WorldWideScience

Sample records for shi pin gong

  1. Solar Imagery - GONG (Magnetogram)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Global Oscillation Network Group (GONG) is a network of 6 globally-spaced solar observatories that the NOAA Space Weather Prediction Center uses to monitor the...

  2. Solar Imagery - GONG

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Global Oscillation Network Group (GONG) is a network of 6 globally-spaced solar observatories that the NOAA Space Weather Prediction Center uses to monitor the...

  3. The GONG Farside Project

    Science.gov (United States)

    Leibacher, J. W.; Braun, D.; González Hernández, I.; Goodrich, J.; Kholikov, S.; Lindsey, C.; Malanushenko, A.; Scherrer, P.

    2005-05-01

    The GONG program is currently providing near-real-time helioseismic images of the farside of the Sun. The continuous stream of low resolution images, obtained from the 6 earth based GONG stations, are merged into a single data series that are the input to the farside pipeline. In order to validate the farside images, it is crucial to compare the results obtained from different instruments. We show comparisons between the farside images provided by the MDI instrument and the GONG ones. New aditions to the pipeline will allow us to create full-hemisphere farside images, examples of the latest are shown in this poster. Our efforts are now concentrated in calibrating the farside signal so it became a reliable solar activity forecasting tool. We are also testing single-skip acoustic power holography at 5-7 mHz as a prospective means of reinforcing the signatures of active regions crossing the the east and west limb and monitoring acoustic emission in the neighborhoods of Sun's the poles. This work utilizes data obtained by the Global Oscillation Network Group (GONG) Program, managed by the National Solar Observatory, which is operated by AURA, Inc. under a cooperative agreement with the National Science Foundation. The data were acquired by instruments operated by the Big Bear Solar Observatory, High Altitude Observatory, Learmonth Solar Observatory, Udaipur Solar Observatory, Instituto de Astrofisico de Canarias, and Cerro Tololo Interamerican Observatory, as well as the Michaelson Doppler Imager on SoHO, a mission of international cooperation between ESA and NASA. This work has been supported by the NASA Living with a Star - Targeted Research and Technology program.

  4. Gong and Its Therapeutic Meaning

    Directory of Open Access Journals (Sweden)

    Albinca Pesek

    2016-12-01

    Full Text Available The study, which was conducted utilising a sample of 129 users of sound baths with gongs in 2015 in Slovenia, has shown that all users define the effect of sound vibrations as healing and/or relaxing. They testified on achieving durable inner peace, on better physical and mental wellbeing, fresh impetus for work, desire for personal growth and other positive effects.

  5. Solar Imagery - GONG (H-alpha)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Global Oscillation Network Group (GONG) is a network of 6 globally-spaced solar observatories that the NOAA Space Weather Prediction Center uses to monitor the...

  6. A ginástica terapêutica e preventiva chinesa Lian Gong/Qi Gong como um dos instrumentos na prevenção e reabilitação da LER/DORT

    Directory of Open Access Journals (Sweden)

    Gutembergue Livramento

    Full Text Available Este ensaio traz elementos da medicina ocidental, da medicina tradicional chinesa e da sociologia do trabalho para reflexão sobre o Qi Gong - exercícios terapêuticos, um dos pilares da Medicina Tradicional Chinesa (MTC - como importante meio de prevenção da LER/DORT e recuperação da saúde. Considerando a natureza interdisciplinar e diversos níveis de prevenção, aborda aspectos sociológicos sobre as condições de trabalho frequentemente relacionadas com este tipo de adoecimento e categorias de trabalhadores mais acometidos. Focaliza aspectos médicos sobre a LER/DORT e as Síndromes de Bloqueio na MTC, estabelecendo canais de articulação e contribuição entre esses campos de conhecimento sobre a saúde humana. Ressalta o Qi Gong como importante prática terapêutica e preventiva na MTC e sua adequação à LER/DORT. No âmbito do Qi Gong, focaliza o Lian Gong Shi Ba Fa - Lian Gong em 18 Terapias, já amplamente experimentado na China e divulgado, inclusive no Brasil, para tratar e prevenir síndromes de dor em região cervical, ombros, membros superiores, membros inferiores e região lombar. À guisa de conclusão, são apresentadas algumas reflexões sobre a propriedade e a importância do Qi Gong na reabilitação e na prevenção da LER/DORT.

  7. Transkripsi Musik Gong Timor Menggunakan Continous Wavelet Transform (CWT

    Directory of Open Access Journals (Sweden)

    Yovinia C H Siki

    2016-12-01

    Full Text Available Abstrak: Transkripsi musik gong timor dibutuhkan untuk pengembangan aplikasi pengolahan sinyal musik seperti mengeditmusik, melacak tempo musik dan analisis sinyal musik lainnya yang dapat membantu para pemain pemula untukbelajar bagaimana memainkan alat musik gong. Rumitnya analisa suara musik gong dibandingkan analisa peralatanmusik barat karena dipengaruhi oleh cara pembuatan peralatan yang kurang sempurna, dan cara pemukulan peralatanyang berdasar kira-kira. Dengan menggunakan metode CWT, sinyal music gong dikonvolusi untuk menghasilkanscalogram music gong domain skala dan frekuensi. Estimasi nada gong diperoleh menggunakan sebuah proses notegenerating. Keberhasilan transkripsi ditentukan dengan menghitung error yaitu ketepatan menterjemah. Dimana adanada yang seharusnya tidak ada tetapi dikenali sebagai note (insertion, ada nada yang tidak dikenali sehinggaterhapus (deletion dan ada nada yang dikenali salah (substitution.Kata kunci: Gong timor, transkripsi musik, CWT, scalogram, note generating Abstract: Gong timor music transcription used to develop some other aplication in music signal processing such as music editing,beat detection, etc. With this transcription, new percussionist of gong can learn more easily to playing gong instrument.Analyzing music gong are more difficult than any other music instrument, it is because gong instrument created withvery simple tools and the percussionist playing this instrument by feelings of any other instrument in gamelan. Musicgong signal convoluted using CWT to create scalogram of music gong in scale and frequency domain. Tone estimationobtained using a note generating process. The success of transcription process determined by calculating errors intranscription results. Which are sometimes there is a tone that shouldn’t exist but marked as a tone (insertion, or thereis a tone but the transcription process doesn’t recognize it (deletion and sometimes there is a tone but marked as adifferent tone

  8. Thermography applied acupuncture and qi-gong

    Science.gov (United States)

    Qin, Yuwen; Ji, Hong-Wei; Chen, Jin-Long; Li, Hong-Qi

    1997-04-01

    Thermographic technique can be used to measure temperature distribution of body surface in real-time, non-contact and full-field, which has been successfully used in medical diagnosis, remote sensing, and NDT, etc. The authors have developed a thermographic experiment that can be applied to inspect the effect of action of acupuncture and qi-gong (a system of deep breathing exercises) by measuring the temperature of hand and arm. The observation is performed respectively by thermography for the dynamic changes of temperature of the arm and hand after acupuncture therapy and qi-gong therapy. Thermographic results show that the temperature on the collateral channels increases markedly. In the meantime, it can be seen that the above therapies of Chinese medicine can stimulate the channel collateral system. This also contributes a new basis to the effect of action of the therapies of Chinese medicine. The work shows that thermographic technique is a powerful tool for research in Chinese medicine. In this paper, some thermal images are obtained from the persons treated with acupuncture and qi- gong.

  9. Tai Chi and Qi Gong for Health and Well-Being

    Medline Plus

    Full Text Available ... Tai Chi and Qi Gong for Health and Well-Being Share: © Mariann Seriff The following video is intended ... Tai Chi and Qi Gong for Health and Well-Being Video › Tai Chi and Qi Gong for Health ...

  10. Tai Chi and Qi Gong for Health and Well-Being

    Science.gov (United States)

    ... Tai Chi and Qi Gong for Health and Well-Being Share: © Mariann Seriff The following video is intended ... Tai Chi and Qi Gong for Health and Well-Being Video › Tai Chi and Qi Gong for Health ...

  11. Tai Chi and Qi Gong for Health and Well-Being

    Medline Plus

    Full Text Available ... Chi and Qi Gong for Health and Well-Being Share: © Mariann Seriff The following video is intended ... Chi and Qi Gong for Health and Well-Being Video › Tai Chi and Qi Gong for Health ...

  12. Women stereotypes in Shi Zhecun's short stories.

    Science.gov (United States)

    Rosenmeier, Christopher

    2010-01-01

    This article analyses the representation of women in two 1933 short story collections by Shi Zhecun: An Evening of Spring Rain and Exemplary Conduct of Virtuous Women. It discusses how the New Woman image was a site of contestation in Republican China, and argues that Shi Zhecun’s short stories contain four basic stereotypes: the enigmatic woman, the estranged wife, the prostitute, and the inhibited woman. Using these narratives of women and how they were perceived by men, Shi Zhecun deconstructed the New Woman image by subverting the various ways modernity was projected onto women.

  13. Pin care

    Science.gov (United States)

    ... Drugs & Supplements Videos & Tools Español You Are Here: Home → Medical Encyclopedia → Pin care URL of this page: //medlineplus.gov/ency/patientinstructions/000481.htm Pin care To use the sharing features on this page, please enable JavaScript. Broken bones can be fixed in surgery with metal ...

  14. Dr. Shi Hanzhang's Experience in Treating Andropathy

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    @@ Dr. Shi Hanzhang (施汉章) of Dongzhimen Hospital affiliated to Beijing University of Traditional Chinese Medicine is experienced in both teaching and clinical practice, especially in treating andropathy, such as sexual disorder, infertility, and hyperplasia of the prostate. The author has the honour to follow him for study and really learned a lot from him. A brief introduction to Dr. Shi's way of thinking in treatment is as follows.

  15. AHP 37: A GROUP OF MURAL PAINTINGS FROM THE 1930S IN A MDO REB GONG

    Directory of Open Access Journals (Sweden)

    Rob Linrothe

    2015-05-01

    Full Text Available Over the course of several summer and winter visits to A mdo Reb gong in the late 1990s and early 2000s, I had the privilege of meeting 'Teacher Kevin' and several of his students (of Tibetan and various ethnicities and teaching colleagues in Xining. I sat in on more than one of the evenings at his apartment with his amazingly proficient language students. Often these rather jolly gatherings ended with a performance fest: going round the room, each person was obliged to sing a song. Without either musicality or a good memory for lyrics, and in the face of some truly extraordinary musical talents among the Tibetan-speaking young men, I usually begged off. I vividly recall one evening, however, when I was somehow convinced or inspired to uncharacteristically sing a bawdy song taught to me in the winter of 1971 by my friends Chief and Skeezix, two Chippewa Native Americans who were resident, as I was that year, on Madelaine Island in the Wisconsin side of Lake Superior. The ditty started, "There once was an Indian maid, a shy little prairie maid..." and went downhill from there. In Xining that night, we all recovered, and I even had the good fortune soon after to be able to steer Skidmore College into admitting, in consecutive years, two of Teacher Kevin's students, Spencer (Don grub dbang chen and Joe (Sgrol ma don grub, who both graduated with BA degrees. The point of this anecdote is to suggest that Kevin's methods may have been unorthodox, but, to put it mildly, they did work, not only with Tibetan students and the English language, but also to the mutual benefit with the world of Tibet-related scholars, so many of whom came to know and appreciate Kevin, his colleagues, and his students. ...

  16. Full-disk Solar H-alpha Images From GONG

    Science.gov (United States)

    Harvey, J. W.; Bolding, J.; Clark, R.; Hauth, D.; Hill, F.; Kroll, R.; Luis, G.; Mills, N.; Purdy, T.; Henney, C.; Holland, D.; Winter, J.

    2011-05-01

    Since mid-2010 the Global Oscillation Network Group (GONG) has collected H-alpha images at six sites around the world. These images provide a near real-time solar activity patrol for use in space weather applications and also an archive for research purposes. Images are collected once per minute, dark, smear, and flat corrected, compressed and then sent via the Internet to a 'cloud' server where reduction is completed. Various reduced images are usually available within a minute after exposure. The H-alpha system is an add-on to the normal GONG helioseismology instrument and does not interfere with regular observations. A polarizing beamsplitter sends otherwise unused 656 nm light through two lenses to a Daystar 0.04 nm mica etalon filter. The filter is matched to an image of the GONG light feed entrance pupil and sees an image of the Sun at infinity. Two lenses behind the filter form the solar image on a DVC-4000 2k x 2k interline transfer CCD camera. Exposure times are automatically adjusted to maintain the quiet disk center at 20% of full dynamic range to avoid saturation by bright flares. Image resolution is limited by diffraction, seeing and some high-order wavefront errors in the filters. A unique dual-heater system was developed by Daystar to homogenize the passband characteristics of the mica etalons. The data are in regular use for space weather forecasting by the U.S. Air Force Weather Agency, which funded construction and installation of the instruments. Operational and reduction improvements are underway and archived data are already being used for research projects. The Web site URL is http://halpha.nso.edu.

  17. Happy Pinning

    DEFF Research Database (Denmark)

    Fausing, Bent

    2012-01-01

    This is about Pinterest, but with a different approach than usual to social networks. Pinterest is an image site par excellence. The images are as Windows that open outwards and also lets us look inwards and displays the soul and heart, the unintentional or pre-conscious desires. Happy Pinning!...

  18. Tai Chi and Qi Gong for Health and Well-Being

    Medline Plus

    Full Text Available ... Legislation Advisory Council Job Opportunities All About NCCIH Health Topics A-Z # A B C D E ... Y Z Tai Chi and Qi Gong for Health and Well-Being Share: © Mariann Seriff The following ...

  19. Tai Chi and Qi Gong for Health and Well-Being

    Medline Plus

    Full Text Available ... tool that features tai chi and qi gong as an activity to enhance wellness. These exercise therapies ... care approaches used to promote a healthy lifestyle. As always, talk to your health care provider if ...

  20. Civil Engineering for the SHiP facility

    CERN Document Server

    Osborne, John Andrew

    2015-01-01

    The enlarged scope of the recently proposed experiment to search for Heavy Neutral Leptons, SPSC-EOI-010, is a general purpose fixed target facility which in the initial phase is aimed at a general Search for Hidden Particles (SHiP) as well as tau neutrino physics. This report represents an annex to the SHiP Technical Proposal summarizing the civil engineering considerations for SHiP.

  1. Radiation protection studies for the SHiP facility

    CERN Document Server

    Strabel, Claudia Christina; Vincke, Helmut

    2015-01-01

    The enlarged scope of the recently proposed experiment to search for Heavy Neutral Leptons, SPSC-EOI-010, is a general purpose fixed target facility which in the initial phase is aimed at a general Search for Hidden Particles (SHiP) as well as tau neutrino physics. This report summarizes radiation protection considerations for the SHiP facility and the primary beam extraction for SHiP.

  2. Dicty_cDB: SHI251 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHI251 (Link to dictyBase) - - - Contig-U11819-1 - (Link to Or...iginal site) SHI251F 125 - - - - - - Show SHI251 Library SH (Link to library) Clone ID SHI251 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11819-1 Original site URL http://dictycdb.b...XX sequence update 2002.10.25 Translated Amino Acid sequence ilfqilkistnk**IKNYYVNRVYEIIIIINICT...YKKK--- Translated Amino Acid sequence (All Frames) Frame A: ilfqilkistnk**IKNYYVNRVYEIIIIINICT

  3. Dicty_cDB: SHI867 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHI867 (Link to dictyBase) - - - Contig-U11503-1 - (Link to Or...iginal site) SHI867F 646 - - - - - - Show SHI867 Library SH (Link to library) Clone ID SHI867 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Original site URL http://dictycdb.b...fsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICTSLKDAVSRAFLLISNNSRVCIGIIGNINVTSEQITLGNYCGA...l*lsif--- Frame C: qkkqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICT

  4. Dicty_cDB: SHI777 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHI777 (Link to dictyBase) - - - Contig-U12085-1 - (Link to Or...iginal site) SHI777F 332 - - - - - - Show SHI777 Library SH (Link to library) Clone ID SHI777 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12085-1 Original site URL http://dictycdb.b...IKEIIQHAKEYGIRVELEIDMPGHAYSWGIGYPS VLPANFSHSIQCQPSICTNK***ikknk*kk*kniylkikkkx*kk...IKEIIQHAKEYGIRVELEIDMPGHAYSWGIGYPS VLPANFSHSIQCQPSICTNK***ikknk*kk*kniylkikkkx*kk

  5. Dark matter at the SHiP experiment

    International Nuclear Information System (INIS)

    Timiryasov, Inar

    2016-01-01

    We study prospects of dark matter searches in the SHiP experiment. SHiP (Search for Hidden Particles) is the recently proposed fixed target experiment which will exploit the high-intensity beam of 400 GeV protons from the CERN SPS. In addition to the hidden sector detector, SHiP will be equipped with the ν_τ detector, which presumably would be sensitive to dark matter particles. We describe appropriate production and detection channels and estimate SHiP’s sensitivity for a scalar dark matter coupled to the Standard model through the vector mediator

  6. Qi Gong exercises and Feldenkrais method from the perspective of Gestalt concept and humanistic psychology.

    Science.gov (United States)

    Posadzki, Paul; Stöckl, Andrea; Mucha, Dariusz

    2010-07-01

    This study describes two similar approaches to human movement: Qi Gong exercises and the Feldenkrais method. These systems are investigated in terms of Gestalt concepts and humanistic psychology. Moshe Feldenkrais created the concept known as Awareness Through Movement. This concept assumes that by becoming more aware of one's movements, one functions at a higher level. In similar ways to those using the Feldenkrais method, individuals may become more aware of their own movements by performing Qi Gong exercises: A therapeutic modality that facilitates mind-body integration. Qi Gong exercises commonly lead to increased personal awareness accompained by enhanced quality, fluency and smoothness of movement. These two methods of movement therapies are explored in terms of their relations with Gestalt concept and humanistic psychology. (c) 2008. Published by Elsevier Ltd. All rights reserved.

  7. Internal fuel pin oxidizer

    International Nuclear Information System (INIS)

    Andrews, M.G.

    1978-01-01

    A nuclear fuel pin has positioned within it material which will decompose to release an oxidizing agent which will react with the cladding of the pin and form a protective oxide film on the internal surface of the cladding

  8. The SHiP physics program

    Science.gov (United States)

    De Lellis, Giovanni

    2018-05-01

    The discovery of the Higgs boson has fully confirmed the Standard Model of particles and fields. Nevertheless, there are still fundamental phenomena, like the existence of dark matter and the baryon asymmetry of the Universe, which deserve an explanation that could come from the discovery of new particles. The SHiP experiment at CERN meant to search for very weakly coupled particles in the few GeV mass domain has been recently proposed. The existence of such particles, foreseen in different theoretical models beyond the Standard Model, is largely unexplored. A beam dump facility using high intensity 400 GeV protons is a copious source of such unknown particles in the GeV mass range. The beam dump is also a copious source of neutrinos and in particular it is an ideal source of tau neutrinos, the less known particle in the Standard Model. Indeed, tau anti-neutrinos have not been directly observed so far. We report the physics potential of such an experiment including the tau neutrino magnetic moment.

  9. Why investors shy away from coal

    International Nuclear Information System (INIS)

    Roling, D.A.

    1994-01-01

    Why do investors shy away from coal? This may sound like a strange question given the change in ownership of many major coal companies in recent years, but the ongoing consolidation within the coal industry is quite different from any actual new investment in the industry. To begin to understand why, one must return to the early '70s, a time of low-cost, abundant energy. The price of oil was about $2-4/bbl until 1973. The price of natural gas was about 60 cents/M ft 3 , and coal was approximately $7/st. This, however, was before the first Organization of the Petroleum Exporting Countries (OPEC) shock. The price of coal declined throughout the 1980s, and continues its downward path in some markets. Many coal investments have not achieved their expected return, such as the case of a 1M st/yr mine in West Virginia, which was developed in the early '80s only to be put immediately on a care-and-maintenance basis, where it languished until it was sold in 1990. Other mines, such as the large open-pit mines in the Powder River Basin in Wyoming, never reached their targeted production rates. Some of these large mines had equipment that remained in crates for years, only later to be sold at a loss. The extent of losses on investments in coal mines is discussed

  10. The SHiP project at CERN

    Science.gov (United States)

    De Lellis, G.; SHiP Collaboration

    2016-07-01

    The discovery of the Higgs boson has fully confirmed the Standard Model of particles and fields. Nevertheless, there are still fundamental phenomena, like the existence of dark matter and the baryon asymmetry, which deserve an explanation that could come from the discovery of new particles. Searches for new physics with accelerators are performed at the LHC, looking for high massive particles coupled to matter with ordinary strength. A new experimental facility at CERN meant to search for very weakly coupled particles in the few GeV mass domain has been recently proposed. The existence of such particles, foreseen in different theoretical models beyond the Standard Model, is largely unexplored. A beam dump facility using 400 GeV protons is a copious factory of charmed hadrons and could be used to probe the existence of such particles. The beam dump is also a copious source of neutrinos and in particular it is an ideal source of tau neutrinos, the less known particle in the Standard Model. Indeed, tau anti-neutrinos have not been directly observed so far. We report the physics potential of such an experiment. Resistive Plate Chambers could play a role in the SHiP detector.

  11. The SHiP experiment at CERN

    Science.gov (United States)

    Bonivento, Walter M.

    2017-07-01

    The discovery of the Higgs boson has fully confirmed the Standard Model of particles and fields. Nevertheless, there are still fundamental phenomena, like the existence of dark matter and the baryon asymmetry of the Universe, deserving an explanation that could come from the discovery of new particles. Searches for new physics with accelerators are performed at the LHC, looking for high massive particles coupled to matter with ordinary strength. A new experiment at CERN meant to search for very weakly coupled particles in the few GeV mass domain has been recently proposed. The existence of such particles, foreseen in different theoretical models beyond the Standard Model, is largely unexplored. A beam dump facility using high intensity 400 GeV protons is a copious source of such unknown particles in the GeV mass range. The beam dump is also a copious source of neutrinos and in particular it is an ideal source of tau neutrinos, the less known particle in the Standard Model. The neutrino detector can also search for dark matter through its scattering off the electrons. We report the physics potential of the SHiP experiment.

  12. Tai Chi and Qi Gong for Health and Well-Being

    Medline Plus

    Full Text Available ... The following video is intended to be an educational tool that features tai chi and qi gong as an activity to enhance wellness. These exercise therapies are generally considered safe, self-care approaches used to promote a healthy lifestyle. As always, talk to your health care provider if you are ...

  13. MICROCONTROLLER PIN CONFIGURATION TOOL

    OpenAIRE

    Bhaskar Joshi; F. Mohammed Rizwan; Dr. Rajashree Shettar

    2012-01-01

    Configuring the micro controller with large number of pins is tedious. Latest Infine on microcontroller contains more than 200 pins and each pin has classes of signals. Therefore the complexity of the microcontroller is growing. It evolves looking into thousands of pages of user manual. For a user it will take days to configure the microcontroller with the peripherals. We need an automated tool to configure the microcontroller so that the user can configure the microcontroller without having ...

  14. PINS Spectrum Identification Guide

    Energy Technology Data Exchange (ETDEWEB)

    A.J. Caffrey

    2012-03-01

    The Portable Isotopic Neutron Spectroscopy—PINS, for short—system identifies the chemicals inside munitions and containers without opening them, a decided safety advantage if the fill chemical is a hazardous substance like a chemical warfare agent or an explosive. The PINS Spectrum Identification Guide is intended as a reference for technical professionals responsible for the interpretation of PINS gamma-ray spectra. The guide is divided into two parts. The three chapters that constitute Part I cover the science and technology of PINS. Neutron activation analysis is the focus of Chapter 1. Chapter 2 explores PINS hardware, software, and related operational issues. Gamma-ray spectral analysis basics are introduced in Chapter 3. The six chapters of Part II cover the identification of PINS spectra in detail. Like the PINS decision tree logic, these chapters are organized by chemical element: phosphorus-based chemicals, chlorine-based chemicals, etc. These descriptions of hazardous, toxic, and/or explosive chemicals conclude with a chapter on the identification of the inert chemicals, e.g. sand, used to fill practice munitions.

  15. Brothers or Rivals? Iran and the Shi'a of Iraq

    National Research Council Canada - National Science Library

    Hunter, Robert C

    2006-01-01

    This thesis examines the loyalty of the Shi a of Iraq. While some Sunni Arab leaders have recently accused the Shi a of Iraq of pledging loyalty to Iran, in fact the Iraqi Shi a are loyal to their own nation...

  16. Extraction and beam transfer for the SHiP facility

    CERN Document Server

    Goddard, Brennan; Borburgh, Jan; Balhan, Bruno; Le Godec, Gilles; Zerlauth, Markus; Tommasini, Davide; Kain, Verena; Cornelis, Karel; Wenninger, Jorg; Jensen, Lars; Todd, Benjamin; Bauche, Jeremie; Puccio, Bruno

    2015-01-01

    This document summarises the key feasibility issues associated with the SPS extraction and beam transfer systems required for the SHiP facility. It describes the expected performance limits of the electrostatic septa, the expected beam losses during extraction and consequences, the design of the new beamline geometry and equipment systems and the expected extracted spill structure.

  17. Fuel pin transfer tool

    International Nuclear Information System (INIS)

    Patenaude, R. S.

