics: nuclear-electronic synergy. - Abstract: An extensive survey for the formation energies of Frenkel pairs, as representative candidates for radiation-induced point defects, is presented and discussed in relation to the cumulative mechanisms (CM) of track formation in dielectric materials under swift heavy ion (SHI) irradiation. These mechanisms rely on the generation and accumulation of point defects during irradiation followed by collapse of the lattice once a threshold defect concentration is reached. The physical basis of those approaches has been discussed by Fecht as a defect-assisted transition to an amorphous phase. Although a first quantitative analysis of the CM model was previously performed for LiNbO{sub 3} crystals, we have, here, adopted a broader phenomenological approach. It explores the correlation between track formation thresholds and the energies for Frenkel pair formation for a broad range of materials. It is concluded that the threshold stopping powers can be roughly scaled with the energies required to generate a critical Frenkel pair concentration in the order of a few percent of the total atomic content. Finally, a comparison with the predictions of the thermal spike model is discussed within the analytical Szenes approximation.

  3. Effect of SHI irradiation on structural, surface morphological and optical studies of CVT grown ZnSSe single crystals

    Kannappan, P.; Asokan, K.; Krishna, J.B.M.; Dhanasekaran, R.

    2013-01-01

    Highlights: •CVT grown ZnSSe single crystals were irradiated with 120 MeV Au ion. •The GIXRD results show the FWHM increases with increasing ion fluency. •The AFM study show the surface roughness increases with ion fluency. •The optical band gap energy vary with increasing ion fluency. •The PL emission decreases with increasing ion fluency. -- Abstract: The ZnSSe single crystals grown by chemical vapour transport (CVT) method have been irradiated by 120 MeV Au 9+ ions at room temperature with fluences of 1 × 10 12 and 5 × 10 12 ions/cm 2 . The grazing incidence X-ray diffraction (GIXRD) results show that the full width at half maximum (FWHM) value for the as grown ZnSSe crystal is 0.215°; and for the irradiated samples, the FWHM values are 0.413° and 0.625°, with the increase of ion fluences. The atomic force microscopy (AFM) studies reveal the formation of the pits and islands due to irradiation. The optical absorption cut off wavelength is found to be 441 nm for as grown ZnSSe crystal. The cut off values are increased to 447 nm and 457 nm for the irradiated samples with increasing ion fluency. The photoluminescence studies show the emission for the as grown ZnSSe is 590 nm whereas for the irradiated samples in the emission range it is 580–590 nm and 575–595 nm due to SHI irradiation. FT-Raman spectra analysis has been made for the ZnSSe single crystals and irradiated samples. The results are discussed in detail

  4. Effect of SHI irradiation on structural, surface morphological and optical studies of CVT grown ZnSSe single crystals

    Kannappan, P. [Crystal Growth Centre, Anna University, Chennai 600 025 (India); Asokan, K. [Inter University Accelerator Centre, Aruna Asaf Ali Marg, New Delhi 110 067 (India); Krishna, J.B.M. [UGC-DAE Consortium for Scientific Research, III-/LB-8, Bidhan nagar, Kolkata 700 098 (India); Dhanasekaran, R., E-mail: rdcgc@yahoo.com [Crystal Growth Centre, Anna University, Chennai 600 025 (India)

    2013-12-15

    Highlights: •CVT grown ZnSSe single crystals were irradiated with 120 MeV Au ion. •The GIXRD results show the FWHM increases with increasing ion fluency. •The AFM study show the surface roughness increases with ion fluency. •The optical band gap energy vary with increasing ion fluency. •The PL emission decreases with increasing ion fluency. -- Abstract: The ZnSSe single crystals grown by chemical vapour transport (CVT) method have been irradiated by 120 MeV Au{sup 9+} ions at room temperature with fluences of 1 × 10{sup 12} and 5 × 10{sup 12} ions/cm{sup 2}. The grazing incidence X-ray diffraction (GIXRD) results show that the full width at half maximum (FWHM) value for the as grown ZnSSe crystal is 0.215°; and for the irradiated samples, the FWHM values are 0.413° and 0.625°, with the increase of ion fluences. The atomic force microscopy (AFM) studies reveal the formation of the pits and islands due to irradiation. The optical absorption cut off wavelength is found to be 441 nm for as grown ZnSSe crystal. The cut off values are increased to 447 nm and 457 nm for the irradiated samples with increasing ion fluency. The photoluminescence studies show the emission for the as grown ZnSSe is 590 nm whereas for the irradiated samples in the emission range it is 580–590 nm and 575–595 nm due to SHI irradiation. FT-Raman spectra analysis has been made for the ZnSSe single crystals and irradiated samples. The results are discussed in detail.

  5. Bridging the Divide: Literature, Dao and the Case for Subjective Access in the Thought of Su Shi

    Curie Virág

    2014-10-01

    Full Text Available In the 11th century in China, there was an unusual moment in which a number of philosophers, later associated with the Daoxue—or Neo-Confucian—school, confronted what they perceived as a long-standing sense of disjunction between inner, subjective reality and the structured patterns of the cosmos. One way they sought to overcome this disjunction was by positing new theories of the cosmos that focused on the underlying, shared reality behind the myriad differentiations of phenomena. A potential tension was born that affected how thinkers understood the relationship between wen 文 (writing, literature, culture and Dao 道 (the cosmic process, the ultimate reality, the normative path. Some thinkers, like Zhou Dunyi 周敦頤 (1017–1073, believed that wen was simply a vehicle for carrying the Dao, and was thus, implicitly, dispensable. This idea was met with resistance from one of the leading intellectual figures of the time—the philosopher, poet and statesman Su Shi 蘇軾 (1037–1101. While some of Su’s contemporaries, in their attempts to demonstrate that the world was real, and that truth was knowable, downplayed the role of individual experience and perception, Su stressed the necessity of subjective, individual experience as giving access, and concrete expression, to Dao. Su’s philosophical project came in the form of defending the enterprise of wen—writing as a creative, individual endeavor—and asserting that the quest for unity with the Dao could only be realized through direct, personal engagement in wen and other forms of meaningful practice. Through his philosophy of wen, Su sought to show that the search for truth, meaning and order did not—and could not—be achieved by transcending subjective experience. Instead, it had to be carried out at the point of encounter between self and the world, in the realm of practice.

  6. Regional asymmetry of metabolic and antioxidant profile in the sciaenid fish shi drum (Umbrina cirrosa white muscle. Response to starvation and refeeding

    M. Carmen Hidalgo

    2017-04-01

    Full Text Available The objective of the present study is to characterize the metabolic and antioxidant profile of white muscle of shi drum in two sites of the body, anterior dorsal (AM and posterior dorsal (PM portions. In addition, it will be analyzed the possible effect of starvation and a subsequent refeeding, with two different protocols, pair feeding and ad libitum. Activities of key enzymes of intermediary metabolism and of antioxidant enzymes, as well as lipid peroxidation, as an index of oxidative stress, were evaluated. The results indicate the existence of a regional asymmetry of the metabolic capacities of the white muscle of shi drum, which is likely related to the different contribution to swimming of the body regions examined. Starvation induces a metabolic depression that is more marked in those activities that support burst swimming in PM, while those activities supporting maintenance requirements are conserved. The greatest energy demands during starvation appear to lie in AM, which showed the highest oxidative metabolism rate. The increased use of fatty acids as energy source for AM leads to oxidative stress. A period of more than four weeks of refeeding for full restoration of metabolic capacities in AM is needed, probably related to the higher muscle mass located in this region. On the contrary, all enzyme activities in PM returned to control levels in both refeeding protocols, but pair feeding seems to be advantageous since compensatory growth has been taking place without signs of oxidative stress. This work was addressed to gain knowledge on the physiology of a promising fish species in aquaculture like shi drum. The results displayed here show how the starving and further re-feeding events could generate oxidative stress situations characterized by high lipid peroxidation levels which may influence negatively on the quality of the edible part of the fish. This study opens an interesting field on this fish species which deserves being

  7. Diagnosis and Improvement on the Interior Communication System of the Xin-You Technical Limited Company%信友科技有限公司内部沟通体系诊断及改进研究

    翟超

    2011-01-01

    This paper aims to discuss the internal communicarion of high-tech enterprises by the method of combining theory and practice, through analysis of features, advantages and disadvantages of Xin-You's internal communication, conducts on discussion and diagnosis on how to resolve the internal communication hamers, improve communication efficiency and effectiveness, uses the related theory with the characteristics of company, proposes Lhe improving way of internal communication system to solve the problems in effective transmission of information and make the company be more bigger and stronger.%本文旨在以理论与实践相结合的研究方法,重点探讨高科技企业内部的沟通行为,并通过分析信友科技有限公司内部沟通的特点及利弊,就如何解决其内部沟通障碍、提高沟通效率及沟通效能进行探讨及诊断,应用相关理论结合公司的特点,提出内部沟通体系改进方法,为该公司解决信息有效传递问题,做大做强企业进行有益尝试.

  8. Traditional Chinese Medicine ShenZhuGuanXin Granules Mitigate Cardiac Dysfunction and Promote Myocardium Angiogenesis in Myocardial Infarction Rats by Upregulating PECAM-1/CD31 and VEGF Expression

    Dan-Ping Xu

    2017-01-01

    Full Text Available Background. Myocardial infarction (MI is the main cause of global mortality and morbidity despite the development of therapeutic approaches. ShenZhuGuanXin granules (SG have been shown to possess cardioprotective effects against coronary heart disease (CHD. However, little is known about its specific mechanism. The present study aimed to investigate the therapeutic effect of SG in cardiac dysfunction and to demonstrate whether SG can promote myocardium angiogenesis by establishing a rat model of myocardial infarction with left anterior descending ligating. Methods and Results. Three days after MI, rats were randomly divided into six groups: sham group (sham, MI group (MI, MI + low dose SG (SG-L group, MI + middle dose SG (SG-M group, MI + high dose SG (SG-H group, and MI + compound Danshen dropping pills (CDDP group as a positive control. Four weeks after administration, rats underwent hemodynamics and echocardiography study. Ventricle tissues were processed for histology and immunohistochemistry studies. Compared with MI group, SG treatment dose-dependently improved cardiac hemodynamic function, attenuated infarct size, increased microvessel density, and increased the expression of PECAM-1/CD31 and VEGF. Conclusions. SG dose-dependently improved cardiac hemodynamic function and attenuated infarct size by promoting angiogenesis through upregulating PECAM-1/CD31 and VEGF expression.

  9. Simultaneous quantitation of polygalaxanthone III and four ginsenosides by ultra-fast liquid chromatography with tandem mass spectrometry in rat and beagle dog plasma after oral administration of Kai-Xin-San: application to a comparative pharmacokinetic study.

    Lv, Chunxiao; Li, Qing; Zhang, Xiaowen; He, Bosai; Xu, Huarong; Yin, Yidi; Liu, Ran; Liu, Jingjing; Chen, Xiaohui; Bi, Kaishun

    2014-05-01

    A fast, selective, and quantitative ultra-fast liquid chromatography with tandem mass spectrometry method has been developed and validated for the simultaneous quantitation of polygalaxanthone III, ginsenoside Rb1, ginsenoside Rd, ginsenoside Re, and ginsenoside Rg1 in the plasma of rat and beagle dog after oral administration of Kai-Xin-San. After addition of the internal standard, salidroside, the plasma samples were extracted by liquid-liquid extraction and separated on a Venusil MP C18 column with methanol/0.01% acetic acid water as mobile phase. The tandem mass spectrometric detection was performed in the multiple reaction monitoring with turbo ion spray source in a switching ionization mode. The method was examined, and found to be precise and accurate with the linearity range of the compounds. The intra- and interday precision and accuracy of the analytes were well within acceptance criteria (±15%). The mean extraction recoveries of analytes and internal standard were all >75.0%. The validated method has been successfully applied to comparing pharmacokinetic profiles of analytes in rat and beagle dog plasma. The results indicated that no significant differences were observed in pharmacokinetic parameters of ginsenoside Rg1, while the others had significant differences, which may due to the different mechanisms of absorption and metabolism. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  10. Once Bitten, Twice Shy

    Andersen, Steffen; Hanspal, Tobin; Meisner Nielsen, Kasper

    We study how personal experiences affect individual risk taking. To separate the intertwining effects of personal experiences and wealth changes, our identification strategy relies on the decision to keep unexpected inheritances of risky assets. Experience derives from investments in banks...... that defaulted in the aftermath of the financial crisis. To differentiate the effect of personal experiences, we classify the degrees of experiences into first-hand experiences from personal losses, second-hand experiences from the losses of close family members, and third-hand experiences from living...... in municipalities where banks defaulted. We find that third-hand experiences result in marginally lower risk taking. Second-hand experiences have a relatively stronger negative effect, whereas the effect of first-hand experiences on risk taking is strongly negative. Overall, our results demonstrate that personal...

  11. Once Bitten, Twice Shy

    Andersen, Steffen; Hanspal, Tobin; Meisner Nielsen, Kasper

    We study how inertia and personal experiences affect individual risk taking. Our research design relies on active portfolio decisions relating to inheritances to separate the effect of personal experiences from inertia, which otherwise would be observationally equivalent. Experience derives from...... results demonstrate that experiences gained personally, aside from inertia or common shocks, explain substantial heterogeneity in individuals' risk taking....

  12. SHiP: a new facility with a dedicated detector to search for new neutral particles and studying tau neutrino properties

    Shevchenko V.

    2017-01-01

    Full Text Available SHiP (Search for Hidden Particles is a new general purpose fixed target facility, whose Technical Proposal has been recently reviewed by the CERN SPS Committee and by the CERN Research Board. The two boards recommended that the experiment proceeds further to a Comprehensive Design phase in the context of the new CERNWorking group "Physics Beyond Colliders", aiming at presenting a CERN strategy for the European Strategy meeting of 2019. In the initial phase of SHiP, the 400 GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating 2×1020 pot in 5 years. A dedicated detector, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below O(10 GeV/c2. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutrinos. The sensitivity to Heavy Neutrinos will allow for the first time to probe, in the mass range between the kaon and the charm meson mass, a coupling range for which Baryogenesis and active neutrino masses could also be explained. Another dedicated detector will allow the study of neutrino cross-sections and angular distributions.

  13. SHI induced effects on the electrical and optical properties of HfO{sub 2} thin films deposited by RF sputtering

    Manikanthababu, N.; Dhanunjaya, M.; Nageswara Rao, S.V.S.; Pathak, A.P., E-mail: appsp@uohyd.ernet.in

    2016-07-15

    The continuous downscaling of Metal Oxide Semiconductor (MOS) devices has reached a limit with SiO{sub 2} as a gate dielectric material. Introducing high-k dielectric materials as a replacement for the conservative SiO{sub 2} is the only alternative to reduce the leakage current. HfO{sub 2} is a reliable and an impending material for the wide usage as a gate dielectric in semiconductor industry. HfO{sub 2} thin films were synthesized by RF sputtering technique. Here, we present a study of Swift Heavy Ion (SHI) irradiation with100 MeV Ag ions for studying the optical properties as well as 80 MeV Ni ions for studying the electrical properties of HfO{sub 2}/Si thin films. Rutherford Backscattering Spectrometry (RBS), Field Emission Scanning Electron Microscope (FESEM), energy-dispersive X-ray spectroscopy (EDS), profilometer and I–V (leakage current) measurements have been employed to study the SHI induced effects on both the structural, electrical and optical properties.

  14. Raman and time resolved photoluminescence studies on the effect of temperature on disorder production in SHI irradiated N-doped 6H-SiC crystals

    Sivaji, K., E-mail: sivaji.krishnan@yahoo.com [Materials Science Centre, Department of Nuclear Physics, University of Madras, Guindy Campus, Chennai 600025 (India); Viswanathan, E. [Materials Science Centre, Department of Nuclear Physics, University of Madras, Guindy Campus, Chennai 600025 (India); Selvakumar, S. [Materials Science Centre, Department of Nuclear Physics, University of Madras, Guindy Campus, Chennai 600025 (India); University of Tsukuba Tandem Accelerator Complex, University of Tsukuba, Tennodai 1-1-1, Ibaraki 305-8577 (Japan); Sankar, S. [Department of Physics, MIT Campus, Anna University, Chennai 600044 (India); Kanjilal, D. [Inter-University Accelerator Centre, Aruna Asaf Ali Marg, P.O. Box 10502, New Delhi 110067 (India)

    2014-02-25

    Highlights: • N doped SiC were irradiated with 150 MeV Ag{sup 12+} (1 × 10{sup 12} to 5 × 10{sup 13} ions/cm{sup 2}). • Local disorder are analyzed by studying the LO Raman mode of the irradiated sample. • The TRPL studies provided evidence of the formation of radiative centers at 80 K. -- Abstract: In this report, the effect of disorder accumulation in Swift Heavy Ion (SHI) irradiated 6H-SiC is distinguished with respect to the irradiation temperature, viz., 80 K and 300 K. The samples were irradiated with 150 MeV Ag{sup 12+} ions with different fluences ranging from 1 × 10{sup 12} to 5 × 10{sup 13} ions/cm{sup 2}. The structural and optical properties of N-doped 6H-SiC in its pristine condition and after SHI irradiation have been studied. The changes observed by Raman spectroscopy and Time resolved photoluminescence (TRPL) spectroscopy were ascribed to the disorder accumulation in 6H-SiC. The local disorder has been analyzed by studying the LO Raman mode of the irradiated sample in comparison to the pristine sample. The TRPL studies have provided evidence of the formation of radiative centers after irradiation at 80 K.

  15. Effect of the partial replacement of fish meal and oil by vegetable products on performance and quality traits of juvenile shi drum (Umbrina cirrosa L.

    Igino Andrighetto

    2010-01-01

    Full Text Available A four-month growth trial was carried out in order to evaluate performance and quality traits of juvenile shi drum fedwith two isonitrogenous and isoenergetic diets having different amounts of vegetable products (Vegetable diet vs. Controldiet. Compared to the Control diet, the Vegetable diet was formulated by increasing the replacement of fish meal (14%with soybean and cereal products, and fish oil (12% with a mixture of vegetable oil. On June, 4 groups of 225 fish (2replicates per dietary treatment were sorted according to live weight and reared in fibreglass tanks over a four- monthlong experimental period. Fish were hand fed to apparent satiety. Offered feed, growth parameters and feed efficiencywere recorded as productive performance. At the end of the trial (October biometric, chemical and reological traits wereexamined to assess fish quality. The dietary treatments showed similar productive performance. The relatively high inclusionof vegetable sources led to a significant modification of body shape, mesenteric fat and viscera weight. Among qualitytraits, Vegetable diet-fed fish demonstrated a significantly lower whole body and fillet crude protein content.Yellowness value of the cooked fillet was significantly lower in the Control diet-fed fish, whereas fillet texture was similar.The results of this research showed that shi drum is a suitable candidate for Mediterranean marine aquaculture andits dietary formulation might include at least the amount of vegetable sources used in this trial.

  16. Test of Shi et al. Method to Infer the Magnetic Reconnection Geometry from Spacecraft Data: MHD Simulation with Guide Field and Antiparallel Kinetic Simulation

    Denton, R.; Sonnerup, B. U. O.; Swisdak, M.; Birn, J.; Drake, J. F.; Heese, M.

    2012-01-01

    When analyzing data from an array of spacecraft (such as Cluster or MMS) crossing a site of magnetic reconnection, it is desirable to be able to accurately determine the orientation of the reconnection site. If the reconnection is quasi-two dimensional, there are three key directions, the direction of maximum inhomogeneity (the direction across the reconnection site), the direction of the reconnecting component of the magnetic field, and the direction of rough invariance (the "out of plane" direction). Using simulated spacecraft observations of magnetic reconnection in the geomagnetic tail, we extend our previous tests of the direction-finding method developed by Shi et al. (2005) and the method to determine the structure velocity relative to the spacecraft Vstr. These methods require data from four proximate spacecraft. We add artificial noise and calibration errors to the simulation fields, and then use the perturbed gradient of the magnetic field B and perturbed time derivative dB/dt, as described by Denton et al. (2010). Three new simulations are examined: a weakly three-dimensional, i.e., quasi-two-dimensional, MHD simulation without a guide field, a quasi-two-dimensional MHD simulation with a guide field, and a two-dimensional full dynamics kinetic simulation with inherent noise so that the apparent minimum gradient was not exactly zero, even without added artificial errors. We also examined variations of the spacecraft trajectory for the kinetic simulation. The accuracy of the directions found varied depending on the simulation and spacecraft trajectory, but all the directions could be found within about 10 for all cases. Various aspects of the method were examined, including how to choose averaging intervals and the best intervals for determining the directions and velocity. For the kinetic simulation, we also investigated in detail how the errors in the inferred gradient directions from the unmodified Shi et al. method (using the unperturbed gradient

  17. Studies for the electro-magnetic calorimeter {\\em SplitCal} for the SHiP experiment at CERN with shower direction reconstruction capability

    2018-01-01

    This paper describes the basic ideas and the first simulation results of a new electro-magnetic calorimeter concept, named {\\it SplitCal}, aimed at optimising the measurement of photon direction in fixed-target experiment configuration, with high photon detection efficiency. This calorimeter was designed for the invariant mass reconstruction of axion-like particles decaying into two photons in the mass range 200~MeV to 1~GeV for the proposed proton beam dump experiment SHiP at CERN. Preliminary results indicate that angular resolutions better than obtained by past experiments can be achieved with this design. An implementation of this concept with real technologies is under study.

  18. Studies for the electro-magnetic calorimeter SplitCal for the SHiP experiment at CERN with shower direction reconstruction capability

    Bonivento, Walter M.

    2018-02-01

    This paper describes the basic ideas and the first simulation results of a new electro-magnetic calorimeter concept, named SplitCal, aimed at optimising the measurement of photon direction in fixed-target experiment configuration, with high photon detection efficiency. This calorimeter was designed for the invariant mass reconstruction of axion-like particles decaying into two photons in the mass range 200 MeV to 1 GeV for the proposed proton beam dump experiment SHiP at CERN. Preliminary results indicate that angular resolutions better than obtained by past experiments can be achieved with this design. An implementation of this concept with real technologies is under study.

  19. Measurement of parameters of scintillating bars with wavelength-shifting fibres and silicon photomultiplier readout for the SHiP Muon Detector

    Montanari, Alessandro; Baldini, Wander; Calcaterra, Alessandro; Lanfranchi, Gaia; Saputi, Alessandro; Khotyantsev, Alexey; Kudenko, Yury; Mefodev, Aleksandr; Mineev, Oleg

    2016-01-01

    The light yield and the time resolution of different types of 3 m long scintillating bars instrumented with wavelength shifting fibres and read out by different models of silicon photomultipliers have been measured at a test beam at the T9 area at the CERN Proton Synchrotron. The results obtained with different configurations are presented. A time resolution better than 800 ps, constant along the bar length within 20%, and a light yield of 140 (70) photo-electrons are obtained for bars 3 m long, 4.5 (5) cm wide and 2 (0.7) cm thick. These results nicely match the requirements for the Muon Detector of the SHiP experiment.

  20. [Non-pharmaceutical therapy of candidates for geriatric rehabilitation: Non-pharmaceutical therapy prescribed by SHI-accredited doctors after application for outpatient geriatric rehabilitative care].

    Krupp, Sonja; Schnoor, Maike; Lohse, Kristina; Katalinic, Alexander; Willkomm, Martin

    2015-06-01

    The rejection of an application for ambulant geriatric rehabilitation (AGRV) is usually justified by the argument that non-pharmaceutical therapy prescribed by doctors accredited by social housing institutions (SHI) would suffice. The reality in healthcare during the 6 months following an application is unknown. In this study 203 patients who had made an application for AGRV in the second half of 2010 in Flensburg, Lübeck or Ratzeburg were interviewed by telephone. The survey revealed that 25.7% of the applications for AGRV had been rejected. The majority of these patients received no ambulant non-pharmaceutical therapy (e.g. physical therapy, physiotherapy, occupational therapy, speech therapy or psychological therapy), less than 20% received more than 12 therapy sessions and in most cases exclusively physiotherapy. The 141 successful AGRV applicants received additional ambulant therapies of a similar magnitude. The difference between the intensified interdisciplinary therapy offered in the AGRV and additionally and the offer to rejected applicants is substantial.

  1. Optoelectronic properties of XIn{sub 2}S{sub 4} (X = Cd, Mg) thiospinels through highly accurate all-electron FP-LAPW method coupled with modified approximations

    Yousaf, Masood [Department of Physics, Ulsan National Institute of Science and Technology, Ulsan 689-798 (Korea, Republic of); Physics Department, Faculty of Science, Universiti Teknologi Malaysia, Skudai 81310, Johor (Malaysia); Dalhatu, S.A. [Physics Department, Faculty of Science, Universiti Teknologi Malaysia, Skudai 81310, Johor (Malaysia); Murtaza, G. [Department of Physics, Islamia College, Peshawar, KPK (Pakistan); Khenata, R. [Laboratoire de Physique Quantique et de Modélisation Mathématique (LPQ3M), Département de Technologie, Université de Mascara, 29000 Mascara (Algeria); Sajjad, M. [School of Electronic Engineering, Beijing University of Posts and Telecommunications, Beijing 100876 (China); Musa, A. [Physics Department, Faculty of Science, Universiti Teknologi Malaysia, Skudai 81310, Johor (Malaysia); Rahnamaye Aliabad, H.A. [Department of Physics, Hakim Sabzevari University (Iran, Islamic Republic of); Saeed, M.A., E-mail: saeed@utm.my [Physics Department, Faculty of Science, Universiti Teknologi Malaysia, Skudai 81310, Johor (Malaysia)

    2015-03-15

    Highlights: • Highly accurate all-electron FP-LAPW+lo method is used. • New physical parameters are reported, important for the fabrication of optoelectronic devices. • A comparative study that involves FP-LAPW+lo method and modified approximations. • Computed band gap values have good agreement with the experimental values. • Optoelectronic results of fundamental importance can be utilized for the fabrication of devices. - Abstract: We report the structural, electronic and optical properties of the thiospinels XIn{sub 2}S{sub 4} (X = Cd, Mg), using highly accurate all-electron full potential linearized augmented plane wave plus local orbital method. In order to calculate the exchange and correlation energies, the method is coupled with modified techniques such as GGA+U and mBJ-GGA, which yield improved results as compared to the previous studies. GGA+SOC approximation is also used for the first time on these compounds to examine the spin orbit coupling effect on the band structure. From the analysis of the structural parameters, robust character is predicted for both materials. Energy band structures profiles are fairly the same for GGA, GGA+SOC, GGA+U and mBJ-GGA, confirming the indirect and direct band gap nature of CdIn{sub 2}S{sub 4} and MgIn{sub 2}S{sub 4} materials, respectively. We report the trend of band gap results as: (mBJ-GGA) > (GGA+U) > (GGA) > (GGA+SOC). Localized regions appearing in the valence bands for CdIn{sub 2}S{sub 4} tend to split up nearly by ≈1 eV in the case of GGA+SOC. Many new physical parameters are reported that can be important for the fabrication of optoelectronic devices. Optical spectra namely, dielectric function (DF), refractive index n(ω), extinction coefficient k(ω), reflectivity R(ω), optical conductivity σ(ω), absorption coefficient α(ω) and electron loss function are discussed. Optical’s absorption edge is noted to be 1.401 and 1.782 for CdIn{sub 2}S{sub 4} and MgIn{sub 2}S{sub 4}, respectively. The

  2. Bu-Shen-Ning-Xin decoction: inhibition of osteoclastogenesis by abrogation of the RANKL-induced NFATc1 and NF-κB signaling pathways via selective estrogen receptor α

    Wang L

    2015-07-01

    Full Text Available Ling Wang,1,2,* Xue-Min Qiu,1,2,* Yu-Yan Gui,1,2 Ying-Ping Xu,1,2 Hans-Jürgen Gober,3 Da-Jin Li11Laboratory for Reproductive Immunology, Hospital and Institute of Obstetrics and Gynecology, IBS, Fudan University Shanghai Medical College, 2Shanghai Key Laboratory of Female Reproductive Endocrine Related Diseases, Shanghai, People’s Republic of China; 3Department of Pharmacy, Wagner Jauregg Hospital and Children’s Hospital, Wagner Jauregg Weg, Linz, Austria*These authors contributed equally to this workIntroduction: Bu-Shen-Ning-Xin decoction (BSNXD is a traditional Chinese medicinal composition that has been used as a remedy for postmenopausal osteoporosis, but the mechanisms affecting bone metabolism are not fully understood.Purpose: We investigated the molecular mechanism and signaling pathway underlying the effect of BSNXD on osteoclastogenesis.Materials and methods: A postmenopausal osteoporosis animal model generated by ovariectomy was administered BSNXD and drug-derived serum was prepared. An enzyme immunoassay was conducted to measure the 17-β-estradiol (E2 concentration in the drug-derived serum. Bone marrow-derived monocyte/macrophage precursor cells were treated with drug-derived serum, and tartrate-resistance acid phosphatase staining was conducted to observe osteoclastogenesis. A bone resorption assay was performed to analyze the effect on osteoclastic resorptive function. Real-time PCR, flow cytometry, Western blotting, transfection, and luciferase assays were conducted to explore the related mechanism.Results: E2 was not elevated in BSNXD-derived serum. BSNXD-derived serum suppressed receptor activation of nuclear factor κB ligand (RANKL-activated osteoclastogenesis in a dose-dependent manner; this effect could be reversed by estrogen receptor α antagonist methyl-piperidino-pyrazole. The serum suppressed RANKL-induced NF-κB transcription and inhibited the accumulation of nuclear factor of activated T-cells, cytoplasmic 1

  3. Shi Diao and the Social Enlightenment Movement in the Late Qing Dynasty%时调唱歌与清末之社会启蒙运动

    李秋菊

    2017-01-01

    流传于市井的时调艺术以其俚俗时行的特质,与清末启蒙思潮正相契合,因而被一些感时忧世的爱国文人所关注、重视并加以利用,成为开启民智、再造人心、救亡图存、改良社会的利器。启蒙者根据清末流行的时调曲调新填的曲词,已经完全跳出儿女情思、古人古事、市井俗态的窠臼,不但在题材内容、创作动机等方面呈现出新的质素,不论是感慨时政、劝戒恶俗,还是破除迷信、介绍新知,无不体现出“启蒙救亡”的特色,而且承载着救亡图存的爱国精神及强身—强种—强国、男女平等平权与维新图强的思想,因而老树发新芽,在清末社会启蒙运动中扮演着重要角色。发掘时调艺术在清末启蒙思潮中所起的积极作用,对于清末社会启蒙运动研究的推进及重新评估时调之类的民间文艺的价值不无裨益。%Because of its popularity,Shi diao 时调 (popular tune) was in line with the social enlightenment movement in the late Qing Dynasty and thus attracted attention of the patriotic intellectuals,who employed this type of popular musical and literary genre to awaken Chinese people to their patriotic mission of saving their nation from outside bullying and invasion through mental and social reforms. Different from the old themes (e.g. love stories and legends) associated with this genre,Shi diao thus created acquired a distinctive feature of pursuing social enlightenment and reforms,which were intended to eliminate superstitions and backward customs and traditions,introduce new knowledge,enhance the mental and physical quality of Chinese people, and even achieve the equality between men and women. These patriotic themes made Shi

  4. Assessment of benzene-induced hematotoxicity using a human-like hematopoietic lineage in NOD/Shi-scid/IL-2Rγnull mice.

    Masayuki Takahashi

    Full Text Available Despite recent advancements, it is still difficult to evaluate in vivo responses to toxicants in humans. Development of a system that can mimic the in vivo responses of human cells will enable more accurate health risk assessments. A surrogate human hematopoietic lineage can be established in NOD/Shi-scid/IL-2Rγ(null (NOG mice by transplanting human hematopoietic stem/progenitor cells (Hu-NOG mice. Here, we first evaluated the toxic response of human-like hematopoietic lineage in NOG mice to a representative toxic agent, benzene. Flow cytometric analysis showed that benzene caused a significant decrease in the number of human hematopoietic stem/progenitor cells in the bone marrow and the number of human leukocytes in the peripheral blood and hematopoietic organs. Next, we established chimeric mice by transplanting C57BL/6 mouse-derived bone marrow cells into NOG mice (Mo-NOG mice. A comparison of the degree of benzene-induced hematotoxicity in donor-derived hematopoietic lineage cells within Mo-NOG mice indicated that the toxic response of Hu-NOG mice reflected interspecies differences in susceptibilities to benzene. Responses to the toxic effects of benzene were greater in lymphoid cells than in myeloid cells in Mo-NOG and Hu-NOG mice. These findings suggested that Hu-NOG mice may be a powerful in vivo tool for assessing hematotoxicity in humans, while accounting for interspecies differences.

  5. Anti-hepatitis B viral activity of Phyllanthus niruri L (Phyllanthaceae ...

    Yong Li, Xin Li, Jia-Kun Wang, Yan Kuang and Ming-Xiu Qi*. Centers for Disease .... sarkosyl, 7 % 2-mercaptoethanol, 4 M guanidine ..... AK, Gane E, Hou JL, Jafri W, Jia J, Kim JH, Lai CL, Lee. HC, Lim SG, Liu CJ ... Shin MS, Kang EH, Lee YI.

  6. Retraction Note to: Ultra-High Strength and Ductile Lamellar-Structured Powder Metallurgy Binary Ti-Ta Alloys

    Liu, Yong; Xu, Shenghang; Wang, Xin; Li, Kaiyang; Liu, Bin; Wu, Hong; Tang, Huiping

    2018-05-01

    The editors and authors have retracted the article, "Ultra-High Strength and Ductile Lamellar-Structured Powder Metallurgy Binary Ti-Ta Alloys" by Yong Liu, Shenghang Xu, Xin Wang, Kaiyang Li, Bin Liu, Hong Wu, and Huiping Tang (https://doi.org/10.1007/s11837-015-1801-1).

  7. Applying dam height-storage curve to geomorphic features analysis within virtual geographic environment: a case study of the Hong-Shi-Mao watershed

    Wang, Daojun; Gong, Jianhua; Ma, Ainai; Li, Wenhang; Wang, Xijun

    2005-10-01

    There are generally two kinds of approaches to studying geomorphic features in terms of the quantification level and difference of major considerations. One is the earlier qualitative characterization, and the other is the 2-dimension measurement that includes section pattern and projection pattern. With the development of geo-information technology, especially the 3-D geo-visualization and virtual geographic environments (VGE), 3-dimension measurement and dynamic interactive between users and geo-data/geo-graphics can be developed to understand geomorphic features deeply, and to benefit to the effective applications of such features for geographic projects like dam construction. Storage-elevation curve is very useful for site selection of projects and flood dispatching in water conservancy region, but it is just a tool querying one value from the other one. In fact, storage-elevation curve can represent comprehensively the geomorphic features including vertical section, cross section of the stream and the landform nearby. In this paper, we use quadratic regression equation shaped like y = ax2 + bx + c and the DEM data of Hong-Shi-Mao watershed, Zi Chang County, ShaanXi Province, China to find out the relationship between the coefficients of the equation and the geomorphic features based on VGE platform. It's exciting that the coefficient "a" appear to be correlative strongly with the stream scale, and the coefficient "b" may give an index to the valley shape. In the end, we use a sub-basin named Hao-Jia-Gou of the watershed as an application. The result of correlative research about quadratic regression equation and geomorphic features can save computing and improve the efficiency in silt dam systems planning.

  8. Pituitary-dependent hyperadrenocorticism in a shi tzu dog treated with twice-daily oral trilostane: a case reportHyperadrenocorticismo hipófise dependente em um cão shi tzu tratado com trilostane oral a cada 12 horas: relato de caso

    Lucas Alécio Gomes

    2012-10-01

    Full Text Available Hyperadrenocorticism can be defined as a chronic high circulating cortisol, and is a relatively common disease in dogs when compared to cats. Of dogs with naturally occurring HAC, 80 to 85% have pituitary-dependent hyperadrenocorticism (PDH, which is an excessive secretion of ACTH by the pituitary, causing bilateral adrenal hyperplasia and excessive secretion of glucocorticoids. More than 90% of dogs with PDH have a pituitary tumor. The aim of this article is to report a case of a dog, seven years old, female, Shi Tzu, that presented with panting, polyuria/polydipsia, polyphagia, pendulous abdomen and bilateral abdominal alopecia, and intermittent weakness in the pelvic limbs. Based on laboratorial and screening tests a pituitary-dependent hyperadrenocorticism was diagnosed and treated with twice-daily trilostane, orally. In the early monitoring period, ACTH test was performed with an unusual interval (to 30 days. In this case, the starting dose didn’t show improvement in the cutaneous alterations, requiring an increase on the dosage. Hiperadrenocorticismo (HAC é uma doença relativamente comum em cães quando comparado aos gatos e pode ser definido como aumento persistente do cortisol na circulação sanguínea. Quanto ao tipo de manifestação o HAC hipófise-dependente ocorre em 80 a 85% dos casos, causando secreção excessiva de ACTH pela hipófise levando ao aumento bilateral das glândulas adrenais. Mais de 90% dos casos de HAC hipófise-dependente (em cães ocorrem devido a tumores na glândula. O objetivo deste trabalho é relatar o caso de uma cadela da raça Shi Tzu, com sete anos de idade, que apresentou respiração ofegante, poliúria/polidipsia, polifagia, abdome pendular, alopecia bilateral simétrica e fraqueza intermitente em membros pélvicos. Os exames laboratoriais de rotina associados aos testes de triagem confirmaram a suspeita de hiperadrenocorticismo hipófise dependente. O tratamento desde o início tem sido com

  9. Prevalence of swallowing and speech problems in daily life after chemoradiation for head and neck cancer based on cut-off scores of the patient-reported outcome measures SWAL-QOL and SHI.

    Rinkel, Rico N; Verdonck-de Leeuw, Irma M; Doornaert, Patricia; Buter, Jan; de Bree, Remco; Langendijk, Johannes A; Aaronson, Neil K; Leemans, C René

    2016-07-01

    The objective of this study is to assess swallowing and speech outcome after chemoradiation therapy for head and neck cancer, based on the patient-reported outcome measures Swallowing Quality of Life Questionnaire (SWAL-QOL) and Speech Handicap Index (SHI), both provided with cut-off scores. This is a cross-sectional study. Department of Otolaryngology/Head and Neck Surgery of a University Medical Center. Sixty patients, 6 months to 5 years after chemoradiation for head and neck squamous cell carcinoma. Swallowing Quality of Life Questionnaire (SWAL-QOL) and SHI, both validated in Dutch and provided with cut-off scores. Associations were tested between the outcome measures and independent variables (age, gender, tumor stage and site, and radiotherapy technique, time since treatment, comorbidity and food intake). Fifty-two patients returned the SWAL-QOL and 47 the SHI (response rate 87 and 78 %, respectively). Swallowing and speech problems were present in 79 and 55 %, respectively. Normal food intake was noticed in 45, 35 % had a soft diet and 20 % tube feeding. Patients with soft diet and tube feeding reported more swallowing problems compared to patients with normal oral intake. Tumor subsite was significantly associated with swallowing outcome (less problems in larynx/hypopharynx compared to oral/oropharynx). Radiation technique was significantly associated with psychosocial speech problems (less problems in patients treated with IMRT). Swallowing and (to a lesser extent) speech problems in daily life are frequently present after chemoradiation therapy for head and neck cancer. Future prospective studies will give more insight into the course of speech and swallowing problems after chemoradiation and into efficacy of new radiation techniques and swallowing and speech rehabilitation programs.

  10. Tongxinluo (Tong xin luo or Tong-xin-luo) capsule for unstable angina pectoris.

    Wu, Taixiang; Harrison, R A; Chen, Xiaoyan; Ni, Juan; Zhou, Likun; Qiao, Jieqi; Wang, Qin; Wei, Jiafu; Xin, Duan; Zheng, Jie

    2006-10-18

    Tongxinluo capsule is a medicine consisting of traditional Chinese herbs and insects used for cardiovascular diseases in China and some other Asian countries. To date the evidence of its effect has not previously been subject to systematic review, making it difficult to derive robust conclusions about its actual benefits, and indeed, possible harms. To assess systematically the effects of tongxinluo capsule in people with unstable angina pectoris. We searched the Cochrane Central Register of Controlled Trials (CENTRAL) on The Cochrane Library, Issue 4 2004, MEDLINE, EMBASE, Chinese Biomedical Database, China National Knowledge Infrastructure, Japana Centra Revuo Medicina (all 1995 to 2005). We also handsearched the relevant Chinese journals, checked with manufacturers and registers of ongoing studies. Randomised trials comparing either tongxinluo capsule only or standard treatment plus tongxinluo capsule with standard treatment or other anti-angina pectoris drugs, placebo or no intervention. Two authors identified relevant studies for the review independently and went on to abstract data, and assess trial quality. Authors of included studies were contacted to obtain further information as required. 18 short term follow-up trials involving 1413 people were included. The studies did not provide strong support of a benefit of tongxinluo for reducing the combined outcome of acute myocardial infarction, angioplasty (PTCA) coronary artery bypass graft (CABG) and sudden death or all-cause mortality (RR 0.42, 95% CI 0.07 to 2.59, P=0.35; RR 0.33, 95% CI 0.01to 7.78, P=0.49, respectively). Tongxinluo reduced the frequency of acute angina attacks (WMD -1.20, 95%CI -1.38 to -1.02, P<0.00001 and RR -2.36, 95%CI -2.53 to -2.18, P<0.00001, respectively), improved ECG (RR 1.31, 95% CI 1.08 to 1.57, P=0.005) and angina symptoms (RR 1.21, 95% CI 1.06 to 1.40; P=0.007). Tongxinluo in combination with routine angina therapy appears to reduce the risk of subsequent AMI, PTCA or CABG, angina attacks and severity, as well as improving symptoms and ischaemic changes on the electrocardiogram (ECG). Due to the methodological limitations of the studies, the evidence is insufficient to make any conclusive recommendations about the use of this treatment for patients presenting with unstable angina. Large high quality randomised controlled trials are warranted.