    1985-01-01

    A fuel pin transfer tool has a latching device of the collet type attached to a first member movable vertically through a long work stroke enabling a fuel pin in an under water assembly to be engaged and withdrawn therefrom or placed therein and released. The latching device has a collet provided with a plurality of resilient fingers having cam portions normally spaced apart to receive the upper end of a fuel pin between them and a second member, movable vertically through a short stroke relative to the first member is provided with cam portions engageable with those of the fingers and is yieldably and resiliently held in a raised position in which its cam portions engage those of the fingers and force the fingers into their pin-gripping positions. When a predetermined force is applied to the second member, it is so moved that its cam portions are disengaged from the cam portions of the fingers permitting the latter to move into their normal relationship in which a gripped pin is released or another pin received but with their pin-gripping relationship positively re-established and maintained once the force on the tubular member is lessened. Movement of the first member in either direction and movement of the second member into its raised position is attended by forces inadequate to affect the integrity of fuel pin cladding. That force is applied in the preferred embodiment, by a power operated actuator which is within the upper portion of a housing and, in the preferred embodiment, carried by the long stroke member but always in the upper housing portion which is of a material sufficiently translucent to enable the actuator to be observed throughout the work stroke and is sufficiently light in weight to prevent the tool from being top heavy

  18. Flux Pinning in Superconductors

    CERN Document Server

    Matsushita, Teruo

    2007-01-01

    The book covers the flux pinning mechanisms and properties and the electromagnetic phenomena caused by the flux pinning common for metallic, high-Tc and MgB2 superconductors. The condensation energy interaction known for normal precipitates or grain boundaries and the kinetic energy interaction proposed for artificial Nb pins in Nb-Ti, etc., are introduced for the pinning mechanism. Summation theories to derive the critical current density are discussed in detail. Irreversible magnetization and AC loss caused by the flux pinning are also discussed. The loss originally stems from the ohmic dissipation of normal electrons in the normal core driven by the electric field induced by the flux motion. The readers will learn why the resultant loss is of hysteresis type in spite of such mechanism. The influence of the flux pinning on the vortex phase diagram in high Tc superconductors is discussed, and the dependencies of the irreversibility field are also described on other quantities such as anisotropy of supercondu...

  19. [Doctor HUANG Shi-ping's acupuncture with golden needles].

    Science.gov (United States)

    Chen, Teng-Fei; Ma, Zeng-Bin; Xin, Si-Yuan; Zhu, Jiang

    2013-08-01

    Taking Doctor HUANG Shi-ping as the representative, the school of Huang's golden needle is based on Chinese martial art. Golden needles are adopted as main tool. Attaching great importance on the combination of acupuncture and moxibustioin, it is also characterized with penetrating needling with long needles. Through the development of three generations, it once outshone other schools in the field of acupuncture, and became famous all over the world. It made great contribution to the development of the course of acupuncture. However, with the development of the history, the form of acupuncture education as well as apparatus were all undergone an unified reform. Therefore, Doctor HUANG Shi-ping's acupuncture school be lost gradually.

  20. AHP 37: A GROUP OF MURAL PAINTINGS FROM THE 1930S IN A MDO REB GONG

    OpenAIRE

    Rob Linrothe

    2015-01-01

    Over the course of several summer and winter visits to A mdo Reb gong in the late 1990s and early 2000s, I had the privilege of meeting 'Teacher Kevin' and several of his students (of Tibetan and various ethnicities) and teaching colleagues in Xining. I sat in on more than one of the evenings at his apartment with his amazingly proficient language students. Often these rather jolly gatherings ended with a performance fest: going round the room, each person was obliged to sing a song. Witho...

  1. A SHiP to explore new routes

    CERN Multimedia

    Antonella Del Rosso

    2015-01-01

    SHiP (Search for Hidden Particles) is a proposed new facility for CERN's SPS accelerator. Its challenging goals include a direct search for hidden non-Standard-Model particles. Predicted by a large number of theoretical models, such particles could have slipped under the radar of the LHC experiments because of their specific features. In its first symposium held at CERN on 2 July, SHiP scientists showed the broader scientific community how they plan to unveil the hidden world.     The SHiP experiment is designed to be installed next to the SPS North Area.  Powerful accelerators like the LHC allow physicists to explore extensively the primordial phenomena at energy densities equivalent to those that existed just a few moments after the Big Bang. In this way, thanks to the high precision of the LHC experiments, scientists have been able to comprehensively confirm the predictions of the Standard Model (SM), including the existence of a Higgs boson. However, new...

  2. PINS-3X Operations

    Energy Technology Data Exchange (ETDEWEB)

    E.H. Seabury

    2013-09-01

    Idaho National Laboratory’s (INL’s) Portable Isotopic Neutron Spectroscopy System (PINS) non-intrusively identifies the chemical fill of munitions and sealed containers. The PINS-3X variant of the system is used to identify explosives and uses a deuterium-tritium (DT) electronic neutron generator (ENG) as the neutron source. Use of the system, including possession and use of the neutron generator and shipment of the system components requires compliance with a number of regulations. This report outlines some of these requirements as well as some of the requirements in using the system outside of INL.

  3. Pinning Down versus Density

    OpenAIRE

    Juhász, István; Soukup, Lajos; Szentmiklóssy, Zoltán

    2015-01-01

    The pinning down number $ {pd}(X)$ of a topological space $X$ is the smallest cardinal $\\kappa$ such that for any neighborhood assignment $U:X\\to \\tau_X$ there is a set $A\\in [X]^\\kappa$ with $A\\cap U(x)\

  4. R and D of tritium technology as SHI (Sumitomo Heavy Industries)

    International Nuclear Information System (INIS)

    Yokogawa, N.

    1997-01-01

    Sumitomo Heavy Industries (SHI) participated in an R and D programme on tritium processing for the first time in 1967 by joining the advanced thermal reactor project. (The thermal reactor is cooled by light water and moderated by heavy water.) From that time SHI has developed various kind of tritium handling technologies. On the basis of cooperation with Sulzer (Sulzer Chemtech Ltd. Switzerland), SHI developed a system for removing waste water for fuel reprocessing plants by water distillation technology. In the field of fusion technology, SHI has developed a hydrogen isotope separation system by cryogenic distillation and thermal diffusion methods, and a tritium storage bed. Fundamental data required for the system design were obtained through the production and operation of the above prototype systems. Recently, SHI has also been taking part in the design and planning of ITER. In the future, along with ITER design, SHI will aim at developing tritium measuring technology. (author)

  5. Pin clad strains in Phenix

    International Nuclear Information System (INIS)

    Languille, A.

    1979-07-01

    The Phenix reactor has operated for 4 years in a satisfactory manner. The first 2 sub-assembly loadings contained pins clad in solution treated 316. The principal pin strains are: diametral strain (swelling and irradiation creep), ovality and spiral bending of the pin (interaction of wire and pin cluster and wrapper). A pin cluster irradiated to a dose of 80 dpa F reached a pin diameter strain of 5%. This strain is principally due to swelling (low fission gas pressure). The principal parameters governing the swelling are instantaneous dose, time and temperature for a given type of pin cladding. Other types of steel are or will be irradiated in Phenix. In particular, cold-worked titanium stabilised 316 steel should contribute towards a reduction in the pin clad strains and increase the target burn-up in this reactor. (author)

  6. $\\mu$-flux measurements for SHiP using NA61/SHINE

    CERN Document Server

    Dijkstra, H; Korzenev, A; Mermod, P

    2016-01-01

    A major concern for the design of the SHiP experiment is the lack of a precise knowledge of the muon flux. This is a proposal to measure the expected muon flux in the SHiP experiment by installing a replica of the SHiP target in a 400 GeV/c proton beam in front of the NA61/SHINE spectrometer. We propose to do a first measurement in june 2017.

  7. Calibrating the SHiP muon-flux using NA61/SHINE

    CERN Document Server

    Van Herwijnen, Eric; Korzenev, Alexander; Mermod, Philippe

    2016-01-01

    A major concern for the design of the SHiP experiment is the lack of a precise knowledge of the muon flux. This is a proposal to measure the expected muon flux in the SHiP experiment by installing a replica of the SHiP target in a 400 GeV proton beam in front of the NA61/SHINE spectrometer. We propose to do a first measurement in 2017.

  8. SHI induced irradiation effect on Mo/Si interface

    International Nuclear Information System (INIS)

    Agarwal, Garima; Agarwal, Shivani; Jain, Rajkumar; Lal, Chhagan; Jain, I.P.; Kabiraj, D.; Pandey, Akhilesh

    2006-01-01

    Present parametric study investigates the characteristics of SHI induced mixed molybdenum silicide film with various ion fluences. The deposition of molybdenum thin films onto the Silicon substrate was performed using e-beam evaporation, while the heavy Au ion irradiation with energy 120 MeV was subsequently applied to form molybdenum silicide. The samples have been characterized by grazing incidence X-ray diffraction (GIXRD) for the identification of phase formation at the interface. Formation of t-Mo 5 Si 3 mixed molybdenum silicide was observed on increasing the ion irradiation fluences. (author)

  9. Nuclear fuel pin

    International Nuclear Information System (INIS)

    Hartley, Kenneth; Moulding, T.L.J.; Rostron, Norman.

    1979-01-01

    Fuel pin for use in fast breeder nuclear reactors containing fissile and fertile areas of which the fissile and fertile materials do not mix. The fissile material takes the shape of large and small diameter microspheres (the small diameter microspheres can pass through the interstices between the large microspheres). The barrier layers being composed of microspheres with a diameter situated between those of the large and small microspheres ensure that the materials do not mix [fr

  10. Pinning in nonmagnetic borocarbides

    International Nuclear Information System (INIS)

    Zholobenko, A.N.; Mikitik, G.P.; Fil, V.D.; Kim, J.D.; Lee, S.I.

    2005-01-01

    The field dependences of the Labush parameter in nonmagnetic borocarbides are measured by the method which does not require the free flux flow regime. The anticipated critical current densities are estimated. These values are by two orders of magnitude higher than those measured 'directly' in transport (magnetic) experiments. The giant peak-effect in the field dependences of the Labush parameter is revealed in the Y-based borocarbides. Its behavior is well approximated by the collective pinning theory

  11. Search for New Physics in SHiP and at future colliders

    CERN Document Server

    AUTHOR|(CDS)2080890; Serra, Nicola; Storaci, Barbara

    2015-01-01

    SHiP is a newly proposed fixed-target experiment at the CERN SPS with the aim of searching for hidden particles that interact very weakly with SM particles. The work presented in this document investigates SHiP's physics reach in the parameter space of the Neutrino Minimal Standard Model ($\

  12. First steps towards geometry optimization for Spectrometer Straw Tracker of SHiP detector

    CERN Document Server

    Solovev, Vladimir

    2017-01-01

    This report contains details of CERN Summer Student project which was performed for SHiP experiment (Search for Hidden Particles). The main aim of the project is optimization of Spectrometer Straw Tracker (SST) geometry implemented in FairSHiP simulation program.

  13. Interaction and conflict between Sufism and Shi`ism during Safavid era

    Directory of Open Access Journals (Sweden)

    E Naghibi

    2017-10-01

    Full Text Available 14th century was considered as the conciliation of Imami Shi`ism and Sufism. But, the relation at the beginning of Safavid dynasty developed to the extent that concepts such as guardianship in a mixture of Shi’ite and Sufi themes made the situation prone to political functions. Imami Shi`ism became official for the first time by Safavids however, their reliance on the support of Turkmen to acquire power urged them to make Sufism superior to Shi`ism. Thus, Ghezelbash people representing Sufism depicted a great kinglike image of the Absent Imam which did not comply with religion and was against the claim of jurists. The perspective did not remain stable after Safavid dynasty was completely established. The idea was in conflict with the interests of the ruling authority, so Safavid rulers turned to Shi`ism from Sufism. The issue not only made Shi`ism and jurists superior to Sufism but also caused Shi`ites confront Sufism for several centuries. The aim of the present article is to investigate the process of peace and conflict between Sufism and Shi`ism during Safavid dynasty.

  14. Social surrogacy and adjustment: exploring the correlates of having a "social helper" for shy and non-shy young adolescents.

    Science.gov (United States)

    Markovic, Andrea; Bowker, Julie C

    2015-01-01

    A social surrogate is an individual who offers help and comfort in social situations or makes social events more exciting. In this study of 157 young adolescents (55% female; Mage = 13.84 years, SD = 0.75 years), the authors examined whether the linear and curvilinear associations between self-reported social surrogate use and adjustment outcomes (social problems, loneliness, anxiety symptoms, depressive symptoms) varied as a function of shyness and gender, after accounting for the effects of positive friendship quality. Regression analyses revealed that low and high levels of social surrogate use were related to greater social problems for all adolescents. In addition, shyness emerged as a moderator for several curvilinear effects. Specifically, results indicated that (a) high levels of social surrogate use were associated with greater anxiety for adolescents high in shyness; and (b) low levels of social surrogate use were associated with greater depressive symptoms for adolescents low in shyness. Findings highlight the developmental importance of specific types of relationship experiences during early adolescence and point to different implications of social surrogate use for shy and non-shy young adolescents.

  15. Search for hidden particles with the SHiP experiment

    Energy Technology Data Exchange (ETDEWEB)

    Hagner, Caren; Bick, Daniel; Bieschke, Stefan; Ebert, Joachim; Schmidt-Parzefall, Walter [Universitaet Hamburg, Institut fuer Experimentalphysik, Luruper Chaussee 149, 22761 Hamburg (Germany)

    2016-07-01

    Many theories beyond the standard model predict long lived neutral (hidden) particles. There might be a whole Hidden Sector (HS) of weakly interacting particles, which cannot be detected in existing high energy experiments. The SHiP experiment (Search for Hidden Particles) requires a high intensity beam dump, which could be realized by a new facility at the CERN SPS accelerator. New superweakly interacting particles with masses below O(10) GeV could be produced in the beam dump and detected in a general purpose Hidden Sector (HS) detector. In addition there will be a dedicated tau neutrino subdetector. I present the major requirements and technical challenges for the HS detector and discuss how the HS can be accessed through several portals: neutrino portal, scalar portal, vector portal and many more.

  16. Transformation of Helicopter PinS Procedures for Airplanes

    Directory of Open Access Journals (Sweden)

    Jakub Kraus

    2013-09-01

    Full Text Available This article deals with the possibility to use existing helicopter Point in Space procedures with minor changes for airplanes. The basis is to find parts of PinS procedures that need to be changed, suggest these changes, and then determine whether the revised procedures could be usable and could bring the benefits for airplane operations.

  17. ANATOMY OF A SOLAR FLARE: MEASUREMENTS OF THE 2006 DECEMBER 14 X-CLASS FLARE WITH GONG, HINODE, AND RHESSI

    International Nuclear Information System (INIS)

    Matthews, S. A.; Zharkov, S.; Zharkova, V. V.

    2011-01-01

    Some of the most challenging observations to explain in the context of existing flare models are those related to the lower atmosphere and below the solar surface. Such observations, including changes in the photospheric magnetic field and seismic emission, indicate the poorly understood connections between energy release in the corona and its impact in the photosphere and the solar interior. Using data from Hinode, TRACE, RHESSI, and GONG we study the temporal and spatial evolution of the 2006 December 14 X-class flare in the chromosphere, photosphere, and the solar interior. We investigate the connections between the emission at various atmospheric depths, including acoustic signatures obtained by time-distance and holography methods from the GONG data. We report the horizontal displacements observed in the photosphere linked to the timing and locations of the acoustic signatures we believe to be associated with this flare, their vertical and horizontal displacement velocities, and their potential implications for current models of flare dynamics.

  18. Pinning, de-pinning and re-pinning of a slowly varying rivulet

    KAUST Repository

    Paterson, C.; Wilson, S.K.; Duffy, B.R.

    2013-01-01

    The solutions for the unidirectional flow of a thin rivulet with prescribed volume flux down an inclined planar substrate are used to describe the locally unidirectional flow of a rivulet with constant width (i.e. pinned contact lines) but slowly varying contact angle as well as the possible pinning and subsequent de-pinning of a rivulet with constant contact angle and the possible de-pinning and subsequent re-pinning of a rivulet with constant width as they flow in the azimuthal direction from the top to the bottom of a large horizontal cylinder. Despite being the same locally, the global behaviour of a rivulet with constant width can be very different from that of a rivulet with constant contact angle. In particular, while a rivulet with constant non-zero contact angle can always run from the top to the bottom of the cylinder, the behaviour of a rivulet with constant width depends on the value of the width. Specifically, while a narrow rivulet can run all the way from the top to the bottom of the cylinder, a wide rivulet can run from the top of the cylinder only to a critical azimuthal angle. The scenario in which the hitherto pinned contact lines of the rivulet de-pin at the critical azimuthal angle and the rivulet runs from the critical azimuthal angle to the bottom of the cylinder with zero contact angle but slowly varying width is discussed. The pinning and de-pinning of a rivulet with constant contact angle, and the corresponding situation involving the de-pinning and re-pinning of a rivulet with constant width at a non-zero contact angle which generalises the de-pinning at zero contact angle discussed earlier, are described. In the latter situation, the mass of fluid on the cylinder is found to be a monotonically increasing function of the constant width. © 2013 Elsevier Masson SAS. All rights reserved.

  19. Pinning, de-pinning and re-pinning of a slowly varying rivulet

    KAUST Repository

    Paterson, C.

    2013-09-01

    The solutions for the unidirectional flow of a thin rivulet with prescribed volume flux down an inclined planar substrate are used to describe the locally unidirectional flow of a rivulet with constant width (i.e. pinned contact lines) but slowly varying contact angle as well as the possible pinning and subsequent de-pinning of a rivulet with constant contact angle and the possible de-pinning and subsequent re-pinning of a rivulet with constant width as they flow in the azimuthal direction from the top to the bottom of a large horizontal cylinder. Despite being the same locally, the global behaviour of a rivulet with constant width can be very different from that of a rivulet with constant contact angle. In particular, while a rivulet with constant non-zero contact angle can always run from the top to the bottom of the cylinder, the behaviour of a rivulet with constant width depends on the value of the width. Specifically, while a narrow rivulet can run all the way from the top to the bottom of the cylinder, a wide rivulet can run from the top of the cylinder only to a critical azimuthal angle. The scenario in which the hitherto pinned contact lines of the rivulet de-pin at the critical azimuthal angle and the rivulet runs from the critical azimuthal angle to the bottom of the cylinder with zero contact angle but slowly varying width is discussed. The pinning and de-pinning of a rivulet with constant contact angle, and the corresponding situation involving the de-pinning and re-pinning of a rivulet with constant width at a non-zero contact angle which generalises the de-pinning at zero contact angle discussed earlier, are described. In the latter situation, the mass of fluid on the cylinder is found to be a monotonically increasing function of the constant width. © 2013 Elsevier Masson SAS. All rights reserved.

  20. Evaluation of the Chinese Fine Spatial Resolution Hyperspectral Satellite TianGong-1 in Urban Land-Cover Classification

    OpenAIRE

    Xueke Li; Taixia Wu; Kai Liu; Yao Li; Lifu Zhang

    2016-01-01

    The successful launch of the Chinese high spatial resolution hyperspectral satellite TianGong-1 (TG-1) opens up new possibilities for applications of remotely-sensed satellite imagery. One of the main goals of the TG-1 mission is to provide observations of surface attributes at local and landscape spatial scales to map urban land cover accurately using the hyperspectral technique. This study attempted to evaluate the TG-1 datasets for urban feature analysis, using existing data over Beijing, ...

  1. The computer-assisted interview In My Shoes can benefit shy preschool children's communication

    Science.gov (United States)

    Salari, Raziye; Eriksson, Maria; Sarkadi, Anna

    2017-01-01

    Interviewing children is a cognitively, socially, and emotionally challenging situation, especially for young and shy children. Thus, finding methods that aid rapport and increase these children’s communication is important. The present study investigated whether children’s verbal and non-verbal communicative behavior developed differently during the rapport phase, depending on whether children were situationally shy or not, and whether the interview was conducted using the computer-assisted interview In My Shoes (IMS) or a Standard verbal interview. The sample consisted of 60 children aged 4 to 5-years-old. The results showed that for the shy children in the IMS group their talkativeness increased and their answer latency decreased including the amount of encouragement the child needed to talk, while no changes were observed for the shy children in the Standard verbal interview group. There were no significant differences in the non-verbal behavior for the shy children regardless of the interview method used. For the non-shy children, overall, the interview method did not affect either the verbal or the non-verbal outcomes. Our findings indicate that IMS can be a useful tool during the rapport-building phase with shy children as it helps these children to improve their verbal communication. PMID:28813534

  2. Vortex pinning and creep experiments

    International Nuclear Information System (INIS)

    Kes, P.H.

    1991-01-01

    A brief review of basic flux-pinning and flux-creep ingredients and a selection of experimental results on high-temperature-superconductivity compounds is presented. Emphasis is put on recent results and on those properties which are central to the emerging understanding of the flux-pinning and flux-creep mechanisms of these fascinating materials

  3. Revolution, Modernity and (Trans)National Shi`i Islam: Rethinking Religious Conversion in Senegal.

    Science.gov (United States)

    Leichtman, Mara A

    2009-07-01

    The establishment of a Shi`i Islamic network in Senegal is one alternative to following the country's dominant Sufi orders. I examine Senegalese conversion narratives and the central role played by the Iranian Revolution, contextualizing life stories (trans)nationally in Senegal's political economy and global networks with Iran and Lebanon. Converts localize foreign religious ideologies into a 'national' Islam through the discourse that Shi`i education can bring peace and economic development to Senegal. Senegalese Shi`a perceive that proselytizing, media technologies, and Muslim networking can lead to social, cultural and perhaps even political change through translating the Iranian Revolution into a non-violent reform movement.

  4. Meridional-Flow Measurements from 15 Years of GONG Spherical-Harmonic Time Series

    International Nuclear Information System (INIS)

    Kholikov, S; Hernandez, I Gonzalez; Hill, F; Leibacher, J

    2011-01-01

    We present results of meridional-flow measurements for 1995-2009, using travel-time differences from velocity images reconstructed using GONG spherical harmonic (SH) coefficients after applying phase-velocity and low-m filters. This filtering technique increases the signal-to-noise ratio and thus extends travel-time measurements to relatively high latitudes and deep into the convection zone. Preliminary analyses shows a strong one-year periodicity presumably due to solar pole misalignment and B 0 -angle artifacts, which makes it difficult to see underlying temporal variations. Removing a simple one-year-period sine wave fit reveals long-term temporal variations of the flow on top of this yearly periodicity. High-latitude measurements are affected more stronger by foreshortening and B 0 -angle artifacts. We analyze different B 0 -angle intervals separately, so in each hemisphere better high-latitude visibility comes six months apart. This approach suggests why at high latitudes travel-time measurements of meridional flow shows a tendency to change sign instead of continuing towards the poles.

  5. Muon-flux measurements for SHiP at H4

    CERN Document Server

    van Herwijnen, E

    2017-01-01

    A major concern for the design of the SHiP experiment is the lack of a precise knowledge of the muon flux. This is a proposal to measure the expected muon flux in the SHiP experiment by installing a replica of the SHiP target in a 400 GeV/c proton beam at H4. We intend building a spectrometer using the drift tube prototypes that were constructed for OPERA. A muon tagger will be built using RPCs, which will also serve as a module-0 for SHiP. We propose to do this measurement in early 2018. Accumulating $\\sim 10^{11}$ 400 GeV/c POT will enable us to make a more realistic design of the muon shield. With some modifications, this setup can also be used to measure the charm cross section (including the cascade production). We intend to test this setup after the measurement of the muon flux.

  6. The Best Friendships of Shy/Withdrawn Children: Prevalence, Stability, and Relationship Quality

    Science.gov (United States)

    Rubin, Kenneth H.; Wojslawowicz, Julie C.; Rose-Krasnor, Linda; Booth-LaForce, Cathryn; Burgess, Kim B.

    2013-01-01

    The mutual best friendships of shy/withdrawn and control children were examined for prevalence, stability, best friend’s characteristics, and friendship quality. Using peer nominations of shy/socially withdrawn and aggressive behaviors, two groups of children were identified from a normative sample of fifth-grade children: shy/withdrawn (n = 169) and control (nonaggressive/nonwithdrawn; n = 163). Friendship nominations, teacher reports, and friendship quality data were gathered. Results revealed that shy/withdrawn children were as likely as control children to have mutual stable best friendships. Withdrawn children’s friends were more withdrawn and victimized than were the control children’s best friends; further, similarities in social withdrawal and peer victimization were revealed for withdrawn children and their friends. Withdrawn children and their friends reported lower friendship quality than did control children. Results highlight the importance of both quantitative and qualitative measures of friendship when considering relationships as risk and/or protective factors. PMID:16485175

  7. Why I Am Not SHY: A Reply to Tononi and Cirelli

    Directory of Open Access Journals (Sweden)

    Marcos Gabriel Frank

    2013-01-01

    Full Text Available In a recent article I reviewed an influential theory of sleep function, the “synaptic homeostasis hypothesis (SHY.” According to SHY, sleep renormalizes synapses that are potentiated during prior wakefulness. I concluded that while SHY is a seminal theory with important implications about sleep function and the brain, its underlying mechanisms are poorly defined. In an accompanying article, the authors of SHY responded at length. Their reply is thoughtful and provocative, but unfortunately many of the points I raised were not accurately represented or addressed. In this brief commentary, I attempt to clarify some points of confusion. I also explain why any theory of sleep function is incomplete without an understanding of the underlying cellular mechanisms.

  8. Automated fuel pin loading system

    Science.gov (United States)

    Christiansen, D.W.; Brown, W.F.; Steffen, J.M.

    An automated loading system for nuclear reactor fuel elements utilizes a gravity feed conveyor which permits individual fuel pins to roll along a constrained path perpendicular to their respective lengths. The individual lengths of fuel cladding are directed onto movable transports, where they are aligned coaxially with the axes of associated handling equipment at appropriate production stations. Each fuel pin can be be reciprocated axially and/or rotated about its axis as required during handling steps. The fuel pins are inerted as a batch prior to welding of end caps by one of two disclosed welding systems.

  9. Sensitivity of the SHiP experiment to a light scalar particle mixing with the Higgs

    CERN Document Server

    Lanfranchi, Gaia

    2017-01-01

    This conceptual study shows the ultimate sensitivity of the SHiP experiment for the search of a light scalar particle mixing with the Higgs for a dataset corresponding to 5-years of SHiP operation at a nominal intensity of 4 1013 protons on target per second. The sensitivity as a function of the length of the vessel and of its distance from the target as well as a function of the background contamination is also studied.

  10. Neutrino scattering physics with the SHiP Experiment

    CERN Document Server

    AUTHOR|(CDS)2083090

    2015-01-01

    SHiP (Search for Hidden Particles) is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In its initial phase the 400 GeV protons beam will be dumped on a heavy target with the aim of integrating 2 × 1020 pot in five years. A dedicated detector downstream the target will allow to probe a variety of models with the light long-lived exotic particles and masses below O(10) GeV/c2. Another dedicated detector will allow the study of active neutrino cross-sections and angular distributions. In particular, the neutrino deep-inelastic cross-sections will be performed with a statistics 1000 times larger than currently available, with the extraction of the F4 and F5 structure functions, never measured so far. Tau neutrinos will be distinguished by anti-neutrinos, thus providing the first observation of the tau anti-neutrino. With muon neutrinos it will be possible to study the strangeness content of the nucleon.

  11. The SHiP experiment at CERN SPS

    CERN Document Server

    Di Crescenzoon, A

    2016-01-01

    SHiP is a new general purpose fixed target facility, whose Technical Proposal has been recently submitted to the CERN SPS Committee. In its initial phase, the 400 GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating 2 × 1020 pot in 5 years. A dedicated detector located downstream of the target, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below a few GeV/c2. The beam dump is also an ideal source of tau neutrinos, the less known particle in the Standard Model. Another dedicated detector, based on the Emulsion Cloud Chamber technology already used in the OPERA experiment, will allow to perform for the first time measurements of the tau neutrino deep inelastic scattering cross section. Tau neutrinos will be distinguished from tau anti-neutrinos, thus providing the first observation of the tau anti-neutrino.

  12. Neutrino scattering physics with the SHiP Experiment

    CERN Document Server

    Di Crescenzo, Antonia

    2016-01-01

    SHiP (Search for Hidden Particles) is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In its initial phase the 400 GeV protons beam will be dumped on a heavy target with the aim of integrating $2 \\times 10^{20}$ pot in five years. A dedicated detector downstream the target will allow to probe a variety of models with the light long-lived exotic particles and masses below O(10) GeV/c2. Another dedicated detector will allow the study of active neutrino cross-sections and angular distributions. In particular, the neutrino deep-inelastic cross-sections will be performed with a statistics 1000 times larger than currently available, with the extraction of the F4 and F5 structure functions, never measured so far. Tau neutrinos will be distinguished by anti-neutrinos, thus providing the first observation of the tau anti-neutrino. With muon neutrinos it will be possible to study the strangeness content of the nucleon.

  13. Neutrino physics with the SHiP experiment

    CERN Document Server

    AUTHOR|(SzGeCERN)759942

    2015-01-01

    Despite the Standard Model (SM) has been strongly confirmed by the Higgs discovery, several experimental facts are still not explained. The SHiP experiment (Search for Hidden Particles), a beam dump experiment at CERN, aims at the observation of long lived particles very weakly coupled with ordinary matter. These particles of the GeV mass scale, foreseen in many extensions of the SM, might come from the decay of charmed hadrons produced in the collision of a 400 GeV proton beam on a target. High rates of all the three active neutrinos are also expected. For the first time the properties and the cross section of the ντ will be studied thanks to a detector based on nuclear emulsions, with the micrometric resolution needed to identify the tau lepton produced in neutrino interactions. Measuring the charge of the tau daughters, will enable the first observation of the ν ̄τ and the study of its cross section.

  14. Different Influences on Tacrolimus Pharmacokinetics by Coadministrations of Zhi Ke and Zhi Shi in Rats

    Directory of Open Access Journals (Sweden)

    Shiuan-Pey Lin

    2011-01-01

    Full Text Available Tacrolimus, an immunosuppressant with narrow therapeutic window, has been used widely in transplant patients. Grapefruit juice and pomelo have been reported to increase the blood levels of tacrolimus. Zhi Ke and Zhi Shi, the ripe peels and unripe fruits of Citrus aurantium which is chemotaxonomically related to grapefruit and pomelo, are in wide use in clinical Chinese medicine. To investigate the possible interaction of these two Citrus herbs with tacrolimus, male Sprague-Dawley rats were orally given tacrolimus (1.5 mg/kg with and without Zhi Ke and Zhi Shi decoctions in a cross-over design. Blood samples were withdrawn via cardiopuncture at specific time and quantitated by a microparticle enzyme immunoassay. In addition, to explore the mechanism of interaction, LS 180 cell line was used for the transport study of rhodamine 123, a typical substrate of P-glycoprotein (P-gp. The results showed that Zhi Shi significantly decreased the Cmax⁡ and AUC0-t of tacrolimus by 72.4% and 72.0%, respectively, whereas Zhi Ke did not affect tacrolimus pharmacokinetics. LS 180 cell line study indicated that Zhi Shi increased the efflux activity of P-gp, enabling us to explain the decreased oral bioavailability of tacrolimus caused by Zhi Shi. Hence, we suggest that Zhi Shi be contraindicated for transplant patients treated with tacrolimus to reduce the risk of allograft rejection.

  15. Different Influences on Tacrolimus Pharmacokinetics by Coadministrations of Zhi Ke and Zhi Shi in Rats

    Science.gov (United States)

    Lin, Shiuan-Pey; Wu, Ping-Ping; Hou, Yu-Chi; Tsai, Shang-Yuan; Wang, Meng-Ju; Fang, Shih-Hua; Chao, Pei-Dawn Lee

    2011-01-01

    Tacrolimus, an immunosuppressant with narrow therapeutic window, has been used widely in transplant patients. Grapefruit juice and pomelo have been reported to increase the blood levels of tacrolimus. Zhi Ke and Zhi Shi, the ripe peels and unripe fruits of Citrus aurantium which is chemotaxonomically related to grapefruit and pomelo, are in wide use in clinical Chinese medicine. To investigate the possible interaction of these two Citrus herbs with tacrolimus, male Sprague-Dawley rats were orally given tacrolimus (1.5 mg/kg) with and without Zhi Ke and Zhi Shi decoctions in a cross-over design. Blood samples were withdrawn via cardiopuncture at specific time and quantitated by a microparticle enzyme immunoassay. In addition, to explore the mechanism of interaction, LS 180 cell line was used for the transport study of rhodamine 123, a typical substrate of P-glycoprotein (P-gp). The results showed that Zhi Shi significantly decreased the C max and AUC0−t of tacrolimus by 72.4% and 72.0%, respectively, whereas Zhi Ke did not affect tacrolimus pharmacokinetics. LS 180 cell line study indicated that Zhi Shi increased the efflux activity of P-gp, enabling us to explain the decreased oral bioavailability of tacrolimus caused by Zhi Shi. Hence, we suggest that Zhi Shi be contraindicated for transplant patients treated with tacrolimus to reduce the risk of allograft rejection. PMID:21318106

  16. Pinning down the axion

    International Nuclear Information System (INIS)

    Dabholkar, A.; Quashnock, J.M.

    1990-01-01

    Davis has argued that, without inflation, the decay of axionic strings is the primary source of axions. This implies a cosmological lower bound on the axion mass of 10 -5 to 10 -3 eV. In order to obtain a sharper bound it is essential to know the spectrum of emitted axions and the detailed motion of a global string strongly coupled to the axionic field. To this end, we obtain self-consistent, renormalized equations that describe the dynamics of a radiating global string interacting with its surrounding axionic field. We describe the numerical formalism for evolving string trajectories using these equations. From the numerical and analytical evidence we argue that, with appropriate renormalization, the motion of an interacting cosmic string loop can be well approximated by the motion of a free Nambu-Goto string. This implies a lower bound for the axion mass of 10 -3 eV. Together with the recent upper bound of 4x10 -4 eV from the supernova SN1987a, this marginally rules out the invisible axion, or at least pins down the axion mass to a very narrow window around 10 -3 eV. This still leaves open the window around 2 eV for hardronic axions, but in that case the axion is no longer a serious dark matter candidate. (orig.)

  17. Pinning Mechanisms in YBCO Tapes

    CERN Document Server

    Spera, Marcello; Ballarino, Amalia

    2015-01-01

    In this thesis work, a study on flux pinning mechanisms of commercial YBCO tapes is presented. This study has been performed via critical current characterization using transport (via direct I-V curves) and magnetization (via a Vibrating Sample Magnetometer) measurements. The latter ones turned out to be better concerning the comprehension of the pinning landscape of the provided samples, as a wider range of magnetic fields and temperatures is available for those measurements in the setup I used. The comparison of the experimental data with existing theoretical models allowed me to draw a picture of the pinning mechanisms underlying in each sample, and they turned out to be quite different one another. Moreover, for high-performance research tapes, another interesting feature has been found: the counterplay between the self-field critical current and the in-field one. Very well engineered artificial pinning structures limit the self-field critical current density due to the hi...

  18. A ginástica terapêutica e preventiva chinesa Lian Gong/Qi Gong como um dos instrumentos na prevenção e reabilitação da LER/DORT

    OpenAIRE

    Livramento,Gutembergue; Franco,Tânia; Livramento,Alaíde

    2010-01-01

    Este ensaio traz elementos da medicina ocidental, da medicina tradicional chinesa e da sociologia do trabalho para reflexão sobre o Qi Gong - exercícios terapêuticos, um dos pilares da Medicina Tradicional Chinesa (MTC) - como importante meio de prevenção da LER/DORT e recuperação da saúde. Considerando a natureza interdisciplinar e diversos níveis de prevenção, aborda aspectos sociológicos sobre as condições de trabalho frequentemente relacionadas com este tipo de adoecimento e categorias de...

  19. Automated system for loading nuclear fuel pins

    International Nuclear Information System (INIS)

    Marshall, J.L.

    1983-10-01

    A completely automatic and remotely controlled fuel pin fabrication system is being designed by the Westinghouse Hanford Company. The Pin Operations System will produce fuel pins for the Fast Flux Test Facility (FFTF) and the Clinch River Breeder Reactor Plant (CRBRP). The system will assemble fuel pin components into cladding tubes in a controlled environment. After fuel loading, the pins are filled with helium, the tag gas capsules are inserted, and the top end cap welded. Following welding, the pins are surveyed to assure they are free of contamination and then the pins are helium leak tested

  20. Moral philosophy of guan gong worship%道德哲学视域下的关公崇拜

    Institute of Scientific and Technical Information of China (English)

    钟英战

    2014-01-01

    在中国传统民间信仰之中,关公崇拜是俗文化兴起的产物,是社会道德情感社会潜意识孕育产生的一个道德模范,经典的三国演义为关公崇拜提供了有力的文本支撑,历代统治者的推波助澜也为这种崇拜发展起了重要作用。同时,关公崇拜背后有着深厚的道德内涵和社会价值,它所推崇的“义”是一种超越传统血亲关系的品德。这种品德即使在今天的商业社会也有着其存在发展的土壤,这也是关公崇拜得以延续至今的重要原因。%In Chinese traditional folk belief, worship of guan gong is a product of vulgar culture rise, social moral emotion is the subconscious breeds of a moral models, the classic romance of The Three Kingdoms provides a powerful text support, guan gong worship rulers by also played an important role for the worship of development. At the same time, guan gong cult behind the profound moral connotation and social value, it is regarded "righteousness" is a kind of beyond the traditional kinship character. This character even in today's business society also has its existence in the development of the soil.

  1. [Study on processing adjuvant medicines in Lei Gong's treatise on preparation and broiling of materia medica (Leigong Paozhi Lun)].

    Science.gov (United States)

    Zhang, Wei; Zhang, Ruixian

    2010-09-01

    There were 268 kinds of medicines recorded in the book of Lei Gong's Treatise on preparation and broiling of materia medica (Leigong Paozhi Lun). Among these medicines, 178 medicines were prepared with adjuvant medicines, including general and special compatible adjuvant medicines. These adjuvant medicines used in this book can be explained by the theory of "seven-relation compatibility". The author tried to explain the usage and their compatibility of these adjuvant medicines and put forward that attention should be paid to the changes in functions of medicines and the influences of society should be paid attention.

  2. Enhanced pinning in superconducting thin films with graded pinning landscapes

    Science.gov (United States)

    Motta, M.; Colauto, F.; Ortiz, W. A.; Fritzsche, J.; Cuppens, J.; Gillijns, W.; Moshchalkov, V. V.; Johansen, T. H.; Sanchez, A.; Silhanek, A. V.

    2013-05-01

    A graded distribution of antidots in superconducting a-Mo79Ge21 thin films has been investigated by magnetization and magneto-optical imaging measurements. The pinning landscape has maximum density at the sample border, decreasing linearly towards the center. Its overall performance is noticeably superior than that for a sample with uniformly distributed antidots: For high temperatures and low fields, the critical current is enhanced, whereas the region of thermomagnetic instabilities in the field-temperature diagram is significantly suppressed. These findings confirm the relevance of graded landscapes on the enhancement of pinning efficiency, as recently predicted by Misko and Nori [Phys. Rev. B 85, 184506 (2012)].

  3. Stress relaxation of thermally bowed fuel pins

    International Nuclear Information System (INIS)

    Crossland, I.G.; Speight, M.V.

    1983-01-01

    The presence of cross-pin temperature gradients in nuclear reactor fuel pins produces differential thermal expansion which, in turn, causes the fuel pin to bow elastically. If the pin is restrained in any way, such thermal bowing causes the pin to be stressed. At high temperatures these stresses can relax by creep and it is shown here that this causes the pin to suffer an additional permanent deflection, so that when the cross-pin temperature difference is removed the pin remains bowed. By representing the cylindrical pin by an equivalent I-beam, the present work examines this effect when it takes place by secondary creep. Two restraint systems are considered, and it is demonstrated that the rate of relaxation depends mainly upon the creep equation, and hence the temperature, and also the magnitude of the initial stresses. (author)

  4. Defect pin behaviour in the DFR

    International Nuclear Information System (INIS)

    Sloss, W.M.; Bagley, K.Q.; Edmonds, E.; Potter, P.E.

    1979-01-01

    A program of defective fuel pin irradiations has been carried out in the DFR. This program employed fuel pins which had failed during previous irradiations (natural defects) and pins in which simulated failures (artificial defects) had been induced prior to irradiation or during an intermediate examination stage at moderate or substantial burnups. The artificial defects simulated longitudinal ruptures and were normally located at positions near the top, middle and bottom of the pin where clad temperatures were 450, 540 and 630 0 C respectively. The fuel was mixed U-Pu oxide, and fuel form, stoichiometry, clad type, pin diameter, linear rating, and burnup were among the variables examined. The defect pin tests were normally carried out in single pin or trefoil type vehicles. After irradiation all the pins were subjected to the normal nondestructive examination procedures and the visual, radiographic, gamma-scanning, and dimensional change results are presented. Several pins were destructively examined and the metallographic data are discussed

  5. MONJU fuel pin performance analysis

    International Nuclear Information System (INIS)

    Kitagawa, H.; Yamanaka, T.; Hayashi, H.

    1979-01-01

    Monju fuel pin has almost the same properties as other LMFBR fuel pins, i.e. Phenix, PFR, CRBR, but would be irradiated under severe conditions: maximum linear heat rate of 381 watt/cm, hot spot cladding temperature of 675 deg C, peak burnup of 131,000 MWd/t, peak fluence (E greater than 0.1 MeV) of 2.3 10 23 n/cm 2 . In order to understand in-core performance of Monju fuel pin, its thermal and mechanical behaviour was predicted using the fast running performance code SIMPLE. The code takes into account pellet-cladding interaction due to thermal expansion and swelling, gap conductance, structural changes of fuel pellets, fission product gas release with burnup and temperature increase, swelling and creep of fuel pellets, corrosion of cladding due to sodium flow and chemical attack by fission products, and cumulative damage of the cladding due to thermal creep

  6. Neutron radiography of fuel pins

    International Nuclear Information System (INIS)

    Jackson, C.N. Jr.; Powers, H.G.; Burgess, C.A.

    1975-01-01

    Neutron radiography performed with a reactor source has been shown to be a superior radiographic method for the examination of unirradiated mixed oxide fuel pins at the Hanford Engineering Development Laboratory. Approximately 1,700 fuel pins were contained in a sample that demonstrated the capability of the method for detecting laminations, structural flaws, fissile density variation, hydrogenous inclusions and voids in assembled fuel pins. The nature, extent, and importance of the detected conditions are substantiated by gamma autoradiography and by destructive analysis employing alpha autoradiography, electron microprobe and visual inspection. Also, a series of radiographs illustrate the response of neutron radiography as compared to low voltage and high voltage x-ray and gamma source Iridium 192 radiography. (U.S.)

  7. Mode of failure of LMFBR fuel pins

    International Nuclear Information System (INIS)

    Washburn, D.F.

    1975-01-01

    The objectives of the irradiation test described were to evaluate mixed-oxide fuel performance and to confirm the design adequacy of the FFTF fuel pins. After attainment of the initial objectives the irradiation of several of the original fuel pins was continued until a cladding breach occurred. The consequences of a cladding breach were evaluated by reconstituting the original 37-pin subassembly into two 19-pin subassemblies after a burnup at 50,000 MWd/MTM (5.2 a/o). The original pins were supplemented with fresh pins as necessary. Irradiation of the subassemblies was continued until a cladding breach occurred. Results are presented and discussed

  8. [Contribution of Professor SHI Xue-min's academic thoughts to treatment of stroke].

    Science.gov (United States)

    Liu, Jian; Fan, Xiao-Nong; Wang, Shu

    2014-01-01

    Based on the thought of Zhishen (a kind of mind regulation), Professor SHI Xue-min, academician of the China Academy of Engineering, found the Xingnao Kaiqiao (to refresh the mind and to cause resuscitation) acupuncture method, which still plays an important role in the acupuncture treatment of wind stroke nowadays. Meanwhile, great importance is attached to the comprehensive treatment of wind stroke. Danqi Piantan capsule (see text) is developed and "wind stroke unit" is set up. In recent years, Professor SHI shifts the center of research to the treatment of hypertension, the risk factor of wind stroke. Taking Renying (ST 9) as the major acupoint, acupuncture with standard measurement and manipulations is established. And good clinical effect has been obtained as well. Therefore, this article focuses on the introduction of Professor SHI Xue-min's contribution to wind stroke treatment.

  9. The SPS beam parameters, the operational cycle, and proton sharing with the SHiP facility

    CERN Document Server

    Arduini, Gianluigi; Gatignon, Lau; Cornelis, Karel

    2015-01-01

    The SHiP experiment aims at acquiring a total of 4×1019 protons on target per year. Based on demonstrated SPS performance for CNGS, the expected proton sharing between the TCC2 targets and SHiP is estimated taking into account the constraints in the super-cycle composition. We review the SPS beam parameters, the operational cycles taking into account the concurrent operation of the SPS as LHC injector and for the TCC2 experiments and the limitations on the maximum possible power dissipation and the expected sharing of the protons on target of the SHiP facility with the TCC2 targets. As a typical example this aim could be achieved while maintaining a duty cycle for the other fixed target experiments of about 18%.

  10. TianShuiShi space breeding current situation and developing trend

    International Nuclear Information System (INIS)

    Wang Fuquan; Song Jianrong; Zhang Zhongping; Guo Zhenfang

    2011-01-01

    TianShuiShi is located in xian to lanzhou among two big cities, the five space launch, has vegetables, food, grasses, flowers, rape, melon and fruit, Chinese traditional medicine, amount of 8 categories of crops, such as the 22 new material after carrying the ground breeding work. Only vegetables on identified 23 aerospace new varieties. After ten years of space breeding, summarizes the present situation of TianShuiShi space breeding, development experience, characteristic, trends, and puts forward the development space breeding TianShuiShi organization and breeding of talent from the matching policy and grow up incentive mechanism, strengthen the cooperation and all over the country, establishing fiscal policy support from the aspects such as advice. (authors)

  11. Improved pinning regime by energetic ions using reduction of pinning potential

    Energy Technology Data Exchange (ETDEWEB)

    Weinstein, Roy; Gandini, Alberto; Sawh, Ravi-Persad; Parks, Drew; Mayes, Bill

    2003-05-15

    When ion damage is used to create pinning centers, full columnar pinning centers provide the largest pinning potential, U{sub pin}, but not the greatest J{sub c} or pinned field, B{sub pin}. Some of the characteristics of columnar defects which limit J{sub c} and B{sub pin} are discussed, including reduction of percolation path, and the need for a larger number of columns of damage, for pinning, than are usually estimated. It is concluded that columnar pinning centers are limited to B{sub pin}<4 T, and also severely reduce J{sub c}. Evidence is reviewed that aligned damage, or broken-columnar pinning centers, described herein, can provide orders of magnitude higher J{sub c}, and higher pinned field, despite providing lower U{sub pin}. A pinning center morphology is discussed which utilizes multiple-in-line-damage (MILD). For, e.g., present day large grain HTS J{sub c}, obtainable by MILD pinning, is estimated to be of the order of 10{sup 6} A/cm{sup 2} at 77 K, even when crystal plane alignment and weak links are not improved. Pinned field is increased by over an order of magnitude. An experiment is proposed to confirm these observations, and to directly compare MILD to columnar pinning centers. It will also determine the optimum MILD structure. Other measurements of interest, made possible by the same data set, are described.

  12. Spontaneous hemoperitoneum in pregnancy (SHiP) and endometriosis - A systematic review of the recent literature.

    Science.gov (United States)

    Lier, Marit C I; Malik, Romana F; Ket, Johannes C F; Lambalk, Cornelis B; Brosens, Ivo A; Mijatovic, Velja

    2017-12-01

    Spontaneous Hemoperitoneum in Pregnancy (SHiP), an unprovoked (nontraumatic) intraperitoneal bleeding in pregnancy (up to 42days postpartum), is associated with serious adverse pregnancy outcomes. To evaluate the clinical consequences of SHiP and its association with endometriosis, a systematic review was conducted according to the PRISMA guidelines. PubMed, Embase.com and Thomson Reuters/Web of Science were searched for articles published since the latest review (August 2008) until September 2016. After assessment for eligibility, forty-four articles were included in this systematic review, describing 59 cases of SHiP. Endometriosis was present in 33/59 cases (55.9%), most often diagnosed prior to pregnancy. An association between the severity of SHiP and the stage of endometriosis could not be found. In the majority of cases, SHiP occurred in the third trimester of pregnancy (30/59 cases (50.8%)); women presented with (sub)acute abdominal pain (56/59 cases (94.9%)), hypovolemic shock (28/59 cases (47.5%)) and/or a decreased level of hemoglobin (37/59 cases (62.7%)). Signs of fetal distress were observed in 24/59 cases (40.7%). Imaging confirmed free peritoneal fluid in (37/59 cases (62.7%)). At time of surgery active bleeding was revealed in 51/56 cases (91,1%), originating from endometriotic implants (11/51 cases (21.6%)), ruptured utero-ovarian vessels (29/51 cases (56.8%)), hemorrhagic nodules of decidualized cells (1/51 cases (2.0%)) or a combination (10/51 cases (19.6%)). Median amount of hemoperitoneum was 1600mL (IQR 1000mL-2500mL). From the 45/59 cases (76.3%) in which surgical interventions was carried out during pregnancy, 7/45 cases (15.6%) reported a successful continuation of pregnancy. 5/59 cases reported recurrence of SHiP (recurrence rate 8.5%). The perinatal mortality rate was 26.9% (18/67 fetus), one maternal death was reported (1/59 cases (1,7%)). In conclusion, SHiP is a very serious complication of pregnancy, highly associated with adverse

  13. Multicenter Study of Pin Site Infections and Skin Complications Following Pinning of Pediatric Supracondylar Humerus Fractures.

    Science.gov (United States)

    Combs, Kristen; Frick, Steven; Kiebzak, Gary

    2016-12-03

    Pediatric supracondylar humerus fractures are the most common elbow fractures in pediatric patients. Surgical fixation using pins is the primary treatment for displaced fractures. Pin site infections may follow supracondylar humerus fracture fixation; the previously reported incidence rate in the literature is 2.34%, but there is significant variability in reported incidence rates of pin site infection. This study aims to define the incidence rate and determine pre-, peri-, and postoperative factors that may contribute to pin site infection following operative reduction, pinning, and casting. A retrospective chart analysis was performed over a one-year period on patients that developed pin site infection. A cast care form was added to Nemours' electronic medical records (EMR) system (Epic Systems Corp., Verona, WI) to identify pin site infections for retrospective review. The cast care form noted any inflamed or infected pins. Patients with inflamed or infected pin sites underwent a detailed chart review. Preoperative antibiotic use, number and size of pins used, method of postoperative immobilization, pin dressings, whether postoperative immobilization was changed prior to pin removal, and length of time pins were in place was recorded. A total of 369 patients underwent operative reduction, pinning, and casting. Three patients developed a pin site infection. The pin site infection incidence rate was 3/369=0.81%. Descriptive statistics were reported for the three patients that developed pin site infections and three patients that developed pin site complications. Pin site infection development is low. Factors that may contribute to the development of pin site infection include preoperative antibiotic use, length of time pins are left in, and changing the cast prior to pin removal.

  14. Fuel pin bowing in CAGR

    International Nuclear Information System (INIS)

    Crossland, I.G.

    1982-01-01

    Some of the more important mechanisms by which pin bowing can occur in Advanced Gas Cooled Reactors are examined. These include creep relaxation of the stresses which occur when thermal bowing is restrained and asymmetric axial clad creep. The clad temperature changes which accompany such bowing are also investigated and the theoretical results briefly compared with the empirical behaviour. (author)

  15. Suspension scheme for fuel pin

    International Nuclear Information System (INIS)

    Butts, C.E.; Gray, H.C.