  11. 石氏针药结合治疗急性踝关节扭伤早期疗效研究%Clinical Observation on the Treatment of Acute Ankle Sprain by Shi's Acupuncture Therapy Combined with Compound Zijing Plaster

    李涛; 郭海玲; 杨光月; 商海滨; 赵咏芳

    2017-01-01

    目的:研究石氏针刺结合复方紫荆消伤膏外用治疗急性踝关节扭伤早期症状改善特点,评价石氏针刺结合外用膏药治疗急性踝关节扭伤、弹力绷带固定治疗和功能锻炼治疗的优效性.方法:对上海市浦东新区6家医院2014年1月至2016年10月收治的300例急性踝关节扭伤患者随机分为针药结合治疗组、弹力绷带固定组和功能锻炼组,三组受试者分别予石氏针刺结合膏药外用治疗,弹力绷带固定结合膏药治疗和功能锻炼处方结合膏药治疗.在入组时(入组)、第7天(第1周、访视一)、第28天(第4周、访视二)和第42天(第6周、访视三)采用美国足踝外科学会AOFAS踝后足评分量表、VAS疼痛评分进行优效性评价.结果:三种治疗方法对急性踝关节扭伤均有疗效(P<0.05).在第7天,针药结合组AOFAS评分与绷带固定组和功能锻炼组差异有统计学意义(P<0.05),针药结合组AOFAS评分高于绷带固定组和功能锻炼组评分.在第7天、第28天针药结合组VAS疼痛评分变化与绷带固定组和功能锻炼组差异有统计学意义(P<0.05),针药结合组VAS疼痛评分改善大于弹力绷带固定组和功能锻炼组.针药结合组AOFAS疗效评定痊愈率和VAS疼痛疗效评定痊愈率高于绷带固定组和功能锻炼组(P<0.05).结论:石氏针药结合治疗急性踝关节扭伤临床疗效明确,对损伤早期的疼痛改善和功能恢复疗效优于弹力绷带固定治疗和功能锻炼治疗.%Objective:To study the improvement characteristics of early symptoms of acute ankle sprain treated with the Shi's acupuncture therapy combined with compound Zijing plaster,and to evaluate the superiority of the Shi's therapy combined with topical plaster,elastic bandage fixation and functional exercise therapy in the treatment of acute ankle sprain.Methods:All 300 cases of acute ankle sprain patients were randomly assigned to groups of Shi's therapy

  12. Changing patient safety culture in China: a case study of an experimental Chinese hospital from a comparative perspective

    Xu XP

    2018-05-01

    Full Text Available Xiao Ping Xu,* Dong Ning Deng,* Yong Hong Gu, Chui Shan Ng, Xiao Cai, Jun Xu, Xin Shi Zhang, Dong Ge Ke, Qian Hui Yu, Chi Kuen Chan Clinical Service Department, The University of Hong Kong - Shenzhen Hospital, Shenzhen, Guangdong, People’s Republic of China *These authors contributed equally to this work Background: The World Health Organization highlights that patient safety interventions are not lacking but that the local context affects their successful implementation. Increasing attention is being paid to patient safety in Mainland China, yet few studies focus on patient safety in organizations with mixed cultures. This paper evaluates the current patient safety culture in an experimental Chinese hospital with a Hong Kong hospital management culture, and it aims to explore the application of Hong Kong’s patient safety strategies in the context of Mainland China. Methods: A quantitative survey of 307 hospital staff members was conducted using the Hospital Survey on Patient Safety Culture questionnaire. The findings were compared with a similar study on general Chinese hospitals and were appraised with reference to the Manchester Patient Safety Framework. Results: Lower scores were observed among participants with the following characteristics: males, doctors, those with more work experience, those with higher education, and those from the general practice and otolaryngology departments. However, the case study hospital achieved better scores in management expectations, actions and support for patient safety, incident reporting and communication, and teamwork within units. Its weaknesses were related to non-punitive responses to errors, teamwork across units, and staffing. Conclusions: The case study hospital contributes to a changing patient safety culture in Mainland China, yet its patient safety culture remains mostly bureaucratic. Further efforts could be made to deepen the staff’s patient safety culture mind-set, to realize a

  13. Journal of Chemical Sciences | Indian Academy of Sciences

    Home; Journals; Journal of Chemical Sciences. Hai-Liang Zhu. Articles written in Journal of Chemical Sciences. Volume 121 Issue 4 July 2009 pp 463-470. Synthesis, antimicrobial activity of lamotrigine and its ammonium derivatives · Yong Qian Peng-Cheng Lv Lei Shi Rui-Qin Fang Zhong-Cheng Song Hai-Liang Zhu.

  14. Genetic dissection of seed vigour traits in maize (Zea mays L.) under ...

    subjected to cold stress and frequently exhibit poor early- season vigour that ... Yong Shi, Guohui Li and Zhiqiang Tian contributed equally to this work. Yu82 × Shen137 is .... Other vigour-related traits within the three parental lines exhibited no ...

  15. Biological and Clinical Characterization of Novel lncRNAs Associated with Metastatic Prostate Cancer

    2014-10-01

    Matthew K. Iyer, Yang Shi, Xia Jiang, June Escara-Wilke, Rachell Brendenis, Dmitry Borkin, Anastasia K. Yocum, Dattatreya Mellacheruvu, Yuanyuan... Anastasia Yocum, Anton Poliakov, Vishal Kothari, Xiaojun Jing, Harika Gundlapalli, Xuhong Cao, Xiaoju Wang, Rohit Malik, PhD...Yuanyuan Qiao, Anton Poliakov, Anastasia K. Yocum, Yong Li, Wei Chen, Xuhong Cao, Xia Jiang, Arun Dahiya, Clair Harris, Felix Y. Feng, Sundeep Kalantry

  16. Towards the identification of alkaline phosphatase binding ligands in Li-Dan-Hua-Shi pills: A Box-Behnken design optimized affinity selection approach tandem with UHPLC-Q-TOF/MS analysis.

    Tao, Yi; Huang, Surun; Gu, Xianghui; Li, Weidong; Cai, Baochang

    2018-05-30

    Alkaline phosphatase conjugated magnetic microspheres were synthesized via amide reaction, and employed as an effective adsorbent in affinity selection of binding ligands followed by UHPLC-Q-TOF/MS analysis. The analytical validity of the developed approach was evaluated under optimized conditions and the following figures of merit were obtained: linearity, 0.01-0.5 g L -1 with good determination coefficients (R 2  = 0.9992); limits of detection (LODs), 0.003 g L -1 ; and limits of quantitation (LOQ), 0.01 g L -1 . The precision (RSD%) of the proposed affinity selection approach was studied based on intra-day (0.8%) and inter-day (1.3%) precisions. Finally, the adsorbent was successfully applied to identification of binding ligands in Li-Dan-Hua-Shi pills and good recoveries were obtained in the range from 96.9 to 99.4% (RSDs 1.6-3.0%). Copyright © 2018 Elsevier B.V. All rights reserved.

  17. Expert consensus on acute exacerbation of chronic obstructive pulmonary disease in the People's Republic of China

    Cai BQ

    2014-04-01

    Full Text Available Bai-qiang Cai,1 Shao-xi Cai,2 Rong-chang Chen,3 Li-ying Cui,4 Yu-lin Feng,5 Yu-tong Gu,6 Shao-guang Huang,7 Rong-yu Liu,8 Guang-nan Liu,9 Huan-zhong Shi,10 Yi Shi,11 Yuan-lin Song,6 Tie-ying Sun,12 Chang-zheng Wang,13 Jing-lan Wang,1 Fu-qiang Wen,5 Wei Xiao,14 Yong-jian Xu,15 Xi-xin Yan,16 Wan-zhen Yao,17 Qin Yu,18 Jing Zhang,6 Jin-ping Zheng,3 Jie Liu,6 Chun-xue Bai6 1Department of Pulmonary Medicine, Peking Union Medical College Hospital, Chinese Academy of Medical Sciences and Peking Union Medical College, Beijing, 2Southern Medical University South Hospital, Guangzhou, 3The First Affiliated Hospital of Guangzhou Medical College and Guangzhou Institute of Respiratory Diseases, Guangzhou, 4Affiliate Hospital of Inner Mongolia Medical University, Huhehaote, 5Huaxi Hospital of Sichuan University, Chendu, 6Zhongshan Hospital, Shanghai Medical College, Fudan University and Shanghai Respiratory Research Institute, Shanghai, 7Ruijing Hospital of Shanghai Jiaotong University, Shanghai, 8The First Affiliated University of Anhui Medical University, Hefei, 9The First Affiliated University of Guangxi Medical University, Nanning, 10Beijing Chao-Yang Hospital, Capital Medical University, Beijing, 11General Hospital of Nanjing Military Region, Nanjing, 12Beijing Hospital of the Ministry of Health, Beijing, 13Xinqiao Hospital, Third Military Medical University, Chongqing, 14Qilu Hospital of Shandong University, Jinan, 15Tongji Hospital, Tongji Medical College, Huazhong University of Science and Technology, Wuhan, 16The Second Affiliated Hospital of Hebei Medical University and Hebei Research Institute of Respiratory Medicine, Shijiazhuang, 17The Third Affiliated Hospital of Beijing University, Beijing, 18The First Affiliated University of Lanzhou University, Lanzhou, People's Republic of China Abstract: Chronic obstructive pulmonary disease (COPD is a common disease that severely threatens human health. Acute exacerbation of COPD (AECOPD is a major cause of

  18. Implementación de un equipo de laboratorio para la planta piloto de lácteos campus Juan Lunardi, para el análisis de la leche en tres razas de vacas (Holstein, Jersey y Criollas) de la comuna indígena de Shiña-Nabón

    Ascaribay Andrade, Saúl Geovani

    2013-01-01

    El presente trabajo de grado trata sobre la implementación de un equipo de laboratorio para el análisis comparativo de la leche entre tres razas de vacas, (Holstein, Jersey y Criollas), este análisis se lo realizo en la Asociación de Productores Agropecuarios de la comuna indígena de Shiña perteneciente al cantón Nabón provincia del Azuay, los parámetros a ser analizados están basados dentro de las normas técnicas que dicta el INEN, las normas que fueron analizadas fueron: Leche Cruda Requisi...

  19. The SHiP facility at CERN

    AUTHOR|(SzGeCERN)452451

    2016-01-01

    Searches for new physics with accelerators are being performed at the LHC, looking for high massive particles coupled to matter with ordinary strength. A new experimental facility meant to search for very weakly coupled particles in the few GeV mass domain has been recently proposed. The existence of such particles, foreseen in dierent theoretical models beyond the Standard Model, is largely unexplored from the experimental point of view. A beam dump facility, built at CERN in the north area, using 400 GeV protons is a copious factory of charmed hadrons and could be used to probe the existence of such particles. The beam dump is also an ideal source of tau neutrinos, the less known particle in the Standard Model. In particular, tau anti-neutrinos have not been directly observed so far. We report the physics potential of such an experiment and outline the performances of a detector operating at the same facility for the search for the tau --> mu mu mu decay

  20. Coaxing shy particles into an atomic jar

    Hellemans, A

    2000-01-01

    A Dutch-American team claim they can produce anti-hydrogen atoms in far greater quantities than any other current method. They use rubidium ions to trap electrons by applying a pulsed electric field in a series of steps (1 page).

  1. Do talented women shy away from competition?

    Hoyer, Britta; van Huizen, T.M.; Keijzer, L.M.; Rezaei Khavas, T.; Rosenkranz, S.; Westbrock, B.

    2016-01-01

    We study the willingness to compete in a cognitive task among an entire cohort of fresh man business and economics students. Combining data from a lab-in-thefield experiment with university admissions data, we trace the gender gap in competitiveness at different levels of high school performance.

  2. Biased Facial Expression Interpretation in Shy Children

    Kokin, Jessica; Younger, Alastair; Gosselin, Pierre; Vaillancourt, Tracy

    2016-01-01

    The relationship between shyness and the interpretations of the facial expressions of others was examined in a sample of 123 children aged 12 to 14?years. Participants viewed faces displaying happiness, fear, anger, disgust, sadness, surprise, as well as a neutral expression, presented on a computer screen. The children identified each expression…

  3. 从对电视剧《施琅大将军》的争论看 中国文化民族主义复兴的困境 (The Dilemma of Chinese Cultural Nationalism: the Case of the TV Program 'General Shi Lang'

    Mobo Gao

    2007-01-01

    Full Text Available With the rise of China's status on international stage as a result of its economic development there is an increasingly audible voice of Chinese cultural nationalism. More and more educators and intellectuals are calling for the revival of Chinese traditional culture values. However, the very issues of who are the Chinese and what are traditional Chinese cultural values present a huge dilemma. The debates on a recent a TV program "General Shi Lang" consist a good case to illustrate this dilemma. Shi Lang was a general of the last days of the Ming Dynasty, but had surrendered to the Manchu Qing dynasty invaders and fought for the Machus take over Taiwan from a Chinese ruler. The debates show that the dilemma has its cause in at least three issues. First, it is not at all obvious who should be categorized as Chinese. Secondly, it is not at all obvious what Chinese cultural values are. And finally it is the issue of evaluation of traditional values against the universal claim of the values of liberal democracy.

  4. Chemical profiling approach to evaluate the influence of traditional and simplified decoction methods on the holistic quality of Da-Huang-Xiao-Shi decoction using high-performance liquid chromatography coupled with diode-array detection and time-of-flight mass spectrometry.

    Yan, Xuemei; Zhang, Qianying; Feng, Fang

    2016-04-01

    Da-Huang-Xiao-Shi decoction, consisting of Rheum officinale Baill, Mirabilitum, Phellodendron amurense Rupr. and Gardenia jasminoides Ellis, is a traditional Chinese medicine used for the treatment of jaundice. As described in "Jin Kui Yao Lue", a traditional multistep decoction of Da-Huang-Xiao-Shi decoction was required while simplified one-step decoction was used in recent repsorts. To investigate the chemical difference between the decoctions obtained by the traditional and simplified preparations, a sensitive and reliable approach of high-performance liquid chromatography coupled with diode-array detection and electrospray ionization time-of-flight mass spectrometry was established. As a result, a total of 105 compounds were detected and identified. Analysis of the chromatogram profiles of the two decoctions showed that many compounds in the decoction of simplified preparation had changed obviously compared with those in traditional preparation. The changes of constituents would be bound to cause the differences in the therapeutic effects of the two decoctions. The present study demonstrated that certain preparation methods significantly affect the holistic quality of traditional Chinese medicines and the use of a suitable preparation method is crucial for these medicines to produce special clinical curative effect. This research results elucidated the scientific basis of traditional preparation methods in Chinese medicines. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  5. The Shi’a Crescent: A Misconception of Shi’a Alliance

    2014-12-01

    Iranian origin to Iran.33 After the Iraq-Iran War started, Saddam’s regime encouraged Iraqi men who were married to Iranian women to divorce their...region, indicating that “The Shi’a point to a pattern of negligence and poverty resulting from discriminatory practices of governments from Ottoman...decreased the authority of the sayyids, who were tribal counselors on marriages, divorces , and inheritances,26 and marked the success of the Sunni

  6. Semiconductor laser with fresh aloe shi fu and nursing therapy curative effect observation of indwelling needle phlebitis in patients with cerebral apoplexy%半导体激光联合鲜芦荟湿敷及护理治疗脑卒中患者留置针静脉炎的疗效观察

    王爱丽; 卢琦; 梅现红; 官莉

    2015-01-01

    Objective:To investigate the semiconductor laser combined fresh aloe shi fu and nursing treatment the curative effect of needle phlebitis in patients with cerebral apoplexy. Methods: 66 cases of patients with cerebral stroke with phlebitis, randomly divided into experimental group and the control group, 33 cases each. The control group was treated with fresh aloe shi fu; On the basis of the experimental group in the control group treatment using semiconduc﹣tor laser irradiation in vitro and nursing intervention in the treatment of phlebitis. On two groups before and after the treatment of phlebitis treatment efficient and subjective pain level. Results: The patients with phlebitis treatment effec﹣tive rate of 93. 94% , compared with control group effective rate was 81. 82% (P < 0. 05), the difference was statisti﹣cally significant. The experimental group patients with venous pain level compared with control group (P < 0. 05), the difference was statistically significant. Conclusion: The application of semiconductor laser with fresh aloe shi fu and nursing therapy in patients with cerebral apoplexy phlebitis, can alleviate the pain of the patients with cerebral apo﹣plexy.%探讨半导体激光照射联合鲜芦荟湿敷及护理治疗脑卒中患者留置针静脉炎的疗效。方法:将脑卒中并发静脉炎患者66例,随机分为实验组和对照组,各33例。对照组采用鲜芦荟湿敷方法治疗;实验组在对照组治疗的基础上采用半导体激光体外照射及护理干预治疗静脉炎。对两组治疗前后静脉炎治疗有效率及主观疼痛级别进行比较。结果:实验组患者静脉炎治疗有效率为93.94%,和对照组有效率81.82%相比(P<0.05),差别有统计学意义;实验组患者静脉疼痛级别和对照组相比(P<0.05),差别有统计学意义。结论:应用半导体激光照射联合鲜芦荟湿敷及护理治疗脑卒中患者静脉炎,能减轻脑卒中患者的痛苦。

  7. Shifts in the pelagic ammonia-oxidizing microbial communities along the eutrophic estuary of Yong River in Ningbo City, China

    Zhang, Qiufang; Tang, Fang-Yuan; Zhou, Yang-Jing; Xu, Jirong; Chen, Heping; Wang, Ming-Juang; Laanbroek, H.J.

    2015-01-01

    BACKGROUND: Aerobic ammonia oxidation plays a key role in the nitrogen cycle, and the diversity of the responsible microorganisms is regulated by environmental factors. Abundance and composition of ammonia-oxidizing archaea (AOA) and ammonia-oxidizing bacteria (AOB) were investigated in the surface

  8. Regional Implications of Shi’a Revival in Iraq

    2004-01-01

    From the marshes of southern Iraq to the ghettoes of Karachi, the Shi‘a have been the underdogs —oppressed and marginalized by Sunni ruling regimes and...former with “true” Is- lam—and their governments as its defenders—and branding the latter as obscurantist extremism. They dismissed Khomeini as Shi‘a... branding his vitriol against the House of Saud in the 1980s as fitna (illegitimate rebellion and sowing of disunity) against the Muslim community.7

  9. Search for heavy sterile neutrinos with SHiP

    Jacobsson, Richard

    Invited contribution to the White Paper on keV sterile neutrino Dark Matter as proceedings of the v-Dark 2015 international workshop which was held at the Institute for Advanced Study of the Technical University of Munich, Garching, Germany, 7 - 9 December 2015. White Paper will be submitted to JCAP.

  10. Iranian Influence in Iraqi Shi’a Groups

    2012-06-01

    Movement in Iraq, 254. 60 Jabar, The Shīʻite Movement in Iraq, 254. 61 Robert Fisk, The Great War For Civilisation : the Conquest of the Middle East...by Iran in 62 Fisk, The Great War For Civilisation : the Conquest of the Middle East, 647. 63 John...U.S. soldier missing in Iraq. AAH sources indicated that the group was not behind the killing but rather just mediators in the process of returning

  11. Sunni and Shi’a Terrorism: Differences that Matter

    2008-12-29

    Upon the United States (Washington, DC: St. Martin’s Press, 2004), 88‐89.  The  report’s  language  was curiously qualified when discussing the Iranian...such a tactic cannot be ruled out in the future.  84 Poland, the Czech Republic, the  Slovak  Republic...Democratic Front for the Liberation of Palestine (DFLP)*    Hamas*    Iranian Extremists/Militants – Kuwait ( label  applied by Sunni Kuwait  government

  12. Dicty_cDB: SHI783 [Dicty_cDB

    Full Text Available 34, mRNA sequence. 42 5.0 1 DV288069 |DV288069.1 NAAHW80TF Aedes aegypti - Fat Bodie...583TR Aedes aegypti - Fat Bodies Normalized (NAFFB2) Aedes aegypti cDNA clone NAAG583, mRNA sequence. 42 5.0... 1 DV284076 |DV284076.1 NAAG583TF Aedes aegypti - Fat Bodies Normalized (NAFFB2) ...Aedes aegypti cDNA clone NAAG583, mRNA sequence. 42 5.0 1 DV276964 |DV276964.1 NAAFQ66TR Aedes aegypti - Fat Bodie...AAFQ66TF Aedes aegypti - Fat Bodies Normalized (NAFFB2) Aedes aegypti cDNA clone NAAFQ66, mRNA sequence. 42

  13. Dicty_cDB: SHI292 [Dicty_cDB

    Full Text Available nt alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL157766 |pid:none) 106 4e-22 BC1384...82_1( BC138482 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 104 2e-21 (Q9JLC8) RecName: Full=Sacsi

  14. Multiple System Atrophy with Orthostatic Hypotension (Shy-Drager Syndrome)

    ... the onset of symptoms. A problem with the respiratory system is the most common cause of death. x ... the onset of symptoms. A problem with the respiratory system is the most common cause of death. View ...

  15. Dicty_cDB: SHI734 [Dicty_cDB

    Full Text Available ESIWYDYWLDNGYFSPEKQMEIQPHVVKDKKFVIVIPPPNVTGSLHLGHALTNSIQDAVV RYHRMKG*slfmgtryrscrycnts...KQEAEEKIVREHIEKILKTPKGEKKDVSSLLSSYHPTAV ESIWYDYWLDNGYFSPEKQMEIQPHVVKDKKFVIVIPPPNVTGSLHLGHALTNSIQDAVV RYHRMKG*slfmgtryrscrycnts

  16. Once hurt, twice shy: Social pain contributes to social anxiety.

    Fung, Klint; Alden, Lynn E

    2017-03-01

    Social rejection has been consistently linked to the development of social anxiety. However, mechanisms underlying the relation have been largely unexplored, which presents an obstacle to fully understanding the origins of social anxiety and to the development of effective prevention and treatment strategies. Two studies were conducted to test the hypothesis that the emotion of social pain following rejection promotes the development of social anxiety in subsequent situations. In Study 1, undergraduate participants were exposed to 2 social situations (Cyberball) 2 days apart. Participants who were rejected in the first situation reported higher social anxiety before and during the second situation relative to those who were included. This effect was fully mediated by initial social pain intensity. In Study 2, all participants were initially rejected. Using double-blinded drug administration, participants were randomly assigned to ingest acetaminophen to alleviate the social pain from rejection, or a sugar placebo. As predicted, the acetaminophen group reported lower social anxiety before and during the second situation. Approximately half of the effect was mediated by reduction in social pain. Notably, the immediate effect of acetaminophen was specific to social pain rather than social anxiety. Results were discussed in the context of literature on the etiology of social anxiety and social pain. Future directions were suggested. (PsycINFO Database Record (c) 2017 APA, all rights reserved).

  17. Dicty_cDB: SHI133 [Dicty_cDB

    Full Text Available 044130 |CR044130.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering ...Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering clone MHPP47e19. 50... 0.068 1 CR034434 |CR034434.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering...ion targeting and chromosome engineering clone MHPP142o16. 50 0.068 1 BX990136 |B...X990136.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering clone MHP

  18. Dicty_cDB: SHI542 [Dicty_cDB

    Full Text Available . 42 8.2 1 CR129751 |CR129751.1 Reverse strand read from insert in 5'HPRT insertion targeting and chromosome engineering...ion targeting and chromosome engineering clone MHPN147m24. 42 8.2 1 CR010531 |CR010531.1 Reverse strand read... from insert in 5'HPRT insertion targeting and chromosome engineering clone MHPN2...17j13. 42 8.2 1 CR103480 |CR103480.1 Reverse strand read from insert in 5'HPRT insertion targeting and chromosome engineering

  19. SHI induced damage in electrical properties of silicon NPN BJTs

    Kumar, M. Vinay, E-mail: vkm288@gmail.com; Krishnaveni, S. [Department of studies in Physics, University of Mysore, Mysore (India); Kumar, Santhosh [Department of Physics, Regional Institute of Education, Mysore (India); Yashoda, T. [Department of Physics, AVK College for Women, Hassan (India)

    2016-05-23

    The investigation of radiation damage in Si microelectronic circuitry and devices are being carried out by various research groups globally. In particular the Si Bipolar junction transistors are very sensitive to high energetic radiation. In the present study, radiation response of NPN Bipolar junction transistor (2N3773) has been examined for 60 MeV B{sup 4+} ion. Key electrical properties like Gummel, dc current gain and capacitance – voltage (C-V) characteristics of 60 MeV B{sup 4+} ion irradiated transistor were studied before and after irradiation. Ion irradiation and subsequent electrical characterizations were performed at room temperature. Current voltage (I-V) measurements showed the increase in collector current for V{sub BE} ≤ 0.4 V as a function of fluence, which is due to B{sup 4+} ion induced surface leakage currents. Base current is observed to be more sensitive than collector current and gain appears to be degraded with ion fluence. Also, C-V measurements shows that both built in potential and doping concentration increased significantly after irradiation.

  20. Xin et al., Afr J Tradit Complement Altern Med. (2015) 12(6):39-70 ...

    Proff.Adewunmi

    ... consisting of 6 spreading tepals, 3 distinct stamens, a style with a tripartite stigma, and an ...... More recently, Japanese scholars reported that one of the mechanisms of the ...... traditionally used for the management of menopausal symptoms.

  1. Heterologous Expression of Aspergillus Niger --beta--D-Xylosidase (XInD): Characterization on Lignocellulosic Substrates

    Selig, M. J.; Knoshaug, E. P.; Decker, S. R.; Baker, J. O.; Himmel, M. E.; Adney, W. S.

    2008-01-01

    The gene encoding a glycosyl hydrolase family 3 xylan 1,4-beta-xylosidase, xlnD, was successfully cloned from Aspergillus niger strain ATCC 10864. The recombinant product was expressed in Aspergillus awamori, purified by column chromatography, and verified by matrix-assisted laser desorption ionization, tandem time of flight (MALDI-TOF/TOF) mass spectroscopy of tryptic digests. The T{sub max} was determined using differential scanning microcalorimetry (DSC) to be 78.2 C; the K{sub m} and k{sub cat} were found to be 255 {micro}M and 13.7 s{sup -1}, respectively, using {rho}NP-{Beta}-d-xylopyranoside as substrate. End-product inhibition by d-xylose was also verified and shown to be competitive; the K{sub i} for this inhibition was estimated to be 3.3 mM. XlnD was shown to efficiently hydrolyze small xylo-oligomers to monomeric xylose, making it a critical hydrolytic activity in cases where xylose is to be recovered from biomass conversion processes. In addition, the presence of the XlnD was shown to synergistically enhance the ability of an endoxylanase, XynA from Thermomyces lanuginosus, to convert xylan present in selected pretreated lignocellulosic substrates. Furthermore, the addition of the XynA/XlnD complex was effective in enhancing the ability of a simplified cellulase complex to convert glucan present in the substrates.

  2. Parameter identification and global sensitivity analysis of Xin'anjiang model using meta-modeling approach

    Xiao-meng Song

    2013-01-01

    Full Text Available Parameter identification, model calibration, and uncertainty quantification are important steps in the model-building process, and are necessary for obtaining credible results and valuable information. Sensitivity analysis of hydrological model is a key step in model uncertainty quantification, which can identify the dominant parameters, reduce the model calibration uncertainty, and enhance the model optimization efficiency. There are, however, some shortcomings in classical approaches, including the long duration of time and high computation cost required to quantitatively assess the sensitivity of a multiple-parameter hydrological model. For this reason, a two-step statistical evaluation framework using global techniques is presented. It is based on (1 a screening method (Morris for qualitative ranking of parameters, and (2 a variance-based method integrated with a meta-model for quantitative sensitivity analysis, i.e., the Sobol method integrated with the response surface model (RSMSobol. First, the Morris screening method was used to qualitatively identify the parameters' sensitivity, and then ten parameters were selected to quantify the sensitivity indices. Subsequently, the RSMSobol method was used to quantify the sensitivity, i.e., the first-order and total sensitivity indices based on the response surface model (RSM were calculated. The RSMSobol method can not only quantify the sensitivity, but also reduce the computational cost, with good accuracy compared to the classical approaches. This approach will be effective and reliable in the global sensitivity analysis of a complex large-scale distributed hydrological model.

  3. Cardioprotective effects of Dan-Yang-Fu-Xin decoction on chronic ...

    Tropical Journal of Pharmaceutical Research May 2016; 15 (5): 945-950 ... After intragastric administration for 8 weeks, several functional cardiac ... include the suppression of expression of inflammatory mediators and myocardial enzymes.

  4. Effects of tMa-Xin-Di-Tan decoction on ovalbumin-induced allergic ...

    box expressed in T cells (T-bet) levels were determined in lung tissues by western blot analysis. Results: MXDT ... airway inflammation, airway hyperreactivity, shortness of breath, and ..... polysaccharide on activation of mast cells. Evid Based.

  5. Investigating AAK1-and GAK-Regulated Virus-Host Interactions Uncovers Broad-Spectrum Antivirals

    2017-02-16

    AP1) and AP2M1 (AP2) were 527 selected from the Human ORFeome library of cDNA clones (65) (Open Biosystems) and 528 recombined into either pCherry...TSV01 Renilla reporter plasmid was a gift from Pei-Yong Shi (68). 534 Lentiviral constructs used for AP2 overexpression were cloned into the pRRLSIN...681 total of 10 days and observed daily for 28 days for lethality or clinical signs of disease. 682 683 Animal study approval/ Ethics Statement

  6. Type I enteropathy-associated T-cell lymphoma in the colon of a 29-year-old patient and a brief literature review

    Zhang JC

    2016-02-01

    Full Text Available Jiu-Cong Zhang, Yong Wang, Xiu-Feng Wang, Fang-Xin Zhang Department of Gastroenterology, Lanzhou General Hospital of Lanzhou Military Command, Lanzhou, People’s Republic of China Abstract: Enteropathy-associated T-cell lymphoma (EATL is a rare gastrointestinal non-Hodgkin’s lymphoma, originating from intraepithelial T-lymphocyte, which is specifically associated with celiac disease. EATL most commonly presents in the sixth and seventh decades of life. We report a unique case of type I EATL in the colon with liver metastasis, which was presented with nonspecific radiological findings and at a very young age (29 years old compared with previously published data. We suggest that EATL should be regarded as part of differential diagnosis in any patient presenting with abdominal pain, diarrhea, weight loss, and malabsorption because delay in treatment can result in an irreversible clinical outcome. Keywords: enteropathy-associated T-cell lymphoma, colon, ulcer, liver metastasis

  7. Prediction study of structural, electronic and optical properties of XIn2S4 (X = Hg, Zn) thiospinels under pressure effect

    Yousaf, Masood; Inam, F.; Khenata, R.; Murtaza, G.; Isa, A.R.M.; Saeed, M.A.

    2014-01-01

    Highlights: • Pressure effect is employed for the first time on HgIn 2 S 4 and ZnIn 2 S 4 thiospinels. • A number of physical parameters are calculated and equations are developed. • FP-LAPW+lo method is coupled with different approximations (GGA+U and mBJ-GGA). • Relationships between pressure and parameters are in accordance with the theory. • Computed band gap values have good agreement with the experimental values. -- Abstract: First principle calculations are carried out to study the effect of pressure (up to 30 GPa) on physical properties of HgIn 2 S 4 and ZnIn 2 S 4 thiospinels. A number of structural, electronic and optical parameters are calculated, and equations are developed for their prediction at different pressures. Highly effective all electron FP-LAPW+lo method coupled with two different approximations (GGA+U and mBJ-GGA) provides very accurate results. All relationships developed between pressure and structural parameters are in full accordance with the established theory thus validating the approach used in the current study. Computed In–S bond length for ZnIn 2 S 4 matches closely with the experimental value. The band gap values of 0.920 eV (1.851 eV) and 1.68 eV (2.733 eV) are obtained with GGA+U (mBJ-GGA) at 0 GPa for HgIn 2 S 4 and ZnIn 2 S 4 , respectively. Additionally, we have calculated the optical properties, namely, the complex dielectric function, refractive index, extinction coefficient, reflectivity, optical conductivity, absorption coefficient and electron energy loss function under pressure effect for radiation up to 30.0 eV. The first critical point also known as optical’s absorption edge calculated with GGA+U (mBJ-GGA) appears at 0.939 eV (1.891 eV) and 1.701 eV (2.981 eV) for HgIn 2 S 4 and ZnIn 2 S 4 , respectively. Variation of the absorption spectrum indicates the prospective use of both compounds for device applications, which can be operated on a wide range of the energy scale. The entire work gives useful results of fundamental importance, which can be utilized for the fabrication of optoelectronic devices

  8. The satisfaction level of indigenous people towards planned housing development. Case study: Orang Asli Kg. Sejagong, Sri Medan, Yong Peng Johor

    Kamaruddin, S. M.; Zaini, N. S.; Misni, A.; Ahmad, P.

    2018-02-01

    Orang Asli possesses a unique relationship with their traditional land. Indigenous people have their thoughts on development, life values, visions, needs, and priorities. The government through Department of Orang Asli Development or Jabatan Kebajikan Orang Asli (JAKOA) implemented various development programs such as structured settlement program, physical improvements such as Regrouping Plan (RPS), Village Restructuring project (PSK), New Village Plan (RKB) and Orang Asli settlement customary Land Survey (village) / Land Acquisition. Orang Asli Community. However, their sense of satisfaction towards the development implemented is rarely evaluated. This paper aims to highlight Orang Asli’s thoughts and level of satisfaction towards the planned housing development of their settlement. A mixed methodology was employed using survey and interview to record their thoughts. The findings suggest that the Orang Asli Community’s sense of satisfaction towards housing development has improved. However, their needs to adhere to their social traditions and norms such as living adjacent to relatives, surrounded by nature within a low-density environment must be respected.

  9. Regional new energy vision formulated for Murakami City; 2001 nendo Murakami shi chiiki shin energy vision sakutei tou jigyo. Murakami shi shin energy puran

    NONE

    2002-03-01

    For promoting the introduction of new energy and for enhancing people's consciousness of such at Murakami City, Niigata Prefecture, surveys and studies were conducted involving energy consumption in the town, the amount of new energy resources in existence, and new energy introduction projects, and a vision was formulated. The annual energy consumption of the city is estimated at 78,000 kL in terms of oil. The residential/commercial sector consumes 24,000 kL, the industrial sector 28,000 kL, and the transportation sector 26,000 kL, with the three sectors demanding similar amounts. The carbon dioxide emitted by the sectors is estimated at 223,000 t-CO2/year. New energy introduction projects were discussed, which included hot water supply, heating, road heating, and power generation, all these utilizing heat from the Senami hot spa; biogas fueled power generation and BDF (bio-diesel) bus operation in the Senami hot spa district; the introduction of a hybrid wind power/photovoltaic power generation system into Ogata Seaside Park; the introduction of a mini-scale hydroelectric power generation system into the Kamikaifu district; a large-scale wind power generation business at the Iwafune district; the introduction of wind power and photovoltaic power generation facilities into primary and junior high schools; the use of clean energy vehicles for official use; and so forth. (NEDO)

  10. Study on Climate and Grassland Fire in HulunBuir, Inner Mongolia Autonomous Region, China

    Meifang Liu

    2017-03-01

    distributed in Xin Barag Youqi, Xin Barag Zuoqi, Zalantun Shi, Oroqen Zizhiqi, and Molidawa Zizhiqi; the zones with medium fire climate index are mainly distributed in Chen Barag Qi, Ewenkizu Zizhiqi, Manzhouli Shi, and Arun Qi; and the zones with lower fire climate index are mainly distributed in Genhe Shi, Ergun city, Yakeshi Shi, and Hailar Shi. The results of this study will contribute to the quantitative assessment and management of early warning and forecasting for mid-to long-term grassland fire risk in HulunBuir.

  11. On-call x-rays made easy AN Au-Yong On-call x-rays made easy , Amy Au-Yong and Nigel Broderick Churchill Livingstone Elsevier £21.99 304pp 9780702034459 0702034452 [Formula: see text].

    2011-02-10

    DesigneD for clinicians involved in the management of acutely ill patients, this book enables them to recognise quickly the appearance of life-threatening conditions. It also concentrates on the interpretation of plain chest and abdominal images.

  12. ACCORDING TO HWC ON TURKISH WORDS ADOPTED FROM CHINE LANGUAGE / HANYU WAILAICI CIDIAN’a (HWC GÖRE ÇİNCEYE GEÇEN TÜRKÇE KELİMELER ÜZERİNE

    Prof. Dr. Alimcan İNAYET

    2008-02-01

    Full Text Available Today, there exist thousands of loan words in Chinese language. Chinese linguists -Liu Zheng-yan, Gao Ming-kai, Mai Yong-qian and Shi You-wei- have determined ten thousand loan-words (with the different versions of the same word adopted by Chinese from various languages and published them in “A Dictionary of Loan Words and Hybrid Words in Chinese” in 1984. Among the considered words of this dictionary, there are also hundreds of words which were directly and indirectly adopted from Turkish language and Turkic dialects in various eras. Additionally, some of them are still be in use in Chinese language today. In this article, we have listed those Turkish words determined in this dictionary with the necessary explanations attached.

  13. Analysis of the Chinese martial periodicals edited during the Republican Era

    William Acevedo

    2012-07-01

    Full Text Available The present article studies the periodicals and magazines published during the Chinese Republican period (1912-1949. The main sources for this work are the index and thirty volumes of the Republican Era Collection of National Arts Periodicals (Mingguo Guoshu Qi Kan Wenxian Jicheng, edited by Shi Yong Xing in 2008. Besides basic data about the 45 publications included in the collection such as title, editor, publication information and period of existence; this article emphasises the historical context in which these publications appeared as well as their efforts to help China becoming a nation recognized at the world stage. As an example of the wealth of information contained in these periodicals regarding Chinese martial arts, we have analyzed the terminology that was used to define them, the publications’ contribution to exalt nationalism up to their influence in strengthening of China’s citizens and military.

  14. Status and physics of the SHiP experiment at CERN

    Buonaura, Annarita

    2017-01-01

    SHIP is a new general purpose fixed target facility, whose Technical Proposal has been recently reviewed by the CERN SPS Committee and by the CERN Research Board. The two boards recommended that the experiment proceeds further to a Comprehensive Design phase in the context of the new CERN Working group "Physics Beyond Colliders", aiming at presenting a CERN strategy for the European Strategy meeting of 2019. In its initial phase, the 400GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating $2 \\times 10^{20}$ pot in 5 years. A dedicated detector, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below O(10) GeV /c$^{2}$. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutrinos. The sensitivity to Heavy Neutrinos will allow for the first time...

  15. New energy vision of the Gotsu city area; 2001 nendo Gotsu shi chiiki shin energy vision

    NONE

    2002-02-01

    For the purpose of promoting the introduction of new energy and enhancing the awareness of it in Gotsu City, Shimane Prefecture, an investigational study was conducted of the energy consumption amount of the city, existence amount of new energy, project for new energy introduction, etc., and a new energy vision was worked out. The energy consumption amount of the city was estimated at 1,558,022 Gcal. By sector, the energy consumption amount consisted of 80.0% in the industrial sector, 11.2% of in the transportation sector, 5.8% in the residential sector and 3.0% in the business sector. In the industrial sector, the main energy consumption industries were the paper manufacturing industry and tile industry. As the project for new energy introduction, the following were studied: project for the wind farm where a lot of wind power generators are installed; park as a symbol having 1 or 2 wind power generators; introduction of solar energy use water warmer/photovoltaic power generation to public facilities; system for promotion of the introduction of solar energy use water warmer/photovoltaic power generation to households; project on CO2 reduction by installation of LNG station; refuse/waste power generation project; project on utilization of the waste heat from tile makers. (NEDO)

  16. Do Women Shy Away From Competition? Do Men Compete Too Much?

    Muriel Niederle; Lise Vesterlund

    2005-01-01

    Competitive high ranking positions are largely occupied by men, and women remain scarce in engineering and sciences. Explanations for these occupational differences focus on discrimination and preferences for work hours and field of study. We examine if absent these factors gender differences in occupations may still occur. Specifically we explore whether women and men, on a leveled playing field, differ in their selection into competitive environments. Men and women in a laboratory experimen...

  17. Learning from the Stones: A Go Approach to Mastering China's Strategic Concept, Shi

    Lai, David

    2004-01-01

    .... It is through learning the Chinese board game called go. This game is a living reflection of Chinese philosophy, culture, strategic thinking, warfare, military tactics, and diplomatic bargaining...

  18. The beam test of muon detector parameters for the SHiP experiment at CERN

    Likhacheva, V. L.; Kudenko, Yu. G.; Mefodiev, A. V.; Mineev, O. V.; Khotyantsev, A. N.

    2018-01-01

    Scintillation detectors based on extruded plastics have been tested in a 10 GeV/c beam at CERN. The scintillation signal readout was provided using optical wavelength shifting fibers Y11 Kuraray and Hamamatsu MPPC micropixel avalanche photodiodes. The light yield was scanned along and across the detectors. Time resolution was found by fitting the MPPC digitized pulse rise and other methods.

  19. A Facility to Search for Hidden Particles (SHiP) at the CERN SPS

    Anelli, M.; Arduini, G.; Back, J.J.; Bagulya, A.; Baldini, W.; Baranov, A.; Barker, G.J.; Barsuk, S.; Battistin, M.; Bauche, J.; Bay, A.; Bayliss, V.; Bellagamba, L.; Bencivenni, G.; Bertani, M.; Bezshyyko, O.; Bick, D.; Bingefors, N.; Blondel, A.; Bogomilov, M.; Boyarsky, A.; Bonacorsi, D.; Bondarenko, D.; Bonivento, W.; Borburgh, J.; Bradshaw, T.; Brenner, R.; Breton, D.; Brook, N.; Bruschi, M.; Buonaura, A.; Buontempo, S.; Cadeddu, S.; Calcaterra, A.; Calviani, M.; Campanelli, M.; Capoccia, C.; Cecchetti, A.; Chatterjee, A.; Chauveau, J.; Chepurnov, A.; Chernyavskiy, M.; Ciambrone, P.; Cicalo, C.; Conti, G.; Cornelis, K.; Courthold, M.; Dallavalle, M.G.; D'Ambrosio, N.; De Lellis, G.; De Serio, M.; Dedenko, L.; Di Crescenzo, A.; Di Marco, N.; Dib, C.; Dietrich, J.; Dijkstra, H.; Domenici, D.; Donskov, S.; Druzhkin, D.; Ebert, J.; Egede, U.; Egorov, A.; Egorychev, V.; Alaoui, M. A. El; Enik, T.; Etenko, A.; Fabbri, F.; Fabbri, L.; Fedorova, G.; Felici, G.; Ferro-Luzzi, M.; Fini, R.A.; Franke, M.; Fraser, M.; Galati, G.; Giacobbe, B.; Goddard, B.; Golinka-Bezshyyko, L.; Golubkov, D.; Golutvin, A.; Gorbunov, D.; Graverini, E.; Grenard, J-L; Guler, A.M.; Hagner, C.; Hakobyan, H.; Helo, J.C.; van Herwijnen, E.; Horvath, D.; Iacovacci, M.; Iaselli, G.; Jacobsson, R.; Kadenko, I.; Kamiscioglu, M.; Kamiscioglu, C.; Khaustov, G.; Khotjansev, A.; Kilminster, B.; Kim, V.; Kitagawa, N.; Kodama, K.; Kolesnikov, A.; Kolev, D.; Komatsu, M.; Konovalova, N.; Koretskiy, S.; Korolko, I.; Korzenev, A.; Kovalenko, S.; Kudenko, Y.; Kuznetsova, E.; Lacker, H.; Lai, A.; Lanfranchi, G.; Lauria, A.; Lebbolo, H.; Levy, J. -M.; Lista, L.; Loverre, P.; Lukiashin, A.; Lyubovitskij, V.E.; Malinin, A.; Manfredi, M.; Perillo-Marcone, A.; Marrone, A.; Matev, R.; Messomo, E.N.; Mermod, P.; Mikado, S.; Mikhaylov, Yu.; Miller, J.; Milstead, D.; Mineev, O.; Mingazheva, R.; Mitselmakher, G.; Miyanishi, M.; Monacelli, P.; Montanari, A.; Montesi, M.C.; Morello, G.; Morishima, K.; Movtchan, S.; Murzin, V.; Naganawa, N.; Naka, T.; Nakamura, M.; Nakano, T.; Nurakhov, N.; Obinyakov, B.; Ocalan, K.; Ogawa, S.; Oreshkin, V.; Orlov, A.; Osborne, J.; Pacholek, P.; Panman, J.; Paoloni, A.; Paparella, L.; Pastore, A.; Patel, M.; Petridis, K.; Petrushin, M.; Poli-Lener, M.; Polukhina, N.; Polyakov, V.; Prokudin, M.; Puddu, G.; Pupilli, F.; Rademakers, F.; Rakai, A.; Rawlings, T.; Redi, F.; Ricciardi, S.; Rinaldesi, R.; Roganova, T.; Rogozhnikov, A.; Rokujo, H.; Romaniouk, A.; Rosa, G.; Rostovtseva, I.; Rovelli, T.; Ruchayskiy, O.; Ruf, T.; Saitta, G.; Samoylenko, V.; Samsonov, V.; Ull, A. Sanz; Saputi, A.; Sato, O.; Schmidt-Parzefall, W.; Serra, N.; Sgobba, S.; Shaposhnikov, M.; Shatalov, P.; Shaykhiev, A.; Shchutska, L.; Shevchenko, V.; Shibuya, H.; Shitov, Y.; Silverstein, S.; Simone, S.; Skorokhvatov, M.; Smirnov, S.; Solodko, E.; Sosnovtsev, V.; Spighi, R.; Spinetti, M.; Starkov, N.; Storaci, B.; Strabel, C.; Strolin, P.; Takahashi, S.; Teterin, P.; Tioukov, V.; Tommasini, D.; Treille, D.; Tsenov, R.; Tshchedrina, T.; Ustyuzhanin, A.; Vannucci, F.; Venturi, V.; Villa, M.; Vincke, Heinz; Vincke, Helmut; Vladymyrov, M.; Xella, S.; Yalvac, M.; Yershov, N.; Yilmaz, D.; Yilmazer, A.U.; Vankova-Kirilova, G.; Zaitsev, Y.; Zoccoli, A.; CERN. Geneva. SPS and PS Experiments Committee; SPSC

    2015-01-01

    A new general purpose fixed target facility is proposed at the CERN SPS accelerator which is aimed at exploring the domain of hidden particles and make measurements with tau neutrinos. Hidden particles are predicted by a large number of models beyond the Standard Model. The high intensity of the SPS 400~GeV beam allows probing a wide variety of models containing light long-lived exotic particles with masses below ${\\cal O}$(10)~GeV/c$^2$, including very weakly interacting low-energy SUSY states. The experimental programme of the proposed facility is capable of being extended in the future, e.g. to include direct searches for Dark Matter and Lepton Flavour Violation. The facility will be serviced by a new dedicated beam line branched off the splitter section on the North Area. It is followed by a new target station and a magnetic shield to suppress beam induced background. The proposed orientation of the beam line and the underground complex allows reserving more than 100~m of space beyond the experiment...