    1975-01-01

    A description is presented of a nuclear fuel pin suspension arrangement comprising, in combination, a rod; a first beam member connected to said rod at one end; a plurality of parallel-spaced slidable fuel support plates attached to said first beam member, the longitudinal axis of first beam member being perpendicular to the longitudinal axis of each of said fuel support plates, a first coupling means disposed along the length of the first beam member for permitting slidable fuel support plates parallel movement with respect to the longitudinal axis of said first beam member, a second coupling means located at one end of each of slidable fuel plates for slidably engaging first coupling means of first beam member, a second beam member connected to the other end of each of parallel-spaced slidable fuel support plates and providing an extension, second beam member being provided with a third coupling means disposed along the length of second beam member at one end thereof; and a plurality of fuel pins provided with a fourth coupling means located at one end of each fuel pin for slidably engaging third coupling means of second beam member to permit each fuel pin parallel movement with respect to the longitudinal axis of second beam member. (U.S.)

  16. Preliminary Evaluation of a Social Skills Training and Facilitated Play Early Intervention Programme for Extremely Shy Young Children in China

    Science.gov (United States)

    Li, Yan; Coplan, Robert J.; Wang, Yuemin; Yin, Jingtong; Zhu, Jingjing; Gao, Zhuqing; Li, Linhui

    2016-01-01

    The goal of this study was to provide a preliminary evaluation of a social skills and facilitated play early intervention programme to promote social interaction, prosocial behaviours and socio-communicative skills among young extremely shy children in China. Participants were a sample of n = 16 extremely shy young children attending kindergarten…

  17. Defining According to Its Essence: An Analysis on the Concept of Tong Shi Education (General Education) in the Native Chinese Context

    Science.gov (United States)

    Lu, Yi; Xu, Yuan

    2018-01-01

    The authors review the concept of Tong Shi (Chinese characters omitted) in ancient Chinese philosophical texts, illustrate the Chinese cultural attributes unique to the characters Tong and Shi, and confirm that the name and essence of Tong Shi Education has a clear directivity and irreplaceable coverage to university general education in…

  18. Etude linguistique chez les Baráshi/Banyaambo du Rwanda ...

    African Journals Online (AJOL)

    Among the main African Languages spoken in Rwanda besides Kinyarwaanda: amashí in the South, olucigá in the North and ikiráshi/ikinyaambo in the East, only olucigá has been particularly described: J.-B. Murekezi (1984), F.-X. Bangamwabo (1989); others are just mentioned in global sociolinguistic studies: B.

  19. Interface reactions between Pd thin films and SiC by thermal annealing and SHI irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Njoroge, E.G., E-mail: eric.njoroge@up.ac.za [Department of Physics, University of Pretoria, Pretoria (South Africa); Theron, C.C. [Department of Physics, University of Pretoria, Pretoria (South Africa); Skuratov, V.A. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Wamwangi, D. [School of Physics, University of Witwatersrand, Johannesburg (South Africa); Hlatshwayo, T.T. [Department of Physics, University of Pretoria, Pretoria (South Africa); Comrie, C.M. [MRD, iThemba LABS, P.O. Box 722, Somerset West 7129 (South Africa); Malherbe, J.B. [Department of Physics, University of Pretoria, Pretoria (South Africa)

    2016-03-15

    The solid-state reactions between Pd thin films and 6H-SiC substrates induced by thermal annealing, room temperature swift heavy ion (SHI) irradiation and high temperature SHI irradiation have been investigated by in situ and real-time Rutherford backscattering spectrometry (RBS) and Grazing incidence X-ray diffraction (GIXRD). At room temperature, no silicides were detected to have formed in the Pd/SiC samples. Two reaction growth zones were observed in the samples annealed in situ and analysed by real time RBS. The initial reaction growth region led to formation of Pd{sub 3}Si or (Pd{sub 2}Si + Pd{sub 4}Si) as the initial phase(s) to form at a temperature of about 450 °C. Thereafter, the reaction zone did not change until a temperature of 640 °C was attained where Pd{sub 2}Si was observed to form in the reaction zone. Kinetic analysis of the initial reaction indicates very fast reaction rates of about 1.55 × 10{sup 15} at cm{sup −2}/s and the Pd silicide formed grew linear with time. SHI irradiation of the Pd/SiC samples was performed by 167 MeV Xe{sup 26+} ions at room temperature at high fluences of 1.07 × 10{sup 14} and 4 × 10{sup 14} ions/cm{sup 2} and at 400 °C at lower fluences of 5 × 10{sup 13} ions/cm{sup 2}. The Pd/SiC interface was analysed by RBS and no SHI induced diffusion was observed for room temperature irradiations. The sample irradiated at 400 °C, SHI induced diffusion was observed to occur accompanied with the formation of Pd{sub 4}Si, Pd{sub 9}Si{sub 2} and Pd{sub 5}Si phases which were identified by GIXRD analysis.

  20. Overexpression of the AtSHI gene in poinsettia, Euphorbia pulcherrima, results in compact plants.

    Directory of Open Access Journals (Sweden)

    M Ashraful Islam

    Full Text Available Euphorbia pulcherrima, poinsettia, is a non-food and non-feed vegetatively propagated ornamental plant. Appropriate plant height is one of the most important traits in poinsettia production and is commonly achieved by application of chemical growth retardants. To produce compact poinsettia plants with desirable height and reduce the utilization of growth retardants, the Arabidopsis SHORT INTERNODE (AtSHI gene controlled by the cauliflower mosaic virus 35S promoter was introduced into poinsettia by Agrobacterium-mediated transformation. Three independent transgenic lines were produced and stable integration of transgene was verified by PCR and Southern blot analysis. Reduced plant height (21-52% and internode lengths (31-49% were obtained in the transgenic lines compared to control plants. This correlates positively with the AtSHI transcript levels, with the highest levels in the most dwarfed transgenic line (TL1. The indole-3-acetic acid (IAA content appeared lower (11-31% reduction in the transgenic lines compared to the wild type (WT controls, with the lowest level (31% reduction in TL1. Total internode numbers, bract numbers and bract area were significantly reduced in all transgenic lines in comparison with the WT controls. Only TL1 showed significantly lower plant diameter, total leaf area and total dry weight, whereas none of the AtSHI expressing lines showed altered timing of flower initiation, cyathia abscission or bract necrosis. This study demonstrated that introduction of the AtSHI gene into poinsettia by genetic engineering can be an effective approach in controlling plant height without negatively affecting flowering time. This can help to reduce or avoid the use of toxic growth retardants of environmental and human health concern. This is the first report that AtSHI gene was overexpressed in poinsettia and transgenic poinsettia plants with compact growth were produced.

  1. Pinning synchronization of a mobile agent network

    International Nuclear Information System (INIS)

    Wang, Lei; Sun, You-xian

    2009-01-01

    We investigate the problem of controlling a group of mobile agents in a plane in order to move them towards a desired orbit via pinning control, in which each agent is associated with a chaotic oscillator coupled with those of neighboring agents, and the pinning strategy is to have the common linear feedback acting on a small fraction of agents by random selection. We explore the effects of the pinning probability, feedback gains and agent density in the pinning synchronization of a mobile agent network under a fast-switching constraint, and perform numerical simulations for validation. In particular, we show that there exists a critical pinning density for network synchronization with an unbounded region: above the threshold, the dynamical network can be controlled by pinning; below it, anarchy prevails. And for the network with a single bounded synchronization region, pinning control has little effect as regards enhancing network synchronizability

  2. Design of a detector to study associated charm production in the SHiP beam dump facility

    CERN Document Server

    Iuliano, Antonio; Di Crescenzo, Antonia

    A dedicated experiment has been proposed by the SHiP Collaboration, to study associated charm production and decay of charmed hadrons. In this thesis we report the first design of such an experiment. This work has been carried out within the Naples neutrino group that participates to the SHiP experiment. The aim of the experiment designed in this thesis is to measure the differential associated charm production cross sections with respect to the angular and energy spectra of charmed particles. This measurement could give the acceptance of the SHiP detector for hidden particles and tau neutrinos, which are produced from charmed hadron decays.

  3. Unicortical self-drilling external fixator pins reduce thermal effects during pin insertion.

    Science.gov (United States)

    Greinwald, Markus; Varady, Patrick A; Augat, Peter

    2017-12-14

    External fixation is associated with the risk of pin loosening and pin infection potentially associated to thermal bone necrosis during pin insertion. This study aims to investigate if the use of external fixator systems with unicortical pins reduces the heat production during pin insertion compared to fixators with bicortical pins. Porcine bone specimens were employed to determine bone temperatures during insertion of fixator pins. Two thermographic cameras were used for a simultaneous temperature measurement on the bone surface (top view) and a bone cross-section (front view). Self-drilling unicortical and bicortical pins were inserted at different rotational speeds: (30-600) rpm. Maximum and mean temperatures of the emerging bone debris, bone surface and bone cross-section were analyzed. Maximum temperatures of up to 77 ± 26 °C were measured during pin insertion in the emerging debris and up to 42 ± 2 °C on the bone surface. Temperatures of the emerging debris increased with increasing rotational speeds. Bicortical pin insertion generated significantly higher temperatures at low insertion speed (30 rpm) CONCLUSION: The insertion of external fixator pins can generate a considerable amount of heat around the pins, primarily emerging from bone debris and at higher insertion speeds. Our findings suggest that unicortical, self-drilling fixator pins have a decreased risk for thermal damage, both to the surrounding tissue and to the bone itself.

  4. Spectroscopic amplifier for pin diode; Amplificador espectroscopico para diodo Pin

    Energy Technology Data Exchange (ETDEWEB)

    Alonso M, M. S.; Hernandez D, V. M.; Vega C, H. R., E-mail: bebe.luna_s@hotmail.com [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas (Mexico)

    2014-10-15

    The photodiode remains the basic choice for the photo-detection and is widely used in optical communications, medical diagnostics and field of corpuscular radiation. In detecting radiation it has been used for monitoring radon and its progeny and inexpensive spectrometric systems. The development of a spectroscopic amplifier for Pin diode is presented which has the following characteristics: canceler Pole-Zero (P/Z) with a time constant of 8 μs; constant gain of 57, suitable for the acquisition system; 4th integrator Gaussian order to waveform change of exponential input to semi-Gaussian output and finally a stage of baseline restorer which prevents Dc signal contribution to the next stage. The operational amplifier used is the TLE2074 of BiFET technology of Texas Instruments with 10 MHz bandwidth, 25 V/μs of slew rate and a noise floor of 17 nv/(Hz)1/2. The integrated circuit has 4 operational amplifiers and in is contained the total of spectroscopic amplifier that is the goal of electronic design. The results show like the exponential input signal is converted to semi-Gaussian, modifying only the amplitude according to the specifications in the design. The total system is formed by the detector, which is the Pin diode, a sensitive preamplifier to the load, the spectroscopic amplifier that is what is presented and finally a pulse height analyzer (Mca) which is where the spectrum is shown. (Author)

  5. Pin Wire Coating Trip Report

    International Nuclear Information System (INIS)

    Spellman, G P

    2004-01-01

    A meeting to discuss the current pin wire coating problems was held at the Reynolds plant in Los Angeles on 2MAR04. The attendance list for Reynolds personnel is attached. there was an initial presentation which gave a brief history and the current status of pin wire coating at Reynolds. There was a presentation by Lori Primus on the requirements and issues for the coating. There was a presentation by Jim Smith of LANL on the chemistry and to some extent process development done to date. There was a long session covering what steps should be taken in the short term and, to a lesser extent, the long term. The coating currently being used is a blend of two polymers, polyethersulfone and polyparabanic acid (PPA) and some TiO2 filler. This system was accepted and put into production when the pin wire coating was outsourced to another company in 1974. When that company no longer was interested, the wire coating was brought in-house to Reynolds. At that time polyparabanic acid was actually a commercial product available from Exxon under the trade name Tradlon. However, it appears that the material used at Reynolds was synthesized locally. Also, it appears that a single large batch was synthesized in that time period and used up to 1997 when the supply ran out. The reason for the inclusion of TiO2 is not known although it does act as a rheological thickener. However, a more controlled thickening can be obtained with materials such as fumed silica. This material would have less likelihood of causing point imperfections in the coatings. Also, the mixing technique being used for all stages of the process is a relatively low shear ball mill process and the author recommends a high shear process such as a three roll paint mill, at least for the final mixing. Since solvent is added to the powder at Reynolds, it may be that they need to have the paint mill there

  6. Transient survivability of LMR oxide fuel pins

    International Nuclear Information System (INIS)

    Weber, E.T.; Pitner, A.L.; Bard, F.E.; Culley, G.E.; Hunter, C.W.

    1986-01-01

    Fuel pin integrity during transient events must be assessed for both the core design and safety analysis phases of a reactor project. A significant increase in the experience related to limits of integrity for oxide fuel pins in transient overpower events has been realized from testing of fuel pins irradiated in FFTF and PFR. Fourteen FFTF irradiated fuel pins were tested in TREAT, representing a range of burnups, overpower ramp rates and maximum overpower conditions. Results of these tests along with similar testing in the PFR/TREAT program, provide a demonstration of significant safety margins for oxide fuel pins. Useful information applied in analytical extrapolation of fuel pin test data have been developed from laboratory transient tests on irradiated fuel cladding (FCTT) and on unirradiated fuel pellet deformation. These refinements in oxide fuel transient performance are being applied in assessment of transient capabilities of long lifetime fuel designs using ferritic cladding

  7. Cesium migration in LMFBR fuel pins

    International Nuclear Information System (INIS)

    Karnesky, R.A.; Jost, J.W.; Stone, I.Z.

    1978-10-01

    The factors affecting the axial migration of cesium in mixed oxide fuel pins and the effects of cesium migration on fuel pin performance are examined. The development and application of a correlated model which will predict the occurrence of cesium migration in a mixed oxide (75 w/o UO 2 + 25 w/o PuO 2 ) fuel pins over a wide range of fabrication and irradiation conditions are described

  8. ν{sub τ}-physics with the SHiP experiment

    Energy Technology Data Exchange (ETDEWEB)

    Bick, Daniel; Bieschke, Stefan; Ebert, Joachim; Hagner, Caren; Schmidt-Parzefall, Walter [Universitaet Hamburg, Institut fuer Experimentalphysik, Luruper Chaussee 149, 22761 Hamburg (Germany)

    2016-07-01

    SHiP stands for Search for Hidden Particles and is a recently proposed new general-purpose fixed target facility at the SPS at CERN. The main aim is the search for hidden particles predicted by different models capable of explaining dark matter, neutrino masses or the origin of baryon asymmetry in the Universe. Furthermore, a huge number of (τ-)neutrinos will be produced at such a facility making it an ideal place for ν{sub τ}-physics and thus giving the opportunity for a measurement of the τ-neutrino cross-sections or a first-time experimental evidence of the anti-τ-neutrino. This talk will give an overview of the neutrino experiment at the SHiP experiment. An emphasis is given to the reconstruction of muons from interactions in the neutrino target using a magnetic spectrometer.

  9. Overexpression of the AtSHI gene in poinsettia, Euphorbia pulcherrima, results in compact plants

    DEFF Research Database (Denmark)

    Islam, M. Ashraful; Lütken, Henrik Vlk; Haugslien, Sissel

    2013-01-01

    of the AtSHI gene into poinsettia by genetic engineering can be an effective approach in controlling plant height without negatively affecting flowering time. This can help to reduce or avoid the use of toxic growth retardants of environmental and human health concern. This is the first report that At......Euphorbia pulcherrima, poinsettia, is a non-food and non-feed vegetatively propagated ornamental plant. Appropriate plant height is one of the most important traits in poinsettia production and is commonly achieved by application of chemical growth retardants. To produce compact poinsettia plants...... integration of transgene was verified by PCR and Southern blot analysis. Reduced plant height (21–52%) and internode lengths (31–49%) were obtained in the transgenic lines compared to control plants. This correlates positively with the AtSHI transcript levels, with the highest levels in the most dwarfed...

  10. FFTF fuel pin design bases and performance

    International Nuclear Information System (INIS)

    Cox, C.M.; Hanson, J.E.; Roake, W.E.; Slember, R.J.; Weber, C.E.; Millunzi, A.C.

    1975-04-01

    The FFTF fuel pin was conservatively designed to meet thermal and structural performance requirements in the categories normal operation, upset events, emergency events, and hypothetical, faulted events. The fuel pin operating limits consistent with these requirements were developed from a strong fuel pin irradiation testing program scoped to define the performance capability under relevant steady state and transient conditions. Comparison of the results of the irradiation testing program with design requirements indicates that the FFTF fuel pin can exceed its goal burnup of 80,000 MWd/MTM. (U.S.)

  11. Integral Fast Reactor fuel pin processor

    International Nuclear Information System (INIS)

    Levinskas, D.

    1993-01-01

    This report discusses the pin processor which receives metal alloy pins cast from recycled Integral Fast Reactor (IFR) fuel and prepares them for assembly into new IFR fuel elements. Either full length as-cast or precut pins are fed to the machine from a magazine, cut if necessary, and measured for length, weight, diameter and deviation from straightness. Accepted pins are loaded into cladding jackets located in a magazine, while rejects and cutting scraps are separated into trays. The magazines, trays, and the individual modules that perform the different machine functions are assembled and removed using remote manipulators and master-slaves

  12. Magnetic pinning in superconductor-ferromagnet multilayers

    International Nuclear Information System (INIS)

    Bulaevskii, L. N.; Chudnovsky, E. M.; Maley, M. P.

    2000-01-01

    We argue that superconductor/ferromagnet multilayers of nanoscale period should exhibit strong pinning of vortices by the magnetic domain structure in magnetic fields below the coercive field when ferromagnetic layers exhibit strong perpendicular magnetic anisotropy. The estimated maximum magnetic pinning energy for single vortex in such a system is about 100 times larger than the pinning energy by columnar defects. This pinning energy may provide critical currents as high as 10 6 -10 7 A/cm 2 at high temperatures (but not very close to T c ) at least in magnetic fields below 0.1 T. (c) 2000 American Institute of Physics

  13. Magnetic pinning in superconductor-ferromagnet multilayers

    Energy Technology Data Exchange (ETDEWEB)

    Bulaevskii, L. N. [Department of Physics and Astronomy, CUNY Lehman College 250 Bedford Park Boulevard West, Bronx, New York 10468-1589 (United States); Los Alamos National Laboratory, Los Alamos, New Mexico 87545 (United States); Chudnovsky, E. M. [Department of Physics and Astronomy, CUNY Lehman College, 250 Bedford Park Boulevard West, Bronx, New York 10468-1589 (United States); Maley, M. P. [Los Alamos National Laboratory, Los Alamos, New Mexico 87545 (United States)

    2000-05-01

    We argue that superconductor/ferromagnet multilayers of nanoscale period should exhibit strong pinning of vortices by the magnetic domain structure in magnetic fields below the coercive field when ferromagnetic layers exhibit strong perpendicular magnetic anisotropy. The estimated maximum magnetic pinning energy for single vortex in such a system is about 100 times larger than the pinning energy by columnar defects. This pinning energy may provide critical currents as high as 10{sup 6}-10{sup 7} A/cm{sup 2} at high temperatures (but not very close to T{sub c}) at least in magnetic fields below 0.1 T. (c) 2000 American Institute of Physics.

  14. Fabrication of FFTF fuel pin wire wrap

    International Nuclear Information System (INIS)

    Epperson, E.M.

    1980-06-01

    Lateral spacing between FFTF fuel pins is required to provide a passageway for the sodium coolant to flow over each pin to remove heat generated by the fission process. This spacing is provided by wrapping each fuel pin with type 316 stainless steel wire. This wire has a 1.435mm (0.0565 in.) to 1.448mm (0.0570 in.) diameter, contains 17 +- 2% cold work and was fabricated and tested to exacting RDT Standards. About 500 kg (1100 lbs) or 39 Km (24 miles) of fuel pin wrap wire is used in each core loading. Fabrication procedures and quality assurance tests are described

  15. Addendum to Technical Proposal: A Facility to Search for Hidden Particles (SHiP) at the CERN SPS

    CERN Document Server

    SHiP Collaboration

    2015-01-01

    With the Technical Proposal submitted to the SPSC committee in April 2015, the SHiP collaboration declared its interest in proceeding towards a Comprehensive Design Study phase with the aim of preparing for the Technical Design Reports pending an approval by the CERN committees. Following the recommendation by the SPSC, it has been decided to complement the TP with this addendum that provides an update of the key aspects for the review of the SHiP project.

  16. Spectroscopic amplifier for pin diode

    International Nuclear Information System (INIS)

    Alonso M, M. S.; Hernandez D, V. M.; Vega C, H. R.

    2014-10-01

    The photodiode remains the basic choice for the photo-detection and is widely used in optical communications, medical diagnostics and field of corpuscular radiation. In detecting radiation it has been used for monitoring radon and its progeny and inexpensive spectrometric systems. The development of a spectroscopic amplifier for Pin diode is presented which has the following characteristics: canceler Pole-Zero (P/Z) with a time constant of 8 μs; constant gain of 57, suitable for the acquisition system; 4th integrator Gaussian order to waveform change of exponential input to semi-Gaussian output and finally a stage of baseline restorer which prevents Dc signal contribution to the next stage. The operational amplifier used is the TLE2074 of BiFET technology of Texas Instruments with 10 MHz bandwidth, 25 V/μs of slew rate and a noise floor of 17 nv/(Hz)1/2. The integrated circuit has 4 operational amplifiers and in is contained the total of spectroscopic amplifier that is the goal of electronic design. The results show like the exponential input signal is converted to semi-Gaussian, modifying only the amplitude according to the specifications in the design. The total system is formed by the detector, which is the Pin diode, a sensitive preamplifier to the load, the spectroscopic amplifier that is what is presented and finally a pulse height analyzer (Mca) which is where the spectrum is shown. (Author)

  17. Study of nu-tau properties with the SHiP experiment

    CERN Document Server

    AUTHOR|(CDS)2209555

    The SHiP experiment (Search for Hidden Particles) is a beam dump experiment proposed at the CERN SPS with the submission of a Technical Proposal in April 2015. SHiP aims at the observation of long lived particles very weakly coupled with ordinary matter. These particles are mostly produced in the decay of charmed hadrons whose production is therefore enhanced through the definition of the characteristics of both the beam and the proton target. This makes the SHiP experiment a Standard Model neutrino factory too, in particular of tau neutrinos produced by the Ds decay chain. My studies have mainly focused on the design of the neutrino detector and on the evaluation of its performances. The Neutrino Detector is placed in a magnetic field and it exploits the Emulsion Cloud Chamber Technology with the micrometric position resolution needed to disentangle the tau lepton decay vertex from the neutrino interaction vertex. This peculiarity, together with the high electron identification efficiency, makes this det...

  18. Development of a Summarized Health Index (SHI for use in predicting survival in sea turtles.

    Directory of Open Access Journals (Sweden)

    Tsung-Hsien Li

    Full Text Available Veterinary care plays an influential role in sea turtle rehabilitation, especially in endangered species. Physiological characteristics, hematological and plasma biochemistry profiles, are useful references for clinical management in animals, especially when animals are during the convalescence period. In this study, these factors associated with sea turtle surviving were analyzed. The blood samples were collected when sea turtles remained alive, and then animals were followed up for surviving status. The results indicated that significantly negative correlation was found between buoyancy disorders (BD and sea turtle surviving (p < 0.05. Furthermore, non-surviving sea turtles had significantly higher levels of aspartate aminotranspherase (AST, creatinine kinase (CK, creatinine and uric acid (UA than surviving sea turtles (all p < 0.05. After further analysis by multiple logistic regression model, only factors of BD, creatinine and UA were included in the equation for calculating summarized health index (SHI for each individual. Through evaluation by receiver operating characteristic (ROC curve, the result indicated that the area under curve was 0.920 ± 0.037, and a cut-off SHI value of 2.5244 showed 80.0% sensitivity and 86.7% specificity in predicting survival. Therefore, the developed SHI could be a useful index to evaluate health status of sea turtles and to improve veterinary care at rehabilitation facilities.

  19. Reduction of halo pin site morbidity with a new pin care regimen.

    Science.gov (United States)

    Kazi, Hussain Anthony; de Matas, Marcus; Pillay, Robin

    2013-06-01

    A retrospective analysis of halo device associated morbidity over a 4-year period. To assess the impact of a new pin care regimen on halo pin site related morbidity. Halo orthosis treatment still has a role in cervical spine pathology, despite increasing possibilities of open surgical treatment. Published figures for pin site infection range from 12% to 22% with pin loosening from 7% to 50%. We assessed the outcome of a new pin care regimen on morbidity associated with halo spinal orthoses, using a retrospective cohort study from 2001 to 2004. In the last two years, our pin care regimen was changed. This involved pin site care using chlorhexidene & regular torque checking as part of a standard protocol. Previously, povidone iodine was used as skin preparation in theatre, followed by regular sterile saline cleansing when pin sites became encrusted with blood. There were 37 patients in the series, the median age was 49 (range, 22-83) and 20 patients were male. The overall infection rate prior to the new pin care protocol was 30% (n=6) and after the introduction, it dropped to 5.9% (n=1). This difference was statistically significant (p<0.05). Pin loosening occurred in one patient in the group prior to the formal pin care protocol (3%) and none thereafter. Reduced morbidity from halo use can be achieved with a modified pin cleansing and tightening regimen.

  20. Phosphorylation of conserved PIN motifs directs Arabidopsis PIN1 polarity and auxin transport

    NARCIS (Netherlands)

    Huang, F.; Kemel Zago, M.; Abas, L.; van Marion, A.; Galván-Ampudia, C.S.; Offringa, R.

    2010-01-01

    Polar cell-to-cell transport of auxin by plasma membrane-localized PIN-FORMED (PIN) auxin efflux carriers generates auxin gradients that provide positional information for various plant developmental processes. The apical-basal polar localization of the PIN proteins that determines the direction of

  1. Modal approach for nonlinear vibrations of damped impacted plates: Application to sound synthesis of gongs and cymbals

    Science.gov (United States)

    Ducceschi, M.; Touzé, C.

    2015-05-01

    This paper presents a modal, time-domain scheme for the nonlinear vibrations of perfect and imperfect plates. The scheme can take into account a large number of degrees-of-freedom and is energy-conserving. The targeted application is the sound synthesis of cymbals and gong-like musical instruments, which are known for displaying a strongly nonlinear vibrating behaviour. This behaviour is typical of a wave turbulence regime, in which the wide-band spectrum of excited modes is observable in the form of an energy cascade. The modal method is selected for its versatility in handling complex damping laws that can be implemented easily by selecting appropriate damping values in each one of the modal equations. In the first part of the paper, the modal method is explained in its generality, and it will be seen that the method is valid for plates with arbitrary geometry and boundary conditions as long as the eigenmodes are known. Secondly, a time-integration, energy-conserving scheme for perfect and imperfect plates is presented, and implementation comments are given in order to treat efficiently the high-dimensionality of the resulting dynamical system. The scheme is run with appropriate parameters in order to produce sound samples. A simple impact law is considered for the excitation, whereas the flexibility of the method is highlighted by showing simulations for free-edge circular plates and simply-supported rectangular plates, together with various damping laws.

  2. Synchronizability on complex networks via pinning control

    Indian Academy of Sciences (India)

    Keywords. Complex network; the pinning synchronization; synchronizability. ... The findings reveal the relationship between the decreasing speed of maximum eigenvalue sequence of the principal submatrices for coupling matrix and the synchronizability on complex networks via pinning control. We discuss the ...

  3. Breached-pin testing in the US

    International Nuclear Information System (INIS)

    Mahagin, D.E.; Lambert, J.D.B.

    1981-04-01

    Experience gained at EBR-II by the late 1970's from a significant number of failures in experimental fuel-pin irradiations forms the basis of a program directed towards the characterization of breached pins. The questions to be answered and the issues raised by further testing are discussed

  4. TACO: fuel pin performance analysis

    International Nuclear Information System (INIS)

    Stoudt, R.H.; Buchanan, D.T.; Buescher, B.J.; Losh, L.L.; Wilson, H.W.; Henningson, P.J.

    1977-08-01

    The thermal performance of fuel in an LWR during its operational lifetime must be described for LOCA analysis as well as for other safety analyses. The determination of stored energy in the LOCA analysis, for example, requires a conservative fuel pin thermal performance model that is capable of calculating fuel and cladding behavior, including the gap conductance between the fuel and cladding, as a function of burnup. The determination of parameters that affect the fuel and cladding performance, such as fuel densification, fission gas release, cladding dimensional changes, fuel relocation, and thermal expansion, should be accounted for in the model. Babcock and Wilcox (B and W) has submitted a topical report, BAW-10087P, December 1975, which describes their thermal performance model TACO. A summary of the elements that comprise the TACO model and an evaluation are presented

  5. Incommensurate pinning mechanism in KCP

    International Nuclear Information System (INIS)

    Apostol, M.; Baldea, I.

    1984-07-01

    A new pinning mechanism (termed incommensurate) is put forward for K 2 Pt(CN) 4 Brsub(0.3)x3.2H 2 O(KCP) based on the Q-quasi-modulated distribution of the bromine anions (Br-bar) along the chain axis (Q/2 being the Fermi momentum reduced to the first Brillouin zone). The different origins of the direct current (d.c.) thermally-activated gap and optical gap are thereby explained. The spectrum of the collective excitations (amplitudons and phasons) and the dielectric function are calculated for the charge density wave (CDW) state. Fair agreement is obtained with the optical and neutron scattering data. (author)

  6. Pinning impulsive control algorithms for complex network

    International Nuclear Information System (INIS)

    Sun, Wen; Lü, Jinhu; Chen, Shihua; Yu, Xinghuo

    2014-01-01

    In this paper, we further investigate the synchronization of complex dynamical network via pinning control in which a selection of nodes are controlled at discrete times. Different from most existing work, the pinning control algorithms utilize only the impulsive signals at discrete time instants, which may greatly improve the communication channel efficiency and reduce control cost. Two classes of algorithms are designed, one for strongly connected complex network and another for non-strongly connected complex network. It is suggested that in the strongly connected network with suitable coupling strength, a single controller at any one of the network's nodes can always pin the network to its homogeneous solution. In the non-strongly connected case, the location and minimum number of nodes needed to pin the network are determined by the Frobenius normal form of the coupling matrix. In addition, the coupling matrix is not necessarily symmetric or irreducible. Illustrative examples are then given to validate the proposed pinning impulsive control algorithms

  7. Resistance projection welding small pins in vacuum tube feedthrough assembly

    International Nuclear Information System (INIS)

    Kuncz, F. Jr.

    1980-01-01

    Resistance projection welding of two stainless steel pins to a cup is successfully accomplished by specially designed electrodes and by forming domes on the pin ends. Details of electrode and pin construction are given, as well as welding parameters

  8. Pin fin compliant heat sink with enhanced flexibility

    Science.gov (United States)

    Schultz, Mark D.

    2018-04-10

    Heat sinks and methods of using the same include a top and bottom plate, at least one of which has a plurality of pin contacts flexibly connected to one another, where the plurality of pin contacts have vertical and lateral flexibility with respect to one another; and pin slice layers, each having multiple pin slices, arranged vertically between the top and bottom plates such that the plurality of pin slices form substantially vertical pins connecting the top and bottom plates.

  9. Cesium chemistry in GCFR fuel pins

    International Nuclear Information System (INIS)

    Fee, D.C.; Johnson, C.E.

    1979-01-01

    The fuel rod design for the Gas Cooled Fast-Breeder Reactor (GCFR) is similar to that employed for the Liquid Metal Fast Breeder Reactor (LMFBR) with the exception of the unique features inherent to the use of helium as the coolant. These unique design features include the use of (1) vented and pressure-equalized fuel rods, and (2) ribbed cladding along 75% of the fuel section. The former design feature enables reduction in cladding thickness and prevention of possible creep collapse of the cladding due to the high coolant pressure (8.5 MPa). The latter design feature brings about improved heat transfer characteristics. Each GCFR fuel rod is vented to a manifold whereby gaseous fission products diffusing out of the fuel pin are retained on charcoal traps. As a result, the internal pressure of a GCFR fuel pin does not increase during irradiation. In addition, the venting system also maintains the pressure within the fuel pin slightly below (0.3 to 0.5 MPa) the coolant pressure outside the fuel pin. Consequently, should a breach occur in the cladding, helium flows into the breached fuel pin thereby minimizing fission product contamination of the coolant. These desirable aspects of a GCFR fuel pin can be maintained only as long as axial gas transport paths are available and operating within the fuel pin

  10. Vortex lattice melting, pinning and kinetics

    International Nuclear Information System (INIS)

    Doniach, S.; Ryu, S.; Kapitulnik, A.

    1994-01-01

    The phenomenology of the high T c superconductors is discussed both at the level of the thermodynamics of melting of the Abrikosov flux lattice and in terms of the melting and kinetics of the flux lattice for a pinned system. The authors review results on 3D melting obtained by a Monte Carlo simulation approach in which the 2D open-quotes pancakeclose quotes vortices are treated as statistical variables. The authors discuss pinning in the context of the strong pinning regime in which the vortex density given in terms of the applied field B is small compared to that represented by an effective field B pin measuring the pinning center density. The authors introduce a new criterion for the unfreezing of a vortex glass on increase of magnetic field or temperature, in the strong pinning, small field unit. The authors model this limit in terms of a single flux line interacting with a columnar pin. This model is studied both analytically and by computer simulation. By applying a tilt potential, the authors study the kinetics of the vortex motion in an external current and show that the resulting current-voltage characteristic follows a basic vortex glass-like scaling relation in the vicinity of the depinning transition

  11. Computer simulation of vortex pinning in type II superconductors. II. Random point pins

    International Nuclear Information System (INIS)

    Brandt, E.H.

    1983-01-01

    Pinning of vortices in a type II superconductor by randomly positioned identical point pins is simulated using the two-dimensional method described in a previous paper (Part I). The system is characterized by the vortex and pin numbers (N/sub v/, N/sub p/), the vortex and pin interaction ranges (R/sub v/, R/sub p/), and the amplitude of the pin potential A/sub p/. The computation is performed for many cases: dilute or dense, sharp or soft, attractive or repulsive, weak or strong pins, and ideal or amorphous vortex lattice. The total pinning force F as a function of the mean vortex displacment X increases first linearly (over a distance usually much smaller than the vortex spacing and than R/sub p/) and then saturates, fluctuating about its averaging F-bar. We interpret F-bar as the maximum pinning force j/sub c/B of a large specimen. For weak pins the prediction of Larkin and Ovchinnikov for two-dimensional collective pinning is confirmed: F-bar = const. iW/R/sub p/c 66 , where W-bar is the mean square pinning force and c 66 is the shear modulus of the vortex lattice. If the initial vortex lattice is chosen highly defective (''amorphous'') the constant is 1.3--3 times larger than for the ideal triangular lattice. This finding may explain the often observed ''history effect.'' The function F-bar(A/sub p/) exhibits a jump, which for dilute, sharp, attractive pins occurs close to the ''threshold value'' predicted for isolated pins by Labusch. This jump reflects the onset of plastic deformation of the vortex lattice, and in some cases of vortex trapping, but is not a genuine threshold

  12. Electro-optical fuel pin identification system

    International Nuclear Information System (INIS)

    Kirchner, T.L.

    1978-09-01

    A prototype Electro-Optical Fuel Pin Identification System referred to as the Fuel Pin Identification System (FPIS) has been developed by the Hanford Engineering Development Laboratory (HEDL) in support of the Fast Flux Test Facility (FFTF) presently under construction at HEDL. The system is designed to remotely read an alpha-numeric identification number that is roll stamped on the top of the fuel pin end cap. The prototype FPIS consists of four major subassemblies: optical read head, digital compression electronics, video display, and line printer

  13. Flux pinning characteristics of YBCO coated conductor

    International Nuclear Information System (INIS)

    Matsushita, T.; Watanabe, T.; Fukumoto, Y.; Yamauchi, K.; Kiuchi, M.; Otabe, E.S.; Kiss, T.; Watanabe, T.; Miyata, S.; Ibi, A.; Muroga, T.; Yamada, Y.; Shiohara, Y.

    2005-01-01

    Flux pinning properties of PLD-processed YBCO coated conductors deposited on IBAD substrate are investigated. The thickness of YBCO layer is changed in the range of 0.27-1.0 μm. The thickness dependence of critical current density, n-value and irreversibility field are measured in a wide range of magnetic field. The results are compared with the theoretical flux creep-flow model. It is found that these pinning properties are strongly influenced by the thickness as well as the pinning strength. Optimum condition for high field application of this superconductor is discussed

  14. [A review for a traditional Chinese medical journal Shou Shi Yi Bao].

    Science.gov (United States)

    Xiao, Mei-Hua; Sun, Wen-Zhong

    2009-06-01

    Shou Shi Yi Bao was a journal of traditional Chinese medicine (TCM) during the period from 1935 to 1937, and was originated by Chen Huan-yun, a TCM physician in Suzhou. It is mainly to transmit the knowledge of TCM and to promote the epidemic prevention capacity of local public. The editorial characteristics and historical value of the journal were explored in initial background, staff writers, editorial policies, contents and the Editor Chen's medical ideas. Shou Shi Yi Bao was supported by many famous TCM physicians, although the journal was originated from the civil society. It was an academic TCM journal with perfect practicability for orientating to the public and highlighting the academic spirit. Chen Huan-yun was a resolute defender of TCM, and had many opinions on clinical practice and lots of scientific suggestions on TCM development. Shou Shi Yi Bao reflected the main characteristics of TCM journals in 1930s. The journal was one of the important documents to study the TCM history during the period of the Republic of China in Jiangsu Province, and it also set a stage for the struggle between TCM and Western medicine at that time. The documentary information of the journal has literature and history values in reflecting the historical process of TCM self-improvement. The success of the journal was due to not only the broken-up sectarian bias and cooperation of the TCM practitioners but also the preponderant geographic and cultural circumstances of Suzhou as well as Chen Huan-yun's profound knowledge in traditional Chinese culture and medicine.

  15. SHiP: a new facility to search for heavy neutrinos and study $\

    CERN Document Server

    De Serio, Marilisa

    2016-01-01

    SHiP (Search for Hidden Particles) is a newly designed fixed target facility, proposed at the CERN SPS accelerator, with the aim of complementing searches for New Physics at LHC by searching for light long-lived exotic particles with masses below a few GeV/c2. The sensitivity to Heavy Neutrinos will allow for the first time probing a region of the parameter space where Baryogenesis and active neutrino masses and oscillation could also be explained. A dedicated detector, based on OPERA-like bricks, will provide the first observation of the tau anti-neutrino. Moreover, $\

  16. [Shi Weishan, the pioneer of the western medicine in Hubei in the Late Qing Dynasty].

    Science.gov (United States)

    Liu, F W

    2017-07-28

    The Englishman Shi Weishan (Frederick Porter Smith) is the first Christianity medical missionary sent to Central China, who is also the founder of the first mission hospital named 'Hospital of Universal Love' in Hubei. Arrived at Hankou in May 1864, he started medical work in July, and left Hankou in December 1870 because of health problem. In addition to medical mission, he tried to communicate with Chinese doctors in Hankou, then enlightened local people with health knowledge by written several books and articles, which brought some success. He also devoted to the translation of Chinese proper names and also wrote related book.

  17. Etude linguistique chez les Baráshi/Banyaambo du Rwanda

    African Journals Online (AJOL)

    User

    ont quitté le Nkóle et ont gagné le Mutára, puis le Mubarí qui est une large bande frontalière située au nord du lac Ihema jouxtant la région tanzanienne de Karágwe. Puis le mouvement s'est poursuivi vers le sud, ce qui explique donc la présence aujourd'hui d'une communauté Baráshi/Banyaambo au. Gisaká autour des ...

  18. Evaluation of the Chinese Fine Spatial Resolution Hyperspectral Satellite TianGong-1 in Urban Land-Cover Classification

    Directory of Open Access Journals (Sweden)

    Xueke Li

    2016-05-01

    Full Text Available The successful launch of the Chinese high spatial resolution hyperspectral satellite TianGong-1 (TG-1 opens up new possibilities for applications of remotely-sensed satellite imagery. One of the main goals of the TG-1 mission is to provide observations of surface attributes at local and landscape spatial scales to map urban land cover accurately using the hyperspectral technique. This study attempted to evaluate the TG-1 datasets for urban feature analysis, using existing data over Beijing, China, by comparing the TG-1 (with a spatial resolution of 10 m to EO-1 Hyperion (with a spatial resolution of 30 m. The spectral feature of TG-1 was first analyzed and, thus, finding out optimal hyperspectral wavebands useful for the discrimination of urban areas. Based on this, the pixel-based maximum likelihood classifier (PMLC, pixel-based support vector machine (PSVM, hybrid maximum likelihood classifier (HMLC, and hybrid support vector machine (HSVM were implemented, as well as compared in the application of mapping urban land cover types. The hybrid classifier approach, which integrates the pixel-based classifier and the object-based segmentation approach, was demonstrated as an effective alternative to the conventional pixel-based classifiers for processing the satellite hyperspectral data, especially the fine spatial resolution data. For TG-1 imagery, the pixel-based urban classification was obtained with an average overall accuracy of 89.1%, whereas the hybrid urban classification was obtained with an average overall accuracy of 91.8%. For Hyperion imagery, the pixel-based urban classification was obtained with an average overall accuracy of 85.9%, whereas the hybrid urban classification was obtained with an average overall accuracy of 86.7%. Overall, it can be concluded that the fine spatial resolution satellite hyperspectral data TG-1 is promising in delineating complex urban scenes, especially when using an appropriate classifier, such as the

  19. Pinning and creep in superconductors

    International Nuclear Information System (INIS)

    Ovchinnikov, Yu.N.

    1994-01-01

    All superconductors can be separated into two large groups: type I and type II. The behaviour of these two groups in a magnetic field is quite different. The superconductors of type I, in a strong magnetic field, enter the intermediate state. Phenomenological picture of this state was given by Landau. The type II superconductors, in strong magnetic fields, form the mixed state (or Shubnikov phase). The microscopic picture of the mixed state was given by Abrikosov on the basis of Ginzburg-Landau equations. In ideal homogeneous superconductors the free energy is not changed if all the vortex structure is shifted on some distance u. The transport current will be proportional, therefore, to the electric field E. All the real superconductors, however, are inhomogeneous. Inhomogeneities interact with vortex lattice and pin it. In this new state the transport current below some critical value does not lead to the motion of the flux lattice and to the energy dissipation. The value of critical current strongly depends on the type of inhomogeneities, on the value of magnetic field and on temperature. In new layered superconductors, the critical current depends also on the orientation of the magnetic field B with respect to the layer planes. Temperature and quantum fluctuations lead to the transition between different metastable states in superconductors with current. As a result, the vortex lattice slowly moves (creep phenomenon). Below we will briefly discuss all these phenomena. (orig.)

  20. Vortex pinning by point defect in superconductors

    International Nuclear Information System (INIS)

    Liao Hongyin; Zhou Shiping; Du Haochen

    2003-01-01

    We apply the periodic time-dependent Ginzburg-Landau model to study vortex distribution in type-II superconductors with a point-like defect and square pinning array. A defect site will pin vortices, and a periodic pinning array with right geometric parameters, which can be any form designed in advance, shapes the vortex pattern as external magnetic field varies. The maximum length over which an attractive interaction between a pinning centre and a vortex extends is estimated to be about 6.0ξ. We also derive spatial distribution expressions for the order parameter, vector potential, magnetic field and supercurrent induced by a point defect. Theoretical results and numerical simulations are compared with each other and they are consistent

  1. Pinning Synchronization of Switched Complex Dynamical Networks

    Directory of Open Access Journals (Sweden)

    Liming Du

    2015-01-01

    Full Text Available Network topology and node dynamics play a key role in forming synchronization of complex networks. Unfortunately there is no effective synchronization criterion for pinning synchronization of complex dynamical networks with switching topology. In this paper, pinning synchronization of complex dynamical networks with switching topology is studied. Two basic problems are considered: one is pinning synchronization of switched complex networks under arbitrary switching; the other is pinning synchronization of switched complex networks by design of switching when synchronization cannot achieved by using any individual connection topology alone. For the two problems, common Lyapunov function method and single Lyapunov function method are used respectively, some global synchronization criteria are proposed and the designed switching law is given. Finally, simulation results verify the validity of the results.

  2. Nuclear fuel pin controlled failure device

    International Nuclear Information System (INIS)

    Schlenker, L.D.

    1975-01-01

    Each fuel pin of a fuel assembly for a water-cooled nuclear reactor is provided with means for rupturing the cladding tube at a predetermined location if an abnormal increase in pressure of the gases present occurs due to a loss-of-coolant accident. Preferably all such rupture means are oriented to minimize the hydraulic resistance to the flow of emergency core coolant such as all rupture means pointing in the same direction. Rupture means may be disposed at different elevations in adjacent fuel pins and, further, fuel pins may be provided with two or more rupture means, one of which is in the upper portion of the fuel pin. Rupture means are mechanical as by providing a locally weakened condition of a controlled nature in the cladding. (U.S.)

  3. Ultrasonic inspections of fuel alignment pins

    International Nuclear Information System (INIS)

    Rathgeb, W.; Schmid, R.

    1994-01-01

    As a remedy to the practical problem of defects in fuel alignment pins made of Inconel X750, an inspection technique has been developed which fully meets the requirements of detecting defects. The newly used fuel alignment pins made of austenite are easy to test and therefore satisfy the necessity of further inspections.For the fuel alignment pins of the upper core structure a safe and fast inspection technique was made available. The inspection sensitivity is high and it is possible to give quantitative directions concerning defect orientation and depth. After the required inspections had been concluded in 1989, a total of 18 inspections were carried out in various national and international nuclear power plants in the following years. During this time more than 6000 fuel alignment pines were examined.For the fuel alignment pins the inspection technique provided could increase the understanding of the defect process. This technique contributed to the development of an adaptive and economical repair strategy. ((orig.))

  4. Application of PIN diodes in Physics Research

    International Nuclear Information System (INIS)

    Ramirez-Jimenez, F. J.; Mondragon-Contreras, L.; Cruz-Estrada, P.

    2006-01-01

    A review of the application of PIN diodes as radiation detectors in different fields of Physics research is presented. The development and research in semiconductor technology, the use of PIN diodes in particle counting, X-and γ-ray spectroscopy, medical applications and charged particle spectroscopy are considered. Emphasis is made in the activities realized in the different research and development Mexican institutions dealing with this kind of radiation detectors

  5. IMp: The customizable LEGO® Pinned Insect Manipulator

    Directory of Open Access Journals (Sweden)

    Steen Dupont

    2015-02-01

    Full Text Available We present a pinned insect manipulator (IMp constructed of LEGO® building bricks with two axes of movement and two axes of rotation. In addition we present three variants of the IMp to emphasise the modular design, which facilitates resizing to meet the full range of pinned insect specimens, is fully customizable, collapsible, affordable and does not require specialist tools or knowledge to assemble.

  6. IMp: The customizable LEGO® Pinned Insect Manipulator

    Science.gov (United States)

    Dupont, Steen; Price, Benjamin; Blagoderov, Vladimir

    2015-01-01

    Abstract We present a pinned insect manipulator (IMp) constructed of LEGO® building bricks with two axes of movement and two axes of rotation. In addition we present three variants of the IMp to emphasise the modular design, which facilitates resizing to meet the full range of pinned insect specimens, is fully customizable, collapsible, affordable and does not require specialist tools or knowledge to assemble. PMID:25685035

  7. Anisotropic flux pinning in high Tc superconductors

    International Nuclear Information System (INIS)

    Kolesnik, S.; Igalson, J.; Skoskiewicz, T.; Szymczak, R.; Baran, M.; Pytel, K.; Pytel, B.

    1995-01-01

    In this paper we present a comparison of the results of FC magnetization measurements on several Pb-Sr-(Y,Ca)-Cu-O crystals representing various levels of flux pinning. The pinning centers in our crystals have been set up during the crystal growth process or introduced by neutron irradiation. Some possible explanations of the observed effects, including surface barrier, flux-center distribution and sample-shape effects, are discussed. ((orig.))

  8. Investigation on macroscopic cross section model for BWR pin-by-pin core analysis - 118

    International Nuclear Information System (INIS)

    Fujita, T.; Tada, K.; Yamamoto, A.; Yamane, Y.; Kosaka, S.; Hirano, G.

    2010-01-01

    A cross section model used in the pin-by-pin core analysis for BWR is investigated. In the pin-by-pin core calculation method, pin-cell averaged cross sections are calculated for many combinations of state and history variables that have influences on the cross section and are tabulated prior to the core calculations. Variation of a cross section in a core simulator is classified into two different types, i.e., the instantaneous effect and the history effect. The instantaneous effect is incorporated by the variation of cross section which is caused by the instantaneous change of state variables. For this effect, the exposure, the void fraction, the fuel temperature, the moderator temperature and the control rod are used as indexes. The history effect is the cumulative effect of state variables. We treat this effect with a unified approach using the spectral history. To confirm accuracy of the cross section model, the pin-by-pin fission rate distribution and the k-infinity of fuel assembly which are obtained with the tabulated and the reference cross sections are compared. For the instantaneous effect, the present cross section model well reproduces the reference results for all off-nominal conditions. For the history effect, however, considerable differences both on the pin-by-pin fission rate distribution and the k-infinity are observed at high exposure points. (authors)

  9. A macroscopic cross-section model for BWR pin-by-pin core analysis

    International Nuclear Information System (INIS)

    Fujita, Tatsuya; Endo, Tomohiro; Yamamoto, Akio

    2014-01-01

    A macroscopic cross-section model used in boiling water reactor (BWR) pin-by-pin core analysis is studied. In the pin-by-pin core calculation method, pin-cell averaged cross sections are calculated for many combinations of core state and depletion history variables and are tabulated prior to core calculations. Variations of cross sections in a core simulator are caused by two different phenomena (i.e. instantaneous and history effects). We treat them through the core state variables and the exposure-averaged core state variables, respectively. Furthermore, the cross-term effect among the core state and the depletion history variables is considered. In order to confirm the calculation accuracy and discuss the treatment of the cross-term effect, the k-infinity and the pin-by-pin fission rate distributions in a single fuel assembly geometry are compared. Some cross-term effects could be negligible since the impacts of them are sufficiently small. However, the cross-term effects among the control rod history (or the void history) and other variables have large impacts; thus, the consideration of them is crucial. The present macroscopic cross-section model, which considers such dominant cross-term effects, well reproduces the reference results and can be a candidate in practical applications for BWR pin-by-pin core analysis on the normal operations. (author)

  10. Do temperamentally shy children process emotion differently than nonshy children? Behavioral, psychophysiological, and gender differences in reticent preschoolers.

    Science.gov (United States)

    Theall-Honey, Laura A; Schmidt, Louis A

    2006-04-01

    We examined regional brain electrical activity (EEG), heart rate, and subjective responses at rest and during the presentation of videoclips designed to elicit a range of emotions (e.g., sadness, anger, happiness, fear) among a sample of healthy 4-year-old children selected for temperamental shyness. We found that shy children exhibited significantly greater relative right central EEG activation at rest and during the presentation of the fear-eliciting videoclip than nonshy children. Shy females displayed greater relative right mid-frontal EEG activation during the sad, happy, and fear videoclips than shy males who displayed greater relative left mid-frontal EEG activation. These results (1) suggest that recent frontal EEG activation/emotion models might be gender-specific and (2) appear to provide the first empirical evidence for recent theoretical notions linking the origins and maintenance of temperamental shyness in children to difficulty in regulating fear responses. Copyright (c) 2006 Wiley Periodicals, Inc.