  20. Development of a Summarized Health Index (SHI) for Use in Predicting Survival in Sea Turtles

    Li, Tsung-Hsien; Chang, Chao-Chin; Cheng, I-Jiunn; Lin, Suen-Chuain

    2015-01-01

    Veterinary care plays an influential role in sea turtle rehabilitation, especially in endangered species. Physiological characteristics, hematological and plasma biochemistry profiles, are useful references for clinical management in animals, especially when animals are during the convalescence period. In this study, these factors associated with sea turtle surviving were analyzed. The blood samples were collected when sea turtles remained alive, and then animals were followed up for surviving status. The results indicated that significantly negative correlation was found between buoyancy disorders (BD) and sea turtle surviving (p turtles had significantly higher levels of aspartate aminotranspherase (AST), creatinine kinase (CK), creatinine and uric acid (UA) than surviving sea turtles (all p turtles and to improve veterinary care at rehabilitation facilities. PMID:25803431

  1. Shy Children Are Less Sensitive to Some Cues to Facial Recognition

    Brunet, Paul M.; Mondloch, Catherine J.; Schmidt, Louis A.

    2010-01-01

    Temperamental shyness in children is characterized by avoidance of faces and eye contact, beginning in infancy. We conducted two studies to determine whether temperamental shyness was associated with deficits in sensitivity to some cues to facial identity. In Study 1, 40 typically developing 10-year-old children made same/different judgments about…

  2. SI-SHY: Dysregulated Fear in Toddlerhood Predicts Kindergarten Social Withdrawal through Protective Parenting.

    Kiel, Elizabeth J; Buss, Kristin A

    2014-05-01

    Two recent advances in the study of fearful temperament (behavioral inhibition) include the validation of dysregulated fear as a temperamental construct that more specifically predicts later social withdrawal and anxiety, and the use of conceptual and statistical models that place parenting as a mechanism of development from temperament to these outcomes. The current study further advances these areas by examining whether protective parenting mediated the relation between dysregulated fear in toddlerhood and social withdrawal in kindergarten. Participants included 93 toddlers and their mothers, who engaged in laboratory tasks assessing traditional fearful temperament, dysregulated fear, and protective parenting. When children reached kindergarten, they returned to the laboratory for a multimethod assessment of social withdrawal. Results confirmed the hypothesis that dysregulated fear predicted social withdrawal through protective parenting, and this occurred above and beyond the effect of traditional fearful temperament. These findings bolster support for the use of dysregulated fear as a temperamental construct related to, but perhaps more discerning of risk than traditionally measured fearful temperament/behavioral inhibition and highlight the importance of transactional influences between the individual and the caregiving environment in the development of social withdrawal.

  3. Internet communication: an activity that appeals to shy and socially phobic people?

    Madell, Dominic; Muncer, Steven

    2006-10-01

    Shyness (or social anxiety) and social phobia can be viewed as two distinct conditions, and this study investigates whether they are related to use of the Internet generally, and for communication purposes. 362 participants from two schools, a college and a university in the Teesside area in England were asked to complete Mattick and Clarke's (1998) Social Phobia (SPS) and Social Interaction Anxiety (SIAS) scales and also answer a questionnaire which asked them about their use of the Internet generally and for communication purposes. The findings from these suggested that social anxiety and social phobia are not highly associated with use of the Internet either in general, or for communication purposes, although minor associations with certain aspects of Internet use are discussed.

  4. Institucional'naja podgotovka Pol'shi k vstupleniju v Evropejskij sojuz

    Tomaszewski W.

    2015-05-01

    Full Text Available In May 2014 it was aready ten years since Poland’s accession to the European Union. The accession was preceded by a long period of political action and negotiations between the Polish and the EU institutions. The process of integration was extremely complex. It covered almost all areas of economic, legal and civil aspects of the aspiring country’s economy, in which all necessary requirements had to be met. The aim of the article was to present the institutional framework created for efficient implementation of the process of accession. The considerations involved especially an institutional method. The research resulted in poining out both the actually efficient and less efficient bodies participating in the process of integration.

  5. Status and physics of the SHiP experiment at CERN

    Buonaura, Annarita

    2018-01-01

    SHIP is a new general purpose fixed target facility, whose Technical Proposal has been recently reviewed by the CERN SPS Committee and by the CERN Research Board. The two boards recommended that the experiment proceeds further to a Comprehensive Design phase in the context of the new CERN Working group "Physics Beyond Colliders", aiming at presenting a CERN strategy for the European Strategy meeting of 2019. In its initial phase, the 400GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating $2 \\times 10^{20}$ pot in 5 years. A dedicated detector, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below O(10) GeV /c$^{2}$. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutrinos. The sensitivity to Heavy Neutrinos will allow for the first time...

  6. Shi et al., Afr J Tradit Complement Altern Med. (2015) 12(6):169-179 ...

    Proff.Adewunmi

    ... indicating that ethyl acetate extracts of TA leaves are efficacious in attenuating oxidative stress in the liver of ... Antioxidant and antibacterial activities of polyphenolic compounds from bitter cumin (Cuminum .... functions and human disease.

  7. On dendrocincla tyrannina: Morphology, behavior and conservation of a shy lek-type insectivore

    Willis Edwin O.

    1995-11-01

    Full Text Available El trepatroncos tiranino o "churulo" (Dendrocincla tyrannina, Dendrocolaptidae de los bosques de neblina del norte de los Andes es solitario, como las otras especies del género. Se desplaza en el sotobosque lleno de epífitas, dependiendo parcialmente de los insectos que huyen de los escasos ejércitos de hormigas. Es un ave silenciosa y arisca, que se esconde después de volar cortas distancias en busca de presas, o procurándolas en musgos o troncos. La pérdida de los bosques húmedos andinos de laderas abruptas para dar lugar a la ganadería de baja productividad amenaza a la especie y aumenta el peligro de derrumbes en áreas sujetos a temblores; el uso más apropiado para tales áreas es para estudios científicos y actividades turísticas, y no para asentamientos permanentesThe Tyrannine Woodcreeper (Dendrocincla tyrannina, Dendrocolaptidae of northern Andean cloud forests is solitary, like the rest of the genus, and wanders in the epiphyte-laden forest understory, depending partly on hard-to-find swarms of army ants and on understory flocks to flush insects. It is wary and silent, hiding after flying short distan ces for prey or gleaning it from moss or trunks. As los s of sleep Andean wet forests where the woodcreepers live resulls in gretaer danger from earthquakes, study and tourism are preferable to settlements.

  8. The SHiP experiment and its detector for neutrino physics

    Buonaura, Annarita

    2016-01-01

    SHIP is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In its initial phase the 400GeV proton beam will be dumped on a heavy target with the aim of integrating $2 \\times 10^{20}$ pot in 5 years. A detector downstream of the target will allow to search long-lived exotic particles with masses below O(10) GeV/c2 forseen in extension of the Standard Model. Another dedicated detector, that will be the focus of this talk, will allow to study active neutrino cross- sections and angular distributions. The neutrino detector consists of an emulsion target, based on the Emulsion Cloud Chamber technology fruitfully employed in the OPERA experiment. The Emulsion Cloud Chamber will be placed in a magnetic field, with the so-called Compact Emulsion spectrometer, a few cm thick chamber for the charge and momentum measurement of hadrons. This will provide the leptonic number measurement also in the hadronic tau decay channels. The detector will be hybrid, using nuclear emulsions and electr...

  9. SHI induced defects in chemically synthesized graphene oxide for hydrogen storage applications

    Sharma, Preetam K., E-mail: preetam.nano@gmail.com; Sharma, Vinay; Rajaura, Rajveer Singh; Singh, M. [Department of Physics, University of Rajasthan, Jaipur-302004, India. (India); Srivastava, Subodh; Vijay, Y. K. [Department of Physics, University of Rajasthan, Jaipur-302004, India. (India); Department of Physics, Vivekananda Global University, Jaipur-303012, India. (India); Sharma, S. S. [Department of Physics, Govt. Women Engineering College, Ajmer-305002, India. (India)

    2016-05-06

    Graphene, due to its unique properties arising from the single carbon layer, is a potential candidate for applications in a variety of fields including sensors, photovoltaics and energy storage. The atomic structure and morphology of the carbon nanomaterials especially graphene can be tailored by energetic ionic irradiation. As graphene sheet is very stable, the surface have less reactivity as compared to the edges of the sheets. By surface modification with energetic ion-beams additional dangling bonds can be formed to enhance the surface activity of the graphene film which could be exploited in a variety of applications. In the present work, graphene oxide was synthesized by improved Hummers’ Method. The irradiation was done with Ag{sup +} ions carrying energy 100 MeV with the fluence of 3×10{sup 13}. Raman spectrum of graphene irradiated by Ag{sup +} beam shows additional disordered peaks of D´ and D+G bands. There is also a decrease in the intensity of D band. AFM images depict the increase in the surface roughness of the films. This can be attributed to the increase in the defects in the flakes and intermixing of adjacent layers by irradiation.

  10. Women do not play their aces: the consequences of shying away

    Claussen, J.; Czibor, E.; van Praag, M.

    2015-01-01

    The underrepresentation of women at the top of hierarchies is often explained by gender differences in preferences. We find support for this claim by analyzing a large dataset from an online card game community, a stylized yet natural setting characterized by self-selection into an uncertain,

  11. New energy vision of the Noogata city area; 2001 nendo Noogata shi chiiki shin energy vision

    NONE

    2002-02-01

    For the purpose of promoting the introduction of new energy and enhancing the awareness of it in Noogata City, Fukuoka Prefecture, an investigational study was conducted of the energy demand amount of the city, existence amount of new energy, project for new energy introduction, etc., and a vision was worked out. The energy consumption amount of the city was estimated at 4,825.4 x 10{sup 6} MJ/y. It consisted of 47.1% in the industrial sector, 26.1% in the commercial/residential sector and 24.9% in the transportation sector. The rate of energy source was 65.7% of petroleum-base energy and 25.1% of electric power. As the project for new energy introduction, the following were studied: introduction of wind power generation/photovoltaic power generation to the flower park at the foot of Mt. Fukuchi and Nakanoshima park on the sandbank of the Onga river; introduction of photovoltaic power generation to library. Moreover, as future models of the introduction, the potential study was made on the following: installation of the stockbreeding waste biogas plant at the compost center; installation of fuel cell system using digestion gas from night soil treatment facilities; installation of the natural gas cogeneration system in the project on redevelopment of the urban area, etc. (NEDO)

  12. Regional new energy vision for Hita City; 2001 nendo Hita shi chiiki shin energy vision

    NONE

    2002-02-01

    For promoting the introduction of new energy and for elevating people's consciousness of such in Hita City, Oita Prefecture, surveys and studies were conducted concerning the energy supply/demand trend in the city, the amount of new energy resources in existence, and new energy introduction plans, and a vision was formulated. The city's energy consumption is estimated at 16,216,376 GJ, with the industrial sector responsible for 78.23%, the transportation sector for 11.35%, and the residential and commercial sector for 9.73%. It is in the public sector, general households, forestry, and hog raising that new energy will be utilized. Key projects for new energy introduction were discussed, which covered a residence incorporating a combination of new energies such as solar heat for water heating and photovoltaic power; lumber drying facilities utilizing forestry generated biomass; cogeneration fueled by methane gas from livestock excrements and garbage; photovoltaic power for schools, the city office, etc.; use of photovoltaic power, temperature difference energy, and methane gas at purification centers, etc.; use of clean energy vehicles for official use; etc. (NEDO)

  13. SHI induced enhancement in green emission from nanocrystalline CdS thin films for photonic applications

    Kumar, Pragati; Saxena, Nupur; Chandra, Ramesh; Gao, Kun; Zhou, Shengqiang; Agarwal, Avinash; Singh, Fouran; Gupta, Vinay; Kanjilal, D.

    2014-01-01

    Intense green emission is reported from nanocrystalline CdS thin films grown by pulsed laser deposition. The effect of ion beam induced dense electronic excitation on luminescence property of CdS films is explored under irradiation using 70 MeV 58 Ni 6+ ions. It is found that swift heavy ion beam irradiation enhances the emission intensity by an order of 1 and broadens the emission range. This feature is extremely useful to enhance the performance of different photonic devices like light emitting diodes and lasers, as well as luminescence based sensors. To examine the role of energy relaxation process of swift heavy ions in creation/annihilation of different defect levels, multi-peaks are fitted in photoluminescence spectra using a Gaussian function. The variation of contribution of different emissions in green emission with ion fluence is studied. Origin of enhancement in green emission is supported by various characterization techniques like UV–visible absorption spectroscopy, glancing angle X-ray diffraction, micro-Raman spectroscopy and transmission electron microscopy. A possible mechanism of enhanced GE due to ion beam irradiation is proposed on the basis of existing models. -- Highlights: • Room temperature green luminescence nanocrystalline CdS thin films grown by pulsed laser deposition. • Enhanced green emission by means of swift heavy ion irradiation. • Multipeak fitting of photoluminescence spectra using a Gaussian function. • Variation of area contributed by different emissions in green emission is studied with respect to ion fluence. • Mechanism of enhanced green emission is discussed based on creation/annihilation of defects due to ion beam irradiation

  14. SHI induced enhancement in green emission from nanocrystalline CdS thin films for photonic applications

    Kumar, Pragati, E-mail: pkumar.phy@gmail.com [Department of Physics, Bareilly College, Shahmat Ganj Road, Bareilly 243005, Uttar Pradesh (India); Saxena, Nupur [Inter University Accelerator Centre, Aruna Asaf Ali Marg, P.O. Box 10502, New Delhi 110067 (India); Chandra, Ramesh [Institute Instrumentation Centre, Indian Institute of Technology, Roorkee 247667 (India); Gao, Kun; Zhou, Shengqiang [Institute of Ion Beam Physics and Materials Research, Helmholtz-Zentrum Dresden-Rossendorf (HZDR), P.O. Box 510119, 01314 Dresden (Germany); Agarwal, Avinash [Department of Physics, Bareilly College, Shahmat Ganj Road, Bareilly 243005, Uttar Pradesh (India); Singh, Fouran [Inter University Accelerator Centre, Aruna Asaf Ali Marg, P.O. Box 10502, New Delhi 110067 (India); Gupta, Vinay [Department of Physics and Astrophysics, Delhi University, Delhi 110007 (India); Kanjilal, D. [Inter University Accelerator Centre, Aruna Asaf Ali Marg, P.O. Box 10502, New Delhi 110067 (India)

    2014-03-15

    Intense green emission is reported from nanocrystalline CdS thin films grown by pulsed laser deposition. The effect of ion beam induced dense electronic excitation on luminescence property of CdS films is explored under irradiation using 70 MeV {sup 58}Ni{sup 6+} ions. It is found that swift heavy ion beam irradiation enhances the emission intensity by an order of 1 and broadens the emission range. This feature is extremely useful to enhance the performance of different photonic devices like light emitting diodes and lasers, as well as luminescence based sensors. To examine the role of energy relaxation process of swift heavy ions in creation/annihilation of different defect levels, multi-peaks are fitted in photoluminescence spectra using a Gaussian function. The variation of contribution of different emissions in green emission with ion fluence is studied. Origin of enhancement in green emission is supported by various characterization techniques like UV–visible absorption spectroscopy, glancing angle X-ray diffraction, micro-Raman spectroscopy and transmission electron microscopy. A possible mechanism of enhanced GE due to ion beam irradiation is proposed on the basis of existing models. -- Highlights: • Room temperature green luminescence nanocrystalline CdS thin films grown by pulsed laser deposition. • Enhanced green emission by means of swift heavy ion irradiation. • Multipeak fitting of photoluminescence spectra using a Gaussian function. • Variation of area contributed by different emissions in green emission is studied with respect to ion fluence. • Mechanism of enhanced green emission is discussed based on creation/annihilation of defects due to ion beam irradiation.

  15. Do gays shy away from competition? Do lesbians compete too much?

    Buser, T.; Geijtenbeek, L.; Plug, E.

    It is an established fact that gay men earn less than other men and lesbian women earn more than other women. In this paper we study whether differences in competitive preferences, which have emerged as a likely determinant of labour market differences between men and women, can provide a plausible

  16. Do Gays Shy Away from Competition? Do Lesbians Compete Too Much?

    Buser, Thomas; Geijtenbeek, Lydia; Plug, Erik

    2015-01-01

    It is an established fact that gay men earn less than other men and lesbian women earn more than other women. In this paper we study whether differences in competitive preferences, which have emerged as a likely determinant of labour market differences between men and women, can provide a plausible explanation. We conduct an experiment on a Dutch online survey panel to measure the competitiveness of gay, lesbian and straight panel members. For differences in competitiveness to partially expla...

  17. New energy vision of Kanazawa City; 2001 nendo Kanazawa shi shin energy vision

    NONE

    2002-02-01

    For the purpose of promoting the introduction of new energy and enhancing the awareness of it in Kanazawa City, Ishikawa Prefecture, an investigational study was conducted of the energy demand amount of the city, existence amount of new energy and project for new energy introduction, and a vision was worked out. The energy demand amount of the city was approximately 42 million GJ. The amount of CO2 emitted from this was estimated at approximately 880,000 t-C. The rate of energy source was 65.3% of petroleum-base energy, 24.7% of electric power and 10.0% of gas. As viewed by sector, the energy demand amount consisted of 38.1% in the commercial/residential sector, 32.2% in the transportation sector and 29.7% in the industrial sector. As the project for new energy introduction, the following were studied: introduction of wind power generation to the sport recreation zone of the mountain area; introduction of natural gas cogeneration to the city hospital; introduction of hydroelectric power generation using the idle head of filtration plant; utilization of the sewage heat and sewage digestion gas at the water quality control center, introduction of clean energy vehicle to official vehicle; introduction of photovoltaic power generation to park light/school, etc. (NEDO)

  18. Shy and Ticklish Truths as Species of Scientific and Artistic Perception

    ... recognize a 'gay science' (Nietzsche) not as an eccentric construction of merely poetic insights and expressions, but as a necessary part of the fundamentals of knowledge. It is a truth of the human condition that its truths are grounded in a personal embodiment of individuality, ontogeny, momentariness and situationality.

  19. New energy vision of the Akita city area; 2001 nendo Akita shi chiiki shin energy vision

    NONE

    2002-03-01

    For the purpose of promoting the introduction of new energy and enhancing the awareness of it in Akita City, an investigational study was conducted of the energy demand of the town, existence amount of new energy, project on new energy introduction, etc., and a new energy vision was worked out. The population of Akita City was 317,868 as of December 31, 2000, which is continuously on the increase. The amount of energy demand of the whole city was 990,000 kL/y. The energy demand consists of fossil fuels such as petroleum, coal and propane gas (77.7%) and electric power (22.3%). The CO2 emissions from these are 2,908,000 t-CO2. As the project on the new energy introduction, study was made on the installation of the photovoltaic power system and wind power system at base centers and introduction of the waste power system at the Goshono Works. As the model project, study was made on the introduction of the photovoltaic power generation and wind power generation to street light and public facilities, road snow melting/space heating and cooling using soil heat, introduction of clean energy vehicles, BDF introduction using waste cooking oil and rate blossoms, etc. (NEDO)

  20. Search for Hidden Particles (SHiP): a new experiment proposal

    De Lellis, G.

    2015-06-01

    Searches for new physics with accelerators are being performed at the LHC, looking for high massive particles coupled to matter with ordinary strength. We propose a new experimental facility meant to search for very weakly coupled particles in the few GeV mass domain. The existence of such particles, foreseen in different theoretical models beyond the Standard Model, is largely unexplored from the experimental point of view. A beam dump facility, built at CERN in the north area, using 400 GeV protons is a copious factory of charmed hadrons and could be used to probe the existence of such particles. The beam dump is also an ideal source of tau neutrinos, the less known particle in the Standard Model. In particular, tau anti-neutrinos have not been observed so far. We therefore propose an experiment to search for hidden particles and study tau neutrino physics at the same time.

  1. Current status of X-ray system at SHI Tsukuba facility

    Washio, Masakazu; Kato, Hiroo; Yamase, Yutaka; Odera, Masatoshi; Thompson, C.C.; Cleland, M.R.

    1992-01-01

    Many studies have been carried out on X-ray converter system, characteristics of the X-rays and its applications. In this paper, following items will be described. 1. Characteristics of electron beam obtained from 5 MeV Dynamitron, 2. Design and status of the X-ray converter, 3. Characteristics of converted X-ray, 4. Preliminary results of sterilization of certain microbiological reference standard. (J.P.N.)

  2. SI-SHY: Dysregulated Fear in Toddlerhood Predicts Kindergarten Social Withdrawal through Protective Parenting

    Kiel, Elizabeth J.; Buss, Kristin A.

    2014-01-01

    Two recent advances in the study of fearful temperament (behavioral inhibition) include the validation of dysregulated fear as a temperamental construct that more specifically predicts later social withdrawal and anxiety, and the use of conceptual and statistical models that place parenting as a mechanism of development from temperament to these outcomes. The current study further advances these areas by examining whether protective parenting mediated the relation between dysregulated fear in toddlerhood and social withdrawal in kindergarten. Participants included 93 toddlers and their mothers, who engaged in laboratory tasks assessing traditional fearful temperament, dysregulated fear, and protective parenting. When children reached kindergarten, they returned to the laboratory for a multimethod assessment of social withdrawal. Results confirmed the hypothesis that dysregulated fear predicted social withdrawal through protective parenting, and this occurred above and beyond the effect of traditional fearful temperament. These findings bolster support for the use of dysregulated fear as a temperamental construct related to, but perhaps more discerning of risk than traditionally measured fearful temperament/behavioral inhibition and highlight the importance of transactional influences between the individual and the caregiving environment in the development of social withdrawal. PMID:25242893

  3. Effect of Language Context on Ratings of Shy and Unsociable Behaviors in English Language Learner Children

    Ash, Andrea C.; Rice, Mabel L.; Redmond, Sean M.

    2014-01-01

    Purpose: The primary goal of this study was to explore the effect of language context on the socially withdrawn behaviors of school-age-children who are English language learners (ELLs) from middle- to high-socioeconomic status (SES) backgrounds. This is one of the 1st studies to address the frequently confused concepts of shyness and…

  4. SHiP: a new facility with a dedicated detector for studying $\

    Buonaura, Annarita

    2016-01-01

    SHIP is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In five years, $2\\times 10^{20}$ protons of 400 GeV/c momentum will be dumped on a Molybdenum target. A detector downstream of the target will allow a search to made for long-lived particles with masses below O(10) GeV/c$^2$ foreseen in several extensions of the Standard Model. Another dedicated detector will allow the study of active neutrino cross-sections and angular distributions. The neutrino detector consists of an emulsion target, based on the Emulsion Cloud Chamber technology fruitfully employed in the OPERA experiment. The Emulsion Cloud Chamber will be placed in a magnetic field, with the so-called Compact Emulsion Spectrometer, a few cm thick chamber for the charge and momentum measurement of hadrons. This will provide the leptonic number measurement also in the hadronic tau decay channels. The detector will be hybrid, using nuclear emulsions and electronic detectors for the time stamp of the events and the m...

  5. Regional new energy vision for Joetsu City; 2001 nendo Joetsu shi chiiki shin energy vision

    NONE

    2002-02-01

    For promoting the introduction of new energy and for enhancing people's consciousness of such at Joetsu City, Niigata Prefecture, surveys and studies were conducted involving energy consumption of the city, the amount of new energy resources in existence, and new energy introduction projects, and a vision was formulated. The city consumes 3,593 times 10{sup 9} kcal in energy, with the industrial sector responsible for 47.5%, the transportation sector 28.1%, and the residential/commercial sector 24.3%. As for the energy type, oil based fuel accounts for 58.3%, electric power 26.8%, and town gas 8.6%. The amount of carbon dioxide emissions due to energy consumption is estimated at 1,160 kt-CO2. Studies conducted for new energy introduction covered the supply of photovoltaic power to a project on municipal housing construction and a project on promoting the buildup of environment preservation facilities; the installation of a photovoltaic power generation system for a Citizens' Forest buildup project; the installation of a wind power generation system at the Minowadai Square of Recreation and Relaxation for the citizens; the installation of eco-stations to deal with gasoline, propane gas, and natural gas; the extension of financial support for the purchase of low-pollution vehicles; and so forth. (NEDO)

  6. [Textual research on Chen Ye and his Jia cang jing yan fang (Family-preserved Empirical Recipes) of the Song Dynasty].

    Zhang, Xuedan; Zhang, Ruqing; Chen, Dexing

    2014-01-01

    Chen Ye, an official of the Southern Song Dynasty, also known as Chen Rihua as his styled name, was born in Changle, Fuzhou in the reign of Shaoxing, and died during the reign of Duanping. He had been consecutively in the positions of Jiang shi lang (Court Gentleman for Ceremonial Service), Zhi zhou (Prefect) of Lingding, the Ti xing (Judicial Commissioner) of Guangdong, the Zong ling (Overseer-general) of Sichuan, Shan ding (Reviser), Shu lin and other positions in Tongzhou, Yuanzhou. His works included 1 volume of Gu ling xian sheng nian pu (Mr. Guling's Chronological Biography), 1 volume of Tan xie (On Humor), 1 volume of Shi hua (Poetry), 8 volumes of Jin yuan li shu (Jin Yuan's Smart Technique), 3 volumes of Yi jian zhi lei bian (Classified Compilation of Yijian's Annals), (Zeng guang) Suo sui lu (Augmented Records of Trivial Matters), 5 volumes of Jia cang jing yan fang (Family-preserved Empirical Recipes). He also compiled the 8-volume Yin jiang zhi (Yinjiang's Annals), published the 2-volume Jia cang ji yao fang (Collected Essential Recipes from Family Preservation), and other proses and poetry. Jia cang jing yan fang was a formulary compiled by Chen Ye, which was lost. Altogether 74 of its recipes were cited in Fu ren da quan liang fang (Complete Effective Prescriptions for Women's Diseases), Shou qin yang lao shu (A Book for Pursuing Seniors' Longevity and Healthcare), Pu ji fang (Prescriptions for Universal Relief) and Yong le da dian (Yongle Encyclopedia).

  7. Transport Phenomena In Single Crystals Tl1−XIn1−XGeXSe2 (x=0.1, 0.2

    Zamurueva O.V.

    2015-09-01

    Full Text Available Temperature dependences of electroconductivity for single crystals Tl1−xIn1−xGexSe2 were analyzed. It was established an occurrence of thermoactivated states within the temperature range 100-300 K. The conductivity is formed by delocalized carriers within the conductivity band and the jumping conductivity over the localized states which are situated in the narrow localized states near the Fermi level. Following the performed data the activation energy was evaluated with accuracy up to 0.02 eV. The density of the localized states as well as the distribution of the energy over the mentioned states was evaluated. Additionally the average distance between the localized states is evaluated at different temperatures.

  8. Prediction study of structural, electronic and optical properties of XIn{sub 2}S{sub 4} (X = Hg, Zn) thiospinels under pressure effect

    Yousaf, Masood [Physics Department, Faculty of Science, Universiti Teknologi Malaysia, Skudai 81310, Johor (Malaysia); Inam, F. [School of Science and Engineering, Lahore University of Management Sciences, Opposite Sector U, D.H.A. Lahore 54792 (Pakistan); Khenata, R. [Laboratoire de Physique Quantique et de Modélisation Mathématique (LPQ3M), Département de Technologie, Université de Mascara, 29000 Mascara (Algeria); Murtaza, G. [Department of Physics, Islamia College Peshawar, KPK (Pakistan); Isa, A.R.M. [Physics Department, Faculty of Science, Universiti Teknologi Malaysia, Skudai 81310, Johor (Malaysia); Saeed, M.A., E-mail: saeed@utm.my [Physics Department, Faculty of Science, Universiti Teknologi Malaysia, Skudai 81310, Johor (Malaysia)

    2014-03-15

    Highlights: • Pressure effect is employed for the first time on HgIn{sub 2}S{sub 4} and ZnIn{sub 2}S{sub 4} thiospinels. • A number of physical parameters are calculated and equations are developed. • FP-LAPW+lo method is coupled with different approximations (GGA+U and mBJ-GGA). • Relationships between pressure and parameters are in accordance with the theory. • Computed band gap values have good agreement with the experimental values. -- Abstract: First principle calculations are carried out to study the effect of pressure (up to 30 GPa) on physical properties of HgIn{sub 2}S{sub 4} and ZnIn{sub 2}S{sub 4} thiospinels. A number of structural, electronic and optical parameters are calculated, and equations are developed for their prediction at different pressures. Highly effective all electron FP-LAPW+lo method coupled with two different approximations (GGA+U and mBJ-GGA) provides very accurate results. All relationships developed between pressure and structural parameters are in full accordance with the established theory thus validating the approach used in the current study. Computed In–S bond length for ZnIn{sub 2}S{sub 4} matches closely with the experimental value. The band gap values of 0.920 eV (1.851 eV) and 1.68 eV (2.733 eV) are obtained with GGA+U (mBJ-GGA) at 0 GPa for HgIn{sub 2}S{sub 4} and ZnIn{sub 2}S{sub 4}, respectively. Additionally, we have calculated the optical properties, namely, the complex dielectric function, refractive index, extinction coefficient, reflectivity, optical conductivity, absorption coefficient and electron energy loss function under pressure effect for radiation up to 30.0 eV. The first critical point also known as optical’s absorption edge calculated with GGA+U (mBJ-GGA) appears at 0.939 eV (1.891 eV) and 1.701 eV (2.981 eV) for HgIn{sub 2}S{sub 4} and ZnIn{sub 2}S{sub 4}, respectively. Variation of the absorption spectrum indicates the prospective use of both compounds for device applications, which can be operated on a wide range of the energy scale. The entire work gives useful results of fundamental importance, which can be utilized for the fabrication of optoelectronic devices.

  9. Bu-Shen-Ning-Xin Decoction ameliorated the osteoporotic phenotype of ovariectomized mice without affecting the serum estrogen concentration or uterus

    Wang, Ling; Qiu,Xue-Min; Gui,Yu-Yan; Xu,Yingping; Gober,Hans-Jürgen; Li,Da-Jin

    2015-01-01

    Ling Wang,1,2,* Xue-Min Qiu,1,2,* Yu-Yan Gui,1,2 Ying-Ping Xu,1,2 Hans-Jürgen Gober,3 Da-Jin Li1 1Laboratory for Reproductive Immunology, Hospital and Institute of Obstetrics and Gynecology, IBS, Fudan University Shanghai Medical College, 2Shanghai Key Laboratory of Female Reproductive Endocrine Related Diseases, Shanghai, People’s Republic of China; 3Department of Pharmacy, Wagner Jauregg Hospital and Children’s Hospital, Linz, Austria *These authors contribute...

  10. Reply to Cen LiXiang, Li XinQi, and Yan YiJing: No adiabatic conditional geometrical phase shift

    Xiangbin, Wang

    2002-01-01

    Much long before the appearing time of the Comment by Cen, Li, and Yan,, the main issue addresed there by Cen et al had been resolved already. The information offered by the Comment is selective and misleading.

  11. Influence of polyethylene glycol coating on biodistribution and toxicity of nanoscale graphene oxide in mice after intravenous injection

    Li B

    2014-10-01

    Full Text Available Bo Li,1,2 Xiao-Yong Zhang,1 Jian-Zhong Yang,1 Yu-Jie Zhang,1 Wen-Xin Li,1 Chun-Hai Fan,1 Qing Huang1 1Laboratory of Physical Biology, Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai, 2Department of Human Anatomy, College of Basic Medical Sciences, Jilin University, Changchun, People’s Republic of China Abstract: In this study, we assessed the in vivo behavior and toxicology of nanoscale graphene oxide (NGO in mice after intravenous injection. The influence of a polyethylene glycol (PEG coating on the distribution and toxicity of the NGO was also investigated. The results show that NGO is mainly retained in the liver, lung, and spleen. Retention in the lung is partially due to NGO aggregation. The PEG coating reduces the retention of NGO in the liver, lung, and spleen and promotes the clearance of NGO from these organs, but NGO and NGO-PEG are still present after 3 months. The PEG coating effectively reduces the early weight loss caused by NGO and alleviates NGO-induced acute tissue injuries, which can include damage to the liver, lung, and kidney, and chronic hepatic and lung fibrosis. Keywords: graphene oxide, biodistribution, toxicity, polyethylene glycol

  12. Manicômio em circuito: os percursos dos jovens e a internação psiquiátrica The psychiatric hospital circuit: the trajectories of yong people prior to psychiatric hospitalization

    Andrea Cristina Coelho Scisleski

    2008-02-01

    Full Text Available Este artigo analisa a internação psiquiátrica de jovens, tomando-a não a partir de uma perspectiva psicopatológica individual, mas de uma dimensão subjetivo-social com base nos percursos desses jovens até a internação. O estudo foi realizado no Centro Integrado de Atenção Psicossocial para crianças e adolescentes do Hospital Psiquiátrico São Pedro, na cidade de Porto Alegre, Rio Grande do Sul, Brasil, por meio de oficinas com os jovens que estavam em atendimento na internação deste serviço. Percebeu-se uma recorrência que marca o percurso desses jovens e expressa um determinado modo de funcionamento da rede de atenção até a internação, acarretando na produção de um certo perfil desses jovens: pobreza sócio-econômica, baixa escolaridade e uso de drogas. Outro aspecto importante é o papel da ordem judicial nos encaminhamentos à internação, que obedece tanto a uma lógica de punição aos jovens e aos serviços, como também, paradoxalmente, constitui-se numa estratégia de acesso aos serviços de saúde.This article analyzes psychiatric hospitalization of young patients from a contemporary social-subjective (rather than a psychopathological perspective, following the trajectory of these youth prior to their admission. The study was conducted at the Center for Comprehensive Psychosocial Care for Children and Adolescents, São Pedro Psychiatric Hospital, in the city of Porto Alegre, Rio Grande do Sul State, Brazil. Recurrent traits in the trajectory of these youth expressed how the health care network functioned with them prior to their hospitalization, with a consistent pattern of socioeconomic deprivation, low schooling, and drug use. Another key aspect was the role of the court system in referring them for hospitalization, adhering to a kind of logic that punished both the youth and the services and paradoxically formed a strategy for access to health services.

  13. JiaZhang Dui ErTong FaZhan TongBan GuanXi De ZuoYong (The Role of Parents in the Development of Peer Group Competence). ERIC Digest.

    Moore, Shirley G.

    Among studies that have examined the relationship between parenting styles and children's development of social skills, the research of Diana Baumrind is noteworthy. In several studies, she has identified authoritarian, permissive, and authoritative parenting styles, which differ on the dimensions of nurturance and parental control. Authoritarian…

  14. AIR PRESSURE and Other Data from SHI YAN 3 From Antarctic and Others from 19921109 to 19930224 (NODC Accession 9600025)

    National Oceanic and Atmospheric Administration, Department of Commerce — The accession contains Surface Wave data and Sea Surface Temperature (SST) data collected as part of Tropical Ocean Global Atmosphere (TOGA) and Coupled...

  15. "But at school … I became a bit shy": Korean immigrant adolescents' discursive participation in science classrooms

    Ryu, Minjung

    2013-09-01

    In reform-based science curricula, students' discursive participation is highly encouraged as a means of science learning as well as a goal of science education. However, Asian immigrant students are perceived to be quiet and passive in classroom discursive situations, and this reticence implies that they may face challenges in discourse-rich science classroom learning environments. Given this potentially conflicting situation, the present study aims to understand how and why Asian immigrant students participate in science classroom discourse. Findings from interviews with seven Korean immigrant adolescents illustrate that they are indeed hesitant to speak up in classrooms. Drawing upon cultural historical perspectives on identity and agency, this study shows how immigrant experiences shaped the participants' othered identity and influenced their science classroom participation, as well as how they negotiated their identities and situations to participate in science classroom and peer communities. I will discuss implications of this study for science education research and science teacher education to support classroom participation of immigrant students.

  16. The Shi'ites, the West and the Future of Democracy: Reframing Political Change in a Religio-secular World

    John A Rees

    2006-02-01

    Full Text Available The present article critically reviews Paul McGeough’s important analysis of the most recent Iraq war within a broader consideration of secular-religious relations in international affairs. The thesis of Mission Impossible: The Sheikhs, the US and the Future of Iraq (2004 can be summarised around two ideas: that the US strategy in Iraq was flawed because it wilfully bypassed the traditional power structures of Iraqi society; and that these structures, formed around the tribe and the mosque, are anti-democratic thus rendering attempts at democratisation impossible. The article affirms McGeough’s argument concerning the inadequacy of the US strategy, but critically examines the author’s fatalism toward the democratic capacity of Iraqi structures, notably the structure of the mosque. By broadening the notion of democracy to include religious actors and agendas, and by an introductory interpretation of the Shi’ite community as vital players in an emerging Iraqi democracy, the article attempts to deconstruct the author’s secularist view that the world of the mosque exists in a ‘parallel universe’ to the liberal democratic West. Reframing the Shi’ites as essential actors in the democratic project thus situates political discourse in a ‘religio-secular world’ and brings the ‘other worlds’ of religion and secularism together in a sphere of interdependence. Such an approach emphasises the importance of post-secular structures in the discourses on democratic change.

  17. SHiP: a new facility with a dedicated detector to search for new long-lived neutral particles

    AUTHOR|(SzGeCERN)711794

    2015-01-01

    SHIP is a new fixed target experiment whose Technical Proposal has been recently submitted to the CERN SPS Committee. In its initial phase, the 400 GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating 2 × 1020 pot in 5 years. A dedicated detector, based on a long empty decay volume followed by a spectrometer and particle identi- fication detectors, will allow probing a variety of models with light long-lived exotic particles and masses below O(10) GeV/c2. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, light scalars and pseudo-scalars, and Heavy Neutrinos. The sensitivity to Heavy Neutrinos will allow for the first time to probe, in the mass range between the kaon and the D meson mass, a coupling range for which Baryogenesis and active neutrino masses could also be explained. Direct detection of light and long-lived SUSY particles, such as RPV neutralinos and pseudo-Dirac gauginos could also be performed in an un...

  18. Once bitten, twice shy? Medically-attended injuries can sensitise parents to children's risk of injuries on playgrounds.

    Morrongiello, B A; Howard, A W; Rothman, L; Sandomierski, M

    2009-02-01

    To compare risk perceptions of parents whose child sustained a medically attended playground injury (cases) with those of parents whose child had not (controls) to address two questions. Does having a child experience a medically attended injury: (1) sensitise parents to children's injury vulnerability and severity; (2) influence parents' appraisal of the injury mechanism (child's behaviour), attributions for injuries or beliefs about strategies for prevention? Each case-control parent dyad was assigned to one of two conditions: (1) being presented with 10 common injury-risk playground behaviours specific to the equipment on which their child had been hurt, and asked to appraise injury vulnerability and severity; or (2) being presented with scenarios about playground injuries that varied in severity but were all based on the same child behaviour, and asked questions about this behaviour, attributions for injury and strategies for prevention. The results support the occurrence of a sensitisation process. Compared with control parents, case parents showed higher ratings of injury severity and children's vulnerability to injury, made fewer attributions for injuries to bad luck, and endorsed a greater diversity of prevention strategies, including parent (closer supervision), child (teaching rules about safe play on playgrounds) and environmental (modifications to playgrounds). A child's medically attended injury can create a "teachable moment" for the parent. Linking injury-prevention programming to this teachable moment may increase the likelihood of evoking changes in parental supervisory behaviour and their setting of rules limiting their child's risk behaviours to reduce the occurrence of childhood injury.

  19. Shy and bold great tits (Parus major): body temperature and breath rate in response to handling stress

    Carere, C.; Van Oers, K.

    2004-01-01

    A standard handling protocol was used to test the hypothesis that boldness predicts stress responsiveness in body temperature and breath rate. Great tit (Parus major) nestlings were taken from the field, hand reared until independence, and their response to a novel object was assessed. At the age of

  20. Shy and bold great tits (Parus major) : body temperature and breath rate in response to handling stress

    Carere, C; van Oers, K

    2004-01-01

    A standard handling protocol was used to test the hypothesis that boldness predicts stress responsiveness in body temperature and breath rate. Great tit (Parus major) nestlings were taken from the field, hand reared until independence, and their response to a novel object was assessed. At the age of

  1. Turning shy on a winter's day : Effects of season on personality and stress response in Microtus arvalis

    Gracceva, Giulia; Herde, Antje; Groothuis, Ton G. G.; Koolhaas, Jaap M.; Palme, Rupert; Eccard, Jana A.

    Animal personalities are by definition stable over time, but to what extent they may change during development and in adulthood to adjust to environmental change is unclear. Animals of temperate environments have evolved physiological and behavioural adaptations to cope with the cyclic seasonal

  2. Direct determination of absolute configuration: a vibrational circular dichroism study on dimethyl-substituted phenyloxiranes synthesized by Shi epoxidation

    Fristrup, Peter; Lassen, Peter Rygaard; Tanner, David Ackland

    2008-01-01

    obtained using DFT/B3LYP calculations, and the differences between experiment and theory are discussed. The absolute configuration at the benzylic position was established as being (R), (S) and (R) for the cis, trans and geminal dimethylsubstituted phenyloxiranes, respectively. In all three cases...