  11. Improved pinning by multiple in-line damage

    Energy Technology Data Exchange (ETDEWEB)

    Weinstein, Roy [Beam Particle Dynamics Laboratories, University of Houston, Houston, TX 77204-5005 (United States); Sawh, Ravi-Persad [Beam Particle Dynamics Laboratories, University of Houston, Houston, TX 77204-5005 (United States); Gandini, Alberto [Beam Particle Dynamics Laboratories, University of Houston, Houston, TX 77204-5005 (United States); Parks, Drew [Beam Particle Dynamics Laboratories, University of Houston, Houston, TX 77204-5005 (United States)

    2005-02-01

    Columnar pinning centres provide the largest pinning potential, U{sub pin}, but not the greatest J{sub c} or pinnable field, B{sub pin}. Characteristics of ion-generated columnar defects which limit J{sub c} and B{sub pin} are discussed, including reduction of the percolation path, and the need for a larger number of columns of damage, for pinning, than are usually estimated. It is concluded that columnar pinning centres limit B{sub pin} to less than 4 T, and also severely reduce J{sub c}. The goal of maximizing U{sub pin}, via columnar centres, appears to have obscured a more rewarding approach and resulted in neglect of a large regime of ion interactions. Evidence is reviewed that multiple in-line damage (MILD), described herein, can provide orders of magnitude higher J{sub c} and B{sub pin}, despite providing lower U{sub pin}. The MILD pinning centre morphology is discussed, and it is estimated that for present-day large grain high T{sub c} superconductors, a J{sub c} value of {approx}10{sup 6}Acm{sup -2} is obtainable at 77 K, even when crystal plane alignment and weak links are not improved. In addition, the pinned field is increased by over an order of magnitude. An experiment is proposed to confirm these calculations, directly compare MILD pinning to continuous columnar pinning, and determine the optimum MILD structure. Applications of MILD pinning are discussed.

  12. SHiP: a new multipurpose beam-dump experiment at the SPS.

    CERN Document Server

    AUTHOR|(SzGeCERN)387671

    2016-01-01

    SHiP is an experiment to look for very weakly interacting particles at a new to be constructed beam-dum p facility at the CERN SPS. The SHiP Technical Proposal has been submitted to the CERN SPS Committee in April 2015. The 400 GeV/c proton beam extracted from the SPS will be dumped on a heavy target with the aim of integ rating $2\\times 10^{20}$ proton on target in five years. A detector located downstream of the target, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below a few GeV/c$^2$. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutral Leptons (HNL). The sensitivity to HNL will allow for the first time to probe, in the mass range between the kaon and the charm meson mass, a coupling range for which Baryogenesis and active neutrino masses could also be explained...

  13. Personality Development Within a Generational Context: Life Course Outcomes of Shy Children.

    Science.gov (United States)

    Schmidt, Louis A; Tang, Alva; Day, Kimberly L; Lahat, Ayelet; Boyle, Michael H; Saigal, Saroj; Van Lieshout, Ryan J

    2017-08-01

    Studies have shown that shy children born in the 1920s and 1950s had delayed marriage and parenthood, less stable careers, and lower occupational attainment as adults than other children. Do these effects still hold true? We examined demographic and social outcomes of children born between 1977 and 1982 in a prospective longitudinal study. We assessed shyness in childhood (age 8), adolescence (age 12-16), young adulthood (age 22-26), and adulthood (age 30-35), and derived three shyness trajectories (i.e., decreasing, increasing, and low-stable). Social and demographic outcomes for shy children who outgrew their shyness (i.e., decreasing trajectory) were indistinguishable from those who were consistently low on shyness measures. However, a shyness trajectory beginning in adolescence and increasing to adulthood was associated with poorer outcomes, similar to previous studies. These findings highlight the importance of multiple assessments in long-term longitudinal studies and the need to consider personality development within a generational context.

  14. [Brief discussion on acupuncture technique "controlling Qihai to regulate blood pressure" proposed by academician SHI Xuemin].

    Science.gov (United States)

    Yu, Liang; Xu, Xifa; Liu, Jian; Fan, Xiaonong

    2017-08-12

    According to Qihai theory, academician SHI Xuemin established the acupuncture technique "controlling Qihai to regulate blood pressure" which focused on Renying (ST 9), and achieved favorable effects in clinical application. In this paper, based on the Qihai theory, from aspects of Yuan qi , Zong qi , Ying qi and Wei qi and relations among qi , blood and veins in TCM, and cardiac output, sympathetic nerve activity and blood vessels in modern medicine, the understanding on hypertension was explained. As a result, both TCM and modern medicine had consistency in the understanding of hypertension, reflecting the scientificity and practicability of this acupuncture technique. Besides, according to Qihai theory and "wind leading to vertigo" theory, academician SHI Xuemin brought forward the key pathogenesis of hypertension was "dysfunction of Qihai ", and the acupoint selected Renying (ST 9), Quchi (LI 11), Hegu (LI 4), Zusanli (ST 36) and Taichong (LR 3). At the same time, the operation specification of each acupoint was mainly discussed, and the references of acupoint selection was explained based on TCM theory and modern clinical research.

  15. Heterogeneous neutron-leakage model for PWR pin-by-pin calculation

    International Nuclear Information System (INIS)

    Li, Yunzhao; Zhang, Bin; Wu, Hongchun; Shen, Wei

    2017-01-01

    Highlights: •The derivation of the formula of the leakage model is introduced. This paper evaluates homogeneous and heterogeneous leakage models used in PWR pin-by-pin calculation. •The implements of homogeneous and heterogeneous leakage models used in pin-cell homogenization of the lattice calculation are studied. A consistent method of cooperation between the heterogeneous leakage model and the pin-cell homogenization theory is proposed. •Considering the computational cost, a new buckling search scheme is proposed to reach the convergence faster. The computational cost of the newly proposed neutron balance scheme is much less than the power-method scheme and the linear-interpolation scheme. -- Abstract: When assembly calculation is performed with the reflective boundary condition, a leakage model is usually required in the lattice code. The previous studies show that the homogeneous leakage model works effectively for the assembly homogenization. However, it becomes different and unsettled for the pin-cell homogenization. Thus, this paper evaluates homogeneous and heterogeneous leakage models used in pin-by-pin calculation. The implements of homogeneous and heterogeneous leakage models used in pin-cell homogenization of the lattice calculation are studied. A consistent method of cooperation between the heterogeneous leakage model and the pin-cell homogenization theory is proposed. Considering the computational cost, a new buckling search scheme is proposed to reach the convergence faster. For practical reactor-core applications, the diffusion coefficients determined by the transport cross-section or by the leakage model are compared with each other to determine which one is more accurate for the Pressurized Water Reactor pin-by-pin calculation. Numerical results have demonstrated that the heterogeneous leakage model together with the diffusion coefficient determined by the heterogeneous leakage model would have the higher accuracy. The new buckling search

  16. The effects of lian gong in hypertensives attended a family healthcare unit in the city of Parnaíba, Piauí

    Directory of Open Access Journals (Sweden)

    Elce de Seixas Nascimento

    2012-12-01

    Full Text Available Objective: To understand the effects of Lian Gong in hypertensive users of Family Health Unity. Methods: A descriptive qualitative study, involving 20 volunteers, regardless of gender, aged 45 to 70 years residing in the city of Parnaíba-PI, Brazil. The intervention was performed in quiet and noise-free environment, from August to September 2011, three times per week, with a total of 30 sessions. We used the tool Focus Group at the beginning and end of the intervention. We applied the technique of thematic analysis of the Collective Subject Discourse (CSD using three methodological approaches: main idea, key expressions and CSD. Basic statistics operations were used (percentages to quantify the lines. Results: Before the intervention, the group reported having hypertension perceived by the manifestation of physical symptoms and / or psychic symptoms based on the diagnosis and treatment rejection, revealing a superficial level of knowledge or misinformation about the disease. After the intervention, improvement in physical and emotional symptoms, social relationships and family was reported, as well as the difficulty of changing habits, which can be alleviated with the interdisciplinary support and continuation of exercise. Final Thoughts: The practice of Lian Gong was effective for improving the physical and emotional state of hypertensive patients and may be an adjuvant therapy to control hypertension in primary health care.

  17. Incidencia de Mindfulness y Qi Gong sobre el Estado de Salud, Bienestar Psicológico, Satisfacción Vital y Estrés Laboral

    Directory of Open Access Journals (Sweden)

    Luis Armando Oblitas Guadalupe

    2017-02-01

    Full Text Available El presente estudio se realizó a través de un abordaje metodológico pre-experimental con medidas de tipo pre-test y post-test. Participaron 52 trabajadores de la Universidad de la Costa (Barranquilla, Colombia, quienes asistieron por invitación al taller de ocho horas de mindfulness y qi gong para el mejoramiento de la salud, bienestar psicológico, satisfacción vital y reducción del estrés. Los instrumentos utilizados fueron el Cuestionario de Salud sf-11, Escala de Bienestar Psicológico (Ryff & Keyes, 1995, Escala de Satisfacción Vital (Cortés, 2013 y Escala Numérica de Estrés Laboral. La combinación de mindfulness y qi gong produjo una mejoría en el estado de salud de los trabajadores —salud general, energía, eficiencia, actividades domésticas y disminución del dolor—, cambios importantes en el bienestar psicológico —adaptación, confianza, claridad, apertura y autoestima—, y mejoramiento de la satisfacción vital —salud y productividad—. No se encontraron diferencias significativas en los niveles de estrés laboral.

  18. Whole-Pin Furnace system: An experimental facility for studying irradiated fuel pin behavior under potential reactor accident conditions

    International Nuclear Information System (INIS)

    Liu, Y.Y.; Tsai, H.C.; Donahue, D.A.; Pushis, D.O.; Savoie, F.E.; Holland, J.W.; Wright, A.E.; August, C.; Bailey, J.L.; Patterson, D.R.

    1990-05-01

    The whole-pin furnace system is a new in-cell experimental facility constructed to investigate how irradiated fuel pins may fail under potential reactor accident conditions. Extensive checkouts have demonstrated excellent performance in remote operation, temperature control, pin breach detection, and fission gas handling. The system is currently being used in testing of EBIR-II-irradiated Integral Fast Reactor (IFR) metal fuel pins; future testing will include EBR-II-irradiated mixed-oxide fuel pins. 7 refs., 4 figs

  19. Statistics of dislocation pinning at localized obstacles

    Energy Technology Data Exchange (ETDEWEB)

    Dutta, A. [S. N. Bose National Centre for Basic Sciences, Salt Lake, Kolkata 700098 (India); Bhattacharya, M., E-mail: mishreyee@vecc.gov.in; Barat, P. [Variable Energy Cyclotron Centre, 1/AF Bidhannagar, Kolkata 700064 (India)

    2014-10-14

    Pinning of dislocations at nanosized obstacles like precipitates, voids, and bubbles is a crucial mechanism in the context of phenomena like hardening and creep. The interaction between such an obstacle and a dislocation is often studied at fundamental level by means of analytical tools, atomistic simulations, and finite element methods. Nevertheless, the information extracted from such studies cannot be utilized to its maximum extent on account of insufficient information about the underlying statistics of this process comprising a large number of dislocations and obstacles in a system. Here, we propose a new statistical approach, where the statistics of pinning of dislocations by idealized spherical obstacles is explored by taking into account the generalized size-distribution of the obstacles along with the dislocation density within a three-dimensional framework. Starting with a minimal set of material parameters, the framework employs the method of geometrical statistics with a few simple assumptions compatible with the real physical scenario. The application of this approach, in combination with the knowledge of fundamental dislocation-obstacle interactions, has successfully been demonstrated for dislocation pinning at nanovoids in neutron irradiated type 316-stainless steel in regard to the non-conservative motion of dislocations. An interesting phenomenon of transition from rare pinning to multiple pinning regimes with increasing irradiation temperature is revealed.

  20. Pinning impulsive control algorithms for complex network

    Energy Technology Data Exchange (ETDEWEB)

    Sun, Wen [School of Information and Mathematics, Yangtze University, Jingzhou 434023 (China); Lü, Jinhu [Academy of Mathematics and Systems Science, Chinese Academy of Sciences, Beijing 100190 (China); Chen, Shihua [College of Mathematics and Statistics, Wuhan University, Wuhan 430072 (China); Yu, Xinghuo [School of Electrical and Computer Engineering, RMIT University, Melbourne VIC 3001 (Australia)

    2014-03-15

    In this paper, we further investigate the synchronization of complex dynamical network via pinning control in which a selection of nodes are controlled at discrete times. Different from most existing work, the pinning control algorithms utilize only the impulsive signals at discrete time instants, which may greatly improve the communication channel efficiency and reduce control cost. Two classes of algorithms are designed, one for strongly connected complex network and another for non-strongly connected complex network. It is suggested that in the strongly connected network with suitable coupling strength, a single controller at any one of the network's nodes can always pin the network to its homogeneous solution. In the non-strongly connected case, the location and minimum number of nodes needed to pin the network are determined by the Frobenius normal form of the coupling matrix. In addition, the coupling matrix is not necessarily symmetric or irreducible. Illustrative examples are then given to validate the proposed pinning impulsive control algorithms.

  1. Radon measurements with a PIN photodiode

    International Nuclear Information System (INIS)

    Martin-Martin, A.; Gutierrez-Villanueva, J.L.; Munoz, J.M.; Garcia-Talavera, M.; Adamiec, G.; Iniguez, M.P.

    2006-01-01

    Silicon photodiodes are well suited to detect alphas coming from different sources as neutron reactions or radon daughters. In this work a radon in air detecting device, using an 18x18 mm silicon PIN photodiode is studied. The ionized airborne decay products formed during radon diffusion were focused by an accelerating high voltage to the PIN surface. Several conducting rings were disposed inside a cylindrical PVC vessel in such a way that they reproduced the electric field created by a punctual charge located behind PIN position. Alpha spectra coming from the neutral and ionized species deposited on the PIN surface, dominated by 218 Po and 214 Po progeny peaks, were recorded for varying conditions. Those include radon concentration from a Pylon source, high voltage (thousands of volts) and PIN inverse bias voltage. Different parameters such as temperature and humidity were also registered during data acquisition. The increase in the particle collection efficiency with respect to zero electric field was compared with the corresponding to a parallel plates configuration. A discussion is made in terms of the most appropriate voltages for different radon concentrations

  2. A facility to search for hidden particles at the CERN SPS: the SHiP physics case.

    Science.gov (United States)

    Alekhin, Sergey; Altmannshofer, Wolfgang; Asaka, Takehiko; Batell, Brian; Bezrukov, Fedor; Bondarenko, Kyrylo; Boyarsky, Alexey; Choi, Ki-Young; Corral, Cristóbal; Craig, Nathaniel; Curtin, David; Davidson, Sacha; de Gouvêa, André; Dell'Oro, Stefano; deNiverville, Patrick; Bhupal Dev, P S; Dreiner, Herbi; Drewes, Marco; Eijima, Shintaro; Essig, Rouven; Fradette, Anthony; Garbrecht, Björn; Gavela, Belen; Giudice, Gian F; Goodsell, Mark D; Gorbunov, Dmitry; Gori, Stefania; Grojean, Christophe; Guffanti, Alberto; Hambye, Thomas; Hansen, Steen H; Helo, Juan Carlos; Hernandez, Pilar; Ibarra, Alejandro; Ivashko, Artem; Izaguirre, Eder; Jaeckel, Joerg; Jeong, Yu Seon; Kahlhoefer, Felix; Kahn, Yonatan; Katz, Andrey; Kim, Choong Sun; Kovalenko, Sergey; Krnjaic, Gordan; Lyubovitskij, Valery E; Marcocci, Simone; Mccullough, Matthew; McKeen, David; Mitselmakher, Guenakh; Moch, Sven-Olaf; Mohapatra, Rabindra N; Morrissey, David E; Ovchynnikov, Maksym; Paschos, Emmanuel; Pilaftsis, Apostolos; Pospelov, Maxim; Reno, Mary Hall; Ringwald, Andreas; Ritz, Adam; Roszkowski, Leszek; Rubakov, Valery; Ruchayskiy, Oleg; Schienbein, Ingo; Schmeier, Daniel; Schmidt-Hoberg, Kai; Schwaller, Pedro; Senjanovic, Goran; Seto, Osamu; Shaposhnikov, Mikhail; Shchutska, Lesya; Shelton, Jessie; Shrock, Robert; Shuve, Brian; Spannowsky, Michael; Spray, Andy; Staub, Florian; Stolarski, Daniel; Strassler, Matt; Tello, Vladimir; Tramontano, Francesco; Tripathi, Anurag; Tulin, Sean; Vissani, Francesco; Winkler, Martin W; Zurek, Kathryn M

    2016-12-01

    This paper describes the physics case for a new fixed target facility at CERN SPS. The SHiP (search for hidden particles) experiment is intended to hunt for new physics in the largely unexplored domain of very weakly interacting particles with masses below the Fermi scale, inaccessible to the LHC experiments, and to study tau neutrino physics. The same proton beam setup can be used later to look for decays of tau-leptons with lepton flavour number non-conservation, [Formula: see text] and to search for weakly-interacting sub-GeV dark matter candidates. We discuss the evidence for physics beyond the standard model and describe interactions between new particles and four different portals-scalars, vectors, fermions or axion-like particles. We discuss motivations for different models, manifesting themselves via these interactions, and how they can be probed with the SHiP experiment and present several case studies. The prospects to search for relatively light SUSY and composite particles at SHiP are also discussed. We demonstrate that the SHiP experiment has a unique potential to discover new physics and can directly probe a number of solutions of beyond the standard model puzzles, such as neutrino masses, baryon asymmetry of the Universe, dark matter, and inflation.

  3. Understanding Relations among Children's Shy and Antisocial/Aggressive Behaviors and Mothers' Parenting: The Role of Maternal Beliefs

    Science.gov (United States)

    Evans, Cortney A.; Nelson, Larry J.; Porter, Christin L.; Nelson, David A.; Hart, Craig H.

    2012-01-01

    This study assesses the relationships between children's shy and antisocial/aggressive behaviors and maternal beliefs, and concomitant parenting behaviors. Structural equation models examined 199 mothers' perceptions of aggression and shyness in their preschool-age children (average age = 59.63 months); maternal beliefs (i.e., locus of control,…

  4. Development of a fast pin-by-pin transport solver in ARCADIA registered

    International Nuclear Information System (INIS)

    Geemert, R. van

    2009-01-01

    For satisfaction of future global customer needs, dedicated efforts are being coordinated internationally and pursued continuously at AREVA NP. The currently ongoing CONVERGENCE project is committed to the development of the ARCADIA registered next generation core simulation software package. ARCADIA registered will be put to global use by all AREVA NP business regions, for the entire spectrum of core design processes, licensing computations and safety studies. As part of the currently ongoing trend towards more sophisticated neutronics methodologies, an SP 3 nodal transport concept (van Geemert 2008) has been developed for ARTEMIS (Hobson 2008) which is the steady-state and transient core simulation part of ARCADIA registered . For enabling a high computational performance, the SP 3 calculations are accelerated by applying multi-level coarse mesh rebalancing (van Geemert 2006). In the current implementation, SP 3 is typically about 1.4 times as expensive computationally as SP 1 (diffusion). The developed SP 3 solution concept is foreseen as the future computational workhorse for many-group 3D pin-by-pin full core computations by ARCADIA registered . With the entire numerical workload being highly parallelizable through domain decomposition techniques, associated CPU-time requirements that adhere to the efficiency needs in the nuclear industry can be expected to become feasible in the near future. The accuracy enhancement obtainable by using SP 3 instead of SP 1 has been verified by a detailed comparison of ARTEMIS 16-group pin-by-pin SP N results with KAERI's DeCart reference results (Kozlowski 2003) for the 2D pin-by-pin Purdue UO 2 /MOX benchmark. Within the associated pin-by-pin grid, large pin-to-pin variations in cross-section values occur due to the explicit modelling of guide tubes, gadolinium pins as well as the heterogeneous distribution of MOX assemblies and UO 2 assemblies featuring significantly different burnups. With a pin-by-pin grid as

  5. First reliability test of a surface micromachined microengine using SHiMMeR

    Energy Technology Data Exchange (ETDEWEB)

    Tanner, D.M.; Smith, N.F.; Bowman, D.J. [and others

    1997-08-01

    The first-ever reliability stress test on surface micromachined microengines developed at Sandia National Laboratories (SNL) has been completed. We stressed 41 microengines at 36,000 RPM and inspected the functionality at 60 RPM. We have observed an infant mortality region, a region of low failure rate (useful life), and no signs of wearout in the data. The reliability data are presented and interpreted using standard reliability methods. Failure analysis results on the stressed microengines are presented. In our effort to study the reliability of MEMS, we need to observe the failures of large numbers of parts to determine the failure modes. To facilitate testing of large numbers of micromachines. The Sandia High Volume Measurement of Micromachine Reliability (SHiMMeR) system has computer controlled positioning and the capability to inspect moving parts. The development of this parallel testing system is discussed in detail.

  6. PINS Testing and Modification for Explosive Identification

    International Nuclear Information System (INIS)

    Seabury, E.H.; Caffrey, A.J.

    2011-01-01

    The INL's Portable Isotopic Neutron Spectroscopy System (PINS)1 non-intrusively identifies the chemical fill of munitions and sealed containers. PINS is used routinely by the U.S. Army, the Defense Threat Reduction Agency, and foreign military units to determine the contents of munitions and other containers suspected to contain explosives, smoke-generating chemicals, and chemical warfare agents such as mustard and nerve gas. The objects assayed with PINS range from softball-sized M139 chemical bomblets to 200 gallon DOT 500X ton containers. INL had previously examined2 the feasibility of using a similar system for the identification of explosives, and based on this proof-of-principle test, the development of a dedicated system for the identification of explosives in an improvised nuclear device appears entirely feasible. INL has been tasked by NNSA NA-42 Render Safe Research and Development with the development of such a system.

  7. Effects of Climate Change and Fisheries Bycatch on Shy Albatross (Thalassarche cauta) in Southern Australia.

    Science.gov (United States)

    Thomson, Robin B; Alderman, Rachael L; Tuck, Geoffrey N; Hobday, Alistair J

    2015-01-01

    The impacts of climate change on marine species are often compounded by other stressors that make direct attribution and prediction difficult. Shy albatrosses (Thalassarche cauta) breeding on Albatross Island, Tasmania, show an unusually restricted foraging range, allowing easier discrimination between the influence of non-climate stressors (fisheries bycatch) and environmental variation. Local environmental conditions (rainfall, air temperature, and sea-surface height, an indicator of upwelling) during the vulnerable chick-rearing stage, have been correlated with breeding success of shy albatrosses. We use an age-, stage- and sex-structured population model to explore potential relationships between local environmental factors and albatross breeding success while accounting for fisheries bycatch by trawl and longline fisheries. The model uses time-series of observed breeding population counts, breeding success, adult and juvenile survival rates and a bycatch mortality observation for trawl fishing to estimate fisheries catchability, environmental influence, natural mortality rate, density dependence, and productivity. Observed at-sea distributions for adult and juvenile birds were coupled with reported fishing effort to estimate vulnerability to incidental bycatch. The inclusion of rainfall, temperature and sea-surface height as explanatory variables for annual chick mortality rate was statistically significant. Global climate models predict little change in future local average rainfall, however, increases are forecast in both temperatures and upwelling, which are predicted to have detrimental and beneficial effects, respectively, on breeding success. The model shows that mitigation of at least 50% of present bycatch is required to offset losses due to future temperature changes, even if upwelling increases substantially. Our results highlight the benefits of using an integrated modeling approach, which uses available demographic as well as environmental data

  8. Effects of Climate Change and Fisheries Bycatch on Shy Albatross (Thalassarche cauta in Southern Australia.

    Directory of Open Access Journals (Sweden)

    Robin B Thomson

    Full Text Available The impacts of climate change on marine species are often compounded by other stressors that make direct attribution and prediction difficult. Shy albatrosses (Thalassarche cauta breeding on Albatross Island, Tasmania, show an unusually restricted foraging range, allowing easier discrimination between the influence of non-climate stressors (fisheries bycatch and environmental variation. Local environmental conditions (rainfall, air temperature, and sea-surface height, an indicator of upwelling during the vulnerable chick-rearing stage, have been correlated with breeding success of shy albatrosses. We use an age-, stage- and sex-structured population model to explore potential relationships between local environmental factors and albatross breeding success while accounting for fisheries bycatch by trawl and longline fisheries. The model uses time-series of observed breeding population counts, breeding success, adult and juvenile survival rates and a bycatch mortality observation for trawl fishing to estimate fisheries catchability, environmental influence, natural mortality rate, density dependence, and productivity. Observed at-sea distributions for adult and juvenile birds were coupled with reported fishing effort to estimate vulnerability to incidental bycatch. The inclusion of rainfall, temperature and sea-surface height as explanatory variables for annual chick mortality rate was statistically significant. Global climate models predict little change in future local average rainfall, however, increases are forecast in both temperatures and upwelling, which are predicted to have detrimental and beneficial effects, respectively, on breeding success. The model shows that mitigation of at least 50% of present bycatch is required to offset losses due to future temperature changes, even if upwelling increases substantially. Our results highlight the benefits of using an integrated modeling approach, which uses available demographic as well as

  9. Effect of swift heavy ion (SHI) irradiation on transparent conducting oxide electrodes for dye-sensitized solar cell applications

    International Nuclear Information System (INIS)

    Singh, Hemant Kr.; Avasthi, D.K.; Aggarwal, Shruti

    2015-01-01

    Highlights: •The objective is to study the effect of swift heavy ion (SHI) irradiation on photoanode of DSSC for better efficiency. •This work presents the effect of SHI irradiation on various Transparent conducting oxides (TCOs). •Effects are studied in terms of conductivity and transmittance of TCOs. •ITO-PET gives best results in comparison to ITO and FTO for DSSC application under SHI irradiation. -- Abstract: Transparent conducting oxides (TCOs) are used as electrodes in dye-sensitized solar cells (DSSCs) because of their properties such as high transmittance and low resistivity. In the present work, the effects of swift heavy ion (SHI) irradiation on various types of TCOs are presented. The objective of this study is to investigate the effect of SHI on TCOs. For the present study, three different types of TCOs are considered, namely, (a) FTO (fluorine-doped tin oxide, SnO 2 :F) on a Nippon glass substrate, (b) ITO (indium tin oxide, In 2 O 3 :Sn) coated on polyethylene terephthalate (PET) on a Corning glass substrate, and (c) ITO on a Corning glass substrate. These films are irradiated with 120 MeV Ag +9 ions at fluences ranging from 3.0 × 10 11 ions/cm 2 to 3.0 × 10 13 ions/cm 2 . The structural, morphological, optical and electrical properties are studied via X-ray diffraction (XRD), atomic force microscopy (AFM), UV–Vis absorption spectroscopy and four-probe resistivity measurements, respectively. The ITO-PET electrode is found to exhibit superior conductivity and transmittance properties in comparison with the others after irradiation and, therefore, to be the most suitable for solar cell applications

  10. Effect of swift heavy ion (SHI) irradiation on transparent conducting oxide electrodes for dye-sensitized solar cell applications

    Energy Technology Data Exchange (ETDEWEB)

    Singh, Hemant Kr. [University School of Basic and Applied Sciences, Guru Gobind Singh Indraprastha University, New Delhi (India); Avasthi, D.K. [Inter University Accelerator Center, Post Box 10502, New Delhi (India); Aggarwal, Shruti, E-mail: shruti.al@gmail.com [University School of Basic and Applied Sciences, Guru Gobind Singh Indraprastha University, New Delhi (India)

    2015-06-15

    Highlights: •The objective is to study the effect of swift heavy ion (SHI) irradiation on photoanode of DSSC for better efficiency. •This work presents the effect of SHI irradiation on various Transparent conducting oxides (TCOs). •Effects are studied in terms of conductivity and transmittance of TCOs. •ITO-PET gives best results in comparison to ITO and FTO for DSSC application under SHI irradiation. -- Abstract: Transparent conducting oxides (TCOs) are used as electrodes in dye-sensitized solar cells (DSSCs) because of their properties such as high transmittance and low resistivity. In the present work, the effects of swift heavy ion (SHI) irradiation on various types of TCOs are presented. The objective of this study is to investigate the effect of SHI on TCOs. For the present study, three different types of TCOs are considered, namely, (a) FTO (fluorine-doped tin oxide, SnO{sub 2}:F) on a Nippon glass substrate, (b) ITO (indium tin oxide, In{sub 2}O{sub 3}:Sn) coated on polyethylene terephthalate (PET) on a Corning glass substrate, and (c) ITO on a Corning glass substrate. These films are irradiated with 120 MeV Ag{sup +9} ions at fluences ranging from 3.0 × 10{sup 11} ions/cm{sup 2} to 3.0 × 10{sup 13} ions/cm{sup 2}. The structural, morphological, optical and electrical properties are studied via X-ray diffraction (XRD), atomic force microscopy (AFM), UV–Vis absorption spectroscopy and four-probe resistivity measurements, respectively. The ITO-PET electrode is found to exhibit superior conductivity and transmittance properties in comparison with the others after irradiation and, therefore, to be the most suitable for solar cell applications.