  3. Regional new energy vision formulation for Nichinan City. Fiscal 2001 report; 2001 nendo Nichinan shi chiiki shin energy vision sakuteisho

    NONE

    2002-03-01

    For promoting the introduction of new energy and for elevating people's consciousness of such in Nichinan City, Miyazaki Prefecture, surveys and studies were conducted concerning the energy demand of the city, the amount of new energy resources in existence, and new energy introduction plans, and then a vision was formulated. The city's energy demand is estimated to be approximately 4,028-million MJ/year, which includes 46% for the transportation sector, 30% for the people's livelihood-related business sector, 17% for the residential sector, and 7% for the industrial sector. The energy demand is covered 62% by oil-based fuels and 30% by electric power. Projects discussed for new energy introduction included the introduction of photovoltaic power into a lifelong learning center, a comprehensive center for health and welfare, and primary schools; introduction of solar hot water supply systems into school meal providing facilities; introduction of medium-size wind power systems (five systems); medium- or small-scale hydroelectric power generation on the Sakatani river; use of street light lighted by photovoltaic/wind hybrid power systems; introduction of clean energy vehicles; power generation utilizing livestock excrement; introduction of photovoltaic, hydroelectric, and methane gas power generation into a sewage treatment plant; and the use of RPF (refuse paper and plastic fuel) at the Nichinan plant of Oji Paper Co., Ltd. (NEDO)

  4. Temperament, disordered attachment and parental sensitivity in foster care: Differential findings on attachment security for shy children

    de Schipper, J.C.; Oosterman, M.; Schuengel, C.

    2012-01-01

    In a foster care sample, the moderating effect of temperamental shyness on the association between parental sensitivity and attachment quality was tested. The foster parents of 59 foster children (age M=57 months, SD=16.4) filled out the Child Behavior Questionnaire. To control for confounds,

  5. EDITORIAL: Focus on Dilute Magnetic Semiconductors FOCUS ON DILUTE MAGNETIC SEMICONDUCTORS

    Chambers, Scott A.; Gallagher, Bryan

    2008-05-01

    Chisholm, J D Budai and D P Norton Role of charge carriers for ferromagnetism in cobalt-doped rutile TiO2 T Fukumura, H Toyosaki, K Ueno, M Nakano and M Kawasaki Ab-initio study of exchange constants and electronic structure in diluted magnetic group-IV semiconductors Silvia Picozzi and Marjana Ležaić Phase coherent transport in (Ga,Mn)As D Neumaier, K Wagner, U Wurstbauer, M Reinwald, W Wegscheider and D Weiss Hydrogen interstitials-mediated ferromagnetism in MnxGe1-x magnetic semiconductors Xin-Xin Yao, Shi-Shen Yan, Shu-Jun Hu, Xue-Ling Lin, Chong Han, Yan-Xue Chen, Guo-Lei Liu and Liang-Mo Mei Electronic structures of magnetic semiconductors FeCr2Se4 and Fe0.5Cu0.5Cr2Se4 B I Min, Seung Su Baik, H C Choi, S K Kwon and J-S Kang Investigation of pure and Co2+-doped ZnO quantum dot electronic structures using the density functional theory: choosing the right functional Ekaterina Badaeva, Yong Feng, Daniel R Gamelin and Xiaosong Li Magnetic properties of sol-gel-derived doped ZnO as a potential ferromagnetic semiconductor: a synchrotron-based study N R S Farley, K W Edmonds, A A Freeman, G van der Laan, C R Staddon, D H Gregory and B L Gallagher Local electronic structure of Cr in the II-VI diluted ferromagnetic semiconductor Zn1-xCrxTe M Kobayashi, Y Ishida, J I Hwang, G S Song, A Fujimori, C S Yang, L Lee, H-J Lin, D J Huang, C T Chen, Y Takeda, K Terai, S-I Fujimori, T Okane, Y Saitoh, H Yamagami, K Kobayashi, A Tanaka, H Saito and K Ando Lack of ferromagnetism in n-type cobalt-doped ZnO epitaxial thin films T C Kaspar, T Droubay, S M Heald, P Nachimuthu, C M Wang, V Shutthanandan, C A Johnson, D R Gamelin and S A Chambers XMCD studies on Co and Li doped ZnO magnetic semiconductors Thomas Tietze, Milan Gacic, Gisela Schütz, Gerhard Jakob, Sebastian Brück and Eberhard Goering Ferromagnetic semiconductors and the role of disorder B W Wessels An extensive comparison of anisotropies in MBE grown (Ga,Mn)As material C Gould, S Mark, K Pappert, R G Dengel, J Wenisch, R P

  6. QING LIN

    QING LIN. Articles written in Journal of Genetics. Volume 96 Issue 4 September 2017 pp 535-544 RESEARCH ARTICLE. Effects of genetic variants of the bovine WNT8A gene on nine important growth traits in beef cattle · YONG-ZHEN HUANG YONG ZOU QING LIN HUA HE LI ZHENG ZI-JING ZHANG YONG-LONG DANG ...

  7. Oncogene mutational profile in nasopharyngeal carcinoma

    Zhang ZC

    2014-03-01

    Full Text Available Zi-Chen Zhang,1,* Sha Fu,1,* Fang Wang,1 Hai-Yun Wang,1 Yi-Xin Zeng,2 Jian-Yong Shao11Department of Molecular Diagnostics, 2Department of Experimental Research, Sun Yat-sen University Cancer Center, State Key Laboratory of Oncology in South China, Collaborative Innovation Center of Cancer Medicine, Guangzhou, People's Republic of China *These authors contributed equally to this work Abstract: Nasopharyngeal carcinoma (NPC is a common tumor in Southern China, but the oncogene mutational status of NPC patients has not been clarified. Using time-of-flight mass spectrometry, 238 mutation hotspots in 19 oncogenes were examined in 123 NPC patients. The relationships between mutational status and clinical data were assessed with a χ2 or Fisher's exact test. Survival analysis was performed using the Kaplan–Meier method with the log-rank test. In 123 patients, 21 (17.1% NPC tumors were positive for mutations in eight oncogenes: six patients had PIK3CA mutations (4.9%, five NRAS mutations (4.1%, four KIT mutations (3.3%, two PDGFRA mutations (1.6%, two ABL mutations (1.6%, and one with simultaneous mutations in HRAS, EGFR, and BRAF (1%. Patients with mutations were more likely to relapse or develop metastasis than those with wild-type alleles (P=0.019. No differences or correlations were found in other clinical characteristics or in patient survival. No mutations were detected in oncogenes AKT1, AKT2, CDK, ERBB2, FGFR1, FGFR3, FLT3, JAK2, KRAS, MET, and RET. These results demonstrate an association between NPC and mutations in NRAS, KIT, PIK3CA, PDGFRA, and ABL, which are associated with patient relapse and metastasis. Keywords: NPC, oncogene, mutation

  8. Projects of Earth Sciences Supported by National Natural Science Foundation of China

    2001-01-01

    and Chaotic Dynamics of Urban Systems\tCHEN Yan-guang 40071036\tDriving Force for Formation of Spatial Pattern of Natural Pinus Sylvestris var. Mongolica Forest in Eastern Inner Mongolia\tWANG Xiao-ke 40071037\tStudy on the Model of Two-core Structure in the Regional Development\tLU Yu-qi 40071038\tThe Agricultural Development and Its Effect on the Environment of the Xiliao River Valley during the Liao-Jin Period\tHAN Mao-li 40071039\tStudy on the Mechanism of Agricultural Sustainable Development and the Optimization of Industrial Structure in Bashang Plateau\tMA Li 40071040\tStudy of Forest Changes and Soil Erosion on the Upper Reaches of Yangtze River in Last 2000 Years\tLAN Yong 40071041\tThe Spatial Approach of Ecological Optimizing of City Landscape and Its Practice\tLI Gui-cai 40071042\tA Study on the Formation, Change and Sustainable Development of the Old Industrial Areas - A Case Study of Northeastern Region in China\tLI Guo-ping 40071043\tIntegration and Systematization of Mathematic Models for Soil and Water Resources Study in a Basin and Its Application\tZENG Zhi-yuan 40071044\tMonitoring and Modeling of the Eco-hydrological Processes in a Small Watershed in Yingtan, Jiangxi\tZHANG Bin 40071045\tSpatio-temporal Variation of Reconstructed Soil and Its Amelioration in Coal Mines\tHU Zhen-qi 40071046\tIn-situ Electrochemical Monitoring of Nutrients Leaching Loss in Red Soils after Input of Acid Deposition\tJIANG Xin 40071047\tThe Mechanisms of Nitrogen Loss Reduction by the Ammonia Inhibition Films in Paddy Soil\tYIN Bin 40071048\tComposition and Properties of Cutans in Several Soils and Forms and Transformation of Some Elements\tLIU Fan 40071049\tTwo-phase Reactions: A New Study on the Mechanisms of the Interactions of Humic Acids with Metal Ions\tWEI Shi-qiang 40071050\tStudies on Mechanisms of Bioremediation of Heavy Metal Contaminated Soil by Arbuacular Mycorrhiza\tLI Xiao-lin 40071051\tThe Reactions Between Multi-Nutrient Fertilizers and Soils and Their

  9. Fiscal 1995 survey report. Study of new energy vision formulation for Kawasaki City, Kanagawa Prefecture; 1995 nendo Kawasaki shi shin energy vision sakutei kentou chosa hokokusho

    NONE

    1996-03-01

    A survey was conducted of the current status of energy supply/demand, future problems, goals of the energy policy, basic plan, and so forth, for the formulation of a new energy vision for the city. Concerning energy supply/demand, studies were made of each sector, area, and energy source. In the study of energy demand, it was discovered that, although the industrial sector in the coastal region remained important, the residential/commercial sector was gathering weight and that the city was serving as an energy supply base for the neighboring areas. In the study of new energy, it was found that the available amount of solar energy resources was enormous, that the Tama river fresh water and the Keihin canal seawater constituted a promising source of temperature difference energy, and that sewage energy, transformation station exhaust heat, LNG (liquefied natural gas) cold heat, and so forth, were also available as energy sources. Taken up for discussion as possible new energy introduction models were gas engine cogeneration, photovoltaic power generation, district heat supply utilizing temperature difference energy, and so forth. (NEDO)

  10. Regional new energy vision formulation survey for Makurazaki City. Fiscal 2001 report; 2001 nendo Makurazaki shi chiiki shin energy vision sakutei tou chosa hokokusho

    NONE

    2002-02-01

    For promoting the introduction of new energy and for elevating people's consciousness of such in Makurazaki City, Kagoshima Prefecture, surveys and studies were conducted concerning the energy demand of the city, the amount of new energy resources in existence, and new energy introduction plans, and then a vision was formulated. The city's energy demand in fiscal 1999 is estimated at approximately 3,206 TJ, with the industrial sector demanding 1,820 TJ, the residential and commercial sector demanding 701 TJ, and the transportation sector demanding 684 TJ. Energy consuming industries in this prefecture are fisheries industry and food industry. Pilot projects for new energy introduction were discussed, which included the introduction of photovoltaic power into the city hall, primary and junior high schools, a school meal providing center, and a city-managed hospital; installation of hybrid power-lighted light at the city hall, along the Kedo river, and in the Hinokami park; introduction of a solar heat utilization system into a nursing home for elderly people; introduction of wind power into education facilities; conversion of waste of cooking oil into diesel fuel; introduction of clean energy vehicles into public service; and new energy projects to be contracted to the private sector. (NEDO)

  11. Report on the project on working out the new energy vision of Hisai City; 2001 nendo Hisai shi chiiki shin energy vision sakutei tou jigyo hokokusho

    NONE

    2002-03-01

    For the purpose of promoting the introduction of new energy and enhancing the awareness of it in Hisai City, Mie Prefecture, an investigational study was conducted of the energy demand structure, existence amount of new energy and project for new energy introduction, and a vision was worked out. The energy consumption amount of the city was 21,500 lorries in the industrial sector, 11,200 lorries in the transportation sector, 2,700 lorries in the business sector and 2,400 lorries in the residential sector in terms of tank-lorry loaded oil. As features, the following were cited: growth in the transportation sector, mostly in automobiles, was great; growth in the electric power consumption in the residential sector was great. As the project for new energy introduction, the following were supposed and studied in terms of the economical efficiency and environmental acceptability: introduction of cogeneration to hospital; introduction of ligneous biomass power generation to hospital; substitution of wood burning boiler for A heavy oil boiler for hot water supply use; introduction of photovoltaic power generation for home use and business use; introduction of solar heat use hot water supply device. (NEDO)

  12. Vneshnjaja politika Pol'shi i Kaliningradskaja oblast' v 1989—2012 godah [The foreign policy of Poland and the Kaliningrad region in 1989—2012

    Chełminiak Marcin

    2012-01-01

    Full Text Available This article sets out to analyse the role of the Kaliningrad region in the Polish foreign policy after 1989. The analysis focuses on the political and regional determinants, which had the greatest impact on the Poland-Kaliningrad region relations. The methodology used in the article is not unusual for political science and is based on analysing original (documents and secondary (scholarly publications, press articles sources. The authors also use the system and decision analysis methods. The analysis covers the period after 1989, when the geopolitical changes brought about by the collapse of the Yalta-Potsdam order resulted in Poland redefine the priorities of its foreign policy. One of the most important challenges for the Polish diplomacy after 1989 was the development of economic and political relations with the Russian Federation. Cross-border cooperation between Poland and the Kaliningrad Region is conducted, inter alia, through euroregional structures functioning in the border areas. The analysis of this issue is vital for further cooperation in the Polish-Russian borderland, especially after the conclusion of the local border traffic agreement in 2012. The authors come to a conclusion that the implementation of the local border traffic agreement can improve cross-border relations but it will not significantly change the role of the Kaliningrad region in the Polish foreign policy.

  13. AYAT-AYAT WAH}DAT AL-WUJUd dalam Kitab Tanbi>h al-Ma>shi Karya ‘Abdurrauf al-Sinkili

    Asep Nahrul Musadad

    2015-08-01

    Full Text Available Abstract: One of the key moments in discussing the history of Indonesian Islam is a polemic related to the negotiation on the doctrine of wahdat al-wujud that occured in Aceh in 17th century between the followers of Hamzah al-Fansuri and Nuruddin al-Raniri. This article focuses on analyzing several Qur’anic verses used by ‘Abdurrauf as the confirmation of his argument. In the polemical context, Abdurrauf al-Sinkili appeared to be an actor of reconciliation between two opposite sides. He tried to respond to the disputed issues through his book called “Tanbi>h al-Mashi”. As an exponent of the so-called moderate sufism (mysticism, he built the argument concerning wah}dat al-wujud based on the Quranic text. After making a thematic classification chronologically, his interpretation on these verses is analyzed by using Hussain al-Dhahaby’s theory of sufistic exegesis. In conclusion, it shows that ‘Abdurrauf’s commentary is “sufi-nazari type”, featured by his exegeses pattern. This, of course, represents his attitude as a reconciler who then needs to seek confirmation to the Qur’anic verses in evaluating wah}dat al-wujud doctrine, through which such a polemical issues occurred at that time. الملخص: إن من المرحلة الأساسية التي مرّ بها تاريخ الإسلام في اندونيسيا الجدل و النزاع حول عقيدة وحدة الوجود فى أتشيه (Aceh حول قرن السابع عشر بين أتباع حمزة الفنسوري و نور الدين الرانيري. ففي ذلك الخطاب النزاعي جاء عبد الرؤوف السنكيلي مصلحا بين الجانبين المعاكسين. وعلى مقتضى الظروف، كتب كتاب " تنبيه الماشي" الذي تطرّق فيه طريق التوسّط، ممثّلا للتصوّف المعتدل. اعتمد عبد الرؤوف على النصوص القرآنية فى تحقيق آراءه حول تناقضات وحدة الوجود. فهذه المقالة تطرح نفسها في تحليل الأيات القرآنية التي استخدمها عبد الرؤوف تأكيدا لحجته. بعد إجراء تصنيف موضوعي لتفسيره، سيتم التحليل باستخدام نظرية حسين الذهبي عن التفسير الصوفي. فيمكن القول بأن مادة تفسيره تدخل تحت لون "الصوفى النظري" التي ظهرت من قبل eisegesis (من النظرية الى النص. فهذا بالطبع يمثل على موقفه في الاعتدالية و باعتباره مصلحا، حتى يحتاج الى القرآن في التأكيد و التقييم للمسائل حول وحدة الوجود التي حدث من خلالها مثل هذا الجدل في ذلك الوقت. Abstrak: Salah satu momen kunci dalam perbincangan sejarah Islam Indonesia adalah polemik terkait negosiasi doktrin wah}dat al-wuju>d yang terjadi di Aceh pada abad ke-17 antara pengikut H{amzah al-Fansu>ri> dan Nu>r al-Di>n al-Ra>ni>ri>. Dalam konteks polemikal tersebut, Abdurrauf al-Sinkili muncul sebagai sosok rekonsiliator. Ia mencoba merespon pertikaian tersebut lewat kitabnya yang berjudul “Tanbi>h al-Ma>shi”. Sebagai eksponen tasawuf moderat, ia mendasarkan argumentasi terkait paham wah}dat al-wuju>d kepada al-Qur’an. Tulisan ini membincang ayat-ayat al-Qur’an yang digunakan sebagai konfirmasi dalam argumentasi Abdurrauf. Setelah dikelompokan secara tematik-kronologis, tafsiran Abdurrauf terhadap beberapa ayat al-Qur’an yang terkait wah}dat al-wuju>d dianalisis menggunakan teori tafsir sufistik Hussein al-Dhahaby. Secara konklusif dapat dikatakan bahwa uraian Abdurrauf tersebut merupakan sebuah tafsir sufistik versi “s}u>fi-naz}ari” yang menggunakan pola “eisegesis” (dari gagasan ke teks. Hal ini tentunya merepresentasikan sikapnya sebagai rekonsiliator yang kemudian merasa perlu untuk mencari konfirmasi terhadap ayat al-Qur’an dalam evaluasinya terhadap doktrin wah}dat al-wuju>d yang kontroversial ketika itu.  Keywords: Abdurrauf al-Sinkili, wah}dat al-wuju>d, rekonsiliasi, tafsir sufi

  14. Misunderstanding the Other and Shy Signs of Openness: Discourse on the 1992-1995 War in the Current Bosniak and Bosnian Serb Media

    Michal Janíčko

    2015-04-01

    Full Text Available The article deals with how the 1990s civil war in Bosnia and Herzegovina was represented in the media that currently remain influential among Bosniaks and Bosnian Serbs. Critical discourse analysis is used both as a theoretical approach to discourse and as a methodological tool for its study. In the analysis, the civil war discourse in Bosniak and Bosnian Serb media is represented by two daily newspapers on each side. The analysis reveals mutually incompatible representations of the causes and nature of the war, the prevailing absence of dialogue, and the unwillingness of each side to consider the other side’s war victims. Looking at more specific topics, a number of discourses are identified on both sides, among which some present the potential for dialogue with alternative representations. The discourses are interpreted through Bosniak and Bosnian Serb nationalist ideologies. The findings might support further research on the relation between the media and nationalism and on the ongoing Bosnian political dispute concerning the desired nature of the state.

  15. Regional new energy vision for Kakegawa City. Formulation survey report; 2001 nendo Kakegawa shi chiiki shin energy vision sakutei chosa hokokusho

    NONE

    2002-02-01

    For promoting the introduction of new energy and for enhancing people's consciousness of such at Kakegawa City, Shizuoka Prefecture, surveys and studies were conducted involving the energy demand of the city, the amount of new energy resources in existence, and new energy introduction projects, and a vision was formulated. The city consumes approximately 11,638 GJ/year, with the industrial sector consuming 4,896 GJ, the residential/commercial sector 3,608 GJ, and the transportation sector 3,134 GJ. Energy types are electric power, gas oil, heavy oil, gasoline, kerosene, LPG, and town gas, as listed in the descending order in terms of consumption rate. The amount of carbon dioxide resulting from the consumption is estimated at 673,214 t-CO2. Projects for new energy introduction were studied, which involved photovoltaic power generation for the general-purpose gymnasium, kindergartens, the school meal center, and meeting places; introduction of solar heat utilization systems into public facilities; financial support system for the purchase of solar heat utilization apparatuses; refuse-fueled power generation and heat utilization at a new cleaning center; utilization of biogas from garbage and stock raising waste; utilization of woody resources; clean-energy vehicles; and so on. (NEDO)

  16. Plans for promoting district energy-saving visions for City of Wakkanai; Wakkanai-shi chiiki sho energy vision suishin keikakusho

    NONE

    2001-02-01

    The district energy-saving visions and promotion plans therefor are drawn for City of Wakkanai, to promote energy saving and abatement of gas emissions which cause global warming. The conception of the energy-saving introduction project includes introduction of co-generation systems in the facilities of pivotal functions in the city center, and energy-saving systems in a municipal heated pool and public hot spring facilities. The facilities of pivotal functions in the city, e.g., the municipal office buildings, municipal hospital and all-around culture center of the city are supplied with heat in a centralized manner from the energy center, and the energy-saving effect is expected when co-generation systems are introduced in the energy center. The study results indicate that introduction of the co-generation systems in the energy center has a potential energy-saving effect of 2,400Gcal/y. The energy-saving effects are also analyzed for each of the municipal office buildings, municipal hospital, all-around culture center, municipal heated pool and public hot spring facilities, including those potentially realized by improving illumination and air supply/discharge facilities. (NEDO)

  17. Technology Education and Technology Teacher Education in Taiwan, R.O.C. = Zhong Hua Min Guo Ke Ji Jiao Yu Ji qi shi zi Jiao Yu.

    Lee, Lung-Sheng Steven; Wang, Cheng-Pin Peter; Wang, Yen-chao; Shih, Neng-Mu; Yeh, Chung-ching

    Technology education in Taiwan begins with craft work at the elementary school level, and the most important point is the practical application. All junior high school students are required to take the Living Technology course. Content includes technology and life, information and communication, construction and manufacturing, and energy and…

  18. Report on feasibility study of energy-saving visions for City of Mitaka; Mitaka-shi sho energy vision feasibility study hokokusho

    NONE

    2001-02-01

    The feasibility study is implemented to concretely promote the project for the (new energy/energy-saving visions for the City of Mitaka area) aimed at abatement of green effect gases which cause global warming, for which the public facilities are investigated to collect information related to the energy-saving project, and the implementation schemes are studied from the operational and fund aspects. A total of 60 public facilities in the city are studied for energy-saving potentials and their characteristics through the questionnaires and simulation, and placed in the order of priority. The project implementation simulation is conducted, to grasp the long-term energy-saving effect, energy cost reduction and CO2 abatement potentials, if the project is actually implemented. The studies on the 10 facilities indicate that power consumption can be possibly reduced by 1.45 million kWh in the initial year, and the accumulated introduction and abatement costs indicate that the project will produce the first profit of around 49 million yen in 2012. CO2 can be abated by 230 tons-C/year on the average during the 2008 to 2012 period. (NEDO)

  19. Site response variation due to the existence of near-field cracks based on strong motion records in the Shi-Wen river valley, southern Taiwan

    Wu, Chi-Shin; Yu, Teng-To; Peng, Wen-Fei; Yeh, Yeoin-Tein; Lin, Sih-Siao

    2014-10-01

    Site effect analysis has been applied to investigate soil classification, alluvium depth, and fracture detection, although the majority of previous studies have typically focused only on the response of large-scale single structures. In contrast, we investigated the site effect for small-scale cracks using a case study in southern Taiwan to provide a means of monitoring slope stability or foundation integrity in situ using only an accelerometer. We adopted both the reference site and horizontal-to-vertical spectral ratio methods. We obtained seismographs associated with the typhoon-related development of a crack set (52 m long, 5 m deep) in a steep slope and compared the resonance frequency between two conditions (with and without cracks). Moreover, we divided the seismic waves into P, S, and coda waves and examined the seismic source effect. Our results demonstrate that frequencies of 14.5-17.5 Hz are most sensitive to these cracks, particularly for the E-W component of the P-waves, which coincides with the crack’s strike. Peak ground acceleration, which is controlled by seismic moment and attenuated distance, is another important factor determining the resonance results. Our results demonstrate that the ratio of temporal seismic waves can be used to detect the existence of nearby subsurface cracks.

  20. Site response variation due to the existence of near-field cracks based on strong motion records in the Shi-Wen river valley, southern Taiwan

    Wu, Chi-Shin; Yu, Teng-To; Peng, Wen-Fei; Yeh, Yeoin-Tein; Lin, Sih-Siao

    2014-01-01

    Site effect analysis has been applied to investigate soil classification, alluvium depth, and fracture detection, although the majority of previous studies have typically focused only on the response of large-scale single structures. In contrast, we investigated the site effect for small-scale cracks using a case study in southern Taiwan to provide a means of monitoring slope stability or foundation integrity in situ using only an accelerometer. We adopted both the reference site and horizontal-to-vertical spectral ratio methods. We obtained seismographs associated with the typhoon-related development of a crack set (52 m long, 5 m deep) in a steep slope and compared the resonance frequency between two conditions (with and without cracks). Moreover, we divided the seismic waves into P, S, and coda waves and examined the seismic source effect. Our results demonstrate that frequencies of 14.5−17.5 Hz are most sensitive to these cracks, particularly for the E−W component of the P-waves, which coincides with the crack’s strike. Peak ground acceleration, which is controlled by seismic moment and attenuated distance, is another important factor determining the resonance results. Our results demonstrate that the ratio of temporal seismic waves can be used to detect the existence of nearby subsurface cracks. (paper)

  1. Response of bats to light with different spectra: light-shy and agile bat presence is affected by white and green, but not red light

    Spoelstra, K.; van Grunsven, Roy H. A.; Ramakers, J.J.C.; Ferguson, Kim B.; Raap, Thomas; Donners, Maurice; Veenendaal, Elmar M.; Visser, Marcel E.

    Artificial light at night has shown a remarkable increase over the past decades. Effects are reported for many species groups, and include changes in presence, behaviour, physiology and life-history traits. Among these, bats are strongly affected, and how bat species react to light is likely to vary

  2. New energy vision of the Sen'nan city area. Outline; 2001 nendo Sen'nan shi chiiki shin energy vision (Gaiyo ban)

    NONE

    2002-02-01

    For the purpose of promoting the introduction of new energy and enhancing the awareness of it in Sen'nan City, Osaka Prefecture, a new energy vision was worked out, and a version of the outline was made. The policy on new energy introduction was described as follows: to make a great use of solar energy; to promote the spread of low-emission car and other new energy; to construct a system for spread that is connected to cooperation with citizen and education/enlightenment. Concretely, the following were cited: introduction of photovoltaic power generation to the city office/elementary school/junior high school; study of preferential treatment for introduction of solar energy; introduction of low-emission car to official vehicle; study of preferential treatment for introduction of low-emission car; promotion of car sharing by low-emission car; introduction of natural gas cogeneration and fuel cell to the city office; installation of street light using small wind power generation; potential study of small- and medium-size power generation; support for class for new energy experience at elementary/junior high school; potential study of utilization of biomass energy such as bamboo charcoal; study of preferential treatment for new energy to be given to citizen and enterprises in the city; construction/support of energy utilization system using waste, etc. (NEDO)

  3. [History of population problems and their impact on daily lives: an interview with Ms. Haruko Hashimoto, an experienced midwife at Mitaka-shi. Interview by N. Yamashita].

    Hashimoto, H

    1981-03-01

    A Japanese midwife offered firsthand information and personal observations concerning population problems from 1935 to the present time. In prewar Japan except for some upper class women birth control was not exercised among the ordinary public. At the beginning of World War II a woman who produced 12 children received an award. Birth control was not included in the curriculum for midwives at that time. Postwar baby boom reached its peak around 1948, when the government recognized the need and launched the Eugenic Protection Law. The Eugenic Protection Law was amended a year later and it approved of financial reasons for abortion. By 1952 eugenic counseling became a part of public health clinic duties, and abortion was legalized. 1,170,000 cases of abortion were performed in Japan around 1955. Since abortion is harmful for mothers, the government installed the program called "birth control instructor" as a part of amended eugenic protection law. A birth control instructor license was given to the trained midwives, public health nurses, and nurses. Not only the central government but also local governments allocated funds for the family planning campaign. Around 1965 during the accelerated economic growth the government tried to change its position on family planning to encourage births to supply labor for the growing industries. Japanese people continued to limit their family size voluntarily for a better standard of living. Maternal/child Health Law was passed in 1965, and qualified midwives and public health nurses advocated and instructed family planning at the time of expectant mothers' and newborns' regular visits.

  4. New energy vision at Sabae City. Toward realization of 'environmental international city'; 2001 nendo Sabae shi chiiki shin energy vision. Kankyo kokusai toshi Sabae no jitsugen ni mukete

    NONE

    2002-03-01

    With an object of accelerating introduction of and uplifting consciousness on new energies at Sabae City in Fukui Prefecture, a new energy vision was put into order based on the result of the initial stage investigation having been performed in the previous fiscal year. Solar light and solar heat energies will be introduced positively into public facilities, and at the same time works will be implemented to accelerate the proliferation thereof into general households. The target of introduction by the year 2010y is set to 2,600 kW by photovoltaic power generation, and the introduction thereof is planned to schools, nursery schools, municipality operated houses, and unattended facilities. With regard to solar heat water warmer, the present proliferation rate of about 7.3% will be raised to 15%. Regarding wastes generated from industrial areas, efficient energy extraction by thermal recycling is intended on the assumption of suppression of wastes generation, their re-use, and recycling. Systems may include the bio-gas system, cogeneration, and recovery of energies from plastics wastes. For acceleration of proliferation of new energies in general, promotion of introduction will be achieved on mini-wind power generation, small hydroelectric power generation, and fuel cell automobiles. (NEDO)

  5. Report on feasibility study of district energy-saving and waste heat utilization for City of Iwai; Iwai-shi chiiki sho energy hainetsu riyo kanosei chosa hokokusho

    NONE

    2001-03-01

    As part of the (district energy-saving visions for City of Iwai), the feasibility study is implemented for citizen community facilities which utilize waste heat discharged from factories in the city. More concretely, those items studied include a heated pool, other community facilities and botanical garden of tropical plants which utilize waste heat of exhaust gas cooling water heated to around 70 degrees C by a desulfurization unit at a pulp factory. Case 1 includes the citizen community facilities (e.g., heated pool and bath facilities), and Case 2 includes a green house botanical garden, involving studies on facility scales, requirements of heat and recycling water, hot water supply, air conditioning, bath systems, and heating systems for green houses. It is estimated that the citizen community facilities have an energy saving effect of 640kL/y as fuel oil, which corresponds to saving of around 29 million yen/y, and CO2 abatement effect of 471t/y as carbon, and that the green house botanical garden has an energy saving effect of 669kL/y as fuel oil, which corresponds to saving of around 30 million yen/y, and CO2 abatement effect of 492t/y as carbon. (NEDO)

  6. Feng xian tai du yu jiao yu he zhi ye xuan ze xing wei: yi ge shi yan fang fa de yan jiu an li

    Ding, X.; Sun, Y.; Hartog, J.

    2009-01-01

    An experimental study on risk attitude and choice behavior of education and career This paper introduces a research on risk attitude and choice behavior of education and career. Using the experimental methods, this study focuses on testing the reliability and validity of risk attitude measurement.

  7. Effect of Land Use Change on Soil Carbon Storage over the Last 40 Years in the Shi Yang River Basin, China

    Shurong Yang

    2018-01-01

    Full Text Available Accounting for one quarter of China’s land area, the endorheic Shiyang River basin is a vast semi-arid to arid region in China’s northwest. Exploring the impact of changes in land use on this arid area’s carbon budget under global warming is a key component to global climate change research. Variation in the region’s soil carbon storage due to land use changes occurring between 1973 and 2012 was estimated. The results show that land use change has a significant impact on the soil carbon budget, with soil carbon storage having decreased by 3.89 Tg between 1973 and 2012. Grassland stored the greatest amount of soil carbon (114.34 Mg ha−1, whereas considerably lower carbon storage occurred in woodland (58.53 Mg ha−1, cropland (26.75 Mg ha−1 and unused land (13.47 Mg ha−1. Grasslands transformed into cropland, and woodlands degraded into grassland have substantially reduced soil carbon storage, suggesting that measures should be adopted to reverse this trend to improve soil productivity.

  8. Shy, but funny? Examining peer-valued characteristics as moderators of the associations between anxious-withdrawal and peer outcomes during early adolescence.

    Markovic, Andrea; Bowker, Julie C

    2015-04-01

    Research has revealed significant heterogeneity in the group-level peer outcomes associated with anxious-withdrawal, but little is known about possible sources of this heterogeneity during early adolescence. This study of 271 young adolescents (49 % female; M age = 11.54 years) examined whether the concurrent and short-term longitudinal (3 month period) associations between peer-nominated anxious-withdrawn behaviors and three group-level peer outcomes (overt victimization, peer acceptance, popularity) varied as a function of peer-valued characteristics (humor, prosocial behavior, physical attractiveness, athletic ability) and gender, after accounting for the effects of involvement in mutual friendships. Regression analyses revealed that the associations between anxious-withdrawal and peer outcomes were moderated by peer-valued characteristics and, in many cases, gender. For example, anxious-withdrawal was related positively to overt victimization for all adolescents who were high in prosocial behavior. But, anxious-withdrawal was related negatively to popularity for adolescent boys who were high in prosocial behavior and adolescent girls who were low in prosocial behavior. Anxious-withdrawal also predicted increases in acceptance for adolescent girls who were high in humor, but decreases in acceptance for adolescent boys who were high in humor. Several additional moderator effects were found for boys only. The findings highlight the importance of considering the unique constellation of characteristics displayed by anxious-withdrawn young adolescents in studies on peer experiences at the group-level of social complexity.

  9. Private I: The Protagonists in Lynne Rae Perkins' Newbery-Winning Novel Are Shy, Talented, and Extremely Thoughtful--Kind of Like the Author

    Barstow, Barb

    2006-01-01

    Lynne Rae Perkins is the author of "Criss Cross," which won the Newbery Medal, the nation's most prestigious prize for children's book. Perkins grew up in Cheswick, PA, near Pittsburgh, majored in printmaking at Penn State, and attended grad school at the University of Wisconsin-Milwaukee. She moved to Leelanau County, MI, in 1987 with her…

  10. FY 2000 Project report on survey for drawing district energy-saving visions for City of Ginowan; 2000 nendo Ginowan-shi sho energy vision sakutei chosa hokokusho

    NONE

    2001-02-01

    The Ginowan municipal energy-saving vision drawing committee is established. It is responsible for drawing the energy-saving visions for the city, to study the basic guidelines and promotion measures for energy saving and promote the energy-saving measures suitable for the local characteristics. The studied items include background of and basic guidelines for the plans, analysis of energy consumption, survey on energy-saving consciousness and actual situations, prediction of potentially saved energy, drawing of the basic plans for energy saving and plan implementation programs, and surveys on preceding examples. The action plans include green planning for and revamping of public facilities, green purchasing, energy-saving diagnosis, drawing the design guidelines for energy saving and environmental considerations in public facilities, introduction of low-pollution local transportation systems, drawing the environment-related technology lists, including energy saving, and promotion of clean energy vehicles. (NEDO)

  11. A systemic administration of liposomal curcumin inhibits radiation pneumonitis and sensitizes lung carcinoma to radiation

    Shi HS

    2012-05-01

    Full Text Available Hua-shan Shi1,* Xiang Gao,1,3,* Dan Li,1,* Qiong-wen Zhang,1 Yong-sheng Wang,2 Yu Zheng,1 Lu-Lu Cai,1 Ren-ming Zhong,2 Ao Rui,1 Zhi-yong Li,1 Hao Zheng,1 Xian-cheng Chen,1 Li-juan Chen,11State Key Laboratory of Biotherapy and Cancer Center, West China Hospital, West China Medicine School, Sichuan University, Chengdu, Sichuan, People's Republic of China; 2State Key Laboratory of Biotherapy and Department of Thoracic Oncology, West China Hospital, West China Medical School, Sichuan University, Chengdu, Sichuan, People's Republic of China; 3Deparment of Pathophysiology, College of Preclinical and Forensic Medical Sciences, Sichuan University, Chengdu, People's Republic of China*These authors contributed equally to this workAbstract: Radiation pneumonitis (RP is an important dose-limiting toxicity during thoracic radiotherapy. Previous investigations have shown that curcumin is used for the treatment of inflammatory conditions and cancer, suggesting that curcumin may prevent RP and sensitize cancer cells to irradiation. However, the clinical advancement of curcumin is limited by its poor water solubility and low bioavailability after oral administration. Here, a water-soluble liposomal curcumin system was developed to investigate its prevention and sensitizing effects by an intravenous administration manner in mice models. The results showed that liposomal curcumin inhibited nuclear factor-κB pathway and downregulated inflammatory factors including tumor necrosis factor-α, interleukin (IL-6, IL-8, and transforming growth factor-β induced by thoracic irradiation. Furthermore, the combined treatment with liposomal curcumin and radiotherapy increased intratumoral apoptosis and microvessel responses to irradiation in vivo. The significantly enhanced inhibition of tumor growth also was observed in a murine lung carcinoma (LL/2 model. There were no obvious toxicities observed in mice. The current results indicate that liposomal curcumin can effectively

  12. Codelivery of curcumin and doxorubicin by MPEG-PCL results in improved efficacy of systemically administered chemotherapy in mice with lung cancer

    Wang BL

    2013-09-01

    Full Text Available Bi-Lan Wang,1,* Yong-mei Shen,1,3,* Qiong-wen Zhang,1,* Yu-li Li,1 Min Luo,1 Ze Liu,1,2 Yan Li,1 Zhi-yong Qian,1 Xiang Gao,1 Hua-shan Shi1,2 1State Key Laboratory of Biotherapy and Cancer Center, West China Hospital, West China Medicine School, Sichuan University, Chengdu, Sichuan, 2State Key Laboratory of Biotherapy and Department of Head and Neck Oncology, West China Hospital, West China Medical School, Sichuan University, Chengdu, Sichuan, 3Sichuang Haoyisheng Pharmacy, Chengdu, People’s Republic of China *These authors contributed equally to this work Abstract: Systemic administration of chemotherapy for cancer often has toxic side effects, limiting the doses that can be used in its treatment. In this study, we developed methoxy poly(ethylene glycol-poly(caprolactone (MPEG-PCL micelles loaded with curcumin and doxorubicin (Cur-Dox/MPEG-PCL that were tolerated by recipient mice and had enhanced antitumor effects and fewer side effects. It was shown that these Cur-Dox/MPEG-PCL micelles could release curcumin and doxorubicin slowly in vitro. The long circulation time of MPEG-PCL micelles and the slow rate of release of curcumin and doxorubicin in vivo may help to maintain plasma concentrations of active drug. We also demonstrated that Cur-Dox/MPEG-PCL had improved antitumor effects both in vivo and in vitro. The mechanism by which Cur-Dox/MPEG-PCL micelles inhibit lung cancer might involve increased apoptosis of tumor cells and inhibition of tumor angiogenesis. We found advantages using Cur-Dox/MPEG-PCL micelles in the treatment of cancer, with Cur-Dox/MPEG-PCL achieving better inhibition of LL/2 lung cancer growth in vivo and in vitro. Our study indicates that Cur-Dox/MPEG-PCL micelles may be an effective treatment strategy for cancer in the future. Keywords: methoxy poly(ethylene glycol, poly(caprolactone, curcumin, doxorubicin, micelles, cancer, treatment

  13. Discussion of "Carbon benefits of wolfberry plantation on secondary saline land in Jingtai oasis, Gansu - A case study on application of the CBP model" by Yaolin Wang, Chuanyan Zhao, Quanlin Ma, Yingke Li, Hujia Jing, Tao Sun, Eleanor Milne, Mark Easter, Keith Paustian, Hoi Wen Au Yong, John McDonagh (2015) [Journal of Environmental Management 157, 303-310].

    Azarnivand, Ali

    2015-12-01

    Wang et al. (2015) employed driving force-pressure-state-impact-response (DPSIR) framework to provide a robust decision-making structure for carbon emission reduction by use of wolfberry plantation in the Jingtai oasis, China. DPSIR appropriately identified the causes of problem along with adopting the responses to the barriers associated with wolfberry plantation. However, the discusser argues that, the paper could have prepared more viable outcomes, if the authors had used causal network rather than causal chains through the DPSIR framework. Furthermore, they could have quantified the mutual relationship among the relevant factors to provide a detailed economic assessment. With this knowledge in hand, the current discussion letter suggests eDPSIR and meDPSIR to address drawbacks regarding conventional DPSIR framework. Due to proper performance of eDPSIR and meDPSIR, they are recommended as practical tools in the future environmental studies. Copyright © 2015 Elsevier Ltd. All rights reserved.

  14. Preparation and characterization of solid lipid nanoparticles loaded with frankincense and myrrh oil

    Shi F

    2012-04-01

    Full Text Available Feng Shi, Ji-Hui Zhao, Ying Liu, Zhi Wang, Yong-Tai Zhang, Nian-Ping FengSchool of Pharmacy, Shanghai University of Traditional Chinese Medicine, Shanghai, People's Republic of ChinaAbstract: The aim of the present study was to prepare solid lipid nanoparticles (SLNs for the oral delivery of frankincense and myrrh essential oils (FMO. Aqueous dispersions of SLNs were successfully prepared by a high-pressure homogenization method using Compritol 888 ATO as the solid lipid and soybean lecithin and Tween 80 as the surfactants. The properties of the SLNs such as particle size, zeta potential (ZP, and drug encapsulation efficiency (EE were investigated. The morphology of SLNs was observed by transmission electron microscopy (TEM. The crystallinity of the formulation was analyzed by differential scanning calorimetry (DSC and X-ray diffraction (XRD. In addition, drug evaporation release and antitumor activity were also studied. Round SLNs with a mean size of 113.3 ± 3.6 nm, a ZP of -16.8 ± 0.4 mV, and an EE of 80.60% ± 1.11% were obtained. DSC and XRD measurements revealed that less ordered structures were formed in the inner cores of the SLN particles. Evaporation loss of the active components in FMO could be reduced in the SLNs. Furthermore, the SLN formulation increased the antitumor efficacy of FMO in H22-bearing Kunming mice. Hence, the presented SLNs can be used as drug carriers for hydrophobic oil drugs extracted from traditional Chinese medicines.Keywords: solid lipid nanoparticles, frankincense oil, myrrh oil, evaporation release, antitumor activity, traditional Chinese medicine

  15. The 2nd International Conference on Water Resource and Environment (WRE 2016

    Zhouli Liu

    2016-11-01

    Full Text Available Table of contents 01 The eco-toxicological effects of cadmium stress on five ornamental plants Zhouli Liu, Wei Chen, Xingyuan He, Shuai Yu, Weihang Ding 02 Study on the formation and release mechanisms of hydrogen sulfide in Longtan coal mine Jianjun Liu, Yuliang Wu, Kaixiang Fan 03 Coral bleaching in the North Reef of China’s Xisha Islands in 2014 Yuanchao Li, Xinqing Zheng, Shiquan Chen, Haiqun Xie 04 Soil chemical characteristics in a Cunninghamia lanceolata stand suffering from ice-snow damage Jie Li, Zhuomin Wang, Li Xue 05 Diversity of understory vegetation was under a Cunninghamia lanceolata stand suffering from ice-snow damage Zhiyang Lie, Weilong Huang, Tongtong Zhou, Li Xue 06 The effect of water, nitrogen and harvesting time on yield and biomass allocation of Helianthus tuberosus L. Kai Gao, Tiexia Zhu 07 The vertical variation of microbial communities in the sediment of sea cucumber pond Weiteng Mao, Pei Yu, Xinfang Lv, Yunchun Li 08 Indicating significances of alpine plant functional groups to environmental change Peixi Su, Rui Shi 09 Research on the daily CH4 fluxes of soil in summer mangrove community at Yingluogang of Guangxi, China Yong Jiang, Xingbin Chen, Shichu liang 10 Beach protection structures in middle and lower reaches of Yangtze River Junfeng Xu 11 Social responsibility management of large dam project with owner as core: an empirical case in China Jiwei Zhu, Zhao Zhai, Linan Zhou, Yun Le, Li Cao 12 The ecological function value assessment analysis of urban waterfront Jiwei Zhu, Ping Lu, Zhiqian Huang, Bei Zhou 13 Mechanism of diurnal osmotic potential changes and adjustment of three Caragana species in different habitats of the Inner Mongolia Plateau Zhirong Zheng, Shihai Lv, Chaoyang Feng 14 Biodiversity of phytoplankton and environmental influences analysis of Longfeng Wetland, China Nan Song, Yan Liu, Xinxin Lu, Yawen Fan 15 The effect of human activities on culturable soil microbes from Yaoquan Mountain in

  16. Biocompatibility of chitosan-coated iron oxide nanoparticles with osteoblast cells

    Shi S

    2012-10-01

    Full Text Available Si-Feng Shi,1 Jing-Fu Jia,2 Xiao-Kui Guo,3 Ya-Ping Zhao,2 De-Sheng Chen,1 Yong-Yuan Guo,1 Tao Cheng,1 Xian-Long Zhang11Department of Orthopedic Surgery, Shanghai Sixth People’s Hospital, School of Medicine, 2School of Chemistry and Chemical Technology, 3Department of Medical Microbiology and Parasitology, School of Medicine, Shanghai Jiao Tong University Shanghai, ChinaBackground: Bone disorders (including osteoporosis, loosening of a prosthesis, and bone infections are of great concern to the medical community and are difficult to cure. Therapies are available to treat such diseases, but all have drawbacks and are not specifically targeted to the site of disease. Chitosan is widely used in the biomedical community, including for orthopedic applications. The aim of the present study was to coat chitosan onto iron oxide nanoparticles and to determine its effect on the proliferation and differentiation of osteoblasts.Methods: Nanoparticles were characterized using transmission electron microscopy, dynamic light scattering, x-ray diffraction, zeta potential, and vibrating sample magnetometry. Uptake of nanoparticles by osteoblasts was studied by transmission electron microscopy and Prussian blue staining. Viability and proliferation of osteoblasts were measured in the presence of uncoated iron oxide magnetic nanoparticles or those coated with chitosan. Lactate dehydrogenase, alkaline phosphatase, total protein synthesis, and extracellular calcium deposition was studied in the presence of the nanoparticles.Results: Chitosan-coated iron oxide nanoparticles enhanced osteoblast proliferation, decreased cell membrane damage, and promoted cell differentiation, as indicated by an increase in alkaline phosphatase and extracellular calcium deposition. Chitosan-coated iron oxide nanoparticles showed good compatibility with osteoblasts.Conclusion: Further research is necessary to optimize magnetic nanoparticles for the treatment of bone disease

  17. Mechanisms underlying probucol-induced hERG-channel deficiency

    Shi YQ

    2015-07-01

    Full Text Available Yuan-Qi Shi,1,* Cai-Chuan Yan,1,* Xiao Zhang,1 Meng Yan,1 Li-Rong Liu,1 Huai-Ze Geng,1 Lin Lv,1 Bao-Xin Li1,21Department of Pharmacology, Harbin Medical University, 2State-Province Key Laboratory of Biopharmaceutical Engineering, Harbin, Heilongjiang, People’s Republic of China*These authors contributed equally to this workAbstract: The hERG gene encodes the pore-forming α-subunit of the rapidly activating delayed rectifier potassium channel (IKr, which is important for cardiac repolarization. Reduction of IhERG due to genetic mutations or drug interferences causes long QT syndrome, leading to life-threatening cardiac arrhythmias (torsades de pointes or sudden death. Probucol is a cholesterol-lowering drug that could reduce hERG current by decreasing plasma membrane hERG protein expression and eventually cause long QT syndrome. Here, we investigated the mechanisms of probucol effects on IhERG and hERG-channel expression. Our data demonstrated that probucol reduces SGK1 expression, known as SGK isoform, in a concentration-dependent manner, resulting in downregulation of phosphorylated E3 ubiquitin ligase Nedd4-2 expression, but not the total level of Nedd4-2. As a result, the hERG protein reduces, due to the enhanced ubiquitination level. On the contrary, carbachol could enhance the phosphorylation level of Nedd4-2 as an alternative to SGK1, and thus rescue the ubiquitin-mediated degradation of hERG channels caused by probucol. These discoveries provide a novel mechanism of probucol-induced hERG-channel deficiency, and imply that carbachol or its analog may serve as potential therapeutic compounds for the handling of probucol cardiotoxicity.Keywords: long QT, hERG potassium channels, probucol, SGK1, Nedd4-2

  18. Clinical characteristics of the first cases of invasive candidiasis in China due to pan-echinocandin-resistant Candida tropicalis and Candida glabrata isolates with delineation of their resistance mechanisms

    Xiao M

    2018-01-01

    Full Text Available Meng Xiao,1,2,* Xin Fan,1–3,* Xin Hou,1,2,4,* Sharon CA Chen,5 He Wang,1,2 Fanrong Kong,5 Zi-Yong Sun,6,* Yun-Zhuo Chu,7 Ying-Chun Xu1,2 1Department of Clinical Laboratory, Peking Union Medical College Hospital, Chinese Academy of Medical Sciences, Beijing, People’s Republic of China; 2Beijing Key Laboratory for Mechanisms Research and Precision Diagnosis of Invasive Fungal Diseases, Beijing, People’s Republic of China; 3Department of Infectious Diseases and Clinical Microbiology, Beijing Chaoyang Hospital, Beijing, People’s Republic of China; 4Graduate School, Peking Union Medical College, Chinese Academy of Medical Sciences, Beijing, People’s Republic of China; 5Center for Infectious Diseases and Microbiology Laboratory Services, ICPMR, New South Wales Health Pathology, Westmead Hospital, The University of Sydney, NSW, Australia; 6Department of Clinical Laboratory, Tongji Hospital, Huazhong University of Science and Technology, Wuhan, People’s Republic of China; 7Department of Clinical Laboratory, The First Affiliated Hospital of Chinese Medical University, Shenyang, People’s Republic of China *These authors contributed equally to this work Abstract: Echinocandin antifungal agents have become the first-line therapy for invasive candidiasis (IC in many countries. Despite their increasing use, resistance to this class of drug is, overall, still uncommon. Here, we report two patients from the People’s Republic of China with IC, one with infection caused by pan-echinocandin-resistant Candida tropicalis and the other by pan-echinocandin-resistant Candida glabrata. We also describe the mechanisms of drug resistance of these isolates. The echinocandin-resistant C. glabrata isolate was cultured from ascitic fluid of a 46-year-old male patient with intra-abdominal IC developing after surgery in 2012. This patient had had no prior antifungal exposure. The echinocandin-resistant C. tropicalis isolate was cultured from chest drainage

  19. Review of the genus Pentacentrus Saussure (Orthoptera: Gryllidae: Pentacentrinae) from China .

    Liu, Hao-Yu; Mao, Shao-Li; Shi, Fu-Ming

    2014-07-22

    Four new species of Pentacentrus Gorochov from China are described and illustrated, P. acutiparamerus Liu & Shi sp. nov., P. biflexuous Liu & Shi sp. nov., P. emarginatus Liu & Shi sp. nov. and P. parvulus Liu & Shi sp. nov. A key and a distribution map of the Chinese species of this genus are provided.

  20. Prognostic factors for survival among patients with primary bone sarcomas of small bones

    Wang Z

    2018-05-01

    Full Text Available Zhan Wang,1,* Shu Li,2,* Yong Li,1 Nong Lin,1 Xin Huang,1 Meng Liu,1 Weibo Pan,1 Xiaobo Yan,1 Lingling Sun,1 Hengyuan, Li,1 Binghao Li,1 Hao Qu,1 Yan Wu,1 Peng Lin,1 Zhaoming Ye1 1Department of Orthopaedics, The Second Affiliated Hospital of Zhejiang University School of Medicine, Centre for Orthopaedic Research, Orthopedics Research Institute of Zhejiang University, Hangzhou, China; 2Key Laboratory of Cancer Prevention and Intervention, Key Laboratory of Molecular Biology in Medical Sciences, National Ministry of Education, Department of Hematology, The Second Affiliated Hospital, Zhejiang University School of Medicine, Cancer Institute, Hangzhou, China *These authors contributed equally to this work Background: Primary bone sarcomas of the hands or feet are rare lesions and poorly documented. Moreover, the prognostic determinants of bone sarcomas of the hands or feet have not been reported. Materials and methods: The Surveillance, Epidemiology, and End Results (SEER program database was used to screen patients with bone sarcomas of the hands or feet from 1973 to 2013, with attention paid to chondrosarcoma, Ewing sarcoma, and osteosarcoma. The prognostic values of overall survival (OS and cancer-specific survival (CSS were assessed using Cox proportional hazards regression model with univariate and multivariate analyses. The Kaplan–Meier method was used to obtain OS and CSS curves. Results: A total of 457 cases were selected from the SEER database. Chondrosarcoma was the most common form of lesion in hands or feet or both, followed by Ewing sarcoma and osteosarcoma. The 5- and 10-year OS rates of the entire group were 75.7% and 66.1%, respectively. The 5- and 10-year CSS rates were 78.7% and 73.7%, respectively. Multivariate analysis revealed that age under 40 years, localized stage, low grade, surgical treatment, and first primary tumor were associated with improved OS, and decade of diagnosis, stage, grade, and surgery were independent

  1. Concurrent radiotherapy with oral fluoropyrimidine versus gemcitabine in locally advanced pancreatic cancer: a systematic review and meta-analysis

    Yang YF

    2015-11-01

    Full Text Available Yong-Feng Yang,1 Xiao-Hui Cao,1 Chao-En Bao,1 Xin Wan2 1Department of Radiation Oncology, Third Hospital of Hebei Medical University, Shijiazhuang, People’s Republic of China; 2Department of Radiation Oncology, Fourth Hospital of Hebei Medical University, Shijiazhuang, People’s Republic of China Background: Gemcitabine (GEM is the most widely utilized systemic agent in combination with radiation therapy (RT for treating locally advanced pancreatic cancer (LAPC in the concurrent setting. Despite recent interest in using two novel oral fluoropyrimidines (FUs, capecitabine and S-1, in this setting, there is a lack of randomized controlled trials (RCTs to support this approach.Methods: Trials published between 1994 and 2014 were identified by an electronic search of public databases (Medline, Embase, and the Cochrane Library. All prospective studies were independently identified by two authors for inclusion. Demographic data, treatment response, objective response rate (ORR, progression-free and overall survival (PFS and OS, respectively, and toxicities were extracted and analyzed using comprehensive meta-analysis software (version 2.0.Results: Twenty-three cohorts with 843 patients were included: 497 patients were treated with GEM and 346 patients were treated with oral FU. Pooled OS was significantly higher at 1 and 2 years for S-1 plus RT than for GEM plus RT (relative risk [RR] 1.27; 95% confidence interval [CI], 1.00–1.65; P=0.03; and RR 1.75; 95% CI, 1.18–2.60, P=0.002, respectively, while 1-year PFS and ORR were not significantly different between S-1 and GEM-based chemoradiotherapy (P=0.37 and P=0.06, respectively. Additionally, comparable efficacy was found between capecitabine and GEM-based chemoradiotherapy in terms of OS, PFS, and ORR. As for grade 3 and 4 acute toxicity, oral FU plus RT significantly reduced the risk of developing hematologic toxicities, nausea, and vomiting when compared to GEM plus RT (P<0.001.Conclusions

  2. Clinical applications of somatostatin analogs for growth hormone-secreting pituitary adenomas

    Wang JW

    2014-01-01

    Full Text Available Ji-wen Wang,1,2 Ying Li,3 Zhi-gang Mao,1,2 Bin Hu,1,2 Xiao-bing Jiang,1,2 Bing-bing Song,4 Xin Wang,4 Yong-hong Zhu,4 Hai-jun Wang1,21Department of Neurosurgery and Pituitary Tumor Center, The First Affiliated Hospital, Sun Yat-sen University, 2Key Laboratory of Pituitary Adenoma in Guangdong Province, 3State Key Laboratory of Ophthalmology, Zhongshan Ophthalmic Center, Sun Yat-sen University, 4Department of Histology and Embryology, Zhongshan School of Medicine, Sun Yat-sen University, Guangzhou, People's Republic of ChinaAbstract: Excessive growth hormone (GH is usually secreted by GH-secreting pituitary adenomas and causes gigantism in juveniles or acromegaly in adults. The clinical complications involving cardiovascular, respiratory, and metabolic systems lead to elevated morbidity in acromegaly. Control of serum GH and insulin-like growth factor (IGF 1 hypersecretion by surgery or pharmacotherapy can decrease morbidity. Current pharmacotherapy includes somatostatin analogs (SAs and GH receptor antagonist; the former consists of lanreotide Autogel (ATG and octreotide long-acting release (LAR, and the latter refers to pegvisomant. As primary medical therapy, lanreotide ATG and octreotide LAR can be supplied in a long-lasting formulation to achieve biochemical control of GH and IGF-1 by subcutaneous injection every 4–6 weeks. Lanreotide ATG and octreotide LAR provide an effective medical treatment, whether as a primary or secondary therapy, for the treatment of GH-secreting pituitary adenoma; however, to maximize benefits with the least cost, several points should be emphasized before the application of SAs. A comprehensive assessment, especially of the observation of clinical predictors and preselection of SA treatment, should be completed in advance. A treatment process lasting at least 3 months should be implemented to achieve a long-term stable blood concentration. More satisfactory surgical outcomes for noninvasive macroadenomas treated

  3. Papillary thyroid carcinoma risk factors in the Yunnan plateau of southwestern China

    Zeng R

    2016-06-01

    Full Text Available Rong Zeng,1–3 Tao Shou,3 Kun-xian Yang,4 Tao Shen,5 Jin-ping Zhang,5 Rong-xia Zuo,5 Yong-qing Zheng,5 Xin-ming Yan5 1Faculty of Environmental Science and Engineering, Kunming University of Science and Technology, Kunming, People’s Republic of China; 2Faculty of Life Science and Technology, Kunming University of Science and Technology, Kunming, People’s Republic of China; 3Medical Oncology, The First People’s Hospital of Yunnan Province, Kunming, People’s Republic of China; 4Surgical Oncology, The First People’s Hospital of Yunnan Province Kunming, People’s Republic of China; 5Institute of Clinical and Basic Medicine Research, The Affiliated Hospital of Kunming University of Science and Technology, Kunming, People’s Republic of China Objective: This study investigated clinical and pathological characteristics and risk factors in papillary thyroid carcinoma (PTC patients’ native to Yunnan plateau in southwestern China. Methods: Clinical data from 1,198 patients diagnosed with PTC (n=578 and control subjects (n=620 with benign thyroid disease (ie, thyroid nodule disease, benign thyroid diseases [BTD] in Yunnan province were analyzed retrospectively. Results: The mean patient age was lower for PTC than for BTD. Positive ratios of thyroid peroxidase antibody, thyroglobulin antibody (TGAb, and thyrotrophin receptor antibody (TRAb were higher in PTC than in BTD patients. The ratio of PTC coexisting with Hashimoto’s thyroiditis (HT or with lymphocytic thyroiditis was higher than that of BTD. The number of patients whose age at menarche was ≤13 years, who had given birth to less than or equal to two children, or who were in premenopause were higher in the PTC than in the BTD group. Multivariate conditional logistic regression analyses revealed that age >45 years, nodal size >1 cm, and elevated TG levels were protective factors against PTC. Abnormally elevated TGAb and TRAb levels were independent risk factors for PTC in females

  4. Differentiating Social Phobia from Shyness

    Heiser, Nancy A.; Turner, Samuel M.; Beidel, Deborah C.; Roberson-Nay, Roxann

    2008-01-01

    To clarify the relationship between social phobia and shyness, this study examined the characteristics of highly shy persons with social phobia, highly shy persons without social phobia, and non-shy persons. Those with social phobia reported more symptomatology, more functional impairment, and a lower quality of life than those without social phobia. About one-third of the highly shy without social phobia reported no social fears, highlighting heterogeneity of the shy. The social phobia group...

  5. North Korean Civil-Military Trends: Military-First Politics to a Point

    2006-09-01

    to the Great Leader. Yi Yong Mu. The NDC’s impact on the formal leadership lineup was made clear by 2001, when Yi Yong Mu, vice chairman of the NDC...to be restricted, as are career bonds that could come about between officers through sequential appointments to same commands. • First time

  6. Journal of Genetics | Indian Academy of Sciences

    Home; Journals; Journal of Genetics. ZI-JING ZHANG. Articles written in Journal of Genetics. Volume 96 Issue 4 September 2017 pp 535-544 RESEARCH ARTICLE. Effects of genetic variants of the bovine WNT8A gene on nine important growth traits in beef cattle · YONG-ZHEN HUANG YONG ZOU QING LIN HUA HE LI ...

  7. Bulletin of Materials Science | Indian Academy of Sciences

    Home; Journals; Bulletin of Materials Science. YONG J IANG. Articles written in Bulletin of Materials Science. Volume 40 Issue 6 October 2017 pp 1255-1261. Molecular dynamics study on the relaxation properties of bilayered graphene with defects · WEI ZHANG JIU-REN YIN PING ZHANG YAN-HUAI DING YONG J IANG.

  8. On the data between the ratio of new supply houses at four tenures in Japan. At 47 prefectures and 80 cities; 300,000 and more population on 1995; Shinsetsu chako jutaku no riyo kankeibetsu deta. 47 todofuken and 80 toshi (jinko 300,000 nin 'heisei 7 {center_dot} kokucho' ijo narabini kencho shozaishi)(1993 {approx} 1997)

    Iida, Toshihiko; Kojina, Kyoji

    1999-03-01

    On the owned tenure, the average construction-started ratio spreaded from 1.15 houses in Amagasaki-shi to 6.30 houses in Hamamatsu-shi during 1983 {approx} 1987, the same values spreaded from 1.42 houses in Amagasaki-shi to 5083 houses in Akita-shi during 1988 {approx} 1992 and the same values spreaded from 1.44 houses in Osaka-shi to 6.67 houses in Aomori-shi during 1993 {approx} 1997. 2nd on the rental tenure, the average construction-started ratio spreaded from 1.88 house in Sakai-shi to 14.32 houses in Ichikawa-shi during 1983 {approx} 1987, the same values spreaded from 3.72 houses in Sakai-shi to 13.93 houses in Kawasaki-shi during 1988 {approx} 1992 and from 2.82 houses in Yokosuka-shi to 9.88 houses in Sendai-shi during 1993 {approx} 1997, espicialy 13.17 houses in Nishinomiya-shi. 3rd on the issued tenure, the average construction-started ratio spreaded from 0.05 houses in Maebashi-shi 0.45 houses in Mito-shi during 1983 {approx} 1992 and from 0.02 houses in Naha-shi to 0.74 houses in Omiya-shi during 1993 {approx} 1997, espicialy 1.00 houses in Nishinomiya-shi. 4th on the for-sale tenure, the average construction-started ratio spraeded from 0.36 houses in Kurashiki-shi 5.65 houses in Kobe-shi during 1983 {approx} 1987, the same values spreaded from 0.89 houses in Iwaki-shi and Fukui-shi to 6.14 houses in Fukuoka-shi during 1988 {approx} 1992 and from 0.63 houses in Kurashiki-shi to 7.51 houses in Urawa-shi during 1993 {approx} 1997, especially 8.66 houses in Nishinomiya-shi. The construction-started hoses of the rental tenure were leading during this fifteen years, but the construction-started houses of the for-sale tenure were increasing recently in Japan, though the same values of the owned tenure were continuing during this periods. At 80 cities the construction-started ratio of the rental tenure spreaded from 2.61 houses in Kitakyushu-shi to 12.01 houses in Hachioji-shi on 1993, the same values spreaded from 2.41 houses in Toyota-shi to 9.98 houses in

  9. Report on achievements in fiscal 1999 on research and development of the Welfare Techno-system (Chuo Ward, Kobe); 1999 nendo Welfare Techno system kenkyu kaihatsu (Kobe-shi Chuo-ku) seika hokokusho

    NONE

    2000-03-01

    Research and development has been performed on a help and welfare system to transmit and accumulate monitoring data by utilizing a computer system. This paper summarizes the achievements in fiscal 1999. In the research of transmission and management of information on help requiring persons, a server and its peripheral devices were modified to structure a system to measure body temperatures, pulses, and blood pressures, and transmit them to a central server. In the research on support for the visiting helps, a mobile system was developed, which has map information and scheduling function that shows distribution of help requiring persons. In the research of a simulation to link hospitals, medical organizations and homes, the LAN at health facilities for elderly people was structured, and so was a network for linking hospitals, medical organizations and homes (simulated). Investigations and discussions were performed on interface between body information (vital data) measuring instruments and personal computers. Developmental research was executed on private certification office servers and the certification software that consider security in the help systems. (NEDO)

  10. "I don't feel shy because I will be among others who are just like me…": The role of support groups for children perinatally infected with HIV in Zimbabwe.

    Mupambireyi, Zivai; Bernays, Sarah; Bwakura-Dangarembizi, Mutsa; Cowan, Frances M

    2014-10-01

    As access to paediatric antiretroviral therapy (ART) continues to improve in sub-Saharan Africa, a new historically specific cohort of HIV-perinatally infected children surviving into adolescent has emerged. Although remarkable successes have been made clinically in keeping this cohort alive and in reasonable health, their social support experiences are still unknown. The research being reported here sought to explore peer social support experiences of HIV-perinatally infected children in Harare, Zimbabwe. In this article, we draw on 56 repeat in-depth interviews (IDIs) conducted in three phases and two focus group discussions (FGDs) with HIV-infected children (11-13 years). Additional interviews were held with 10 carers. Study findings suggested that both children and carers perceive support groups as a safe social space for learning and acquiring HIV information as well as gaining confidence. Additionally, findings highlighted the importance of consistency of participation. Structural and personal barriers to access and participation in support group were also identified. We conclude that support groups are a useful resource for HIV-infected children and therefore should be supported by stable funding.

  11. Report on the initial-stage survey of the new energy vision of the Izumi city area; 2001 nendo Izumi shi chiiki shin energy vision shoki dankai chosa hokokusho

    NONE

    2002-02-01

    For the purpose of promoting the introduction of new energy and enhancing the awareness of it in Izumi City, Osaka Prefecture, an investigational study was conducted of the structure of energy consumption, existence amount of new energy, subjects in utilization of new energy, etc. The energy consumption amount of the city is increasing mostly in electric power in the residential sector, but is decreasing in the business sector and industrial sector. It is leveling off in the transportation sector, but only the consumption amount of gasoline is markedly increasing. In the potential amount of new energy utilization in the city, the rate of solar energy/clean energy vehicles was high. As a result of the study, the following were made clear: It is effective to introduce new energy mostly used for citizen such as the household use photovoltaic power system/solar heat use hot water supplier/hybrid private car. Of waste energy, wind energy, biomass energy and temperature difference energy, it is effective for city to take the initiative in introducing them. It is effective for city/proprietor to introduce the natural gas cogeneration. (NEDO)

  12. Regional new energy vision for Kamaishi City. Energy to create community's future out of natural resources; 2001 nendo Kamaishi shi chiiki shin energy vision. Megumi kara machi no mirai wo tsukuru energy

    NONE

    2002-02-01

    For promoting the introduction of new energy and for enhancing people's consciousness of such at Kamaishi City, Iwate Prefecture, surveys and studies were conducted involving the amount of energy needed by the city, the amount of new energy resources in existence, and new energy introduction projects, and a vision was formulated. The city consumed 5,334 times 10{sup 12}J in fiscal 1999, which amount occupied 0.034% of the nation-wide consumption. Concerning the total consumed by the city, the manufacturing sector was responsible for 36% and the transportation sector for 24%. Oil provided 60% of the energy, and electric power 24%. These percentages were similar to those found across the nation. The amount of carbon dioxide emissions was estimated to be equivalent to 463-million kg-CO2. Projects for new energy introduction were studied, which included photovoltaic power generation for primary and junior high school buildings, the new city office, road signs along the municipal roads, and the harbor area; hybrid photovoltaic/wind power generation for a newly built fish market; solar heat utilization for heating frozen roads; wind power generation for the Wayama and Naranoki stock farms and for the harbor area; and a business for utilizing waste heat discharged by Kamaishi City's Eco-Town project. (NEDO)

  13. Survey report on project for drawing district energy-saving visions for Town of Aizu Wakamatsu. Preliminary survey; 2000 nendo Aizu Wakamatsu shi chiiki sho energy vision sakutei nado jigyo (shoki dankai chosa) chosa hokokusho

    NONE

    2001-07-01

    The feasibility study is conducted for introduction of the district energy-saving measures in City of Aizu Wakamatsu, for which the actual situations of energy consumption and promising energy-saving measures are surveyed. The city has a typical basinal weather, cold in winter and very hot and humid in summer, and tends to have a longer air-condition period in a year. It is considered that there are many wasteful energy consumption items to be studied for reduction. In the area of moving means, dependence on public transportation systems is considered to be relatively low, suggesting that there are much space of reducing transportation energy by the measures such as self-imposed control on use of private cars, promotion of utilizing public transportation systems and fuel-saving type driving throughout the city. The promising energy-saving measures studied to verify the effects include introduction of PVM analyzers for establishing better cost/effect relationship between power consumed by air-conditioners and pleasantness; introduction of garbage power generation, co-generation and high-efficiency illuminators; improvement of power-factor; and demand control for air conditioning, rationalization of power-receiving facilities, introduction of systems for saving flushing water and improvement of air conditioners' outdoor facilities. (NEDO)

  14. FY 2000 Project report on survey for drawing district energy-saving visions for City of Oguchi; 2000 nendo Oguchi-shi chiiki sho energy vision sakutei nado jigyo chosa hokokusho

    NONE

    2001-02-01

    The energy-saving visions are drawn for City of Oguchi to help spread the energy-saving practices through the citizens, based on the studies on more efficient and realizable energy-saving measures, including effective utilization of district energy. The energy-saving activities cover the following 6 areas: (1) energy demand trends and current status of energy-saving measures, (2) basic environmental conditions related to energy saving in the district, (3) prediction of energy demands, (4) basic conception of the district energy saving, and introduction methodology, (5) energy-saving implementation plans, and (6) promotion of and problems involved in introduction of the energy-saving measures. The energy-saving implementation plans cover the public facilities, household, schools and private enterprises, and the energy-saving measures studied for the public facilities include introduction of microhydroelectric power generation systems for service water and sewer systems, revolving doors for libraries, high-efficiency illumination systems, and various types of solar systems. Those for household include economic utilization of home electric appliances and automobiles, and those for cooperation by the administration and citizens include thorough separation of garbage. (NEDO)

  15. Turbidity, SOLAR RADIATION - ATMOSPHERIC and other data from XIANG YANG HONG 05 and SHI YAN 3 in the Philippine Sea, Indian Ocean and South Pacific Ocean from 1991-11-01 to 1993-11-30 (NODC Accession 9400186)

    National Oceanic and Atmospheric Administration, Department of Commerce — Conductivity, Temperature and Depth (CTD) and other data were collected as part of the Coupled Ocean Atmosphere Response Experiment. Data were collected from Ships...

  16. Fiscal 1999 research report. Basic research for promotion of joint implementation programs (Energy efficiency survey at Noboil Refinery of Ufa City); 1999 nendo Ufa shi Noboil seiyusho ni kansuru sho energy chosa hokokusho

    NONE

    2000-03-01

    The aim is to explore projects that will lead to joint implementations for greenhouse gas emission reduction, and a survey was conducted at the Bashneftechim Refineries, Ufa City, Bashkir Republic, Russian Federation. A feasibility study was carried out involving energy efficiency improvement for oil refining related units such as atmospheric and vacuum distillators. In the energy efficiency survey, studies covered energy efficiency improvement in the existing equipment through the modification of the normal and vacuum distillators, visbreaker, vacuum desulfurizer for light oil, and the process heating furnace of the catalytic cracking equipment, for a reduction in fuel consumption by realizing combustion excess air ratio control; the installation of an air preheater or a waste heater boiler for the collection of heat from combustion exhaust gas; the addition of heat exchangers and the optimization of their arrangement for an increase in the amount of heat recoverable from hot oil; the replacement of obsolete instruments and controllers with state-of-the-art types for higher energy efficiency in the control of distillation tower operation, etc. It is desired that this energy saving project will be embodied for a reduction in CO2 emissions. (NEDO)

  17. FY 2000 report on the basic survey to promote Joint Implementation, etc. Survey of gas-fired cogeneration in Samarkand City; 2000 nendo kyodo jisshii nado suishin kiso chosa hokokusho. Samarkand shi gas daki cogeneration chosa

    NONE

    2001-03-01

    In the existing heat supply plant in Samarkand City in Uzbekistan, feasibility study was conducted of the project aimed at energy conservation and reduction in greenhouse effect gas emission by introducing the repair/cogeneration system of the regional pipes superannuated. In the project, the following were planned: introduction of two units of 6MW class gas turbine cogeneration, introduction of boiler which can realize 90% of the thermal efficiency, replacement of the existing regional pipes with pre-insulated pipes with less water leak/heat loss, etc. As a result of the study, the energy conservation amount was 21,006 toe, and the amount of greenhouse effect gas reduction was 64,998 t-CO2/y. As to the effects vs. expenses, the energy conservation was 2.80 toe/million yen, and the greenhouse effect gas reduction was 8.66 t-CO2-y/million yen. The initial investment amount was 7.51 billion yen, the business profit was 468 million yen/y, and the internal earning rate was 1.133%. It was judged that great profitability was not expected for the project, but the profit was returnable on investment. (NEDO)

  18. Report on the survey for working out the new energy vision of the Sen'nan city area; 2001 nendo Sen'nan shi chiiki shin energy vision sakutei chosa hokokusho

    NONE

    2002-02-01

    For the purpose of promoting the introduction of new energy and enhancing the awareness of it in Sen'nan City, Osaka Prefecture, an investigational study was conducted of the structure of energy demand, existence amount of new energy, project for new energy introduction, etc. The energy consumption amount of the city in FY 1999 was estimated at 4,971TJ. It consisted of 40.6% in the industrial sector, 29.7% in the transportation sector and 29.6% in the commercial/residential sector. The rate of energy source was 48.8% of petroleum, 32.1% of electric power and 19.1% of gas. As the project for new energy introduction, the following were studied: introduction of photovoltaic power generation and solar heat utilization facilities to the city office/elementary school/junior high school/municipal dwelling houses; street light combinedly using photovoltaic power generation and wind power generation; introduction of clean energy vehicle to official vehicle; preferential treatment for introduction of low-emission car for citizen; introduction of natural gas cogeneration and fuel cell to the city office, etc.; introduction of small-size wind power generation/small- and medium-size hydraulic power generation to public facilities, park, etc.; construction of the waste energy utilization system. (NEDO)

  19. FY 2001 report on the initial-stage survey of the project for working out the new energy vision of the Okinawa City area; 2001 nendo Okinawa shi chiiki shin energy vision sakutei chosa. shoki dankai chosa hokokusho

    NONE

    2002-02-01

    For working out a new energy vision in Okinawa City, an investigational survey was conducted, as the initial-stage survey, of the state of energy demand of the city, estimated amount of existence of new energy, proposed project (draft) on new energy introduction, etc. The energy demand amount of Okinawa City was estimated at 6,865 x 10{sup 6} MJ/y. By sector, it consisted of 41.6% in the transportation sector, 35.6% in the commercial/residential sector and 22.8% in the industrial sector. The rate of energy source was 50.5% of petroleum-base fuel, 31.0% of electric power and 9.5% of LP gas. The expected minable amount of new energy was estimated at 318,513 x 10{sup 3} MJ/y, which is equivalent to 17 x the energy consumption amount/day of the city. As the proposed project (draft) for new energy introduction, study was made of the introduction of photovoltaic power system/solar heat utilization system to the children future zone park/elementary school/junior high school/kindergarten/public hall, introduction of clean energy vehicle to official vehicle of the city, refuse incineration power generation/utilization of incineration heat at Kurahama sanitary facilities, and others. (NEDO)

  20. New energy vision of the Tagawa city area. Aiming at a town for symbiosis of humans and the environment; 2001 nendo Tagawa shi chiiki shin energy vision. Hito to kankyo ga kyoseisuru machi wo mezashite

    NONE

    2002-03-01

    For the purpose of promoting the introduction of new energy and enhancing the awareness of it in Tagawa City, Fukuoka Prefecture, an investigational study was conducted of the energy supply/demand of the city, existence amount of new energy, project for new energy introduction, etc., and a vision was worked out. The energy consumption amount of the city was estimated at 6,678,932 GJ/y. It consisted of 42% in the industrial sector, 35% in the transportation sector and 23% in the commercial/residential sector. The rate of energy source was 75% of petroleum-base energy and 25% of electric power. As the project for new energy introduction, the following were studied: power generation/thermal exchange/composting by fermentation of methane from stockbreeding waste; environmental preservation type agriculture such as large-scale hothouse using exhaust heat from cement plant; utilization of ground mine water at coal goaf for space cooling and as water source; introduction of photovoltaic power generation/solar energy use hot water supply system to public facilities; introduction of clean energy car to vehicle in welfare/education fields; preparation of a program for energy environment education; preparation of bases for energy environment education. (NEDO)

  1. Fiscal 2000 report on results of R and D of welfare techno-system in West Ward, Kobe City; 2000 nendo walfare techno system kenkyu kaihatsu (Kobe-shi Nishi-ku) seika hokokusho

    NONE

    2001-03-01

    R and D was conducted on devices for promoting self-support, mitigating nursing care, and improving safety and comfort for the elderly and the disabled, with the fiscal 2000 results reported. In the development of a wheelchair system (small arm sling mountable on a wheelchair) capable of assisting self-support for eating and vocational activity at home, a mounting device of an arm sling was experimentally manufactured for five different types of wheelchairs. In the research on the welfare device support system at a disaster or emergency, the system was modified based on the result of the system operation in the preceding year. Consequently, it became possible to make use of a power from a solar battery, a storage battery and an utility line, and also to reduce instantaneous interruption caused by switching of the self-sustaining operation for example. Further, a load control adaptor linked with an inverter was developed, enabling the system to use electricity for a long period even at the time of power failure. In addition, a conventional simple charge/discharge control was found to cause a marked deterioration in storage cell properties; hence, an accurate charge controller was added. (NEDO)

  2. Fiscal 2000 report on results of R and D of welfare techno-system in Chuo Ward, Kobe City; 2000 nendo walfare techno system kenkyu kaihatsu (Kobe-shi Chuo-ku) seika hokokusho

    NONE

    2001-03-01

    'R and D on systems for supporting care and welfare through transmission and accumulation of monitored data' was conducted for the purpose of assisting the operation of service providers for the elderly in need of care and supporting nursing care at home and at facilities, for which the results in fiscal 2000 was reported. In the development of vital data measuring devices and inter-computer interfaces, a USB or IEEE1394 interface was developed which was for automatically inputting, into personal computers (PC), the information such as body temperature, heart rate and blood pressure of a person requiring care; and the interface was incorporated in the system. In the research on support for home visit care centers, a geographic information system (GIS) and data were selected, which were to be installed on server's side, with linkage with portable PC's carried out. However, it was pointed out that data transmission took time between the server in the center and the portable PC at a home to visit. Further, investigative research on care services at facilities under the care insurance system was conducted, as were studies on linkage between general practitioners and hospitals, and studies on prevention of illegal access and wiretapping, among others. (NEDO)

  3. Turbidity, SOLAR RADIATION - ATMOSPHERIC and other data from XIANG YANG HONG 05 and SHI YAN 3 from 1992-01-01 to 1993-03-30 (NODC Accession 9400187)

    National Oceanic and Atmospheric Administration, Department of Commerce — Conductivity, Temperature and Depth (CTD) and other data were collected as part of the Coupled Ocean Atmosphere Response Experiment. Data were collected from Ships...

  4. Report on achievements in fiscal 1999 on research and development of the Welfare Techno-system (Nishi Ward, Kobe); 1999 nendo Welfare Techno system kenkyu kaihatsu (Kobe-shi Nishi-ku) seika hokokusho

    NONE

    2000-03-01

    Research and development has been performed on devices to enhance autonomy, safety and comfort for elderly and handicapped people in houses and homes. This paper summarizes the achievements in fiscal 1999. In developing wheelchairs to allow autonomy in meal taking and working at homes, a small upper arm holding device that can be installed on a wheelchair was fabricated on the trial basis according to the experience obtained in making the first prototype in the previous fiscal year, and clinical evaluation was given. In the research and development on a safe walk assisting appliance for elderly and handicapped people, development, improvement and trial fabrication were carried out on a caster in which the brake will not work during walking, but it works automatically in a sudden movement such as falling down. In developing an environment information transmitting system for elderly and handicapped people, a first prototype fabrication was performed on a system to detect sound of an alarm or vibration caused by knocking a door, and convey information to elderly and handicapped people by utilizing the communication services including the commercially available cellular phones. In the research on a welfare device support system for use in disaster and emergency, design and structuring were carried out on a nighttime electric power utilizing system having solar cells combined with storage batteries. Related data were measured. (NEDO)

  5. Visualization of the human CD4+ T-cell response in humanized HLA-DR4-expressing NOD/Shi-scid/γcnull (NOG) mice by retrogenic expression of the human TCR gene

    Takahashi, Takeshi; Katano, Ikumi; Ito, Ryoji; Ito, Mamoru

    2015-01-01

    Highlights: • β-Lactoglobulin (BLG) specific TCR genes were introduced to human HSC by retrovirus. • Human HSC with BLG-specific TCR were transplanted into NOG-HLA-DR4 I-A −/− mice. • BLG-specific TCR induced positive selection of thymocytes. • BLG-specific TCR positive CD4 + T cells mediated immune responses in humanized mice. - Abstract: The development of severe immunodeficient mouse strains containing various human genes, including cytokines or HLA, has enabled the reconstitution of functional human immune systems after transplantation of human hematopoietic stem cells (HSC). Accumulating evidence has suggested that HLA-restricted antigen-specific human T-cell responses can be generated in these humanized mice. To directly monitor immune responses of human CD4 + T cells, we introduced β-lactoglobulin (BLG)-specific T cell receptor (TCR) genes derived from CD4 + T-cell clones of cow-milk allergy patients into HSCs, and subsequently transplanted them into NOG-HLA-DR4 transgenic/I-Aβ deficient mice (NOG-DR4/I-A o ). In the thymus, thymocytes with BLG-specific TCR preferentially differentiated into CD4 + CD8 − single-positive cells. Adoptive transfer of mature CD4 + T cells expressing the TCR into recipient NOG-DR4/I-A o mice demonstrated that human CD4 + T cells proliferated in response to antigenic stimulation and produced IFN-γ in vivo, suggesting that functional T-cell reactions (especially Th1-skewed responses) were induced in humanized mice

  6. Visualization of the human CD4{sup +} T-cell response in humanized HLA-DR4-expressing NOD/Shi-scid/γc{sup null} (NOG) mice by retrogenic expression of the human TCR gene

    Takahashi, Takeshi, E-mail: takeshi-takahashi@ciea.or.jp; Katano, Ikumi; Ito, Ryoji; Ito, Mamoru

    2015-01-02

    Highlights: • β-Lactoglobulin (BLG) specific TCR genes were introduced to human HSC by retrovirus. • Human HSC with BLG-specific TCR were transplanted into NOG-HLA-DR4 I-A{sup −/−} mice. • BLG-specific TCR induced positive selection of thymocytes. • BLG-specific TCR positive CD4{sup +} T cells mediated immune responses in humanized mice. - Abstract: The development of severe immunodeficient mouse strains containing various human genes, including cytokines or HLA, has enabled the reconstitution of functional human immune systems after transplantation of human hematopoietic stem cells (HSC). Accumulating evidence has suggested that HLA-restricted antigen-specific human T-cell responses can be generated in these humanized mice. To directly monitor immune responses of human CD4{sup +} T cells, we introduced β-lactoglobulin (BLG)-specific T cell receptor (TCR) genes derived from CD4{sup +} T-cell clones of cow-milk allergy patients into HSCs, and subsequently transplanted them into NOG-HLA-DR4 transgenic/I-Aβ deficient mice (NOG-DR4/I-A{sup o}). In the thymus, thymocytes with BLG-specific TCR preferentially differentiated into CD4{sup +}CD8{sup −} single-positive cells. Adoptive transfer of mature CD4{sup +} T cells expressing the TCR into recipient NOG-DR4/I-A{sup o} mice demonstrated that human CD4{sup +} T cells proliferated in response to antigenic stimulation and produced IFN-γ in vivo, suggesting that functional T-cell reactions (especially Th1-skewed responses) were induced in humanized mice.

  7. PHYTOPLANKTON - WET WEIGHT and Other Data from SHI YAN 3 and Other Platforms From TOGA Area - Pacific (30 N to 30 S) from 19921109 to 19930217 (NODC Accession 9600043)

    National Oceanic and Atmospheric Administration, Department of Commerce — The accession contains chlorophyll data collected in TOGA Area - Pacific (30 N to 30 S) as part of Tropical Ocean Global Atmosphere (TOGA) and Coupled...