  11. SHI/STY Genes Affect Pre- and Post-meiotic Anther Processes in Auxin Sensing Domains in Arabidopsis

    Directory of Open Access Journals (Sweden)

    Leandro H. Estornell

    2018-02-01

    Full Text Available In flowering plants, mature sperm cells are enclosed in pollen grains formed in structures called anthers. Several cell layers surrounding the central sporogenous cells of the anther are essential for directing the developmental processes that lead to meiosis, pollen formation, and the subsequent pollen release. The specification and function of these tissues are regulated by a large number of genetic factors. Additionally, the plant hormone auxin has previously been shown to play important roles in the later phases of anther development. Using the R2D2 auxin sensor system we here show that auxin is sensed also in the early phases of anther cell layer development, suggesting that spatiotemporal regulation of auxin levels is important for early anther morphogenesis. Members of the SHI/STY transcription factor family acting as direct regulators of YUC auxin biosynthesis genes have previously been demonstrated to affect early anther patterning. Using reporter constructs we show that SHI/STY genes are dynamically active throughout anther development and their expression overlaps with those of three additional downstream targets, PAO5, EOD3 and PGL1. Characterization of anthers carrying mutations in five SHI/STY genes clearly suggests that SHI/STY transcription factors affect anther organ identity. In addition, their activity is important to repress periclinal cell divisions as well as premature entrance into programmed cell death and cell wall lignification, which directly influences the timing of anther dehiscence and the pollen viability. The SHI/STY proteins also prevent premature pollen germination suggesting that they may play a role in the induction or maintenance of pollen dormancy.

  12. Peripheral pin alignment system for fuel assemblies

    International Nuclear Information System (INIS)

    Anthony, A.J.

    1981-01-01

    An alignment system is provided for nuclear fuel assemblies in a nuclear core. The core support structure of the nuclear reactor includes upwardly pointing alignment pins arranged in a square grid and engage peripheral depressions formed in the lateral periphery of the lower ends of each of the fuel assemblies of the core. In a preferred embodiment, the depressions are located at the corners of the fuel assemblies so that each depression includes one-quarter of a cylindrical void. Accordingly, each fuel assembly is positioned and aligned by one-quarter of four separate alignment pins which engage the fuel assemblies at their lower exterior corners. (author)

  13. Pinning, flux diodes and ratchets for vortices interacting with conformal pinning arrays

    International Nuclear Information System (INIS)

    Olson Reichhardt, C. J.; Wang, Y. L.; Argonne National Laboratory; Xiao, Z. L.; Northern Illinois University, DeKalb, IL

    2016-01-01

    A conformal pinning array can be created by conformally transforming a uniform triangular pinning lattice to produce a new structure in which the six-fold ordering of the original lattice is conserved but where there is a spatial gradient in the density of pinning sites. Here we examine several aspects of vortices interacting with conformal pinning arrays and how they can be used to create a flux flow diode effect for driving vortices in different directions across the arrays. Under the application of an ac drive, a pronounced vortex ratchet effect occurs where the vortices flow in the easy direction of the array asymmetry. When the ac drive is applied perpendicular to the asymmetry direction of the array, it is possible to realize a transverse vortex ratchet effect where there is a generation of a dc flow of vortices perpendicular to the ac drive due to the creation of a noise correlation ratchet by the plastic motion of the vortices. We also examine vortex transport in experiments and compare the pinning effectiveness of conformal arrays to uniform triangular pinning arrays. In conclusion, we find that a triangular array generally pins the vortices more effectively at the first matching field and below, while the conformal array is more effective at higher fields where interstitial vortex flow occurs.

  14. Design of a terahertz CW photomixer based on PIN and superlattice PIN devices

    DEFF Research Database (Denmark)

    Krozer, Viktor; Eichhorn, Finn

    2006-01-01

    We present the design of a photomixer LO based on standard and superlattice PIN diodes, operating at 1 THz. The design is based on a direct integration of a double slot antenna with the PIN device and a suitable matching circuit. The antenna has been designed together with a dielectric lens using...... Ansoft HFSS EM simulation. The large-signal PIN diode model employed in the work has been improved compared to our previously developed model presented earlier in a 3 THz design. We demonstrate that the antenna characteristic changes drastically with the device in place....

  15. Tapered leaf support pin for operating plant guide tubes

    International Nuclear Information System (INIS)

    Land, J.T.; Hopkins, R.J.; Ford, D.E.

    1991-01-01

    This patent describes a mounting system for removably mounting the lower flange of a control rod guide tube over an opening in the upper core plate of a nuclear reactor comprising at least one elongated support pin mounted on the guide tube lower flange and resiliently receivable in a bore formed in the upper core plate. It comprises a support pin having a longitudinal axis and comprising a first pin portion mountable on the guide tube lower flange, and a second pin portion receivable within the upper core plate bore, the second pin portion including a solid body section adjacent the first pin portion and having an outer diameter which is accommodated by the bore by a close clearance fit; locking means mounted on the first pin portion of the support pin for retaining the guide tube lower flange between the solid body section of the second pin portion and the locking means; and a washer disposed around the first pin portion between the locking means and the control rod guide tube flange, the washer and the locking means including mutually engaging rounded surfaces for eliminating bending moments and stresses on the support pin during mounting of the locking means on the first pin portion of the support pin

  16. Cladding properties under simulated fuel pin transients

    International Nuclear Information System (INIS)

    Hunter, C.W.; Johnson, G.D.

    1975-01-01

    A description is given of the HEDL fuel pin testing program utilizing a recently developed Fuel Cladding Transient Tester (FCTT) to generate the requisite mechanical property information on irradiated and unirradiated fast reactor fuel cladding under temperature ramp conditions. The test procedure is described, and data are presented

  17. Turban pin aspiration: new fashion, new syndrome.

    Science.gov (United States)

    Ilan, Ophir; Eliashar, Ron; Hirshoren, Nir; Hamdan, Kasem; Gross, Menachem

    2012-04-01

    Turban pin aspiration syndrome is a new clinical entity afflicting young Islamic girls wearing a turban.The goal of this study was to present our experience in diagnosis and treatment of this new entity, define its clinical and epidemiologic features, and shed a new light on the role of fashion in the increased incidence. A retrospective study in a tertiary university hospital. Review of clinical parameters and epidemiologic features of 26 patients diagnosed with turban pin aspiration syndrome admitted to the Hadassah-Hebrew University Hospitals in Jerusalem from 1990 to 2010. All patients were Muslim females with an average age of 16 years. In all cases, the history was positive for accidental aspiration. Most of the pins were located in the trachea (42%). In 20 cases, the pins were extracted by rigid bronchoscopy without major complications. Fluoroscopy-assisted rigid bronchoscopy was used successfully in three cases. In one case, the object was self-ejected by coughing before the bronchoscopy, and two patients were referred to the chest unit for thoracotomy. Clinicians should be aware of this distinct form of foreign body aspiration, its method of diagnosis, and extraction techniques. A cultural investigation showed a difference in the turban-fastening technique of young girls as compared with their mothers. Removal by rigid bronchoscopy is a safe method with a high success rate and should be considered as the preferred extraction method of choice. Copyright © 2012 The American Laryngological, Rhinological, and Otological Society, Inc.

  18. Radiographic examination methods for fuel pins

    International Nuclear Information System (INIS)

    Smirnov, V.P.; Dvoretskii, V.G.

    1987-11-01

    To study the fast neutron reactor fuel pins structure the NIIAR Institute used x diffraction, neutronic radiography and autoradiographies. The two first methods are used for internal macrostructure studies, the third method for the plutonium and uranium radial distribution. These methods and the main results are indicated in this document [fr

  19. Physicist pins hopes on particle collider

    CERN Multimedia

    2007-01-01

    Physicist pins hopes on particle collider By Deseret Morning News Published: Monday, Dec. 31, 27 12:4 a.m. MST FONT Scott Thomas, a 187 State University graduate, is working at the frontiers of science. The theoretical physicist is crafting ways to extract fundamental secrets that seem certain to be uncovered by the Large Hadron Collider.

  20. Analytical method for reconstruction pin to pin of the nuclear power density distribution

    Energy Technology Data Exchange (ETDEWEB)

    Pessoa, Paulo O.; Silva, Fernando C.; Martinez, Aquilino S., E-mail: ppessoa@con.ufrj.br, E-mail: fernando@con.ufrj.br, E-mail: aquilino@imp.ufrj.br [Coordenacao dos Programas de Pos-Graduacao em Engenharia (COPPE/UFRJ), Rio de Janeiro, RJ (Brazil)

    2013-07-01

    An accurate and efficient method for reconstructing pin to pin of the nuclear power density distribution, involving the analytical solution of the diffusion equation for two-dimensional neutron energy groups in homogeneous nodes, is presented. The boundary conditions used for analytic as solution are the four currents or fluxes on the surface of the node, which are obtained by Nodal Expansion Method (known as NEM) and four fluxes at the vertices of a node calculated using the finite difference method. The analytical solution found is the homogeneous distribution of neutron flux. Detailed distributions pin to pin inside a fuel assembly are estimated by the product of homogeneous flux distribution by local heterogeneous form function. Furthermore, the form functions of flux and power are used. The results obtained with this method have a good accuracy when compared with reference values. (author)

  1. Analytical method for reconstruction pin to pin of the nuclear power density distribution

    International Nuclear Information System (INIS)

    Pessoa, Paulo O.; Silva, Fernando C.; Martinez, Aquilino S.

    2013-01-01

    An accurate and efficient method for reconstructing pin to pin of the nuclear power density distribution, involving the analytical solution of the diffusion equation for two-dimensional neutron energy groups in homogeneous nodes, is presented. The boundary conditions used for analytic as solution are the four currents or fluxes on the surface of the node, which are obtained by Nodal Expansion Method (known as NEM) and four fluxes at the vertices of a node calculated using the finite difference method. The analytical solution found is the homogeneous distribution of neutron flux. Detailed distributions pin to pin inside a fuel assembly are estimated by the product of homogeneous flux distribution by local heterogeneous form function. Furthermore, the form functions of flux and power are used. The results obtained with this method have a good accuracy when compared with reference values. (author)

  2. Pinning control of complex networked systems synchronization, consensus and flocking of networked systems via pinning

    CERN Document Server

    Su, Housheng

    2013-01-01

    Synchronization, consensus and flocking are ubiquitous requirements in networked systems. Pinning Control of Complex Networked Systems investigates these requirements by using the pinning control strategy, which aims to control the whole dynamical network with huge numbers of nodes by imposing controllers for only a fraction of the nodes. As the direct control of every node in a dynamical network with huge numbers of nodes might be impossible or unnecessary, it’s then very important to use the pinning control strategy for the synchronization of complex dynamical networks. The research on pinning control strategy in consensus and flocking of multi-agent systems can not only help us to better understand the mechanisms of natural collective phenomena, but also benefit applications in mobile sensor/robot networks. This book offers a valuable resource for researchers and engineers working in the fields of control theory and control engineering.   Housheng Su is an Associate Professor at the Department of Contro...

  3. PROCOPE, Collision Probability in Pin Clusters and Infinite Rod Lattices

    International Nuclear Information System (INIS)

    Amyot, L.; Daolio, C.; Benoist, P.

    1984-01-01

    1 - Nature of physical problem solved: Calculation of directional collision probabilities in pin clusters and infinite rod lattices. 2 - Method of solution: a) Gauss integration of analytical expressions for collision probabilities. b) alternately, an approximate closed expression (not involving integrals) may be used for pin-to-pin interactions. 3 - Restrictions on the complexity of the problem: number of fuel pins must be smaller than 62; maximum number of groups of symmetry is 300

  4. New geranylated flavanones from the fruits of Paulownia catalpifolia Gong Tong with their anti-proliferative activity on lung cancer cells A549.

    Science.gov (United States)

    Gao, Tian-yang; Jin, Xing; Tang, Wen-zhao; Wang, Xiao-jing; Zhao, Yun-xue

    2015-09-01

    Three new geranylated flavanones, named as paucatalinone A (1), B (2), and isopaucatalinone B (3), were isolated from the fruits of Paulownia catalpifolia Gong Tong (Scrophulariaceae). Their structures were well determined by means of IR, MS, 1D and 2D NMR, and CD techniques. Paucatalinone A (1) is the first sample as a dimeric geranylated flavanone derivative isolated from natural products. Paucatalinone A (1) displayed good antiproliferative effects on human lung cancer cells A549 and resulted in a clear increase of the percentage of cells in G1 phase and a decrease in the percentage of cells in S and G2/M phases in comparison with control cells. Copyright © 2015. Published by Elsevier Ltd.

  5. Uniaxial Tensile Properties of Atherosclerotic Carotid Artery After Mobilization of Pushing on Qiao-Gong: A Safety Study Using an Animal Model of Carotid Atherosclerosis.

    Science.gov (United States)

    Qi, Ji; Zhang, Shaoqun; Zhang, Lei; Ping, Ruiyue; Ping, Kaike; Ye, Da; Shen, Honggui; Chen, Yili; Li, Yikai

    2018-02-01

    This study aimed to preliminarily explore the effects of the soft tissue mobilization of pushing on Qiao-Gong (MPQ) on biomechanical properties of the carotid artery using an animal model of carotid atherosclerosis (CAS). Fifty rabbits were randomly divided into 4 groups: animals with CAS treated with MPQ (CAS-MPQ [n = 15]); animals with CAS treated without MPQ (CAS [n = 15]); normal animals treated with MPQ (normal-MPQ [n = 10]); and a blank control group (n = 10). The MPQ procedure consisted of soft tissue mobilization of the Qiao-Gong acupoint on the front edge of the sternocleidomastoid muscle applied from top to bottom, by flat pushing with the thumb repeatedly for 20 times. Disease in the CAS models was induced by carotid artery balloon injury combined with a high-fat diet for 12 weeks. At the end of modeling, carotid color Doppler ultrasonography examination was performed to confirm which animal models were successfully induced with CAS, excluding model rabbits without typical CAS at the same time. Then, MPQ was applied on rabbits in the CAS-MPQ and the normal-MPQ groups for 3 weeks. By contrast, rabbits in the other 2 groups were fed normally without MPQ. Uniaxial failure tests were later performed on carotid arteries in all 4 groups, and at the end of the study, a 2-way factorial analysis of variance of the results was conducted. (1) At the end of modeling, 10 rabbits in the CAS-MPQ group and 9 in the CAS group were included with typical carotid atherosclerotic characteristics. (2) Young's elastic modulus of the rabbit carotid artery increased more significantly in the CAS-MPQ group than the CAS group. (3) Compared with normal rabbit carotid arteries, atherosclerotic carotid arteries had lower levels of ultimate stress and ultimate strain but higher levels of ultimate load. The uniaxial tensile mechanical properties of the rabbit atherosclerotic carotid artery were impaired after MPQ. Copyright © 2018. Published by Elsevier Inc.

  6. Optimization study on pin tip diameter of an impact-pin nozzle at high pressure ratio

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, C. Palani; Lee, Kwon Hee [FMTRC, Daejoo Machinery Co. Ltd., Daegu (Korea, Republic of); Park, Tae Choon; Cha, Bong Jun [Engine Components Research Team, Korea Aerospace Research Institute, Daejeon (Korea, Republic of); Kim, Heuy Dong [Dept. of Mechanical Engineering, Andong National University, Andong (Korea, Republic of)

    2016-09-15

    Wet compression system is typically installed in a gas turbine engine to increase the net power output and efficiency. A crucial component of the wet compression system is the nozzle which generates fine water droplets for injection into the compressor. The main objective of present work is to optimize a kind of nozzle called impact-pin spray nozzle and thereby produce better quality droplets. To achieve this, the dynamics occurring in the water jet impinging on the pin tip, the subsequent formation of water sheet, which finally breaks into water droplets, must be studied. In this manuscript, the progress on the numerical studies on impact-pin nozzle are reported. A small computational domain covering the orifice, pin tip and the region where primary atomization occurs is selected for numerical analysis. The governing equations are selected in three dimensional cartesian form and simulations are performed to predict the dynamics of water jet impinging on the pin. Systematic studies were carried out and the results leading to the choice of turbulence model and the effect of pin tip diameter are reported here. Further studies are proposed to show the future directions of the present research work.

  7. A physico-genetic module for the polarisation of auxin efflux carriers PIN-FORMED (PIN)

    Science.gov (United States)

    Hernández-Hernández, Valeria; Barrio, Rafael A.; Benítez, Mariana; Nakayama, Naomi; Romero-Arias, José Roberto; Villarreal, Carlos

    2018-05-01

    Intracellular polarisation of auxin efflux carriers is crucial for understanding how auxin gradients form in plants. The polarisation dynamics of auxin efflux carriers PIN-FORMED (PIN) depends on both biomechanical forces as well as chemical, molecular and genetic factors. Biomechanical forces have shown to affect the localisation of PIN transporters to the plasma membrane. We propose a physico-genetic module of PIN polarisation that integrates biomechanical, molecular, and cellular processes as well as their non-linear interactions. The module was implemented as a discrete Boolean model and then approximated to a continuous dynamic system, in order to explore the relative contribution of the factors mediating PIN polarisation at the scale of single cell. Our models recovered qualitative behaviours that have been experimentally observed and enable us to predict that, in the context of PIN polarisation, the effects of the mechanical forces can predominate over the activity of molecular factors such as the GTPase ROP6 and the ROP-INTERACTIVE CRIB MOTIF-CONTAINING PROTEIN RIC1.

  8. Primary hip spica with crossed retrograde intramedullary rush pins ...

    African Journals Online (AJOL)

    Bursitis and penetration of pins at the site of Rush pin insertion is a complication associated with this method of treatment. Conclusion: Closed reduction and internal fixation with crossed Rush pins was a superior treatment method in terms of early weight bearing and restoration of normal anatomy. Keywords: Femoral ...

  9. Some aspects of continuum physics used in fuel pin modeling

    International Nuclear Information System (INIS)

    Bard, F.E.

    1975-06-01

    The mathematical formulation used in fuel pin modeling is described. Fuel pin modeling is not a simple extension of the experimental and interpretative methods used in classical mechanics. New concepts are needed to describe materials in a reactor environment. Some aspects of continuum physics used to develop these new constitutive equations for fuel pins are presented. (U.S.)

  10. Post irradiation examination on test fuel pins for PWR

    International Nuclear Information System (INIS)

    Fogaca Filho, N.; Ambrozio Filho, F.

    1981-01-01

    Certain aspects of irradiation technology on test fuel pins for PWR, are studied. The results of post irradiation tests, performed on test fuel pins in hot cells, are presented. The results of the tests permit an evaluation of the effects of irradiation on the fuel and cladding of the pin. (Author) [pt

  11. Temperature and pinning strength dependence of the critical current of a superconductor with a square periodic array of pinning sites

    International Nuclear Information System (INIS)

    Benkraouda, M.; Obaidat, I.M.; Al Khawaja, U.

    2006-01-01

    We have conducted extensive series of molecular dynamic simulations on driven vortex lattices interacting with periodic square arrays of pinning sites. In solving the over damped equation of vortex motion we took into account the vortex-vortex repulsion interaction, the attractive vortex-pinning interaction, and the driving Lorentz force at several values of temperature. We have studied the effect of varying the driving Lorentz force and varying the pinning strength on the critical current for several pinning densities, and temperature values. We have found that the pinning strength play an important role in enhancing the critical current over the whole temperature range. At low temperatures, the critical current was found to increase linearly with increasing the pinning strengths for all pinning densities. As the temperature increases, the effect of small pinning strengths diminishes and becomes insignificant at high temperatures

  12. Pinning impulsive synchronization of stochastic delayed coupled networks

    International Nuclear Information System (INIS)

    Tang Yang; Fang Jian-An; Wong W K; Miao Qing-Ying

    2011-01-01

    In this paper, the pinning synchronization problem of stochastic delayed complex network (SDCN) is investigated by using a novel hybrid pinning controller. The proposed hybrid pinning controller is composed of adaptive controller and impulsive controller, where the two controllers are both added to a fraction of nodes in the network. Using the Lyapunov stability theory and the novel hybrid pinning controller, some sufficient conditions are derived for the exponential synchronization of such dynamical networks in mean square. Two numerical simulation examples are provided to verify the effectiveness of the proposed approach. The simulation results show that the proposed control scheme has a fast convergence rate compared with the conventional adaptive pinning method. (general)

  13. The pin pixel detector--neutron imaging

    CERN Document Server

    Bateman, J E; Derbyshire, G E; Duxbury, D M; Marsh, A S; Rhodes, N J; Schooneveld, E M; Simmons, J E; Stephenson, R

    2002-01-01

    The development and testing of a neutron gas pixel detector intended for application in neutron diffraction studies is reported. Using standard electrical connector pins as point anodes, the detector is based on a commercial 100 pin connector block. A prototype detector of aperture 25.4 mmx25.4 mm has been fabricated, giving a pixel size of 2.54 mm which matches well to the spatial resolution typically required in a neutron diffractometer. A 2-Dimensional resistive divide readout system has been adapted to permit the imaging properties of the detector to be explored in advance of true pixel readout electronics. The timing properties of the device match well to the requirements of the ISIS-pulsed neutron source.

  14. Elementary pinning force for a superconducting vortex

    International Nuclear Information System (INIS)

    Hyun, O.B.; Finnemore, D.K.; Schwartzkopf, L.; Clem, J.R.