  8. Fiscal 1999 report on basic research for promotion of joint implementation programs. Research on energy saving at Ilyich Iron and Steel Works, Mariupol City, the Ukraine; 1999 nendo Ukraine Mariupol shi Ilyich seitetsusho sho energy chosa hokokusho

    NONE

    2000-03-01

    This is to comply with the COP3 (Third Session of the Conference of the Parties to the United Nations Framework Convention on Climate Change) protocol. For the recovery of exhaust heat from the air blast furnace air heater, combustion control will be improved and an exhaust heat recovery facility will be installed. For the recovery of converter-generated gas, the casting process in the open hearth will be changed to a continuous casting process in the converter, and a generated gas recovery facility will be installed. The power plant facilities will be improved. It is expected that these three jobs will reduce greenhouse gases at 178, 583, and 602-thousand tons/year in terms of CO2, respectively, and energy consumption at 826, 8954, and 8152 TJ/year (13% level reduction), respectively. Time periods required for the recovery of the investments will be 31.2, 8.7, and 7.2 years, respectively, and this means that the investments will not be so profitable. As for cost performance, however, they will save energy at 262, 208, and 420 GJ/year/million yen, respectively, and reduce greenhouse gases at 56.4, 13.5, and 31.0 tons/year/million yen in terms of CO2, respectively, and this means that the three jobs will achieve high cost performance. Some more jobs are found to probably contribute to energy efficiency enhancement and cost performance improvement, which include a top pressure recovery turbine, pulverized coal injection, continuous casting in the steelmaking process, improvement in the yield of slabs in the rolling process, and a hot charger. (NEDO)

  9. New energy vision at Sabae City. Toward realization of 'environmental international city'; 2001 nendo Sabae shi chiiki shin energy vision. Kankyo kokusai toshi Sabae no jitsugen ni mukete

    NONE

    2002-03-01

    With an object of accelerating introduction of and uplifting consciousness on new energies at Sabae City in Fukui Prefecture, a new energy vision was put into order based on the result of the initial stage investigation having been performed in the previous fiscal year. Solar light and solar heat energies will be introduced positively into public facilities, and at the same time works will be implemented to accelerate the proliferation thereof into general households. The target of introduction by the year 2010y is set to 2,600 kW by photovoltaic power generation, and the introduction thereof is planned to schools, nursery schools, municipality operated houses, and unattended facilities. With regard to solar heat water warmer, the present proliferation rate of about 7.3% will be raised to 15%. Regarding wastes generated from industrial areas, efficient energy extraction by thermal recycling is intended on the assumption of suppression of wastes generation, their re-use, and recycling. Systems may include the bio-gas system, cogeneration, and recovery of energies from plastics wastes. For acceleration of proliferation of new energies in general, promotion of introduction will be achieved on mini-wind power generation, small hydroelectric power generation, and fuel cell automobiles. (NEDO)

  10. New energy vision of the Yokaichi city area. New energy society to be created by all citizen - Yokaichi City; 2001 nendo Youkaichi shi chiiki shin energy vision. Minna no chikara de tsukuru shin energy shakai Youkaichi

    NONE

    2002-03-01

    For the purpose of promoting the introduction of new energy and enhancing the awareness of it in Yokaichi City, Shiga Prefecture, an investigational study was conducted of the energy demand amount of the city, existence amount of new energy, project for new energy introduction, etc., and a new energy vision was worked out. The energy consumption amount of the city was estimated at approximately 1,004,638 drums in terms of oil drum (200L). By sector, the energy consumption amount was 66.1% in the industrial sector, 17.4% in the transportation sector and 16.5% in the commercial/residential sector. The rate of energy source was 62.2% of fossil fuel, etc., and 37.9% of electric power. As the project for new energy introduction, the following were studied: promotion of introduction of solar energy collector/photovoltaic power generation to general households; introduction of photovoltaic power generation/solar hot water supply space heating system to public facilities; road preparation by installation of street light using photovoltaic power generation; installation of micro wind power generator at the disaster-prevention base; introduction of biomass energy such as wood pellet stove to public facilities; project of rape blossoms (cultivation of rape/production and consumption of rape oil/recovery of waste cooking oil/BDF). (NEDO)

  11. Structural study and electronic band structure investigations of the solid solution Na xCu1-xIn5S8 and its impact on the Cu(In,Ga)Se2/In2S3 interface of solar cells

    Lafond, A.; Guillot-Deudon, C.; Harel, S.; Mokrani, A.; Barreau, N.; Gall, S.; Kessler, J.

    2007-01-01

    The present work reports investigations on the new In 2 S 3 containing Cu and/or Na compounds, which are expected to be formed at the Cu(In,Ga)Se 2 /In 2 S 3 interface. The knowledge of these materials properties is very important in order to better understand the operation of the devices based on these junction partners. It has been observed that a solid solution Na x Cu 1-x In 5 S 8 exists from CuIn 5 S 8 (x = 0) to NaIn 5 S 8 (x = 1) with a spinel-like structure. The single crystal structure determination shows that indium, copper and sodium atoms are statistically distributed on the tetrahedral sites. XPS investigations on the CuIn 5 S 8 , Na 0.5 Cu 0.5 In 5 S 8 and NaIn 5 S 8 compounds combined with the band gap changes reported in a previous work show that these variations are mainly due to valence band maximum shift; it is moved downward when x increases from 0 to 1. These observations are confirmed by the electron structure calculations based on the density functional theory, which additionally demonstrate that the pure sodium compound has direct gap whereas the copper-containing compounds have indirect gaps

  12. A Summary of Proceedings and Participant Recommendations from a National Workshop on Institutionalizing Progress in Agricultural Extension and Education in Taiwan (Taichung, Taiwan, April 22-24, 1991) = Cejin Wo Guo Nongye Tuiguang Jiaoyu Xin Tizhi Yantaohui Zhuanji. Zhonghua Minguao Bashi Nian Siyue 22 zhi 24.

    Ministry of Education, Taipei (Taiwan).

    These proceedings contain four presentations from a workshop at which leaders in agriculture and education contributed suggestions for developing policies and plans for the new Agricultural Extension Education Graduate Institute (AEEGI) in Taiwan. Introductory materials include a list of members of the planning committee, workshop rationale,…

  13. Transarterial chemoembolization combined with sorafenib for the treatment of hepatocellular carcinoma with hepatic vein tumor thrombus

    Zhang YF

    2016-07-01

    Full Text Available Yong-Fa Zhang,1–3,* Wei Wei,1–3,* Jia-Hong Wang,1–3,* Li Xu,1–3 Pei-En Jian,1–3 Cheng-Zuo Xiao,4 Xiao-Ping Zhong,1–3 Ming Shi,1–3 Rong-Ping Guo1–3 1Department of Hepatobiliary Oncology, Sun Yat-sen University Cancer Center, 2State Key Laboratory of Oncology in South China, 3Collaborative Innovation Center for Cancer Medicine, Guangzhou, 4Department of General Surgery, Shenzhen Shajing Affiliated Hospital of Guangzhou Medical University, Shenzhen, People’s Republic of China *These authors contributed equally to this work Objective: To compare the treatment outcomes of sorafenib plus transarterial chemoembolization (TACE vs TACE alone in patients with hepatocellular carcinoma (HCC and hepatic vein tumor thrombus (HVTT.Methods: Twenty patients who were initially diagnosed with HCC and HVTT and received TACE combined with sorafenib during February 2009 to October 2013 were included in the study. To minimize selection bias, these patients were compared with 60 case-matched controls selected from a pool of 81 patients (in a 1:3 ratio who received TACE alone during the same period. The primary end point was overall survival (OS. The secondary end points were time to progression, disease control rate, and adverse events.Results: After a median follow-up period of 12.5 months (range, 1.03–44.23 months, the OS of the combined group was found to be significantly higher compared with the monotherapy group (14.9 vs 6.1 months, P=0.010. The time to progression was found to be significantly longer in the combined group (4.9 vs 2.4 months, P=0.016. Univariate and multivariate analyses revealed that the treatment allocation was an independent predictor of OS.Conclusion: Sorafenib plus TACE was well tolerated and was more effective in treating patients with advanced HCC and HVTT. Future trials with prospective larger samples are required to validate these results. Keywords: hepatocellular carcinoma, hepatic vein tumor thrombus, prognosis

  14. Mesenchymal stem cell-based NK4 gene therapy in nude mice bearing gastric cancer xenografts

    Zhu Y

    2014-12-01

    Full Text Available Yin Zhu,1,* Ming Cheng,2,* Zhen Yang,3 Chun-Yan Zeng,3 Jiang Chen,3 Yong Xie,3 Shi-Wen Luo,3 Kun-He Zhang,3 Shu-Feng Zhou,4 Nong-Hua Lu1,31Department of Gastroenterology, 2Department of Orthopedics, 3Institute of Digestive Disease, The First Affiliated Hospital of Nanchang University, Jiangxi, People’s Republic of China; 4Department of Pharmaceutical Sciences, College of Pharmacy, University of South Florida, Tampa, FL, USA*These authors contributed equally to this workAbstract: Mesenchymal stem cells (MSCs have been recognized as promising delivery vehicles for gene therapy of tumors. Gastric cancer is the third leading cause of worldwide cancer mortality, and novel treatment modalities are urgently needed. NK4 is an antagonist of hepatocyte growth factor receptors (Met which are often aberrantly activated in gastric cancer and thus represent a useful candidate for targeted therapies. This study investigated MSC-delivered NK4 gene therapy in nude mice bearing gastric cancer xenografts. MSCs were transduced with lentiviral vectors carrying NK4 complementary DNA or enhanced green fluorescent protein (GFP. Such transduction did not change the phenotype of MSCs. Gastric cancer xenografts were established in BALB/C nude mice, and the mice were treated with phosphate-buffered saline (PBS, MSCs-GFP, Lenti-NK4, or MSCs-NK4. The tropism of MSCs toward gastric cancer cells was determined by an in vitro migration assay using MKN45 cells, GES-1 cells and human fibroblasts and their presence in tumor xenografts. Tumor growth, tumor cell apoptosis and intratumoral microvessel density of tumor tissue were measured in nude mice bearing gastric cancer xenografts treated with PBS, MSCs-GFP, Lenti-NK4, or MSCs-NK4 via tail vein injection. The results showed that MSCs migrated preferably to gastric cancer cells in vitro. Systemic MSCs-NK4 injection significantly suppressed the growth of gastric cancer xenografts. MSCs-NK4 migrated and accumulated in tumor

  15. Efficacy and safety of immunosuppressive therapy in the treatment of seronegative hepatitis associated aplastic anemia

    Chen HF

    2014-09-01

    Full Text Available Hai-Fei Chen,* Bin-Xian Xu, Hong-Shi Shen,* Zheng-Yang Li, Ling-Juan Jin, Jie-Qing Tang, Jing Wang, Jing-Jing Zhu, Long-Mei Qin, Qing-Ya Cui, Yong-Ya Ren, Tian-Qin Wu Department of hematology, 100th hospital of People’s Liberation Army, Suzhou, Jiangsu province, The People’s Republic of China *These authors have contributed equally to this paper Objective: To investigate the clinical characteristics of seronegative hepatitis-associated aplastic anemia (AA (SNHAA and hepatitis B virus (HBV infection complicating AA (HBVAA, and thereby compare the efficacy of immunosuppressive therapy (IST.Methods: An analysis was conducted on the clinical data of ten patients with SNHAA out of 332 cases of AA from our center at AA diagnosis, and on the efficacy of IST. This was compared to 22 cases of HBVAA at AA onset as well as the associated IST outcomes.Results: Nine patients with SNHAA developed severe aplastic anemia, with a median age of 18 years. After IST, six (60% of the SNHAA patients achieved complete remission and two achieved partial remission. The patients with HBVAA had a total response rate of 82.3%. The disease recurred in two HBVAA patients. No statistically significant differences were observed in response rate, mortality, and recurrence rate between both groups. As compared with HBVAA, patients with SNHAA had a shorter interval from the acute episode of hepatitis to AA onset (4 months versus 92 months, P=0.00, a quicker response to IST (2.5 months versus 4.5 months, P=0.018, a lower proportion of bone marrow hematopoietic tissues (20.6% versus 23.6%, P=0.03, and lower white blood cell and absolute neutrophil count (0.8×109/L versus 1.23×109/L and 0.26×109/L versus 0.58×109/L, P=0.026 and P=0.0009, respectively. No significant liver damage or hepatitis B fulminant infection was observed in either group during the follow-up. Conclusion: The prevalence of SNHAA is 3.01%. SNHAA often presents as severe AA and responds to IST quickly

  16. 20(S-ginsenoside Rg3 promotes senescence and apoptosis in gallbladder cancer cells via the p53 pathway

    Zhang F

    2015-08-01

    Full Text Available Fei Zhang,* Maolan Li,* Xiangsong Wu,* Yunping Hu, Yang Cao, Xu’an Wang, Shanshan Xiang, Huaifeng Li, Lin Jiang, Zhujun Tan, Wei Lu, Hao Weng, Yijun Shu, Wei Gong, Xuefeng Wang, Yong Zhang, Weibin Shi, Ping Dong,# Jun Gu,# Yingbin Liu#Department of General Surgery and Laboratory of General Surgery, Xinhua Hospital Affiliated to Shanghai Jiao Tong University, School of Medicine, Institute of Biliary Tract Disease, Shanghai Jiao Tong University School of Medicine, Shanghai, People’s Republic of China *These authors contributed equally to this work #These authors jointly directed this work Abstract: Gallbladder cancer (GBC, the most frequent malignancy of the biliary tract, is associated with high mortality and extremely poor prognosis. 20(S-ginsenoside Rg3 (20(S-Rg3 is a steroidal saponin with high pharmacological activity. However, the anticancer effect of 20(S-Rg3 in human GBC has not yet been determined. In this study, we primarily found that 20(S-Rg3 exposure suppressed the survival of both NOZ and GBC-SD cell lines in a concentration-dependent manner. Moreover, induction of cellular senescence and G0/G1 arrest by 20(S-Rg3 were accompanied by a large accumulation of p53 and p21 as a result of murine double minute 2 (MDM2 inhibition. 20(S-Rg3 also caused a remarkable increase in apoptosis via the activation of the mitochondrial-mediated intrinsic caspase pathway. Furthermore, intraperitoneal injection of 20(S-Rg3 (20 or 40 mg/kg for 3 weeks markedly inhibited the growth of xenografts in nude mice. Our results demonstrated that 20(S-Rg3 potently inhibited growth and survival of GBC cells both in vitro and in vivo. 20(S-Rg3 attenuated GBC growth probably via activation of the p53 pathway, and subsequent induction of cellular senescence and mitochondrial-dependent apoptosis. Therefore, 20(S-Rg3 may be a potential chemotherapeutic agent for GBC therapy.Keywords: gallbladder cancer, 20(S-ginsenoside Rg3, senescence, apoptosis, p53 pathway

  17. Cisplatin-resistant lung cancer cell–derived exosomes increase cisplatin resistance of recipient cells in exosomal miR-100–5p-dependent manner

    Qin X

    2017-05-01

    Full Text Available Xiaobing Qin,1,2,* Shaorong Yu,1,3,* Leilei Zhou,1,4 Meiqi Shi,3 Yong Hu,1 Xiaoyue Xu,1 Bo Shen,1 Siwen Liu,1 Dali Yan,1 Jifeng Feng1,3 1Research Center for Clinical Oncology, Affiliated Cancer Hospital of Nanjing Medical University, Jiangsu Cancer Hospital and Jiangsu Institute of Cancer Research, Nanjing, 2Department of Oncology, Xuzhou First People’s Hospital, Xuzhou, 3Department of Oncology, Affiliated Cancer Hospital of Nanjing Medical University, Jiangsu Cancer Hospital and Jiangsu Institute of Cancer Research, Nanjing, 4Department of Oncology, Affiliated Huai’an Hospital of Nanjing Medical University, Huai’an, Jiangsu, China *These authors have contributed equally to this work Abstract: Exosomes derived from lung cancer cells confer cisplatin (DDP resistance to other cancer cells. However, the underlying mechanism is still unknown. A549 resistance to DDP (A549/DDP was established. Microarray was used to analyze microRNA (miRNA expression profiles of A549 cells, A549/DDP cells, A549 exosomes, and A549/DDP exosomes. There was a strong correlation of miRNA profiles between exosomes and their maternal cells. A total of 11 miRNAs were significantly upregulated both in A549/DDP cells compared with A549 cells and in exosomes derived from A549/DDP cells in contrast to exosomes from A549 cells. A total of 31 downregulated miRNAs were also observed. miR-100–5p was the most prominent decreased miRNA in DDP-resistant exosomes compared with the corresponding sensitive ones. Downregulated miR-100–5p was proved to be involved in DDP resistance in A549 cells, and mammalian target of rapamycin (mTOR expression was reverse regulated by miR-100–5p. Exosomes confer recipient cells’ resistance to DDP in an exosomal miR-100–5p-dependent manner with mTOR as its potential target both in vitro and in vivo. Exosomes from DDP-resistant lung cancer cells A549 can alter other lung cancer cells’ sensitivity to DDP in exosomal miR-100–5p

  18. Pemetrexed plus dendritic cells as third-line therapy for metastatic esophageal squamous cell carcinoma

    Zhang B

    2016-06-01

    Full Text Available Bin Zhang,1,* Rui Li,2,3,* Chun-Xiao Chang,2,3 Yong Han,2,3 Sheng-Bin Shi,2,3 Jing Tian2,3 1Department of Medical Oncology, Shandong Ji Ning First People’s Hospital, 2Department of Medical Oncology, Shandong Cancer Hospital, Shandong University, Shandong 3Department of Medical Oncology, Shandong Cancer Hospital and Institute, Shandong Academy of Medical Sciences, Jinan, People’s Republic of China*These authors contributed equally to this workAbstract: This study was conducted to evaluate the toxicity and efficacy of pemetrexed plus dendritic cells (DCs when administered as third-line treatment for metastatic esophageal squamous cell carcinoma (ESCC. All patients in the study group had previously failed first-line treatment with 5-fluorouracil and cisplatin-based regimens, as well as second-line treatment with taxane-based regimens. A total of 31 patients were treated with pemetrexed (500 mg/m2 plus DCs on day 1, every 3 weeks. DCs were given for one cycle of 21 days. Thirty patients were evaluated for their response. No patient had a complete response, three patients (10.0% had a partial response, ten patients (33.3% had stable disease, and 17 patients (56.7% had progressive disease. The overall response rate was 10.0%. The median progression-free survival (PFS time was 2.9 months (95% CI, 2.7–3.2, and the median overall survival (OS time was 7.1 months (95% CI, 6.4–7.9. The median PFS and OS times among patients with high and low levels of miR-143 expression in their blood serum were significantly different: median PFS times =3.2 months (95% CI, 2.9–3.4 and 2.7 months (95% CI, 2.4–3.0, respectively (P=0.017, and median OS times =7.8 months (95% CI, 6.8–8.9 and 6.3 months (95% CI, 5.3–7.3, respectively (P=0.036. No patient experienced Grade 4 toxicity. Combined third-line treatment with pemetrexed and DCs was marginally effective and well tolerated in patients with advanced ESCC. Serum miR-143 levels are a potential

  19. Interaction between leucine and phosphodiesterase 5 inhibition in modulating insulin sensitivity and lipid metabolism

    Fu L

    2015-05-01

    Full Text Available Lizhi Fu,1 Fenfen Li,1 Antje Bruckbauer,2 Qiang Cao,1 Xin Cui,1 Rui Wu,1 Hang Shi,1 Bingzhong Xue,1 Michael B Zemel21Department of Biology, Center for Obesity Reversal, Georgia State University, Atlanta, GA, 2NuSirt Biopharma Inc., Nashville, TN, USA Purpose: Leucine activates SIRT1/AMP-activated protein kinase (AMPK signaling and markedly potentiates the effects of other sirtuin and AMPK activators on insulin signaling and lipid metabolism. Phosphodiesterase 5 inhibition increases nitric oxide–cGMP signaling, which in turn exhibits a positive feedback loop with both SIRT1 and AMPK, thus amplifying peroxisome proliferator-activated receptor γ co-activator α (PGC1α-mediated effects. Methods: We evaluated potential synergy between leucine and PDE5i on insulin sensitivity and lipid metabolism in vitro and in diet-induced obese (DIO mice. Results: Leucine (0.5 mM exhibited significant synergy with subtherapeutic doses (0.1–10 nM of PDE5-inhibitors (sildenafil and icariin on fat oxidation, nitric oxide production, and mitochondrial biogenesis in hepatocytes, adipocytes, and myotubes. Effects on insulin sensitivity, glycemic control, and lipid metabolism were then assessed in DIO-mice. DIO-mice exhibited fasting and postprandial hyperglycemia, insulin resistance, and hepatic steatosis, which were not affected by the addition of leucine (24 g/kg diet. However, the combination of leucine and a subtherapeutic dose of icariin (25 mg/kg diet for 6 weeks reduced fasting glucose (38%, P<0.002, insulin (37%, P<0.05, area under the glucose tolerance curve (20%, P<0.01, and fully restored glucose response to exogenous insulin challenge. The combination also inhibited hepatic lipogenesis, stimulated hepatic and muscle fatty acid oxidation, suppressed hepatic inflammation, and reversed high-fat diet-induced steatosis. Conclusion: These robust improvements in insulin sensitivity, glycemic control, and lipid metabolism indicate therapeutic potential for

  20. Chitosan-coated poly(lactic-co-glycolic acid nanoparticles as an efficient delivery system for Newcastle disease virus DNA vaccine

    Zhao K

    2014-09-01

    Full Text Available Kai Zhao,1,* Yang Zhang,1,2,* Xiaoyan Zhang,1,* Ci Shi,1,2 Xin Wang,1 Xiaohua Wang,1 Zheng Jin,3 Shangjin Cui2 1Laboratory of Microbiology, School of Life Science, Heilongjiang University, 2Division of Swine Infectious Diseases, State Key Laboratory of Veterinary Biotechnology, Harbin Veterinary Research Institute, 3Key Laboratory of Chemical Engineering Process and Technology for High-efficiency Conversion, Heilongjiang University, Harbin, People’s Republic of China *These authors contributed equally to this work Abstract: We determined the efficacy and safety of chitosan (CS-coated poly(lactic-co-glycolic acid (PLGA nanoparticles (NPs as a delivery system for a vaccine to protect chickens against Newcastle disease virus (NDV. The newly constructed vaccine contained DNA (the F gene of NDV. The Newcastle disease virus (NDV F gene deoxyribonucleic acid (DNA plasmid (pFDNA-CS/PLGA-NPs were spherical (diameter =699.1±5.21 nm [mean ± ­standard deviation] and smooth, with an encapsulation efficiency of 98.1% and a Zeta potential of +6.35 mV. An in vitro release assay indicated that CS controlled the burst release of plasmid DNA, such that up to 67.4% of the entire quantity of plasmid DNA was steadily released from the pFDNA-CS/PLGA-NPs. An in vitro expression assay indicated that the expression of nanoparticles (NPs was maintained in the NPs. In an immunization test with specific pathogen-free chickens, the pFDNA-CS/PLGA-NPs induced stronger cellular, humoral, and mucosal immune responses than the plasmid DNA vaccine alone. The pFDNA-CS/PLGA-NPs did not harm 293T cells in an in vitro assay and did not harm chickens in an in vivo assay. Overall, the results indicated that CS-coated PLGA NPs can serve as an efficient and safe mucosal immune delivery system for NDV DNA vaccine.Keywords: mucosal immune delivery system, immune effect

  1. Biofunctionalization of silicone rubber with microgroove-patterned surface and carbon-ion implantation to enhance biocompatibility and reduce capsule formation

    Lei ZY

    2016-10-01

    Full Text Available Ze-yuan Lei, Ting Liu, Wei-juan Li, Xiao-hua Shi, Dong-li Fan Department of Plastic and Cosmetic Surgery, XinQiao Hospital, The Third Military Medical University, ChongQing, People’s Republic of China Purpose: Silicone rubber implants have been widely used to repair soft tissue defects and deformities. However, poor biocompatibility can elicit capsule formation, usually resulting in prosthesis contracture and displacement in long-term usage. To overcome this problem, this study investigated the properties of silicone rubber materials with or without a microgroove-patterned surface and with or without carbon (C-ion implantation. Materials and methods: Atomic force microscopy, X-ray photoelectron spectroscopy, and a water contact angle test were used to characterize surface morphology and physicochemical properties. Cytocompatibility was investigated by a cell adhesion experiment, immunofluorescence staining, a Cell Counting Kit-8 assay, and scanning electron microscopy in vitro. Histocompatibility was evaluated by studying the inflammatory response and fiber capsule formation that developed after subcutaneous implantation in rats for 7 days, 15 days, and 30 days in vivo. Results: Parallel microgrooves were found on the surfaces of patterned silicone rubber (P-SR and patterned C-ion-implanted silicone rubber (PC-SR. Irregular larger peaks and deeper valleys were present on the surface of silicone rubber implanted with C ions (C-SR. The silicone rubber surfaces with microgroove patterns had stable physical and chemical properties and exhibited moderate hydrophobicity. PC-SR exhibited moderately increased dermal fibroblast cell adhesion and growth, and its surface microstructure promoted orderly cell growth. Histocompatibility experiments on animals showed that both the anti-inflammatory and antifibrosis properties of PC-SR were slightly better than those of the other materials, and there was also a lower capsular contracture rate and less

  2. Differences in esophageal cancer characteristics and survival between Chinese and Caucasian patients in the SEER database

    Lin MQ

    2016-10-01

    Full Text Available Min-Qiang Lin,1,* Yue-Ping Li,2,* San-Gang Wu,3 Jia-Yuan Sun,4 Huan-Xin Lin,4 Shi-Yang Zhang,5 Zhen-Yu He4 1Department of Scientific Management, The First Affiliated Hospital of Xiamen University, Xiamen, 2Public Health School of Fujian Medical University, Fuzhou, 3Department of Radiation Oncology, The First Affiliated Hospital of Xiamen University, Xiamen, 4Department of Radiation Oncology, State Key Laboratory of Oncology in South China, Collaborative Innovation Center of Cancer Medicine, Sun Yat-sen University Cancer Center, Guangzhou, 5Department of Hospital Infection Management, The First Affiliated Hospital of Xiamen University, Xiamen, People’s Republic of China *These authors contributed equally to this work Background: To compare the clinicopathologic characteristics and survival of Chinese and Caucasian esophageal cancer (EC patients residing in the US, using a population-based national registry (Surveillance Epidemiology and End Results [SEER] database. Methods: Patients with EC were identified from the SEER program from 1988 to 2012. Kaplan–Meier survival methods and Cox proportional hazards regression were performed.Results: A total of 479 Chinese and 35,748 Caucasian EC patients were identified. Compared with Caucasian patients, the Chinese patients had a later year of diagnosis, remained married after EC was diagnosed, had esophageal squamous cell carcinomas (ESCCs more frequently, had tumors located in the upper-third and middle-third of the esophagus more frequently, and fewer patients presented with poorly/undifferentiated EC and underwent cancer-directed surgery. In Chinese patients, the incidence of esophageal adenocarcinomas (EACs increased from 1988 to 2012 (P=0.054, and the majority of EAC patients had tumors located in the lower thoracic esophagus. The overall survival (OS was not significantly different between Chinese and Caucasian patients (P=0.767. However, Chinese patients with ESCC had a significantly better

  3. Application of carbon nanoparticles in lymph node dissection and parathyroid protection during thyroid cancer surgeries: a systematic review and meta-analysis

    Wang L

    2017-02-01

    Full Text Available Lun Wang, Dong Yang, Jun-Yuan Lv, Dan Yu, Shi-Jie Xin Department of Vascular and Thyroid Surgery, The First Affiliated Hospital, China Medical University, Shenyang, People’s Republic of China Purpose: To investigate whether carbon nanoparticles (CNs are helpful in identifying lymph nodes and metastatic lymph nodes and in parathyroid protection during thyroid cancer surgery. Methods: English and Chinese literature in PubMed, Cochrane Database of Systematic Reviews, EMBASE, ClinicalTrials.gov, China Biology Medicine Database, China National Knowledge Infrastructure, China Master’s and Doctoral Theses Full-Text Database, Wanfang database, and Cqvip database were searched (till March 22, 2016. Randomized controlled trials (RCTs that compared the use of CNs with a blank control in patients undergoing thyroid cancer surgery were included. Quality assessment and data extraction were performed, and a meta-analysis was conducted using RevMan 5.1 software. The primary outcomes were the number of retrieved central lymph nodes and metastatic lymph nodes, and the rate of accidental parathyroid removal. Results: We obtained 149 relevant studies, and only 47 RCTs with 4,605 patients (CN group: n=2,197; blank control group: n=2,408 met the inclusion criteria. Compared with the control group, the CN group was associated with more retrieved lymph nodes/patient (weighted mean difference [WMD]: 3.39, 95% confidence interval [CI]: 2.73–4.05, more retrieved metastatic lymph nodes (WMD: 0.98, 95% CI: 0.61–1.35, lower rate of accidental parathyroid removal, and lower rates of hypoparathyroidism and hypocalcemia. However, the total metastatic rate of the retrieved lymph nodes did not differ between the groups (odds ratio: 1.13, 95% CI: 0.87–1.47, P=0.35. Conclusion: CNs can improve the extent of neck dissection and protect the parathyroid glands during thyroid cancer surgery. And the number of identified metastatic lymph nodes can be simultaneously increased

  4. 75 FR 60761 - Government-Owned Inventions; Availability for Licensing

    2010-10-01

    ... related to drug resistance. Inventors: Genbin Shi, Gary Shaw, Xinhua Ji (NCI). Patent Status: U.S... Publications: 1. Blaszczyk J, Shi G, Li Y, Yan H, Ji X. Reaction trajectory of pyrophosphoryl transfer...: 15016362]. 2. Blaszczyk J, Shi G, Yan H, Ji X. Catalytic center assembly of HPPK as revealed by the crystal...

  5. System Optical Quality Users Guide. Part 2.

    1980-03-01

    UPDATES 1. *ID FIXZRN This update redefines the coeffiencets to be input to the Zernike subroutine. This new convention is more physically meaningful...XROT = XIN x COSROT + YIN x SINROT YROT = -XIN x SINROT + YIN x COSROT Application of Zernike polynomials to and SOQ point located at (XIN, YIN) would...MA) MAI1N d !P1 CumT I NUE MAIN 903 opf I TEI bt %) U%7AU5S #AMtES MAIN eI14 ’ 3d F4JeMAr~auoo (AUSSIAN AMP.LLTUOE UJlbIdN~d ON tEAS dtEN FOMb) wIIM

  6. Koreade juhid lõid rahu eelduseks käed / Triin Oppi

    Oppi, Triin

    2007-01-01

    Lõuna-Korea president Roh Moo-Hyan ja Põhja-Korea rahvavabariigi juht Kim Yong Il tõotavad ühisavalduses muuta Korea poolsaare tuumavabaks ja edendada kaubavahetust, turismi ja poliitilist läbikäimist

  7. Chemical engineering in the pharmaceutical industry: R&D to manufacturing

    Ende, David J. am

    2011-01-01

    ... Process R&D Edward L. Paul 73 7 Reaction Kinetics and Characterization Utpal K. Singh and Charles J. Orella 79 vvi CONTENTS 8 Understanding Rate Processes in Catalytic Hydrogenation Reactions Yong...

  8. The Role of MicroRNAs in Pancreatitis

    2015-10-01

    AD______________ AWARD NUMBER: W81XWH-14-1-0469 TITLE: The Role of microRNAs in Pancreatitis PRINCIPAL INVESTIGATOR: Li, Yong RECIPIENT...The Role of MicroRNAs in Pancreatitis 5b. GRANT NUMBER W81XWH-14-1-0469 5c. PROGRAM ELEMENT NUMBER 6. AUTHOR(S) 5d. PROJECT NUMBER Li, Yong 5e...AVAILABILITY STATEMENT Approved for Public Release; Distribution Unlimited 13. SUPPLEMENTARY NOTES 14. ABSTRACT Pancreatitis (inflammation of the

  9. Effect of PEG-PDLLA polymeric nanovesicles loaded with doxorubicin and hematoporphyrin monomethyl ether on human hepatocellular carcinoma HepG2 cells in vitro

    Xiang GH

    2013-12-01

    Full Text Available Guang-Hua Xiang,1,2,* Guo-Bin Hong,2,3,* Yong Wang,2 Du Cheng,2 Jing-Xing Zhou,1 Xin-Tao Shuai21Department of Radiology, Sun Yat-Sen Memorial Hospital, Sun Yat-Sen University, Guangzhou, People's Republic of China; 2PCFM Laboratory of Ministry of Education, School of Chemistry and Chemical Engineering, Sun Yat-Sen University, Guangzhou, People's Republic of China; 3Department of Radiology, Fifth Affiliated Hospital, Sun Yat-Sen University, Zhuhai, People's Republic of China*These two authors contributed equally to this workObjective: To evaluate the cytotoxicity of poly(ethylene glycol-block-poly(D,L-lactic acid (PEG-PDLLA nanovesicles loaded with doxorubicin (DOX and the photosensitizer hematoporphyrin monomethyl ether (HMME on human hepatocellular carcinoma HepG2 cells and to investigate potential apoptotic mechanisms.Methods: PEG-PDLLA nanovesicles were simultaneously loaded with DOX and HMME (PEG-PDLLA-DOX-HMME, and PEG-PDLLA nanovesicles were loaded with DOX (PEG-PDLLA-DOX, HMME (PEG-PDLLA-HMME, or the PEG-PDLLA nanovesicle alone as controls. The cytotoxicity of PEG-PDLLA-DOX-HMME, PEG-PDLLA-DOX, PEG-PDLLA-HMME, and PEG-PDLLA against HepG2 cells was measured, and the cellular reactive oxygen species, percentage of cells with mitochondrial membrane potential depolarization, and apoptotic rate following treatment were determined.Results: Four nanovesicles (PEG-PDLLA-DOX-HMME, PEG-PDLLA-DOX, PEG-PDLLA-HMME, and PEG-PDLLA were synthesized, and mean particle sizes were 175±18 nm, 154±3 nm, 196±2 nm, and 147±15 nm, respectively. PEG-PDLLA-DOX-HMME was more cytotoxic than PEG-PDLLA-DOX, PEG-PDLLA-HMME, and PEG-PDLLA. PEG-PDLLA-HMME-treated cells had the highest mean fluorescence intensity, followed by PEG-PDLLA-DOX-HMME-treated cells, whereas PEG-PDLLA-DOX- and PEG-PDLLA-treated cells had a similar fluorescence intensity. Mitochondrial membrane potential depolarization was observed in 54.2%, 59.4%, 13.8%, and 14.8% of the cells treated with

  10. EGFR mutations in patients with lung adenocarcinoma in southwest China: are G719S/A and L861Q more likely detected in tumors derived from smokers?

    Wang QS

    2013-07-01

    Full Text Available Qiushi Wang,1 Jianghong Mou,1 Xin Yang,1 Yong He,2 Zengpeng Li,1 Qingya Luo,1 Yanqing Li,1 Li Lin,1 Yu Ma,1 Hualiang Xiao11Department of Pathology, 2Department of Respiration, Daping Hospital and Research Institute of Surgery, Third Military Medical University, Chongqing, People’s Republic of ChinaBackground: The clinical characteristics of epidermal growth factor receptor (EGFR hotspot mutations, such as deletions in exon 19, substitution of L858R in exon 21, and mutations in exon 20, have been widely reported in nonsmall cell lung cancer. However, the clinical features of other low frequency EGFR mutations in these four exons (especially the relationship with smoking history, eg, substitutions of G719S/A/C in exon 18 and L861Q in exon 21, remain unclear. This study investigated the relationship between G719S/A/C and L861Q mutations (in exon 18 and 21 and smoking history.Methods: Specimens from 194 patients with lung adenocarcinoma were analyzed for EGFR mutations in exons 18–21 by high-resolution melting curve analysis and amplification refractory mutation technology to establish the relationship between G719S/A/C and L861Q mutations and smoking history.Results: Ninety-six of 194 tumors (49.5% were confirmed to be EGFR mutation-positive. Among these mutations, 71 of 104 (68.3% were from never smokers, six of 17 (35.3% were from former smokers, and 19 of 73 (26.0% were from current smokers (P < 0.001. The mutation rate in heavy smokers (5/23, 21.7% was significantly lower than in light smokers (20/67, 29.9% and never smokers (71/104, 68.3%, P < 0.001. Seven low frequency EGFR mutations (four substitutions of G719S, and G719 A, respectively, and three of L861Q in exon 21 were identified. Five of these mutations were derived from smokers (one former light smoker, one current heavy smoker, and three current light smokers. Four of these patients had been treated with tyrosine kinase inhibitors and all had a partial response, with median overall

  11. Nutrition for Young Men

    ... Healthy Aging Nutrition for Young Men Print Email Nutrition for Young Men Reviewed by Taylor Wolfram, MS, ... 2017 XiXinXing/iStock/Thinkstock For many young men, nutrition isn't always a focus. There are many ...

  12. Synthesis of nano-particle and highly porous conducting perovskites ...

    Administrator

    State Key Laboratory of Materials-oriented Chemical Engineering, Nanjing University of Technology,. No. 5 Xin Mofan Road, ... the molecule level mixing of the raw materials. The solid ... which were then calcined at 1000°C to form highly.

  13. Electrical and microstructural properties of CaTiO3-doped K1/2Na1 ...

    health and environment. Therefore, in ... (Sawada et al 2003), bismuth sodium titanate (Zhou and Xin. 2007 ... these KNN systems possess low-temperature stability for. PPT near to ... CTO phase was not observed; probably due to problems to.

  14. Fulltext PDF

    Universität zu Berlin, Ger- many. Lopez Sauceda, Juan, Universidad Autonoma ... Lu, Xin Bao, Potsdam Institute for Climate Impact Research,. Germany. Macau, Elbert, National Institute for Space Research -. INPE, Brazil. Madhavan, Vinodh, Institute ...

  15. Modulation of biochemical stress initiated by toxicants in diet ...

    sunny t

    2016-07-27

    Jul 27, 2016 ... meat in some parts of Nigeria, such as Owerri in Imo state (Ujowundu et al., ..... containing bromocresol green (BCG) was added to the tubes mixed ...... Xin Z, Waterman DF, Henken RM, Harman RJ (1991) Effects of copper.

  16. Moskva kunstibiennaal reaktsiooni teenistuses? / Johannes Saar

    Saar, Johannes, 1965-

    2007-01-01

    Moskva II rahvusvahelisest nüüdiskunsti biennaalist. Näitustest "Sotsart. Poliitiline kunst Venemaal" (kuraator Andrei Jerofejev), "Sotsart. Poliitiline kunst Hiinas" (kuraator Xin Don Chen), "Mõtlev realism" (kuraator Jekaterina Djegot) ja "Mina usun" (kuraator Oleg Kulik)

  17. Disease: H00335 [KEGG MEDICUS

    Full Text Available xins they produce. It causes two different foodborne diseases: Type A food poisoning and Type C food poisoni...5 PMID:11981970 (description, env_factor) ... AUTHORS ... Brynestad S, Granum PE ... TITLE ... Clostridium perfringens and food

  18. 專論/台灣圖書館史數位圖書館建構之研究/王梅玲;蔡明月;陳志銘;柯雲娥;蔡佳縈;陳勇汀;林怡甄 | A Digital Library Pilot Study on Taiwan Libraries' History / Mei-Ling Wang; Ming-Yueh Tsay; Chih-Ming Chen; Yun-Er Ke; Chia-Ying Tsai; Yong-Ting Chen; Yi-Jen Lin

    王梅玲、蔡明月、陳志銘、柯雲娥、蔡佳縈、陳勇汀、林怡甄

    2008-04-01

    Full Text Available

    圖書館是保存與詮釋人類文化重要的機構,1990 年代開始,網際網路的進步,促成數位圖書館蓬勃發展,有人預測它就是未來的圖書館,因此,圖書館界與教育界積極參與相關研究。台灣地區歷經日據時期、重建 時期、成長時期及茁壯時期四階段,建設許多圖書館,有其豐富的主題與素材值得發展成為數位圖書館。政治大學圖書資訊與檔案學研究所有鑑於此,提出「『台灣 百無圖書館史』數位圖書館」的構想,並獲得政大「發展國際一流大學及頂尖研究中心計畫」經費支持。本研究計畫目的包括:(1探索以台彎圖書館事業史為主 題的數位圖書館建構模式;(2建構數位圖書館以支援圖書資訊學教育與研究;(3研訂圖書館事業史料文獻的Metadata與數位資料格式;(4將圖 書文獻與文物數位化以建構數位館藏;(5發展數位圖書館系統與技術;(6研發數位圖書館網站的瀏覽與檢索功能;(7探討數位圖書館支援數位學習的模 式。計畫成果共研訂六種 Metadata標準:建置746筆數位化資料;以Dspace系統平台,依據需求設計台灣百年圖書館史系統架構與網站,最後提出結論與建議。

    Libraries are important social institutions that preserve and communicate human culture and knowledge. From the beginning of 1990s, the digital library has grown up rapidly based on the progress of the Internet. Libraries and educational institutions should be actively involved in digital library research and development. The Taiwan libraries’ history can be divided into four stages: Japanese occupation period, reconstruction period, growth period and strong period. In these processes, many events and libraries with rich materials that can be developed into a digital library. Graduate Institute of Library, Information and Archival Studies, National Chengchi University, planned the Digital Library Pilot Study on Taiwan Libraries’ History and got the university support. The pilot study objectives include: (1 exploring the digital library model on Taiwan libraries' history; (2 constructing digital library to support education and research in information and library science; (3 developing Metadata standards of library documents and heritage; (4 digitalizing documents and heritage to build digital collections (5 developing digital library systems and technology; (6 researching browsing and search functions of the digital library; (7 exploring the model of the digital library supports e-learning. In this pilot study, we developed six Metadata standards, built 746 digital resources, constructed a digital library system and web site, and proposed the conclusions and suggestions finally.

    頁次:15-38

  19. Differentiating social phobia from shyness.

    Heiser, Nancy A; Turner, Samuel M; Beidel, Deborah C; Roberson-Nay, Roxann

    2009-05-01

    To clarify the relationship between social phobia and shyness, this study examined the characteristics of highly shy persons with social phobia, highly shy persons without social phobia, and non-shy persons. Those with social phobia reported more symptomatology, more functional impairment, and a lower quality of life than those without social phobia. About one-third of the highly shy without social phobia reported no social fears, highlighting heterogeneity of the shy. The social phobia group reported similar levels of anxiety as the shy without social phobia during analogue conversation tasks, but they reported more anxiety during a speech task. The social phobia group performed less effectively across tasks than those without social phobia. All groups' perceptions of anxiety and effectiveness during behavioral tasks were consistent with ratings of independent observers. None of the groups differed on psychophysiological measures. Results are discussed in the context of theoretical models of social phobia.

  20. General practitioners’ attitudes towards and experiences with referrals due to supplemental health insurance

    Andersen, Merethe K; Pedersen, Line B; Dupont, Michael

    2017-01-01

    Background.: Supplemental health insurances (SHI) cover 38% of the Danish population. SHI can give faster access to, and additional treatment from, private health providers. However, this is contingent on a referral from the general practitioner (GP), further complicating clinical decision...... to 3321 GPs focusing on three issues: (i) Attitudes towards the public health care system. (ii) Perceptions of the impact of SHI. (iii) Experiences with patients holding SHIs. Results.: The response rate was 64%. Overall, GPs found that SHIs contribute to inequality (83%) and overtreatment (90%). However...... a majority of GPs associate SHI with overtreatment and inequality in health, many GPs feel under pressure to refer patients holding SHI for treatments or examinations that are not medically warranted. Some GPs even refer these patients without further examination or questioning. Insistent SHI patients may...

  1. Extension of NHWAVE to Couple LAMMPS for Modeling Wave Interactions with Arctic Ice Floes

    2015-09-30

    Modelling, in press. Orzech, M., Shi, F., Veeramony, J., Bateman , S., Calantoni, J., and Kirby, J. T., 2015, “Incorporating floating surface...objects into a fully dispersive surface wave model”, Ocean Modelling, submitted. Bateman , S. Shi, F., Orzech, M., Veeramony, J., and Calantoni, J., 2014...Orzech, M., Shi, F., Calantoni, J., Bateman , S., and Veeramony, J., “Small-scale modeling of waves and floes in the Marginal Ice Zone”, 2014 Fall Meeting of the American Geophysical Union.

  2. Hizbollah–Syrian Intelligence Affairs: A Marriage of Convenience

    Carl Anthony Wege

    2011-01-01

    Full Text Available Since the 1980s, Hizbollah has emerged as the guardian of Lebanon's Shi'a and a stalking horse for Iran. Syria, though allied with Tehran, seeks to manage Hizbollah's freedom of action in Lebanon and is eyed cautiously in Damascus. Hizbollah has managed to maintain independence from these Syrian efforts because of both Lebanese Shi'a religious élan and the protection given Hizbollah by its Shi'a allies in Iran.

  3. Discrimination in waiting times by insurance type and financial soundness of German acute care hospitals.

    Schwierz, Christoph; Wübker, Achim; Wübker, Ansgar; Kuchinke, Björn A

    2011-10-01

    This paper shows that patients with private health insurance (PHI) are being offered significantly shorter waiting times than patients with statutory health insurance (SHI) in German acute hospital care. This behavior may be driven by the higher expected profitability of PHI relative to SHI holders. Further, we find that hospitals offering private insurees shorter waiting times when compared with SHI holders have a significantly better financial performance than those abstaining from or with less discrimination.

  4. Natural History Study of Synucleinopathies

    2018-01-23

    Patients With Synucleinopathies; Neurogenic Orthostatic Hypotension; Pure Autonomic Failure; REM Sleep Behavior Disorder; Parkinson Disease; Dementia With Lewy Bodies; Multiple System Atrophy; Shy-Drager Disease

  5. Peripheral neuropathy

    ... peripheral; Neuritis - peripheral; Nerve disease; Polyneuropathy; Chronic pain - peripheral neuropathy ... Philadelphia, PA: Elsevier; 2016:chap 107. Shy ME. Peripheral neuropathies. In: Goldman L, Schafer AI, eds. Goldman's Cecil ...

  6. Paeonia lactiflora Pall. protects against ANIT-induced cholestasis by activating Nrf2 via PI3K/Akt signaling pathway

    Ma X

    2015-09-01

    Full Text Available Xiao Ma,1,2 Yan-ling Zhao,2 Yun Zhu,3 Zhe Chen,1,2 Jia-bo Wang,4 Rui-yu Li,1,4 Chang Chen,1,2 Shi-zhang Wei,1,2 Jian-yu Li,3 Bing Liu,5 Rui-lin Wang,3 Yong-gang Li,3 Li-fu Wang,3 Xiao-he Xiao4 1Pharmacy College, Chengdu University of Traditional Chinese Medicine, Chengdu, People’s Republic of China; 2Department of Pharmacy, 302 Military Hospital of People’s Liberation Army, Beijing, People’s Republic of China; 3Department of Integrative Medical Center, 302 Military Hospital of People’s Liberation Army, Beijing, People’s Republic of China; 4China Military Institute of Chinese Medicine, 302 Military Hospital of People’s Liberation Army, Beijing, People’s Republic of China; 5School of Chinese Medicine, The University of Hong Kong, Hong Kong Background: Paeonia lactiflora Pall. (PLP, a traditional Chinese herbal medicine, has been used for hepatic disease treatment over thousands of years. In our previous study, PLP was shown to demonstrate therapeutic effect on hepatitis with severe cholestasis. The aim of this study was to evaluate the antioxidative effect of PLP on alpha-naphthylisothiocyanate (ANIT-induced cholestasis by activating NF-E2-related factor 2 (Nrf2 via phosphatidylinositol 3-kinase (PI3K/Akt signaling pathway. Materials and methods: Liquid chromatography-mass spectrometry (LC-MS was performed to identify the main compounds present in PLP. The mechanism of action of PLP and its therapeutic effect on cholestasis, induced by ANIT, were further investigated. Serum indices such as total bilirubin (TBIL, direct bilirubin (DBIL, aspartate aminotransferase (AST, alanine aminotransferase (ALT, alkaline phosphatase (ALP, γ-glutamyl transpeptidase (γ-GT, and total bile acid (TBA were measured, and histopathology of liver was also performed to determine the efficacy of treatment with PLP. Moreover, in order to illustrate the underlying signaling pathway, liver glutathione (GSH content and mRNA or protein levels of glutamate

  7. Synthesis and evaluation of ortho-[18F]fluorocelecoxib for COX-2 cholangiocarcinoma imaging

    Chang CW

    2018-05-01

    Full Text Available Chi-Wei Chang,1,* Chun-Nan Yeh,2,* Yi-Hsiu Chung,3,* Yong-Ren Chen,4 Shi-Wei Tien,4 Tsung-Wen Chen,2 Shiou-Shiow Farn,4,5 Ying-Cheng Huang,6 Chung-Shan Yu4,7 1Department of Nuclear Medicine, Taipei Veterans General Hospital, Taipei, Taiwan; 2Department of Surgery, Liver Research Center, Chang-Gung Memorial Hospital at Linkou, Chang Gung University, Taoyuan, Taiwan; 3Center for Advanced Molecular Imaging and Translation, Chang Gung Memorial Hospital, Taoyuan, Taiwan; 4Department of Biomedical Engineering and Environmental Sciences, National Tsinghua University, Hsinchu, Taiwan; 5Isotope Application Division, Institute of Nuclear Energy Research, Taoyuan, Taiwan; 6Department of Neurosurgery, Chang-Gung Memorial Hospital at Linkou, Chang Gung University, Taoyuan, Taiwan; 7Institute of Nuclear Engineering and Science, National Tsinghua University, Hsinchu, Taiwan *These authors contributed equally to this work Background: An 18F-tagged NSAID analog was prepared for use as a probe for COX-2 expression, which is associated with tumor development. Methods: The in vivo uptake of celecoxib was monitored with ortho-[18F]fluorocelecoxib using positron emission tomography (PET. The binding affinity of ortho-[18F]fluorocelecoxib to COX-1 and COX-2 enzymes were assessed using the competitor celecoxib. Results: The IC50 values were 0.039 μM and 0.024 μM, respectively. A selectivity index of 1.63 was obtained (COX-2 vs COX-1. COX-2 overexpressed cholangiocarcinoma (CCA murine cells took up more ortho-[18F]fluorocelecoxib than that by usual CCA cells from 10 to 60 minutes post incubation. Competitive inhibition (blocking of the tracer uptake of ortho-[18F]fluorocelecoxib in the presence of celecoxib by the COX-2 overexpressed CCA cells and the usual CCA cells gave the IC50 values of 0.5 μM and 46.5 μM, respectively. Based on the in vitro accumulation data and in vivo metabolism half-life (30 min, PET scanning was performed 30–60 min after the

  8. Fiscal 1999 research report. Basic research for promotion of joint implementation programs (Scrap and build for Central Heat-Power Station No. 2, St. Petersburg City, and others); 1999 nendo St. Petersburg shi netsuden heikyusho No.2 hoka Scrap and Build chosa hokokusho

    NONE

    2000-03-01

    Japan intends to resort to various means, including joint implementations with advanced countries, to fulfill its greenhouse gas reduction target in compliance with the United Nations Framework Convention on Climate Change. Exerting one of Japan's efforts, Mitsui and Co., Ltd., has signed a protocol with LENENEGRO on a survey of the Central Heat-Power Station, St. Petersburg City. The heat-power station started its operation in the 1910s and is now quite superannuated. Its efficiency and operating rate have extremely lowered, and its early modernization is earnestly wished for. The aim of the survey is to have the existing old facilities scrapped for the installation of gas combined cycle cogeneration facilities which are high in efficiency and low in greenhouse gas emissions. The new facilities will consist of three 67MW-class gas turbines, three exhaust heat recovery boilers, and one backpressure turbine, capable of 200MW power generation and 200Gcal/hour heat supply. A total of 140-million dollars will have to be invested and the construction work will require 36 months to complete. A reduction of 1,481,979.0 tons/year in CO2 emissions and an energy saving effect of 546,301 tons/year are expected. (NEDO)

  9. 專論/分類不一致之自動偵測:以農資中心資料為例/曾元顯;王峻禧 | Automatic Inconsistency Detection for the ASIC Categorization Collection / Yuen-Hsien Tseng; Chun-Shi Wang

    曾元顯、王峻禧

    2007-10-01

    Full Text Available

    文件分類是根據文件內容的主題給定類別的知識加值工作,傳統上由人工進行。然而受分類架構設計、類別定義以及分類者學識 背景等影響,主題內容類似的文件,不見得都會被分類到相同的類別,因而造成分類不一致的情況,降低分類文件的應用價值。本文以案例的形式,根據農資中心的 人工分類資料, 進行分類一致性的自動驗證,呈現及探討其結果,並說明其可能潛在的應用,以展示此項工作的可行性及實際效益。綜合而言,分類不一致之自動偵測,可作為資料 清理、知識盤點等知識管理實務上的應用,或是後續分類槃構修正、分類策略擬定、人工分類訓練,以及引進自動分類機制之參考與前置作業。

    Text categorization is a process of assigning labels to documents according to the contents or topics of the documents. Traditionally text categorization is carried out by human experts. However, due to factors such as blurred category boundaries, background bias, and personal judgment, label inconsistency is often found in human classified collections, thus reducing their values in various applications. This article described an automatic process to detect such inconsistency based on the Agricultural Science Information Center (ASIC collection. In the article, important examples and results are presented. Potential benefits and applications are discussed.

    頁次:19-32

  10. Fiscal 1999 report on basic research for promotion of joint implementation programs. Heat and power plant reconstruction project for Yuzhmash Company co-generating plant, Donepropetrovsk City, the Ukraine; 1999 nendo Donepropetrovsk shi Yuzhmansh sha Heat and Power Plant Reconstruction Project chosa hokokusho

    NONE

    2000-03-01

    This project complies with the COP3 (Third Session of the Conference of the Parties to the United Nations Framework Convention on Climate Change) protocol. To be newly installed are three gas turbine power generators (rating: 26MW, main fuel: natural gas), three waste heat recovery boilers (additionally fired boilers, 2-pressure natural circulation type), and one 40MW water circulation type mixed pressure steam turbine power generator (including a bleeder for co-generation). Greenhouse gases will be reduced by 242,424 tons/year in terms of CO2. The project will cost 9-billion yen in total, with improvement on cost performance expected to be 37,000 yen/ton/year in terms of CO2 and 1,500 yen/ton/25 years. Profitability is assessed using EIRR (economic internal rate of return) when the exchange rate is set at 4.91 UHA/US dollar (as of February 2000). Provided that the emission trading rate in US dollar/ton in CO2 is 0.0, 5.00, 14.0, or 60.00, the economic rate of return will be 7.363, 8.112, 9.399, or 15.155%, respectively. To realize an internal rate of return of 15% which the project wants to achieve, the emission trading rate needs to be 60 US dollars/ton in CO2 or higher. (NEDO)

  11. FY 2001 report on the new energy vision of the Ishigaki City area. Survey for working out 'the project for the introduction of biomass energy in the central urban area of Ishigaki City'; 2001 nendo Ishigaki shi chiiki shin energy vision sakutei tou jigyo hokokusho

    NONE

    2002-02-01

    Study was made of potentialities of the project of 'an energy supply system for biomass energy using business-derived raw refuse' indicated in 'the new energy vision of Ishigaki City, Okinawa Prefecture.' The amount of the recovered business-derived raw refuse was set at 5.6t at the minimum as against the discharged amount of 8t, and it was calculated that the amount of the biogas generated from the high temperature methane fermentation would be 757.7 m{sup 3}/d. The amount of the suppliable energy calculated from the above was 1,102.4 kWh/d in gas engine. Further, as to the energy demand, supposing the energy demand in large-scale hot bath facilities using salt as a resource of the area, it was calculated that the energy demand would be approximately 1MWh/d altogether with that in the biogas plant. As a result of the study of profitability of the project, the following was found out: it takes 25 years to recover the invested capital in the case of carrying out the biogas plant project alone and 18 years to recover it in the case of carrying out the hot bath facility project alone. In the case of carrying out both projects as one, it takes 18 years to recover the invested capital, the same as in the case of carrying out the hot bath facility project alone, but a great shortage from 6 years to 3 years is shown of the period required to get out of the cumulative deficit. (NEDO)

  12. Basic investigation on promotion of joint implementation in fiscal 2000. Energy saving projects at two steel making companies in Fushun City in China; 2000 nendo kyodo jisshi nado suishin kiso chosa hokokusho. Chugoku Fushun shi ni okeru tekko gaisha 2 sha no shoene project chosa hokokusho

    NONE

    2001-03-01

    With an objective of saving energy and reducing greenhouse gas emission, investigations and discussions were given on two steel making companies in China. Discussions were given for Fushun Special Steel Co., Ltd. on abolishment and unification of four electric furnaces into two new electric furnaces, and for Fushun New Steel Co., Ltd. on installation of a granulation reinforcing facility, a segregation reinforcing device, and cooler waste heat recovery boilers for the sintering machine, installation of sensors including the waste gas oxygen concentration meter, adoption of a process computer, and optimization of the furnace temperature patterns for the heating furnace. As a result of the discussions, it was revealed that the unit requirement for electric power used at Fushun Special Steel can be reduced largely, and so can the fuel used at Fushun New Steel. The annual energy saving effect would be about 500 million yen relative to the investment amount of 2.8 billion yen at Fushun Special Steel, and about 400 million yen relative to the investment amount of about 400 million yen at Fushun New Steel. The greenhouse gas emission would be reduced annually by 40,000 t-CO2 and 60,000 t-CO2 respectively. Fushun Special Steel will execute an international bid in May this year. (NEDO)

  13. FY 2000 report on the basic survey to promote Joint Implementation, etc. Project for the modernization of general industry use boilers at the industrial complex in Namping City, Fujian Province, China; 2000 nendo kyodo jisshi nado suishin kiso chosa hokokusho. Chugoku Fukkensho Namping shi danchi no ippan sangyoyo boiler kindaika jigyo

    NONE

    2001-03-01

    An investigational study was conducted of the project for energy conservation and greenhouse effect gas reduction by introducing the energy utilization system combined with CCS equipment and cogeneration system to general industry plants at the industrial complex in Namping City, Fujian Province, China. As a result of the field survey, it was concluded that the capacity suitable for CCS center was 200,000 t/y and the size suitable for pulverized coal boiler at each site was 35 t/h. The energy conservation amount in this project was the coal use reduction amount by 88,000 t/y (48,000 toe/y), and the greenhouse effect gas reduction amount was approximately 90,000 t-CO2/y. As to the economical efficiency of the project, the period of ROI was about 5.1 years, and the internal earning rate at each site was 14-23%. The materialization of the project was confirmed. However, in the case of raising the required funds from city banks in China, financing conditions are strict, and the financing seems to be difficult at each site. It is necessary to raise low-interest funds such as the special environment yen credit. (NEDO)

  14. Fiscal 1999 report on basic research for promotion of joint implementation programs. Feasibility study on energy saving and environmental improvement for Radom City district cogeneration station; 1999 nendo Radom shi chiiki netsuden heikyu station sho energy oyobi kankyo kaizen kanosei chosa hokokusho

    NONE

    2000-03-01

    Pursuant to the COP3 (Third Session of the Conference of the Parties to the United Nations Framework Convention on Climate Change) protocol, studies are conducted on a district cogeneration station for Radom City, Poland. Using the annual load pattern of heat supply, cogeneration will be built only for the amount that covers utilization factors not lower than a specified level, and the shortage in winter when the load is heavy due to demand for heat will be dealt with by the existing hot water boilers. Daily change in load is to be covered by a new, additional boiler which will bear 20% of the whole output. The system is a natural gas fired turbine cogenerator, and hot water is supplied by a waste heat recovery boiler. Cogeneration will cover 80% of the annual heat supply. As for heat supply capability, it is set at 72MWt with the additional boiler taken into account, and 35MWe is to be generated. Heat efficiency will increase to be higher than 80%, coal consumption will decrease, and 28,117 tons/year in terms of oil will be saved with the increase in natural gas consumption subtracted. CO2 reduction will also be as large as 206,000 tons/year, decreasing air pollutants. Provided that 4.336-billion yen for facilities are financed by Japan's environmental yen loan, Poland's National Fund, and Radom City's own fund, IRR (internal rate of return) on investment will be fairly good at 10% in 30 years of operation. Investment will be recovered in nine years and there is no problem in cash flow. (NEDO)

  15. FY 1999 achievement report on the supporting project to form energy/environmental technology verification project - International joint verification research project. Research on the waste-fueled power system using gases emitted from the sanitary landfill in Samarkand city; 1999 nendo Samarkand shi ni okeru umetate gas wo riyoshita gomi hatsuden system no kenkyu

    NONE

    2000-03-01

    In Samarkand city, Uzbekistan, solid waste materials are treated in the sanitary landfill. However, requests were made from the Minister of Communal Services for the construction of power system as a part of the effective waste utilization and the study of the integrated waste collection system enabling the construction of a power system. There is only one waste dumping site in Samarkand city. That started to be used in the beginning of the 1970s. That was planned to be closed in 2000, but is now planned to used till 2005. Therefore, it is urgent to reduce the volume of waste. The incineration of waste is the most suitable for it. In the study of a power system by using waste effectively, it is important to efficiently recover the methane gas emitted from the waste dumping site, to study the adoption of the repowering system using the combustion gas of methane gas for increasing the generated output of waste-fueled power generation facilities, and to heighten the low power generation efficiency. This study includes the survey of the waste discharge amount/composition/heating value, collection of the data on waste collection, and sampling/analysis of gases emitted from the dumping site. The paper reported on the proposals. (NEDO)

  16. FY 1997 report on the survey on the current residential waste treatment and integrated utilization of waste including heat supply in Shanghai city; 1997 nendo chosa hokokusho (Shanghai shi ni okeru seikatsu gomi shori no genjo narabini kyonetsunado wo fukumu sogo riyo ni kansuru chosa)

    NONE

    1998-03-01

    Survey was made on residential waste treatment in Shanghai city. Shanghai city with nearly 13 million registered residents produces on average 10,000-11,000 tons/day residential solid wastes. Such wastes are basically disposed by land filling. A landfill site has a current disposal capacity of 7,500 tons/day, and is scheduled to be expanded up to 9,000 tons/day. Problems of waste disposal in Shanghai city are as follows: transportation of wastes collected in the city by trucks, transportation through transit stations to the landfill site by ships, and high disposal cost. Shanghai Environmental Sanitation Bureau is pursuing researches on recycling of wastes, reduction of wastes and harmless treatment in place of conventional land filling. As the survey result, adoption of complete separate collection of wastes is basically important, and application of the latest technologies such as combustion treatment for every waste, heat use, gasification fusion furnace, and RDF (refuse derived fuel) for coal-firing boilers should be considered. 86 figs., 18 tabs.

  17. FY 2000 report on the basic survey to promote Joint Implementation, etc. Project for improvement of efficiency of the power generation/desalination plant in Aktau City; 2000 nendo kyodo jisshi nado suishin kiso chosa hokokusho. Aktau shi hatsuden zosui plant koritsu kaizen jigyo

    NONE

    2001-03-01

    For the purpose of conserving energy and reducing greenhouse effect gas emission, feasibility study was conducted for improvement of efficiency of power generation/desalination facilities at MAEK Energy Center, Aktau City, Manghistau, Kazakhstan. Presently, the main facilities are the conventional natural gas fired power plant, evaporation type seawater desalination facility, hot water production facility, etc. In the project, introduction of the following was planned to be made: cogeneration facility composed of two units of 1,100-degree C class gas turbine and reverse osmosis (RO) type desalination facility for drinking water production with a capacity of 50,000 t/d. As a result of the study, the energy conservation amount in this project was 151,900-165,400 toe/y in power generation facility, and the greenhouse effect gas reduction amount was 355,000-387,000 t-CO2/y in power generation facility and 268,000 t-CO2/y in desalination facility. The construction cost and operational cost of the plant were 45.7 billion yen and 2.8 billion yen/y. In the economical estimation, ROI and ROE before tax were 7.4 and 34.8, respectively, which were considered to be appropriate values as social infrastructure related conditions. (NEDO)

  18. Basic investigation on promotion of joint implementation in fiscal 2000. Efficiency improvement project for district heat supplying plants in Dailian City in China; 2000 nendo kyodo jisshi nado suishin kiso chosa hokokusho. Chugoku/Dailian shi chiiki netsu kyokyu plant kokoritsu kaizen project

    NONE

    2001-03-01

    Investigations and discussions have been given on energy saving possibilities at two medium-sized heat and power supplying plants in the city of Dailian in China. The project will improve the operation methods of the heat and power plants so that the energy cost can be minimized, and attempt to improve the boiler heat efficiency and save the energy by means of heat recovery and utilization. The draft modification plan for energy conservation has planned operation optimization for energy conservation, control of boiler operation under variable pressure, modification of the external boiler heat converter, use of inverters for the large capacity motors for boilers, and recovery of heat from the boiler blow-down water. In the analysis, models were structured from the operation data, and the effects of applying the energy saving measures were derived from simulation. As a result, the energy saving effect was found to be about 13,000 tons at the Chunhai plant and about 7,000 tons at the Pulandian plant annually (converted to oil). The reduction in greenhouse gas emission was found to be about 40,000 tons at the Chunhai plant and about 20,000 tons at the Pulandian plant annually. The number of years for investment payback is about 4.1 years at the Chunhai plant, and about 4.9 years at the Pulandian plant, wherein good profitability can be estimated. (NEDO)

  19. Cyclin D1 affects epithelial–mesenchymal transition in epithelial ovarian cancer stem cell-like cells

    Jiao J

    2013-06-01

    Full Text Available Jie Jiao,1,4 Lu Huang,1 Feng Ye,1 MinFeng Shi,2 XiaoDong Cheng,3 XinYu Wang,3 DongXiao Hu,3 Xing Xie,3 WeiGuo Lu31Women's Reproductive Health Laboratory of Zhejiang Province, Women's Hospital, School of Medicine, Zhejiang University, Hangzhou, 2Department of Gynaecology and Obstetrics, Changhai Hospital, the Second Military Medical University, Shanghai, 3Women's Reproductive Health Laboratory of Zhejiang Province, Department of Gynecologic Oncology, Women's Hospital, School of Medicine, Zhejiang University, Hangzhou, 4Department of Gynaecology and Obstetrics, Hangzhou First People's Hospital, Hangzhou, People's Republic of ChinaBackground: The association of cancer stem cells with epithelial–mesenchymal transition (EMT is receiving attention. We found in our previous study that EMT existed from CD24- phenotype cells to their differentiated cells. It was shown that cyclin D1 functioned in sustaining self-renewal independent of CDK4/CDK6 activation, but its effect on the EMT mechanism in ovarian cancer stem cells is unclear.Methods: The anchorage-independent spheroids from ovarian adenocarcinoma cell line 3AO were formed in a serum-free medium. CD24- and CD24+ cells were isolated by fluorescence-activated cell sorting. Cell morphology, viability, apoptosis, and migratory ability were observed. Stem-related molecule Bmi-1, Oct-4 and EMT-related marker E-cadherin, and vimentin expressions were analyzed. Cyclin D1 expression in CD24- phenotype enriched spheroids was knocked down with small interfering RNA, and its effects on cell proliferation, apoptosis, migration ability, and EMT-related phenotype after transfection were observed. Results: In our study, CD24- cells presented stronger proliferative, anti-apoptosis capacity, and migratory ability, than CD24+ cells or parental cells. CD24- cells grew with a scattered spindle-shape within 3 days of culture and transformed into a cobblestone-like shape, identical to CD24+ cells or parental cells at 7

  20. Pharmacokinetics, tissue distribution, and metabolites of a polyvinylpyrrolidone-coated norcantharidin chitosan nanoparticle formulation in rats and mice, using LC-MS/MS

    Ding XY

    2012-04-01

    Full Text Available Xin-Yuan Ding1, Cheng-Jiao Hong2, Yang Liu1, Zong-Lin Gu1, Kong-Lang Xing1, Ai-Jun Zhu1, Wei-Liang Chen1, Lin-Seng Shi1, Xue-Nong Zhang1, Qiang Zhang31Department of Pharmaceutics, College of Pharmaceutical science, Soochow University, Suzhou, 2Jiang Su Provincial Key Laboratory of Radiation Medicine and Protection, Suzhou, 3Department of Pharmaceutics, School of Pharmaceutical Science, Peking University, Beijing, People’s Republic of ChinaAbstract: A novel formulation containing polyvinylpyrrolidone (PVP K30-coated norcantharidin (NCTD chitosan nanoparticles (PVP–NCTD–NPs was prepared by ionic gelation between chitosan and sodium tripolyphosphate. The average particle size of the PVP–NCTD–NPs produced was 140.03 ± 6.23 nm; entrapment efficiency was 56.33% ± 1.41%; and drug-loading efficiency was 8.38% ± 0.56%. The surface morphology of NCTD nanoparticles (NPs coated with PVP K30 was characterized using various analytical techniques, including X-ray diffraction and atomic force microscopy. NCTD and its metabolites were analyzed using a sensitive and specific liquid chromatography-tandem mass spectrometry method with samples from mice and rats. The results indicated the importance of the PVP coating in controlling the shape and improving the entrapment efficiency of the NPs. Pharmacokinetic profiles of the NCTD group and PVP–NCTD–NP group, after oral and intravenous administration in rats, revealed that relative bioavailabilities were 173.3% and 325.5%, respectively. The elimination half-life increased, and there was an obvious decrease in clearance. The tissue distribution of NCTD in mice after the intravenous administration of both formulations was investigated. The drug was not quantifiable at 6 hours in all tissues except for the liver and kidneys. The distribution of the drug in the liver and bile was notably improved in the PVP–NCTD–NP group. The metabolites and excretion properties of NCTD were investigated by analyzing

  1. Aitken extrapolation and epsilon algorithm for an accelerated solution of weakly singular nonlinear Volterra integral equations

    Mesgarani, H; Parmour, P; Aghazadeh, N

    2010-01-01

    In this paper, we apply Aitken extrapolation and epsilon algorithm as acceleration technique for the solution of a weakly singular nonlinear Volterra integral equation of the second kind. In this paper, based on Tao and Yong (2006 J. Math. Anal. Appl. 324 225-37.) the integral equation is solved by Navot's quadrature formula. Also, Tao and Yong (2006) for the first time applied Richardson extrapolation to accelerating convergence for the weakly singular nonlinear Volterra integral equations of the second kind. To our knowledge, this paper may be the first attempt to apply Aitken extrapolation and epsilon algorithm for the weakly singular nonlinear Volterra integral equations of the second kind.

  2. Parliamentary Majorities and National Minorities: Moldova’s Accommodation of the Gagauz

    2007-01-01

    Al R.S.S. Moldova Pentru Problemele i and Mihai Cotorobai, 26 . Nationale Shi Autoadminstrararea Locala Shi Economia Locala, signed by A. Arsen...No ———. Avizul Comissiilor Permanente Ale Soveitului Suprem al R.S.S. Moldova p şi Autoadminstrararea Localâ şi Economia Localâ. Signed by A. Arseni

  3. Sima Qian and His Historical Records

    2003-01-01

    <正> Sima Qian (145-86 BC), a native of Xiayang (now Hancheng, Shaanxi Province), is regarded as China’s greatest historiographer. He is best known for his history book, Historical Records (Shi Ji).Son of Sima Tan, who held the post of the Grand Historian (Tai Shi Ling ) of the Han Dynasty (206 BC-AD 25), Sima

  4. Applications of a Sequence of Points in Teaching Linear Algebra, Numerical Methods and Discrete Mathematics

    Shi, Yixun

    2009-01-01

    Based on a sequence of points and a particular linear transformation generalized from this sequence, two recent papers (E. Mauch and Y. Shi, "Using a sequence of number pairs as an example in teaching mathematics". Math. Comput. Educ., 39 (2005), pp. 198-205; Y. Shi, "Case study projects for college mathematics courses based on a particular…

  5. Eiko Ishioka on Aesthetic Performativity, Creativity, and Mimesis

    Sato, Toyoko

    by Eiko which shows her directorial spirit in full, the Japanese title reads Ishioka Eiko, Fūshi Kaden. Fūshi Kaden is the title of a book of the 14th century, which concerns the attainment of the flowering of art in Noh play and is a philosophical treatise on mimesis. What does it signify to appropriate...

  6. Constraints on Excuse Making: The Deterring Effects of Shyness and Anticipated Retest.

    Shepperd, James A.; And Others

    1995-01-01

    Examined whether the apparent absence of an egocentric bias among shy individuals is reflected in their excuse making following poor performance and whether anticipating a challenge to one's excuses would dissuade even nonshy individuals from making excuses. Shy individuals refrained form making consistency-lowering excuses regardless of…

  7. Stone heterogeneity index as the standard deviation of Hounsfield units: A novel predictor for shock-wave lithotripsy outcomes in ureter calculi.

    Lee, Joo Yong; Kim, Jae Heon; Kang, Dong Hyuk; Chung, Doo Yong; Lee, Dae Hun; Do Jung, Hae; Kwon, Jong Kyou; Cho, Kang Su

    2016-04-01

    We investigated whether stone heterogeneity index (SHI), which a proxy of such variations, was defined as the standard deviation of a Hounsfield unit (HU) on non-contrast computed tomography (NCCT), can be a novel predictor for shock-wave lithotripsy (SWL) outcomes in patients with ureteral stones. Medical records were obtained from the consecutive database of 1,519 patients who underwent the first session of SWL for urinary stones between 2005 and 2013. Ultimately, 604 patients with radiopaque ureteral stones were eligible for this study. Stone related variables including stone size, mean stone density (MSD), skin-to-stone distance, and SHI were obtained on NCCT. Patients were classified into the low and high SHI groups using mean SHI and compared. One-session success rate in the high SHI group was better than in the low SHI group (74.3% vs. 63.9%, P = 0.008). Multivariate logistic regression analyses revealed that smaller stone size (OR 0.889, 95% CI: 0.841-0.937, P < 0.001), lower MSD (OR 0.995, 95% CI: 0.994-0.996, P < 0.001), and higher SHI (OR 1.011, 95% CI: 1.008-1.014, P < 0.001) were independent predictors of one-session success. The radiologic heterogeneity of urinary stones or SHI was an independent predictor for SWL success in patients with ureteral calculi and a useful clinical parameter for stone fragility.

  8. Spontaneous haemoperitoneum in pregnancy and endometriosis: a case series

    Lier, M. van; Malik, R.F.; Waesberghe, J. van; Maas, J.W.; Rumpt-van de Geest, D.A. van; Coppus, S.F.P.J.; Berger, J.P.; Rijn, B.B. van; Janssen, P.F.; Boer, M.A. de; Vries, J.I.P. de; Jansen, F.W.; Brosens, I.A.; Lambalk, C.B.; Mijatovic, V.

    2017-01-01

    OBJECTIVE: To report pregnancy outcomes of SHiP (spontaneous haemoperitoneum in pregnancy) and the association with endometriosis. DESIGN: Retrospective case note review. SETTING: Dutch referral hospitals for endometriosis. SAMPLE: Eleven women presenting with 15 events of SHiP. METHODS: In

  9. Spontaneous haemoperitoneum in pregnancy and endometriosis : a case series

    Lier, McI; Malik, R F; van Waesberghe, Jhtm; Maas, J W; van Rumpt-van de Geest, D A; Coppus, S F; Berger, J P; van Rijn, B B; Janssen, P F; de Boer, M. A; de Vries, Jip; Jansen, F. W.; Brosens, I A; Lambalk, C B; Mijatovic, V

    OBJECTIVE: To report pregnancy outcomes of SHiP (spontaneous haemoperitoneum in pregnancy) and the association with endometriosis. DESIGN: Retrospective case note review. SETTING: Dutch referral hospitals for endometriosis. SAMPLE: Eleven women presenting with 15 events of SHiP. METHODS: In

  10. Effect of Heat Treatment on the Lycopene Content of Tomato Puree.

    MBI

    2013-04-03

    Apr 3, 2013 ... foods is mainly due to lycopene (Shi et al, 2002). Lycopene is a naturally .... containing the 5 g sample to solubilized the lycopene (Shi and Maguer, .... Nigeria, 33(1): 178-. 180. Perkins-Veazie P, Collins J K, Pair S D, Robert S.

  11. Feasibility study of superharmonic imaging using chirps

    Van Neer, P.; Danilouchkine, M.G.; Matte, G.; Voormolen, M.M.; Verweij, M.D.; De Jong, N.

    2010-01-01

    Superharmonic imaging (SHI) targets a combination of the 3rd to 5th harmonics. It was proven to have certain advantages in comparison with the established imaging standards in medical utrasound. SHI enhances the spatial resolution and improves the quality of echographic images, mainly by eliminating

  12. Dual-pulse frequency compounded superharmonic imaging

    Neer, P.L.M.J. van; Danilouchkine, M.G.; Matte, G.M.; Steen, A.F.W. van der; Jong, N. de

    2011-01-01

    Tissue second-harmonic imaging is currently the default mode in commercial diagnostic ultrasound systems. A new modality, superharmonic imaging (SHI), combines the third through fifth harmonics originating from nonlinear wave propagation through tissue. SHI could further improve the resolution and

  13. Is universal coverage via social health insurance financially feasible ...

    SHI would take up an increasing proportion of total health expenditure over the simulation period and become the dominant health financing mechanism. In principle, and on the basis of the assumed policy variables, universal coverage could be reached within 6 years through the implementation of an SHI scheme based ...

  14. ALK and TGF-Beta Resistance in Breast Cancer

    2017-10-01

    Award Number: W81XWH‐15‐1‐0650 TITLE: ALK and TGF-Beta Resistance in Breast Cancer PRINCIPAL INVESTIGATOR: Xin-Hua Feng CONTRACTING...and TGF-Beta Resistance in Breast Cancer 5b. GRANT NUMBER W81XWH‐15‐1‐0650 5c. PROGRAM ELEMENT NUMBER 6. AUTHOR(S) 5d. PROJECT NUMBER Xin-Hua Feng...response is a hallmark in human cancer . However, the mechanisms underlying TGF- resistance in breast cancer have not been elucidated. Anaplastic

  15. Computational performance of a projection and rescaling algorithm

    Pena, Javier; Soheili, Negar

    2018-01-01

    This paper documents a computational implementation of a {\\em projection and rescaling algorithm} for finding most interior solutions to the pair of feasibility problems \\[ \\text{find} \\; x\\in L\\cap\\mathbb{R}^n_{+} \\;\\;\\;\\; \\text{ and } \\; \\;\\;\\;\\; \\text{find} \\; \\hat x\\in L^\\perp\\cap\\mathbb{R}^n_{+}, \\] where $L$ denotes a linear subspace in $\\mathbb{R}^n$ and $L^\\perp$ denotes its orthogonal complement. The projection and rescaling algorithm is a recently developed method that combines a {\\...

  16. Dissecting and Targeting Latent Metastasis

    2014-09-01

    Option in Brain Metastasis Manuel Valiente,1 Anna C. Obenauf,1 Xin Jin,1 Qing Chen,1 Xiang H.-F. Zhang,1,8 Derek J. Lee,1 Jamie E. Chaft,2 Mark G. Kris,2...of poor response to tamoxifen therapy in recurrent breast cancer. J. Natl. Cancer Inst. 87, 751–756. Francia, G., Cruz -Munoz, W., Man, S., Xu, P... Manuel Valiente1, Xin Jin1†, Ekrem Emrah Er1, Ruzeen Patwa1, Ke Xu3 and Joan Massagué1 1 Cancer Biology and Genetics Program, 2 Department of

  17. A minimax inequality for a class of functionals and applications to the existence of solutions for two-point boundary-value problems

    Ghasem Alizadeh Afrouzi

    2006-10-01

    Full Text Available In this paper, we establish an equivalent statement to minimax inequality for a special class of functionals. As an application, we prove the existence of three solutions to the Dirichlet problem $$displaylines{ -u''(x+m(xu(x =lambda f(x,u(x,quad xin (a,b,cr u(a=u(b=0, }$$ where $lambda>0$, $f:[a,b]imes mathbb{R}o mathbb{R}$ is a continuous function which changes sign on $[a,b]imes mathbb{R}$ and $m(xin C([a,b]$ is a positive function.

  18. [The significance of a large number of health insurance funds and fusions for health services research with statutory health insurance data in Germany - experiences of the lidA study].

    March, S; Powietzka, J; Stallmann, C; Swart, E

    2015-02-01

    Since 1970 the health insurance system in Germany has shrunk by more than 90% to 132 statutory health insurance funds (SHI) at present. For studies using data from different SHI, this development means a reduction of contacts and a higher workload when requesting data. The latter is due to the fact that fusions bind resources in the health insurance funds. In order to avoid selection in studies among the insured, all SHI must be contacted. Additionally, 15 controlling institutions on the state and national level have to agree as determined in § 75 of the German Social Code number 10. The lidA study - a German cohort study on work, age and health intends to link primary and secondary data from all SHI of those insured who have given their agreement for participation. Since the beginning of the study in 2009 the number of SHI has been reduced by 70. Of the 6 585 interviews in 2011 approximately half of the interviewees agreed in written form that their individual health insurance data can be linked. This portion of the insured is dispersed among 95 SHI. At this point, 11 contracts with SHI are realised (approximately 50% of the insured) and 8 data controlling authorities have been contacted. The problems involved in the fusion of SHI and its meaning for research are explained in this article. The fusion of SHI makes sense for the long term. It will lead to a reduction of contacts and contracts that researchers have to establish in order to analyse the data. Therefore, this article also discusses the alternative of creating a meta-data set of all the data from the different SHI combined. © Georg Thieme Verlag KG Stuttgart · New York.

  19. Committees

    2012-11-01

    Leadership Team of the IAHR Committee for Hydraulic Machinery and Systems Eduard EGUSQUIZA, UPC Barcelona, Spain, Chair François AVELLAN, EPFL-LMH, Switzerland, Past Chair Richard K FISHER, Voith Hydro Inc., USA, Past Chair Fidel ARZOLA, Edelca, Venezuela Michel COUSTON, Alstom Hydro, France Niklas DAHLBÄCKCK, Vatenfall, Sweden Normand DESY, Andritz VA TECH Hydro Ltd., Canada Chisachi KATO, University of Tokyo, Japan Andrei LIPEJ, Turboinstitut, Slovenija Torbjørn NIELSEN, NTNU, Norway Romeo SUSAN-RESIGA, 'Politehnica' University Timisoara, Romania Stefan RIEDELBAUCH, Stuggart University, Germany Albert RUPRECHT, Stuttgart University, Germany Qing-Hua SHI, Dong Fang Electrical Machinery Co., China Geraldo TIAGO, Universidade Federal de Itajubá, Brazil International Advisory Committee Shouqi YUAN (principal) Jiangsu University China QingHua SHI (principal) Dong Fang Electrical Machinery Co. China Fidel ARZOLA EDELCA Venezuela Thomas ASCHENBRENNER Voith Hydro GmbH & Co. KG Germany Anton BERGANT Litostroj Power doo Slovenia B C BHAOYAL Research & Technology Centre India Hermod BREKKE NTNU Norway Stuart COULSON Voith Hydro Inc. USA Paul COOPER Fluid Machinery Research Inc USA V A DEMIANOV Power Machines OJSC Russia Bart van ESCH Technische Universiteit Eindhoven Netherland Arno GEHRER Andritz Hydro Graz Austria Akira GOTO Ebara Corporation Japan Adiel GUINZBURG The Boeing Company USA D-H HELLMANN KSB AG Germany Ashvin HOSANGADI Combustion Research and Flow Technology USA Byung-Sun HWANG Korea Institute of Material Science Korea Toshiaki KANEMOTO Kyushu Institute of Technology Japan Mann-Eung KIM Korean Register of Shipping Korea Jiri KOUTNIK Voith Hydro GmbH & Co. KG Germany Jinkook LEE Eaton Corporation USA Young-Ho LEE Korea Maritime University Korea Woo-Seop LIM Hyosung Goodsprings Inc Korea Jun MATSUI Yokohama National University Japan Kazuyoshi Mitsubishi H I Ltd, Japan MIYAGAWA Christophe NICOLET Power Vision Engineering Srl Switzerland Maryse PAGE Hydro

  20. Mechanisms Involved in the Removal of Heavy Metals from Stormwater via Lignocellulosic Filtration Media

    2018-01-01

    This report aims to supplement our previous report (Yonge et al. 2016; WA-RD 816.3) that assessed copper and zinc adsorption to lignocellulosic filtration media using laboratory tests and field-scale column tests for urban stormwater remediation. The...

  1. Browse Title Index

    Items 201 - 250 of 990 ... I: Synthesis, characterization and thermal properties of a novel polyhedral cubic silsesquioxane, Abstract PDF. Enock O. Dare, Gabriel A. Olatunji, David S. .... Vol 25, No 2 (2011), Saturated properties prediction in critical region by a quartic equation of state, Abstract PDF. Yong Wang, Guo-bo Huang, ...

  2. Annotated Bibliography for Lake Erie. Volume III. Engineering,

    1974-10-01

    the ecology is examined. 83. Bar- Kochba , Y. and A. J. Simon. 1971. Rainfall and floods in Northeastern Ohio. Dept. of Eng. Univ. Akron. 87 p. This...Bar- Kochba , Y. Bergs, A. Dept. of Civil Eng. 1 Yonge Street University of Akron Toronto, Ontario Akron, Ohio 44304 Canada Barnhouse Associates Bethlehem

  3. A comparative study of the effects of cone-plate and parallel-plate geometries on rheological properties under oscillatory shear flow

    Yong Song, H

    2017-11-01

    Full Text Available -1 Korea-Australia Rheology Journal A comparative study of the effects of cone-plate and parallel- plate geometries on rheological properties under oscillatory shear flow Hyeong Yong Song1, Reza Salehiyan2, Xiaolei Li1, Seung Hak Lee1 and Kyu Hyun1...

  4. Research Article Special Issue

    2017-08-08

    Aug 8, 2017 ... power levels compared to the other types of land-mobile antennas [3]. Usually .... It is because the transmission of radio waves in that path is affected by ..... [21] Yong C Y, Rahman T A, Chew K M. Wireless industry emission: ...

  5. Põhja-Korea valmistub sõjaks / Arko Olesk

    Olesk, Arko, 1981-

    2006-01-01

    Põhja-Korea juhi Kim Yong Nami sõnul on riik nõus naasma läbirääkimistele USA-ga, kui tühistataks senised sanktsioonid Põhja-Korea vastu. ÜRO Julgeolekunõukogus alustati resolutsiooniprojekti arutamist, mis näeb ette Põhja-Koreale tuumakatsetuste eest karistusi. Lisa: Kahtlane katsetus

  6. Journal of Genetics | Indian Academy of Sciences

    Identification of twelve novel polymorphic microsatellite loci in the severe weed, Stellera chamaejasme L. (Thymelaeaceae) · Yong Hong Zhang Ji Pei Yue Hang Sun · More Details Fulltext PDF. pp e27-e30. Polymorphism of Prophet of Pit-1 gene and its relationship with litter size of Small Tail Han sheep · Qiuyue Liu Caixia ...

  7. Sadhana | Indian Academy of Sciences

    Home; Journals; Sadhana. Li Ruiqin. Articles written in Sadhana. Volume 31 Issue 6 December 2006 pp 661-669. Research on conceptual design of mechatronic systems · Xu Yong Zou Huijun Li Ruiqin · More Details Abstract Fulltext PDF. Based on the fact that function-structure generating and function solving are ...

  8. FORUM ISSUES IN THE ENFORCEMENT OF REGULATORY ...

    in his role as father of the country. In modern times, the ... of self-regulatory organisations in most financial markets who thus far have ..... companies and their officers under the Act? There are as yet no clear an- swers to ..... 578 (High Court of Singapore) where Chief Justice Yong Pung How held that to establish a breach of ...

  9. Berlinale terad / Kadri Kõusaar

    Kõusaar, Kadri

    2006-01-01

    56. Berliini festivali filme - Jasmila Zhbanici "Grbavica", Michael Winterbottomi, Mat Whitecrossi "Teekond Guantanamosse", tailase Pen-ek Ratanaruangi "Nähtamatud lained", John Hillcoati "Ettepanek" (stsenarist ja muusika autor Nick Cave), Bennett Milleri "Capote" (nimiosas P.S. Hoffman), Yang Yong-hi dokfilm "Kallis Pyongyang", Tomer Heymanni dokfilm "Pabernukud"

  10. What Is the Transformational Learning Experience of Secondary Teachers Who Have Dealt with Burnout?

    Sims, Julius R., I

    2013-01-01

    Burnout is a syndrome consisting of emotional exhaustion (EE) and depersonalization (DPZ) (Yong & Yue, 2007). Teachers who fall victim to burnout are likely to be less sympathetic toward students, have a lower tolerance for classroom disruption, be less apt to prepare adequately for class, and feel less committed and dedicated to their work…

  11. Sadhana | Indian Academy of Sciences

    Home; Journals; Sadhana. S Ramesh. Articles written in Sadhana. Volume 35 Issue 1 February 2010 pp 87-95. Preparation and characterization of plasticized high molecular weight PVC-based polymer electrolytes · S Ramesh Geok Bee Teh Rong-Fuh Louh Yong Kong Hou Pung Yen Sin Lim Jing Yi · More Details ...

  12. Geok Bee Teh

    Geok Bee Teh. Articles written in Sadhana. Volume 35 Issue 1 February 2010 pp 87-95. Preparation and characterization of plasticized high molecular weight PVC-based polymer electrolytes · S Ramesh Geok Bee Teh Rong-Fuh Louh Yong Kong Hou Pung Yen Sin Lim Jing Yi · More Details Abstract Fulltext PDF.

  13. Linkage disequilibrium and association mapping of drought ...

    sunny t

    2016-11-16

    Nov 16, 2016 ... related to drought tolerance (YongSheng et al., 2009). Among the variety of ... (Li et al., 2013), yield (LiFang et al., 2010) and fibre traits. (Islam et al., 2014). ..... such molecular markers as SSRs (Bertini et al., 2006;. Zhang et al.

  14. Methanotrophic abundance and community fingerprint in pine and ...

    Zheng Y

    2012-07-10

    Jul 10, 2012 ... in pine and tea plantation soils as revealed by molecular methods. Yong Zheng. 1 .... Soil pH was determined with a soil to water ratio of 2:5 (W/V). Soil organic matter (OM) ..... Stable isotope probing analysis of the diversity ...

  15. Reference: 759 [Arabidopsis Phenome Database[Archive

    Full Text Available 759 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u18434608i Guan Yue-Feng...s. 2 852-63 18434608 2008 Jun Plant physiology Gao Ju-Fang|Guan Yue-Feng|Huang Xue-Yong|Yang Zhong-Nan|Zhang Hong-Xia|Zhu Jun

  16. From the role of context to the measurement problem: The Dutch connection pays tribute to Guy Van Orden

    Bosman, A.M.T.; Cox, R.F.A.; Hasselman, F.W.; Wijnants, M.L.

    2013-01-01

    The call for a daisy chain of replications by Daniel Kahneman (as cited in Yong, 2012) to combat the recent credibility problems of psychological science touches upon the issue that Guy dealt with ever since he started his academic career and that we acknowledge as one of his major contributions.

  17. From the role of context to the measurement problem : The Dutch connection pays tribute to Guy Van Orden

    Bosman, Anna M. T.; Cox, Ralf C. A.; Hasselman, Fred; Wijnants, Maarten L.

    2013-01-01

    The call for a daisy chain of replications by Daniel Kahneman (as cited in Yong, 2012) to combat the recent credibility problems of psychological science touches upon the issue that Guy dealt with ever since he started his academic career and that we acknowledge as one of his major contributions.

  18. Is "Yin-Yang Balancing" Superior to Ambidexterity as an Approach to Paradox Management?

    Li, Xin

    2018-01-01

    ) of the Confucian principle of Zhong-Yong that is largely compatible with Aristotle’s doctrine of the mean. Second, at the practical level, his BYin-Yang balancing^ solution, while being different from the structural ambidexterity approach, is compatible with the contextual ambidexterity approach. These first two...

  19. SYNTHESIS, PHYSICO-CHEMICAL AND ANTIMICROBIAL ...

    userpc

    -125. Byeong G. Chae D., Hae N., Hyung K. C. and. Yong K. C. (1996); Synthesis and characterization of schiff base derived 2- hydroxy napthaldehyde and aliphatic diammines. Bulletin Korean Chemical. Society 17(8): 687-693. Hassan S. W. ...

  20. Evaluation of watermelon varieties for tolerance to powdery mildew and Phytophthora fruit rot, 2014

    This experiment was conducted at the U.S. Vegetable Laboratory farm in Charleston, SC. The soil was Yonges loamy fine sand. This study was undertaken to determine the performance of seeded and seedless commercial watermelon varieties for tolerance to powdery mildew (PM) and Phytophthora fruit rot as...

  1. Author Details

    Huang, Yong. Vol 13, No 6 (2016) - Articles Imaging of brain function based on the analysis of functional connectivity - imaging analysis of brain function by fMRI after acupuncture at LR3 in healthy individuals. Abstract PDF. ISSN: 0189-6016. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for ...

  2. Pramana – Journal of Physics | Indian Academy of Sciences

    Physics: WHEPP-XI working group report. Amol Dighe Anjan Giri Rupak Dutta Naveen Gaur Tim Gershon Diptimoy Ghosh Xiao-Gang He George W-S Hou Yong-Yeon Keum Bhavik Kodrani Namit Mahajan Joaquim Matias Barilang Mawlong Basudha Misra Rukmani Mohanta Gagan Mohanty Sudhir Vempati. Volume 76 ...

  3. Reference: 163 [Arabidopsis Phenome Database[Archive

    Full Text Available 163 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u15660207i Kanter Ulr...saccharides. 2 243-54 15660207 2005 May Planta Guerineau Fran巽ois|Kanter Ulrike|Li Yong|Pauly Markus|Tenhaken Raimund|Usadel Bj旦rn

  4. An Approach toward an Asia-Pacific Strategy 2012 to 2020

    2014-06-01

    the Philippines, causing a significant loss to the Filipino farming industry.49 Even though no shots were fired, at the height of the conflict, the...Kim Yong-sam and Mun Il-bong, were executed in 2010; it appears that both were used as scape- goats for failed economic and security policies. In 2011

  5. Journal of Genetics | Indian Academy of Sciences

    Jianchang Du1 Xingna Wang1 2 Mingsheng Zhang1 Dacheng Tian1 Yong-Hua Yang1. State Key Laboratory of Pharmaceutical Biotechnology, Department of Biology, Nanjing University, Nanjing 210093, China; Center for Drug Discovery and Design, State Key Laboratory of Drug Research, Shanghai Institute of Materia ...

  6. The evolutionary strata of DARPP-32 tail implicates hierarchical ...

    The evolutionary strata of DARPP-32 tail implicates hierarchical functional expansion in higher vertebrates. CHOONG YONG UNG and TEOW CHONG TEOH. Supplementary data 1. Protein sequences of PPP1R1 family from 39 vertebrate species in FASTA format. Supplementary data 2. Multiple sequence alignment results ...

  7. Proton-proton elastic scattering at ultrahigh energies

    Saleem, M.; Shaukat, M.A.; Fazal-e-Aleem (University of the Punjab, Lahore (Pakistan). Dept. of Physics)

    1981-05-30

    The authors use a geometrical model of high-energy pp elastic scattering as proposed by Chou and Yong to analyse experimental data available at present and consider the predictions of the dipole pomeron model for pp elastic scattering at ultrahigh energies. Theoretical results for differential cross sections are compared with experimental data.

  8. Yunnan Smelting Group Examines an Aluminum Project for Possible Investment

    2008-01-01

    <正>Tian Yong,General Manager of Yunnan Smelt- ing Group,has gone to Zha gai NuoEr in Heilongjiang Province with a study group to conduct a full careful examination on the feasi- bility of the investment in the aluminum pro- ject.Yunnan Smelting Group is a large-scale

  9. African Journal of Traditional, Complementary and Alternative ...

    Diuretic and anti-diuretic bioactivity differences of the seed and shell extracts of Alpinia oxyphylla fruit · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Yong-hui Li, Yin-feng Tan, Na Wei, Jun-qing Zhang, 25-32 ...

  10. JIU-REN YIN

    Home; Journals; Bulletin of Materials Science. JIU-REN YIN. Articles written in Bulletin of Materials Science. Volume 40 Issue 6 October 2017 pp 1255-1261. Molecular dynamics study on the relaxation properties of bilayered graphene with defects · WEI ZHANG JIU-REN YIN PING ZHANG YAN-HUAI DING YONG J IANG.

  11. Sadhana | Indian Academy of Sciences

    S Ramesh1 Geok Bee Teh1 Rong-Fuh Louh2 Yong Kong Hou1 Pung Yen Sin1 Lim Jing Yi1. Faculty of Engineering and Science, Universiti Tunku Abdul Rahman, Setapak, 53300 Kuala Lumpur, Malaysia; Department of Materials Science and Engineering, Feng Chia University, 100, Wenhwa Road, Seatwen, Taichung, ...

  12. Growth characteristics and productivity of cold-tolerant “Kowinearly ...

    Growth characteristics and productivity of cold-tolerant “Kowinearly” Italian ryegrass in the northern part of South Korea. Gi Jun Choi, Hee Chung Ji, Ki-Yong Kim, Hyung Soo Park, Sung Seo, Ki-Won Lee, Sang-Hoon Lee ...

  13. Expression of porcine myosin heavy chain 1 gene in Berkshire loins ...

    Expression of porcine myosin heavy chain 1 gene in Berkshire loins with a high pH24 value. Jin Hun Kang, Woo Young Bang, Eun Jung Kwon, Yong Hwa Lee, Da Hye Park, Eun Seok Cho, Min Ji Kim, Jong-Soon Choi, Hwa Chun Park, Beom Young Park, Chul Wook Kim ...

  14. Infinite dimensional differential games with hybrid controls

    The study of differential games with Elliott–Kalton strategies in the viscosity solution ... studied by Yong [6, 7]. ... Section 3 is devoted to the proof of the main uniqueness result for SQVI and the existence ...... Moreover, we have given explicit formulation of dynamic programming ... Financial support from NBHM is gratefully.

  15. Costing Household Surveys for Monitoring Progress Toward Ending Extreme Poverty and Boosting Shared Prosperity

    Kilic, Talip; Serajuddin, Umar; Uematsu, Hiroki; Yoshida, Nobuo

    2017-01-01

    On October 15, 2015, World Bank Group President Jim Yong Kim announced the World Bank Group’s commitment to support the 78 poorest countries to implement a multi-topic household survey every three years between 2016 and 2030, for monitoring progress toward ending extreme poverty and boosting shared prosperity. This paper estimates the resource requirements to achieve the objectives of impl...

  16. Developing rearing methods for Tetrastichus planipennisi (Hymenoptera: Eulophidae), a larval endoparasitoid of the emerald ash borer (Coleoptera: Buprestidae)

    Jian J. Duan; Mike Ulyshen; Leah Bauer; Ivich. Fraser

    2011-01-01

    Tetrastichus planipennisi Yong, a gregarious koinobiont endoparasitoid, is one of three hymenopteran parasitoids being released in the U.S. for biological control of the emerald ash borer (Agrilus planipennis Fairmair, EAB), an invasive beetle from Asia causing mortality of the ash trees (Fraxinus spp.) in North...

  17. Studies on middle silkgland proteins of cocoon colour sex-limited ...

    Home; Journals; Journal of Biosciences; Volume 29; Issue 1. Studies on middle silkgland proteins of cocoon colour sex-limited silkworm (Bombyx mori L.) using two-dimensional polyacrylamide gel electrophoresis. Yuan-Xiang Jin Yu-Yin Chen Meng-Kui Xu Yong-Huang Jiang. Articles Volume 29 Issue 1 March 2004 pp 45- ...

  18. Evaluation of fungicide rotations for management of Phytophthora fruit rot of watermelon, 2015

    The experiment was conducted at the U.S. Vegetable Laboratory farm in Charleston, SC. The soil was Yonges loamy fine sand. For the past 6 years, the field has been infested with Phytophthora capsici. The experimental design was a randomized complete block with four replications. Five-week-old seedli...

  19. High frequency plant regeneration from mature seed- derived callus ...

    PRECIOUS

    2009-12-15

    Dec 15, 2009 ... Ki-Won Lee, Gi Jun Choi, Ki-Yong Kim, Hee Chung Ji, Hyung Soo Park, Sei Hyung Yoon and ... Gramineae family plants (Ha et al., 2001; Dong and Qu, ..... Lee SH, Ahsan N, Lee KW, Kim DH, Lee DG, Kwak SS, Kwon SY, ...

  20. Chapter 7: Migration and winter ecology

    Deborah M. Finch; Jeffrey F. Kelly; Jean-Luc E. Cartron

    2000-01-01

    The willow flycatcher (Empidonax traillii) is a Neotropical migrant that breeds in North America, but winters in Central and northern South America. Little specific information is known about migration and wintering ecology of the southwestern willow flycatcher (E. t. extimus) (Yong and Finch 1997). Our report applies principally...

  1. Neural Resilience to Traumatic Brain Injury: Identification of Bioactive Metabolites of Docosahexaenoic Acids Involved in Neuroprotection and Recovery

    2015-05-01

    Involved in Neuroprotection and Recovery PRINCIPAL INVESTIGATOR: Hee-Yong Kim CONTRACTING ORGANIZATION: Henry M. Jackson Foundation for the...O’Dell DM, Lyeth BG, Jenkins LW (1994) The rotarod test: an evaluation of its effectiveness in assessing motor deficits following traumatic brain injury

  2. "Tallinna moodul" pakub linnale ühtset vormi / Margit Tõnson

    Tõnson, Margit, 1978-

    2004-01-01

    Rahvusvahelise ideekonkursi võitis "Fold", autorid Clayton Welham ja Martin Yong Londonist. II koht tööle "Drunken Style", autorid Samson Adjei, Harry Dobbs Ja Greg Epps Londonist. III koht itaalia disaineritele, ergutuspreemiad Argentiinasse ja New Yorki. Kommenteerinud linnadisainer Aavo Ermel

  3. Multi-Mode Analysis of Dual Ridged Waveguide Systems for Material Characterization

    2015-09-17

    analysis”. Instrumenta- tion and Measurement, IEEE Transactions on, 44(1):19–27, 1995. [26] Maode, Niu, Su Yong, Yan Jinkui, Fu Chenpeng, and Xu Deming ...waveguide method”. Instrumentation and Measurement, IEEE Transactions on, 46(2):519–522, 1997. [35] Wang, Shoujun, Maode Niu, and Deming Xu. “A frequency

  4. Nuclear Structure in China 2010

    Bai, Hong-Bo; Meng, Jie; Zhao, En-Guang; Zhou, Shan-Gui

    2011-08-01

    Personal view on nuclear physics research / Jie Meng -- High-spin level structures in [symbol]Zr / X. P. Cao ... [et al.] -- Constraining the symmetry energy from the neutron skin thickness of tin isotopes / Lie-Wen Chen ... [et al.] -- Wobbling rotation in atomic nuclei / Y. S. Chen and Zao-Chun Gao -- The mixing of scalar mesons and the possible nonstrange dibaryons / L. R. Dai ... [et al.] -- Net baryon productions and gluon saturation in the SPS, RHIC and LHC energy regions / Sheng-Qin Feng -- Production of heavy isotopes with collisions between two actinide nuclides / Z. Q. Feng ... [et al.] -- The projected configuration interaction method / Zao-Chun Gao and Yong-Shou Chen -- Applications of Nilsson mean-field plus extended pairing model to rare-earth nuclei / Xin Guan ... [et al.] -- Complex scaling method and the resonant states / Jian-You Guo ... [et al.] -- Probing the equation of state by deep sub-barrier fusion reactions / Hong-Jun Hao and Jun-Long Tian -- Doublet structure study in A[symbol]105 mass region / C. Y. He ... [et al.] -- Rotational bands in transfermium nuclei / X. T. He -- Shape coexistence and shape evolution [symbol]Yb / H. Hua ... [et al.] -- Multistep shell model method in the complex energy plane / R. J. Liotta -- The evolution of protoneutron stars with kaon condensate / Ang Li -- High spin structures in the [symbol]Lu nucleus / Li Cong-Bo ... [et al.] -- Nuclear stopping and equation of state / QingFeng Li and Ying Yuan -- Covariant description of the low-lying states in neutron-deficient Kr isotopes / Z. X. Li ... [et al.] -- Isospin corrections for superallowed [symbol] transitions / HaoZhao Liang ... [et al.] -- The positive-parity band structures in [symbol]Ag / C. Liu ... [et al.] -- New band structures in odd-odd [symbol]I and [symbol]I / Liu GongYe ... [et al.] -- The sd-pair shell model and interacting boson model / Yan-An Luo ... [et al.] -- Cross-section distributions of fragments in the calcium isotopes projectile

  5. Journal of Biosciences | Indian Academy of Sciences

    Home; Journals; Journal of Biosciences. Chen Fang. Articles written in Journal of Biosciences. Volume 30 Issue 3 June 2005 pp 351-357 Articles. Expression of a ribosome inactivating protein (curcin 2) in Jatropha curcas is induced by stress · Wei Qin Huang Ming-Xing Xu Ying Zhang Xin-Shen Chen Fang · More Details ...

  6. Journal of Genetics | Indian Academy of Sciences

    Home; Journals; Journal of Genetics; Volume 95; Issue 1. Distribution and linkage disequilibrium analysis of polymorphisms of GH1 gene in different populations of pigs associated with body size. Yunyun Cheng Songcai Liu Dan Su Chao Lu Xin Zhang Qingyan Wu Siming Li Haoyu Fu Hao Yu Linlin Hao. Research Article ...

  7. Journal of Chemical Sciences | Indian Academy of Sciences

    Home; Journals; Journal of Chemical Sciences; Volume 122; Issue 6. Synthesis and aggregation study of optically active tetra--[()-2-octanyloxy]-substituted copper and nickel phthalocyanines. Fang-Di Cong Gui Gao Jian-Xin Li Guo-Qing Huang Zhen Wei Feng-Yang Yu Xi-Guang Du Ke-Zhi Xing. Full Papers Volume ...

  8. African Journal of Biotechnology - Vol 12, No 41 (2013)

    Expression of an engineered tandem-repeat starch-binding domain in sweet potato plants · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Yunfeng Zhang, Qin Ji, Yujun Xing, Qiang Li, Xin Wang, Chun Xu, Cuixiang Huang. http://dx.doi.org/10.5897/AJB11.3321 ...

  9. Trapping water from desert fog

    Carvalho Esteves, de A.C.

    2013-01-01

    A coated cotton fabric can absorb more than 3 times its weight in water from warm, moist air, and release it again at higher temperatures. John Xin at the Hong Kong Polytechnic University in China, Catarina Esteves at Eindhoven University of Technology in the Netherlands and their colleagues grafted

  10. Photoluminescence quenching and enhanced optical conductivity of P3HT derived Ho3+-doped ZnO nanostructures

    Kabongo, GL

    2016-12-01

    Full Text Available , Swart HC (2016) Eu3 + doped down shifting TiO2 layer for efficient dye-sensitized solar cells. J Colloid Interface Sci 484:24–32 70. Tung-Ming P, Li-Chen Y, Xin-Chang W (2010) A comparative study on the structural properties and electrical...

  11. Fulltext PDF

    Some properties of unbounded operators with closed range. 613. Leng Gangsong see Lv Songjun. 413. Li Xiao-Min. Entire functions sharing one polynomial with their derivatives. 13. Lv Songjun. The Lp-curvature images of convex bodies and Lp-projection bodies. 413. Mao Li-Xin. On P-coherent endomorphism rings 557.

  12. Existence of global solutions to reaction-diffusion systems via a Lyapunov functional

    Said Kouachi

    2001-10-01

    Full Text Available The purpose of this paper is to construct polynomial functionals (according to solutions of the coupled reaction-diffusion equations which give $L^{p}$-bounds for solutions. When the reaction terms are sufficiently regular, using the well known regularizing effect, we deduce the existence of global solutions. These functionals are obtained independently of work done by Malham and Xin [11].

  13. Journal of Genetics | Indian Academy of Sciences

    Home; Journals; Journal of Genetics. XUYE DU. Articles written in Journal of Genetics. Volume 94 Issue 2 June 2015 pp 323-327 Research Note. Cloning and characterization of novel fast ω -gliadin genes in Triticum monococcum · Xuye Du Jinglan Zhao Xin Ma Huayan Yin Hongwei Wang Anfei Li Lingrang Kong.

  14. Protective effect of (-)-epigallocatechin gallate on ultraviolet b ...

    Chang Liu1, Xin-Qiang Zheng1, Li-Ping Xiang2, Jian-Liang Lu1, Curt ..... Fukunagam M, Tsuru K, Horikawa T. UV-induced skin ... Liang YR, Kang SY, Deng L, Xiang LP, Zheng XQ. ... Lee XZ, Liang YR, Chen H, Lu JL, Liang HL, Huang FP,.

  15. Identification and characterization of eighteen polymorphic ...

    Author Affiliations. Fei Xiong1 Hong-Yan Liu1 Xin-Bin Duan2 Da-Qing Chen2. College of Life Sciences, Jianghan University, Wuhan 430056, People's Republic of China; Yangtze River Fisheries Research Institute, Chinese Academy of Fishery Sciences, Wuhan 430223, People's Republic of China ...

  16. 76 FR 40804 - Technical Amendment to the Authorization Validated End-User Regulations of the Export...

    2011-07-12

    ... Di Sheng 3B001.c, 3B001.d, Street, BDA Beijing, 3B001.e, 3B001.f, China 100176. 3C001, 3C002, 3D002..., BDA Beijing, China 100176. Applied Materials (Xi'an) Ltd. No. 28 Xin Xi Ave., Xi'an High Tech Park...

  17. Karyotype variation and conservation in morphotypes of non-heading Chinese cabbage

    Zheng, Jin Shuang; Sun, Cheng Zhen; Xiao, Dong; Zhang, Shu Ning; Bonnema, Guusje; Hou, Xi Lin

    2015-01-01

    Non-heading Chinese cabbage encompasses a wide diversity of morphotypes, like the well-known Pak-choi, Wu ta cai, Cai xin, Tai cai, and Fen nei cai. Despite recent developments in re-sequencing which results in the detection of SNPs, insertions, deletions and copy number variants, there has been

  18. Automatic Generation of Issue Maps: Structured, Interactive Outputs for Complex Information Needs

    2012-09-01

    Le Song, Gaurav Veda , Yisong Yue, Brian Ziebart, and sum- mer intern Doris Xin. Special thanks to Yisong (for screaming at the taxi driver and for a...events/symposium2010. (document), 7.5, 7.8 K El-Arini, G Veda , D Shahaf, and C Guestrin. Turning down the noise in the blogosphere. In KDD ’09, 2009

  19. Practitioner-Initiated Workplace-Based Conjoint Collaboration within an Adult Education Institution toward Democratic Schooling: A Distributed Leadership Perspective

    Fang, Ya-Hui; Huang, Shen-Tzay

    2015-01-01

    This paper examines an account of a practitioner-initiated transformation of workplace-based social relationship within a grassroots adult education institution. This tripartite relationship among adult students, staff and teachers, abbreviated as AST, is a major driving force for activities and missionary functioning of the XinZhuang Community…

  20. My Future, My Family, My Freedom: Meanings of Schooling for Poor, Rural Chinese Youth

    Xiang, Xin

    2018-01-01

    In this article, Xin Xiang investigates what dushu, or "schooling," means for rural senior secondary school students in a high-poverty county in southwestern China. With the persistence of China's rural-urban education inequality and alarming reports about secondary school dropout rates, rural students' and their families' attitudes…

  1. Will strangeness win the prize?

    Kapusta, Joseph I. [School of Physics and Astronomy, University of Minnesota, Minneapolis, MN 55455 (United States). E-mail: kapusta at physics.spa.umn.edu

    2001-03-01

    Five groups have made predictions involving the production of strange hadrons and entered them in a competition set up by Barbara Jacak, Xin-Nian Wang and myself in the spring of 1998 for the purpose of comparing with first-year physics results from RHIC. These predictions are summarized and evaluated. (author)

  2. TiO2 aerogel–metal organic framework nanocomposite: a new class ...

    2018-02-05

    Feb 5, 2018 ... titanium dioxide in association with a monolayer of dye molecules is .... Zn–MOF has not affected the anatase phase formation of. TiO2 crystals ..... [15] Xin X, Scheiner M, Ye M and Lin Z 2011 Langmuir 27 14594. [16] Kim B ...

  3. bromopropane on maturation of mouse oocytes, fertilization and ...

    DR. NJ TONUKARI

    2012-05-31

    May 31, 2012 ... to prevent the hazardous effects of 2-BP on embryos derived from pretreated oocytes. Key words: 2-Bromopropane, ... E-mail: whchan@cycu.edu.tw. Tel: ..... Huang F, Ning H, Xin QQ, Huang Y, Wang H, Zhang ZH, Xu DX,. Ichihara G .... Surh YJ, Hurh YJ, Kang JY, Lee E, Kong G, Lee SJ (1999). Resveratrol,.

  4. Anti-tumor activity of polysaccharides extracted from Senecio ...

    *, Bao Zhang, Mingming Han, Xin Jin, Liyuan Sun and Tao Li. Department of ..... Yang J, Li X, Xue Y, Wang N, Liu W. Anti-hepatoma activity and mechanism of corn ... Peng W, Wu JG, Jiang YB, Liu YJ, Sun T, Wu N, Wu CJ. Antitumor activity of ...

  5. Synergic Investigation Of The Self-Assembly Structure And Mechanism Of Retroviral Capsid Proteins By Solid State NMR, Transmission Electron Microscopy And Multiscale simulation

    2017-03-29

    18], a question naturally arises: if our ssNMR constraints actually impart any meaningful differences to the final model. To answer this question...Mitra at University of Auckland. Xin Qiao, Dr. Chen’s student, presented the ssNMR assignment strategy as a poster presentation titled “Methods

  6. Effect of substitution of titanium by magnesium and niobium on ...

    Administrator

    Effect of substitution of titanium by magnesium and niobium on structure and piezoelectric properties in (Bi1/2. Na1/2. )TiO3 ceramics. ZHOU CHANG-RONG*, LIU XIN-YU, LI WEI-ZHOU. † and YUAN CHANG-LAI. Department of Information Material Science and Engineering, Guilin University of Electronic Technology,. Guilin ...

  7. Journal of Genetics | Indian Academy of Sciences

    Annual Meetings · Mid Year Meetings · Discussion Meetings · Public Lectures · Lecture Workshops · Refresher Courses · Symposia · Live Streaming. Home; Journals; Journal of Genetics; Volume 94; Issue 2. Cloning and characterization of novel fast ω -gliadin genes in Triticum monococcum. Xuye Du Jinglan Zhao Xin Ma ...

  8. The new European legal culture: ten years on

    Hesselink, M.W.

    2009-01-01

    New postscript to: Hesselink, M.W. & Wei, L. (2010). --- Xin de ouzhou falü wenhua. --- Beijing: Zhongguo falü chubanshe. This is the Chinese translation of: Hesselink, M.W. (2001). --- The new European legal culture. --- Deventer : Kluwer. That essay argued that Europe was facing a shift from a

  9. Metonymic-Based Metaphor--A Case Study on the Cognitive Interpretation of "Heart" in English and Chinese

    Qian, Li

    2016-01-01

    English is particularly rich in both metonymic and metaphorical expressions making use of the concept "heart" to speak of emotional issues (Niemeier, 2000). It is not difficult to find a large number of Chinese linguistic expressions in terms of "[Chinese characters omitted]" ("xin") ("heart")" to refer…

  10. Naised, kes teevad suurt raha / Katrin Kapara

    Kapara, Katrin

    2008-01-01

    Maailma rikkaimate inimeste edetabelit koostava ajakirja Forbes nimestikus oli tänavu 99 naist. Liliane Bettencourt - kosmeetikaimpeeriumi LþOreal pärija, Zhang Xin - firma SOHO China omanik, Cristina Green - jaekaubanduskettide omanik, Jelena Baturina - Vene ärinaine, Meg Whitman - eBay käivitaja, Oprah Winfrey - Ameerika telesaatejuht

  11. Chloroquinone Inhibits Cell Proliferation and Induces Apoptosis in ...

    Apoptosis in Nasopharyngeal Carcinoma Cell Lines. Xin-Qing ... However, this requires clinical investigation to ascertain its ... results to restrict the growth of tumors locally in addition ..... MEK1/ERK1/2/iNOS/sGC/PKG pathway associated with.

  12. Simulations of the DARPA Suboff Submarine Including Self-Propulsion with the E1619 Propeller

    2012-01-01

    Young and Kinnas (2003) to evaluate supercavitating and surface-piercing propellers. The simulation’s predicted results compare well with experimental...Young Y, Kinnas S. 2003. Analysis of supercavitating and surface-piercing propeller flows via BEM. Comput. Mech. 32, 269-280. Yu-cun P, Huai-xin Z

  13. The Relationship of Goldberg's Big Five Personality Trait Measures of Mid-Level Leaders at Midwest State-Supported Colleges and Universities to the Cameron and Quinn Competing Values Model

    Kempke Eppler, Michelle R.

    2012-01-01

    This dissertation expands previous work of Giberson, Resick, Dickson, Mitchelson, Randall, and Clark (2009), Zhang, Tsui, Song, & Jia (2008), and Tsui, Zhang, Wang, Xin, and Wu (2006) by examining higher education organizational culture and leadership. There is a paucity of research in examining the relationships between university mid-level…

  14. Identification of seed-related QTL in Brassica rapa

    Bagheri, H.; Pino del Carpio, D.; Hanhart, C.J.; Bonnema, A.B.; Keurentjes, J.J.B.; Aarts, M.G.M.

    2013-01-01

    To reveal the genetic variation, and loci involved, for a range of seed-related traits, a new F2 mapping population was developed by crossing Brassica rapa ssp. parachinensis L58 (CaiXin) with B. rapa ssp. trilocularis R-o-18 (spring oil seed), both rapid flowering and self-compatible. A linkage map

  15. Journal of Genetics | Indian Academy of Sciences

    Home; Journals; Journal of Genetics; Volume 90; Online resources. Genotyping of the k-casein and -lactoglobulin genes in Chinese Holstein, Jersey and water buffalo by PCR-RFLP. Da-Xi Ren Shu-Ying Miao You-Liang Chen Cai-Xia Zou Xian-Wei Liang Jian-Xin Liu. Volume 90 Online resources 2011 pp e1-e5 ...

  16. African Journal of Biotechnology - Vol 8, No 17 (2009)

    Exogenous cycilc AMP and cycilc GMP influence the metabolism of traces of tritium-labeled glycerol in rabbits · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Y Liu, L Zan, F Wei, L Dengke, Y Xin, W Tian ...

  17. Mining microsatellite markers from public expressed sequence tag

    Home; Journals; Journal of Genetics; Volume 91; Issue 3. Mining microsatellite markers from public expressed sequence tag sequences for genetic diversity analysis in pomegranate. Zai-Hai Jian Xin-She Liu Jian-Bin Hu Yan-Hui Chen Jian-Can Feng. Research Note Volume 91 Issue 3 December 2012 pp 353-358 ...

  18. Risky health seeking practice among pregnant women in rural Congo

    Hørby, Laila

    2007-01-01

    the clinics at M’shi., and to analyze the practice and logic of the untrained helpers, in the villages and the professional staff at M’shi. To do that I have done a fieldwork study in the area around M’shi., using qualitative methods such as Interviews, Focus Group Discussions and observations. I have used...... they are part of the tradition and the culture. The women make a perfectly normal choice when they choose the TBAs for care as they are part of the folk sector. The TBA’s are there, culturally sensitive, trusted and respected. They have certain knowledge and skills. The professional, medical system may as well...

  19. Synthesis, Transfer, and Characterization of Nanoscale 2-Dimensional Materials

    2015-09-01

    Shi Y, Hamsen C, Jia X, Kim KK, Reina A, Hofmann M, Kong J. Synthesis of few-layer hexagonal boron nitride thin film by chemical vapor deposition...hexagonal boron nitride layers. Nano Letters. 2010;10(8):3209–3215. 12. Kim KK, Hsu A, Jia X, Kim SM, Shi Y, Hofmann M, Kong J. Synthesis of...microscopy. Physical Review B. 2009;80(15):155425. 33. Kim KK, Hsu A, Jia X, Kim SM, Shi Y, Hofmann M, Kong J. Synthesis of monolayer hexagonal boron

  20. The effect of shyness on children's formation and retention of novel word-object mappings.

    Hilton, Matt; Westermann, Gert

    2017-11-01

    This study set out to examine whether shyness, an aversion to novelty and unfamiliar social situations, can affect the processes that underlie early word learning. Twenty-four-month-old children (n =32) were presented with sets of one novel and two familiar objects, and it was found that shyer children were less likely to select a novel object as the referent of a novel label. Furthermore, not-shy children then showed evidence of retaining these novel mappings, but shy children did not. These findings suggest that shy children's aversion to novelty and to the unfamiliar context can impact on their word learning.

  1. Comparative Transcriptomics Reveals Jasmonic Acid-Associated Metabolism Related to Cotton Fiber Initiation.

    Liman Wang

    Full Text Available Analysis of mutants and gene expression patterns provides a powerful approach for investigating genes involved in key stages of plant fiber development. In this study, lintless-fuzzless XinWX and linted-fuzzless XinFLM with a single genetic locus difference for lint were used to identify differentially expressed genes. Scanning electron microscopy showed fiber initiation in XinFLM at 0 days post anthesis (DPA. Fiber transcriptional profiling of the lines at three initiation developmental stages (-1, 0, 1 DPA was performed using an oligonucleotide microarray. Loop comparisons of the differentially expressed genes within and between the lines was carried out, and functional classification and enrichment analysis showed that gene expression patterns during fiber initiation were heavily associated with hormone metabolism, transcription factor regulation, lipid transport, and asparagine biosynthetic processes, as previously reported. Further, four members of the allene-oxide cyclase (AOC family that function in jasmonate biosynthesis were parallel up-regulation in fiber initiation, especially at -1 DPA, compared to other tissues and organs in linted-fuzzed TM-1. Real time-quantitative PCR (RT-qPCR analysis in different fiber mutant lines revealed that AOCs were up-regulated higher at -1 DPA in lintless-fuzzless than that in linted-fuzzless and linted-fuzzed materials, and transcription of the AOCs was increased under jasmonic acid (JA treatment. Expression analysis of JA biosynthesis-associated genes between XinWX and XinFLM showed that they were up-regulated during fiber initiation in the fuzzless-lintless mutant. Taken together, jasmonic acid-associated metabolism was related to cotton fiber initiation. Parallel up-regulation of AOCs expression may be important for normal fiber initiation development, while overproduction of AOCs might disrupt normal fiber development.

  2. Fiscal 2000 project of inviting proposals for international joint research - invitation for international proposal (Energy conservation No.2). Achievement report on international joint study on popularization promotion of geothermal heat pump-assisted environmentally compatible heating system for Changchun City, China; 2000 nendo kokusai kyodo kenkyu teian kobo jigyo - kokusai teian kobo (Shoe No.2). Chinetsu heat pump ni yoru Chugoku Changchun shi kankyo tekigogata danbo system no fukyu sokushin ni kansuru kokusai kyodo kenkyu seika hokokusho

    NONE

    2001-03-01

    A geothermal heat pump-assisted heating system is introduced into Changchun City and a survey is conducted to determine if the system may be popularized in this extremely cold region located in the northeastern part of China. In concrete terms, the hot water that circulates through the office building of Changchun Ground Heat Development Co., Ltd., is switched to hot water prepared by a geothermal heat pump. The test continued from December 2000 to March 2001. It is then concluded that heating by geothermal heat pumps will be fully serviceable to Changchun City. Implemented are (1) the shift from the coal fired boiler system to a geothermal heat pump system comprising 16 subterranean heat exchangers for the heating of the office building which is approximately 1000 m{sup 2} large, (2) long-term monitoring of the operating conditions, (3) measurement of subterranean heat exchanger thermal conductivity and subterranean temperature, and (4) the study of pipe shapes for improved thermal efficiency, grouting materials, and the like. (NEDO)

  3. Proton radioactivity with analytically solvable potential

    The multidimensional evolution of the system is reduced to one- dimensional case by ... Shi and Swiatecki [13] have shown that inclusion of the nuclear ... the Coulomb barrier such that it has a parabolic shape near its top. Guzmann et al.

  4. Klinefelter Syndrome

    ... Enlarged breast tissue (gynecomastia) Weak bones Low energy levels Tendency to be shy and sensitive Difficulty expressing thoughts and feelings or socializing Problems with reading, writing, spelling or math Men Low sperm count or no sperm Small ...

  5. PATTERNS OF SEVEN AND COMPLICATED MALARIA IN CHILDREN

    GB

    To address this, Ethiopia is currently introducing Social Health Insurance. However ... adequate awareness creation and discussion should be made with all employees at various levels for the .... description included the SHI benefits as well as.

  6. English Pronunciation Errors: A Case Study of Amhara and Oromia ...

    unique firstlady

    speak better than introverts who are always shy to interact with others. Historical Factor: ... over of education by the natives after the fall of the Imperial regime. After the ..... delusion of native or local technology as some people are campaigning.

  7. Elucidating the association between the self-harm inventory and several borderline personality measures in an inpatient psychiatric sample.

    Sellbom, Martin; Sansone, Randy A; Songer, Douglas A

    2017-09-01

    The current study evaluated the utility of the self-harm inventory (SHI) as a proxy for and screening measure of borderline personality disorder (BPD) using several diagnostic and statistical manual of mental disorders (DSM)-based BPD measures as criteria. We used a sample of 145 psychiatric inpatients, who completed the SHI and a series of well-validated, DSM-based self-report measures of BPD. Using a series of latent trait and latent class analyses, we found that the SHI was substantially associated with a latent construct representing BPD, as well as differentiated latent classes of 'high' vs. 'low' BPD, with good accuracy. The SHI can serve as proxy for and a good screening measure for BPD, but future research needs to replicate these findings using structured interview-based measurement of BPD.

  8. Dynamics of social health insurance development: examining the determinants of Chinese basic health insurance coverage with panel data.

    Liu, Jun-Qiang

    2011-08-01

    Social health insurance (SHI) is gaining popularity in many developing countries, but there are few systematic empirical studies on the dynamics of SHI development. This study investigates the determinants of coverage of the Basic Healthcare Insurance for Urban Employees (BHI) in China. Using a panel database ranging from 1999 to 2007, the study finds that: (1) economic development plays a valuable role in BHI development; (2) strong financial capacity and administrative capacity in the government contributes to BHI progress; (3) higher trade union density is closely related to more rapid BHI expansion; and (4) taxation agencies are better at collecting SHI premiums. These findings provide evidence-based lessons for new and ongoing SHI programs. In addition, this article aims to make a more general contribution to the study of social policy development by expanding the scope of current theories on social policy development. Copyright © 2011 Elsevier Ltd. All rights reserved.

  9. Irritable Bowel Syndrome and Complementary Health Practices

    ... IBS) in adults: conventional and complementary/alternative approaches. Alternative Medicine Review. 2011;16(2):134–151. Herbal Supplements Shi J, Tong Y, Shen JG, et al. Effectiveness and safety of herbal medicines in the treatment ...

  10. Proceedings – Mathematical Sciences | Indian Academy of Sciences

    Author Affiliations. Jiangtao Shi1 Cui Zhang1 2. School of Mathematics and Information Science, Yantai University, Yantai 264005, China; University of Primorska, IAM, Muzejski trg 2, 6000 Koper, Slovenia ...

  11. Lebanon's Hizbollah Movement: The Party of God

    Schad, Andrew

    1999-01-01

    In the summer of 1982 in Lebanon, a group of radical Shi'a Muslim clerics in association with Iranian Revolutionary Guardsmen formed the secretive and at times deadly movement known as Hizbollah, or the Party of God...

  12. Secondary School Students Preferences for Instructional Strategies ...

    User

    Yet, value pertaining to discipline in sexual attitude among adolescent is gradually being eroded. ... education into the secondary school curriculum. .... hidden. This result also goes to confirm the researcher's opinion that parents tend to shy ...

  13. Motivating Kids to Be Active

    ... sports like baseball and basketball to martial arts, biking, hiking, and playing outside. As kids learn basic ... shoes might help a shy teen feel comfortable biking or going to the gym. Kids' Fitness Personalities ...

  14. Victorian Dragons: The Reluctant Brood.

    Berman, Ruth

    1984-01-01

    Relates why nineteenth century fantasy writers shied away from the use of dragons in their stories and rejoices over the return and happy transformation of this mythical beast in children's literature. (HOD)

  15. Estimation of Tumor Angiogenesis With Contrast Enhanced Subharmonic Ultrasound Imaging

    Forsberg, Flemming

    2005-01-01

    ...) and receiving at the subharmonic (f0). Hence, the current project proposes to increase the ability of breast ultrasound to differentiate between benign and malignant lesions by combining injection of an ultrasound contrast agent with SHI...

  16. Estimation of Tumor Angiogenesis With Contrast Enhanced Subharmonic Ultrasound Imaging

    Forsberg, Flemming

    2001-01-01

    ...) and receiving at the subharmonic (f0) . Because of no subharmonic generation in tissue and significant subharmonic scattering from some new contrast agents SHI has the potential to detect slow, small volume blood flow associated with tumor...

  17. Estimation of Tumor Angiogenesis With Contrast Enhanced Subharmonic Ultrasound Imaging

    Forsberg, Flemming

    2002-01-01

    .... Hence, the current project proposes to increase the ability of breast ultrasound to differentiate between benign and malignant lesions by combining injection of an ultrasound contrast agent with SHI...

  18. Estimation of Tumor Angiogenesis with Contrast Enhanced Subharmonic Ultrasound Imaging

    Forsberg, Flemming

    2004-01-01

    .... Hence, the current project proposes to increase the ability of breast ultrasound to differentiate between benign and malignant lesions by combining injection of an ultrasound contrast agent with SHI...

  19. Estimation of Tumor Angiogenesis With Constrast Enhanced Subharmonic Ultrasound Imaging

    Forsberg, Fleming

    2003-01-01

    .... Hence, the current project proposes to increase the ability of breast ultrasound to differentiate between denign and malignant lesions by combining injection of an ultrasound contrast agent with SHI...

  20. Pramana – Journal of Physics | Indian Academy of Sciences

    Author Affiliations. Yang Xian-Lin1 2 Tang Jia-Shi1. College of Mechanics and Aerospace, Hunan University, Changsha, Hunan 410082, China; Hunan Radio and Television University, Changsha, Hunan 410004, China ...