    1987-01-01

    The elementary pinning force f/sub p/ has been measured for a single vortex trapped in one of the superconducting layers of a cross-strip Josephson junction. At temperatures close to the transition temperature the vortex can be pushed across the junction by a transport current. The vortex is found to move in a small number of discrete steps before it exits the junction. The pinning force for each site is found to be asymmetric and to have a value of about 10/sup -6/ N/m at the reduced temperature, t = T/T/sub c/ = 0.95. As a function of temperature, f/sub p/ is found to vary approximately as (1-t)/sup 3/2/. .AE

  15. A facility to Search for Hidden Particles at the CERN SPS: the SHiP physics case

    CERN Document Server

    Alekhin, Sergey; Asaka, Takehiko; Batell, Brian; Bezrukov, Fedor; Bondarenko, Kyrylo; Boyarsky, Alexey; Choi, Ki-Young; Corral, Cristobal; Craig, Nathaniel; Curtin, David; Davidson, Sacha; de Gouvea, Andre; Dell'Oro, Stefano; deNiverville, Patrick; Bhupal Dev, P.S.; Dreiner, Herbi; Drewes, Marco; Eijima, Shintaro; Essig, Rouven; Fradette, Anthony; Garbrecht, Bjorn; Gavela, Belen; Giudice, Gian F.; Goodsell, Mark D.; Gorbunov, Dmitry; Gori, Stefania; Grojean, Christophe; Guffanti, Alberto; Hambye, Thomas; Hansen, Steen H.; Helo, Juan Carlos; Hernandez, Pilar; Ibarra, Alejandro; Ivashko, Artem; Izaguirre, Eder; Jaeckel, Joerg; Jeong, Yu Seon; Kahlhoefer, Felix; Kahn, Yonatan; Katz, Andrey; Kim, Choong Sun; Kovalenko, Sergey; Krnjaic, Gordan; Lyubovitskij, Valery E.; Marcocci, Simone; Mccullough, Matthew; McKeen, David; Mitselmakher, Guenakh; Moch, Sven-Olaf; Mohapatra, Rabindra N.; Morrissey, David E.; Ovchynnikov, Maksym; Paschos, Emmanuel; Pilaftsis, Apostolos; Pospelov, Maxim; Reno, Mary Hall; Ringwald, Andreas; Ritz, Adam; Roszkowski, Leszek; Rubakov, Valery; Ruchayskiy, Oleg; Schienbein, Ingo; Schmeier, Daniel; Schmidt-Hoberg, Kai; Schwaller, Pedro; Senjanovic, Goran; Seto, Osamu; Shaposhnikov, Mikhail; Shchutska, Lesya; Shelton, Jessie; Shrock, Robert; Shuve, Brian; Spannowsky, Michael; Spray, Andy; Staub, Florian; Stolarski, Daniel; Strassler, Matt; Tello, Vladimir; Tramontano, Francesco; Tripathi, Anurag; Tulin, Sean; Vissani, Francesco; Winkler, Martin W.; Zurek, Kathryn M.; CERN. Geneva. SPS and PS Experiments Committee; SPSC

    2016-10-24

    This paper describes the physics case for a new fixed target facility at CERN SPS. The SHiP (Search for Hidden Particles) experiment is intended to hunt for new physics in the largely unexplored domain of very weakly interacting particles with masses below the Fermi scale, inaccessible to the LHC experiments, and to study tau neutrino physics. The same proton beam setup can be used later to look for decays of tau-leptons with lepton flavour number non-conservation, $\\tau\\to 3\\mu$ and to search for weakly-interacting sub-GeV dark matter candidates. We discuss the evidence for physics beyond the Standard Model and describe interactions between new particles and four different portals - scalars, vectors, fermions or axion-like particles. We discuss motivations for different models, manifesting themselves via these interactions, and how they can be probed with the SHiP experiment and present several case studies. The prospects to search for relatively light SUSY and composite particles at SHiP are also discussed....

  16. THE SUNNI-SHI'ITE RIVALRY AND ITS INFLUENCE ON THE GEOPOLITICAL SITUATION OF THE MIDDLE EAST

    Directory of Open Access Journals (Sweden)

    Alexander A. Kuznetsov

    2014-01-01

    Full Text Available The article "The Sunni-Shi'ite rivalry and its influence on the geopolitical situation of the Middle East" is dedicated to the sectarian conflicts in the Middle East region in last 30 years. Author considers the Islamic revolution of 1979 in Iran as the point of departure of this conflict. Author of the article makes a difference between the Shi'ite Islamic revolutionary doctrine of Khomeini and the Salafi Islamic fundamentalism of Saudi Arabia. Author realizes the analysis of the war between Iran and Iraq in 1980-1988. This analysis is emphasized on the regional geopolitical situation and positions of the outside actors (Saudi Arabia, USA, France, Germany. Then it is covered the American invasion of Iraq in 2003 and its geopolitical consequences. To the author's mind this aggression and further empowerment of the Shi'ite majority reduced to the civil war in Iraq and exacerbation of the sectarian conflict. Author of the article considers these events as a part of the geopolitical rivalry between Iran and Saudi Arabia to unfold in the areas of Iraq, Syria and Lebanon.

  17. The Sunni-Shi'ite Rivalry And Its Influence On The Geopolitical Situation Of The Middle East

    Directory of Open Access Journals (Sweden)

    Alexander A. Kuznetsov

    2014-01-01

    Full Text Available The article "The Sunni-Shi'ite rivalry and its influence on the geopolitical situation of the Middle East" is dedicated to the sectarian conflicts in the Middle East region in last 30 years. Author considers the Islamic revolution of 1979 in Iran as the point of departure of this conflict. Author of the article makes a difference between the Shi'ite Islamic revolutionary doctrine of Khomeini and the Salafi Islamic fundamentalism of Saudi Arabia. Author realizes the analysis of the war between Iran and Iraq in 1980-1988. This analysis is emphasized on the regional geopolitical situation and positions of the outside actors (Saudi Arabia, USA, France, Germany. Then it is covered the American invasion of Iraq in 2003 and its geopolitical consequences. To the author's mind this aggression and further empowerment of the Shi'ite majority reduced to the civil war in Iraq and exacerbation of the sectarian conflict. Author of the article considers these events as a part of the geopolitical rivalry between Iran and Saudi Arabia to unfold in the areas of Iraq, Syria and Lebanon.

  18. SHI induced modification in structural, optical, dielectric and thermal properties of poly ethylene oxide films

    Energy Technology Data Exchange (ETDEWEB)

    Patel, Gnansagar B.; Bhavsar, Shilpa [Department of Physics, The M.S. University of Baroda, Vadodara 390002 (India); Singh, N.L., E-mail: nl.singh-phy@msubaroda.ac.in [Department of Physics, The M.S. University of Baroda, Vadodara 390002 (India); Singh, F.; Kulriya, P.K. [Inter University Accelerator Centre, Aruna Asaf Ali Marg, New Delhi 110067 (India)

    2016-07-15

    Poly ethylene oxide (PEO) films were synthesized by solution cast method. These self-standing films were exposed with 60 MeV C{sup +5} ion and 100 MeV Ni{sup +7} ion at different fluences. SHI induced effect was investigated by employing various techniques. The crystalline size decreased upon irradiation as observed from XRD analysis. FTIR analysis reveals the decrement in the peak intensity upon irradiation. Tauc’s method was used to determine the optical band gap (E{sub g}), which shows decreasing trends with increase of fluence. The dielectric properties were investigated in the frequency range 10 Hz to 10 MHz for unirradiated and irradiated films. The dielectric constant remains same for the broad-spectrum of frequency and increases at lower frequency. The dielectric loss also moderately influence as a function of frequency due to irradiation. DSC analysis validated the results of XRD. Scanning electron microscopy (SEM) reveals that there is significant change in the surface morphology due to irradiation.

  19. Shi Cihang 航慈釋. The First Case of Mummified Buddhist in Taiwan

    Directory of Open Access Journals (Sweden)

    Stefania Travagnin

    2006-01-01

    Full Text Available Shi Cihang 航慈釋 (1895-1954, is one of the eminent figures in the so-called Modern Buddhism in Taiwan. Engaged in improving education and training of Buddhist monks and nuns, and promoter of the so-called renjian fojiao 教佛間人 (Buddhism for the Human Realm, which refuses any sort of superstitious understanding and practice of Buddhism and calls for the return to the original and pure essence of the Dharma, Cihang is also the first Buddhist monk in Taiwan who attempted to, and eventually succeeded in, preserving his body afterdeath. Nowadays, the gilded relic-body of Cihang is enshrined and venerated in Xizhi, Taipei county, as well as being included in the list of the roushen pusa 薩菩身肉 (flesh-body Bodhisattvas who appeared in the history of Chinese Buddhism. This paper analyses Cihang’s relic-body as case-study of Chinese mummified Buddhist in the scene of contemporary Taiwan and modern Taiwanese Buddhim, discussing the Buddhist significance, sociological implications and eventual impact of mummification within the reality of the new renjian fojiao.

  20. The Variation of Riverbed Material due to Tropical Storms in Shi-Wen River, Taiwan

    Directory of Open Access Journals (Sweden)

    Chin-Ping Lin

    2014-01-01

    Full Text Available Taiwan, because of its location, is a flood prone region and is characterised by typhoons which brings about two-thirds to three quarters of the annual rainfall amount. Consequently, enormous flows result in rivers and entrain some fractions of the grains that constitute the riverbed. Hence, the purpose of the study is to quantify the impacts of these enormous flows on the distribution of grain size in riverbeds. The characteristics of riverbed material prior to and after the typhoon season are compared in Shi-Wen River located at southern Taiwan. These include grain size variation, bimodality, and roughness coefficient. A decrease (65% and increase (50% in geometric mean size of grains were observed for subsurface and surface bed material, respectively. Geometric standard deviation decreased in all sites after typhoon. Subsurface material was bimodal prior to typhoons and polymodal after. For surface material, modal class is in the gravel class, while after typhoons it shifts towards cobble class. The reduction in geometric mean resulted to a decrease in roughness coefficient by up to 30%. Finally, the relationship of Shields and Froude numbers are studied and a change in the bed form to antidunes and transition form is observed, respectively.

  1. The variation of riverbed material due to tropical storms in Shi-Wen River, Taiwan.

    Science.gov (United States)

    Lin, Chin-Ping; Wang, Yu-Min; Tfwala, Samkele S; Chen, Ching-Nuo

    2014-01-01

    Taiwan, because of its location, is a flood prone region and is characterised by typhoons which brings about two-thirds to three quarters of the annual rainfall amount. Consequently, enormous flows result in rivers and entrain some fractions of the grains that constitute the riverbed. Hence, the purpose of the study is to quantify the impacts of these enormous flows on the distribution of grain size in riverbeds. The characteristics of riverbed material prior to and after the typhoon season are compared in Shi-Wen River located at southern Taiwan. These include grain size variation, bimodality, and roughness coefficient. A decrease (65%) and increase (50%) in geometric mean size of grains were observed for subsurface and surface bed material, respectively. Geometric standard deviation decreased in all sites after typhoon. Subsurface material was bimodal prior to typhoons and polymodal after. For surface material, modal class is in the gravel class, while after typhoons it shifts towards cobble class. The reduction in geometric mean resulted to a decrease in roughness coefficient by up to 30%. Finally, the relationship of Shields and Froude numbers are studied and a change in the bed form to antidunes and transition form is observed, respectively.

  2. Neurologic deterioration with progressive CT changes in a child with Kearns-Shy syndrome

    International Nuclear Information System (INIS)

    Yoda, Satoru; Kitahara, Fuminori; Akabane, Taro; Terauchi, Akiko.

    1984-01-01

    A case of the rare juvenile form of Kearns-Shy syndrome with progressive external ophthalmoplegia and lid ptosis, carditis, skeletal muscle weakness, seizures, mental subnormality, short stature, EEG abnormality and deafness is presented. Electromyography revealed a myopathic pattern. Histochemical studies on quadriceps biopsy specimens showed atrophy of type II fibers and ''ragged-red fibers.'' On electron microscopy these muscle cells were seen to contain an increased amount of glycogen particles and abnormal mitochondria were increased in number and size. It is of interest that abrupt deterioration of neurological findings such as seizures, mental subnormality, speech disturbance and deafness was present in our case. Computed tomographic scanning showed progressive changes of cerebral atrophy, low density of cerebral white matter and basal ganglia calcification, which were well associated with the clinical deterioration. A review of the literature also indicated that some patients with this syndrome showed abrupt neurological deterioration in childhood. Involvement of the central nervous system in this syndrome has to be considered as the cause of sudden deterioration and death in childhood. (author)

  3. Prevalence of consanguineous marriages among shi'a populations of Lebanon.

    Science.gov (United States)

    El-Kheshen, Ghadir; Saadat, Mostafa

    2013-09-01

    In genetics, a consanguineous marriage means union between couples who are related as second cousins or closer. The present cross-sectional study was carried out in order to illustrate the prevalence and types of consanguineous marriages in the Shi'a population living in widespread territories in Lebanon including the Bekaa Valley, the south of Lebanon and the southern suburb of Beirut. Data on types of marriages were collected using a simple questionnaire. The total number of couples in the study was 1203. Consanguineous marriage was classified by the degree of relationship between couples. The overall frequency of consanguinity was found to be 28.4%, with first cousin marriages (21.3%) being the most common type followed by first cousins once removed (5.5%), then double first cousins (0.8%). The frequencies of second cousin and beyond second cousin marriages were the same at 0.4% of all the marriages. The mean inbreeding coefficient (α) was estimated at about 0.0161 for the population. There were no significant differences between the three studied territories for frequencies of different types of marriages (p>0.1), nor were there significant differences between the rural and urban areas (p>0.1).

  4. CATS, continuous automated testing of seismological, hydroacoustic, and infrasound (SHI) processing software.

    Science.gov (United States)

    Brouwer, Albert; Brown, David; Tomuta, Elena

    2017-04-01

    To detect nuclear explosions, waveform data from over 240 SHI stations world-wide flows into the International Data Centre (IDC) of the Comprehensive Nuclear-Test-Ban Treaty Organization (CTBTO), located in Vienna, Austria. A complex pipeline of software applications processes this data in numerous ways to form event hypotheses. The software codebase comprises over 2 million lines of code, reflects decades of development, and is subject to frequent enhancement and revision. Since processing must run continuously and reliably, software changes are subjected to thorough testing before being put into production. To overcome the limitations and cost of manual testing, the Continuous Automated Testing System (CATS) has been created. CATS provides an isolated replica of the IDC processing environment, and is able to build and test different versions of the pipeline software directly from code repositories that are placed under strict configuration control. Test jobs are scheduled automatically when code repository commits are made. Regressions are reported. We present the CATS design choices and test methods. Particular attention is paid to how the system accommodates the individual testing of strongly interacting software components that lack test instrumentation.

  5. arXiv Search for new physics with the SHiP experiment at CERN

    CERN Document Server

    Lantwin, Oliver

    2017-12-01

    SHiP is a new general purpose fixed target experiment at the CERN SPS designed to complement LHC experiments in the search for new physics. In its initial phase, the $400$ GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating $2\\times10^{20}$ pot in 5 years. Shielded by an active muon shield, a dedicated detector, based on a long decay volume followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles with masses below $\\mathcal{O}(10)\\; \\mathrm{GeV}/{c^2}$. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutral Leptons. The sensitivity to Heavy Neutral Leptons will allow for the first time to probe, in the mass range above the kaon mass, a coupling range for which Baryogenesis and active neutrino masses could also be explained. A dedicated emulsion-based detector will allow detection of ...

  6. Top-nozzle mounted replacement guide pin assemblies

    International Nuclear Information System (INIS)

    Gilmore, C.B.; Andrews, W.H.

    1993-01-01

    A replacement guide pin assembly is provided for aligning a nuclear fuel assembly with an upper core plate of a nuclear reactor core. The guide pin assembly includes a guide pin body having a radially expandable base insertable within a hole in the top nozzle, a ferrule insertable within the guide pin base and capable of imparting a radially and outwardly directed force on the expandable base to expand it within the hole of the top nozzle and thereby secure the guide pin body to the top nozzle in response to a predetermined displacement of the ferrule relative to the guide pin body along its longitudinal axis, and a lock screw interfitted with the ferrule and threaded into the guide pin body so as to produce the predetermined displacement of the ferrule. (author)

  7. Timing analysis of PWR fuel pin failures

    International Nuclear Information System (INIS)

    Jones, K.R.; Wade, N.L.; Katsma, K.R.; Siefken, L.J.; Straka, M.

    1992-09-01

    Research has been conducted to develop and demonstrate a methodology for calculation of the time interval between receipt of the containment isolation signals and the first fuel pin failure for loss-of-coolant accidents (LOCAs). Demonstration calculations were performed for a Babcock and Wilcox (B ampersand W) design (Oconee) and a Westinghouse (W) four-loop design (Seabrook). Sensitivity studies were performed to assess the impacts of fuel pin bumup, axial peaking factor, break size, emergency core cooling system availability, and main coolant pump trip on these times. The analysis was performed using the following codes: FRAPCON-2, for the calculation of steady-state fuel behavior; SCDAP/RELAP5/MOD3 and TRACPF1/MOD1, for the calculation of the transient thermal-hydraulic conditions in the reactor system; and FRAP-T6, for the calculation of transient fuel behavior. In addition to the calculation of fuel pin failure timing, this analysis provides a comparison of the predicted results of SCDAP/RELAP5/MOD3 and TRAC-PFL/MOD1 for large-break LOCA analysis. Using SCDAP/RELAP5/MOD3 thermal-hydraulic data, the shortest time intervals calculated between initiation of containment isolation and fuel pin failure are 10.4 seconds and 19.1 seconds for the B ampersand W and W plants, respectively. Using data generated by TRAC-PF1/MOD1, the shortest intervals are 10.3 seconds and 29.1 seconds for the B ampersand W and W plants, respectively. These intervals are for a double-ended, offset-shear, cold leg break, using the technical specification maximum peaking factor and applied to fuel with maximum design bumup. Using peaking factors commensurate widi actual bumups would result in longer intervals for both reactor designs. This document also contains appendices A through J of this report

  8. Performance measurements of hybrid PIN diode arrays

    International Nuclear Information System (INIS)

    Jernigan, J.G.; Arens, J.F.; Collins, T.; Herring, J.; Shapiro, S.L.; Wilburn, C.D.

    1990-05-01

    We report on the successful effort to develop hybrid PIN diode arrays and to demonstrate their potential as components of vertex detectors. Hybrid pixel arrays have been fabricated by the Hughes Aircraft Co. by bump bonding readout chips developed by Hughes to an array of PIN diodes manufactured by Micron Semiconductor Inc. These hybrid pixel arrays were constructed in two configurations. One array format having 10 x 64 pixels, each 120 μm square, and the other format having 256 x 256 pixels, each 30 μm square. In both cases, the thickness of the PIN diode layer is 300 μm. Measurements of detector performance show that excellent position resolution can be achieved by interpolation. By determining the centroid of the charge cloud which spreads charge into a number of neighboring pixels, a spatial resolution of a few microns has been attained. The noise has been measured to be about 300 electrons (rms) at room temperature, as expected from KTC and dark current considerations, yielding a signal-to-noise ratio of about 100 for minimum ionizing particles. 4 refs., 13 figs

  9. Applicability of the diffusion and simplified P3 theories for BWR pin-by-pin core analysis

    International Nuclear Information System (INIS)

    Tada, Kenichi; Yamamoto, Akio; Kitamura, Yasunori; Yamane, Yoshihiro; Watanabe, Masato; Noda, Hiroshi

    2007-01-01

    The pin-by-pin fine mesh core calculation method is considered as a candidate of next-generation core calculation method for BWR. In this study, the diffusion and the simplified P 3 (SP 3 ) theories are applied to the pin-by-pin core analysis of BWR. Performances of the diffusion and the SP 3 theories for cell-homogeneous pin-by-pin fine mesh BWR core analysis are evaluated through comparison with cell-heterogeneous detailed transport calculation by the method of characteristics (MOC). In this study, two-dimensional, 2x2 multi-assemblies geometry is used to compare the prediction accuracies of the diffusion and the SP 3 theories. The 2x2 multi- assemblies geometry consists of two types of 9x9 UO 2 assembly that have two different enrichment splittings. To mitigate the cell-homogenization error, the SPH method is applied for the pin-by-pin fine mesh calculation. The SPH method is a technique that reproduces a result of heterogeneous calculation by that of homogeneous calculation. The calculation results indicated that diffusion theory shows larger discrepancy than that of SP 3 theory on pin-wise fission rates. Furthermore, the accuracy of the diffusion theory would not be sufficient for the pin-by-pin fine mesh calculation. In contrast to the diffusion theory, the SP 3 theory shows much better accuracy on pin wise fission rates. Therefore, if the SP 3 theory is applied, the accuracy of the pin-by-pin fine mesh BWR core analysis will be higher and will be sufficient for production calculation. (author)

  10. A proposed parameterization of interface discontinuity factors depending on neighborhood for pin-by-pin diffusion computations for LWR

    International Nuclear Information System (INIS)

    Herrero, Jose Javier; Garcia-Herranz, Nuria; Ahnert, Carol

    2011-01-01

    There exists an interest in performing full core pin-by-pin computations for present nuclear reactors. In such type of problems the use of a transport approximation like the diffusion equation requires the introduction of correction parameters. Interface discontinuity factors can improve the diffusion solution to nearly reproduce a transport solution. Nevertheless, calculating accurate pin-by-pin IDF requires the knowledge of the heterogeneous neutron flux distribution, which depends on the boundary conditions of the pin-cell as well as the local variables along the nuclear reactor operation. As a consequence, it is impractical to compute them for each possible configuration. An alternative to generate accurate pin-by-pin interface discontinuity factors is to calculate reference values using zero-net-current boundary conditions and to synthesize afterwards their dependencies on the main neighborhood variables. In such way the factors can be accurately computed during fine-mesh diffusion calculations by correcting the reference values as a function of the actual environment of the pin-cell in the core. In this paper we propose a parameterization of the pin-by-pin interface discontinuity factors allowing the implementation of a cross sections library able to treat the neighborhood effect. First results are presented for typical PWR configurations. (author)

  11. A proposed parameterization of interface discontinuity factors depending on neighborhood for pin-by-pin diffusion computations for LWR

    Energy Technology Data Exchange (ETDEWEB)

    Herrero, Jose Javier; Garcia-Herranz, Nuria; Ahnert, Carol, E-mail: herrero@din.upm.es, E-mail: nuria@din.upm.es, E-mail: carol@din.upm.es [Departamento de Ingenieria Nuclear, Universidad Politecnica de Madrid (Spain)

    2011-07-01

    There exists an interest in performing full core pin-by-pin computations for present nuclear reactors. In such type of problems the use of a transport approximation like the diffusion equation requires the introduction of correction parameters. Interface discontinuity factors can improve the diffusion solution to nearly reproduce a transport solution. Nevertheless, calculating accurate pin-by-pin IDF requires the knowledge of the heterogeneous neutron flux distribution, which depends on the boundary conditions of the pin-cell as well as the local variables along the nuclear reactor operation. As a consequence, it is impractical to compute them for each possible configuration. An alternative to generate accurate pin-by-pin interface discontinuity factors is to calculate reference values using zero-net-current boundary conditions and to synthesize afterwards their dependencies on the main neighborhood variables. In such way the factors can be accurately computed during fine-mesh diffusion calculations by correcting the reference values as a function of the actual environment of the pin-cell in the core. In this paper we propose a parameterization of the pin-by-pin interface discontinuity factors allowing the implementation of a cross sections library able to treat the neighborhood effect. First results are presented for typical PWR configurations. (author)

  12. Genome-wide identification and evolution of the PIN-FORMED (PIN) gene family in Glycine max.

    Science.gov (United States)

    Liu, Yuan; Wei, Haichao

    2017-07-01

    Soybean (Glycine max) is one of the most important crop plants. Wild and cultivated soybean varieties have significant differences worth further investigation, such as plant morphology, seed size, and seed coat development; these characters may be related to auxin biology. The PIN gene family encodes essential transport proteins in cell-to-cell auxin transport, but little research on soybean PIN genes (GmPIN genes) has been done, especially with respect to the evolution and differences between wild and cultivated soybean. In this study, we retrieved 23 GmPIN genes from the latest updated G. max genome database; six GmPIN protein sequences were changed compared with the previous database. Based on the Plant Genome Duplication Database, 18 GmPIN genes have been involved in segment duplication. Three pairs of GmPIN genes arose after the second soybean genome duplication, and six occurred after the first genome duplication. The duplicated GmPIN genes retained similar expression patterns. All the duplicated GmPIN genes experienced purifying selection (K a /K s genome sequence of 17 wild and 14 cultivated soybean varieties. Our research provides useful and comprehensive basic information for understanding GmPIN genes.

  13. Robustness of pinning a general complex dynamical network

    International Nuclear Information System (INIS)

    Wang Lei; Sun Youxian

    2010-01-01

    This Letter studies the robustness problem of pinning a general complex dynamical network toward an assigned synchronous evolution. Several synchronization criteria are presented to guarantee the convergence of the pinning process locally and globally by construction of Lyapunov functions. In particular, if a pinning strategy has been designed for synchronization of a given complex dynamical network, then no matter what uncertainties occur among the pinned nodes, synchronization can still be guaranteed through the pinning. The analytical results show that pinning control has a certain robustness against perturbations on network architecture: adding, deleting and changing the weights of edges. Numerical simulations illustrated by scale-free complex networks verify the theoretical results above-acquired.

  14. Is magnetic pinning a dominant mechanism in Nb-Ti

    International Nuclear Information System (INIS)

    Cooley, L.D.; Lee, P.J.; Larbalestier, D.C.

    1991-01-01

    In this paper, the authors compare the pinning behavior of an artificial pinning center (APC) composite and a nanometer-filament Nb 46.5 wt% Ti composite to that of a conventional Nb 48 wt% Ti composite. The microstructure of the APC composite resembles the conventional composite, where ribbons of normal metal form the pinning centers, whereas the nanometer-filament composite has no internal normal metal but pins instead at the filament surface. The APC composite exhibits much stronger pinning relative to B c 2 than the conventional composite (21.4 GN/m 3 , 7 T vs. 18.9 GN/m 3 , 11 T), which is possibly due to the increased amount of pinning center (50 vol.% vs. 25 vol.%), however the proximity effect reduces the B c 2 unfavorably

  15. Ferromagnetic artificial pinning centers in multifilamentary superconducting wires

    International Nuclear Information System (INIS)

    Wang, J.Q.; Rizzo, N.D.; Prober, D.E.

    1997-01-01

    The authors fabricated multifilamentary NbTi wires with ferromagnetic (FM) artificial pinning centers (APCs) to enhance the critical current density (J c ) in magnetic fields. They used a bundle and draw technique to process the APC wires with either Ni or Fe as the pinning centers. Both wires produced higher J c in the high field range (5-9 T) than previous non-magnetic APC wires similarly processed, even though the authors have not yet optimized pin percentage. Using a magnetometer they found that the pins remained ferromagnetic for the wires with maximum J c . However, they did observe a substantial loss of FM material for the wires where the pin diameter approached 3 nm. Thus, they expect further enhancement of J c with better pin quality

  16. Correlation of creep and swelling with fuel pin performance

    International Nuclear Information System (INIS)

    Jackson, R.J.; Washburn, D.F.; Garner, F.A.; Gilbert, E.R.

    1975-09-01

    The HEDL PNL-11 experiment described was one in a series of fueled subassemblies irradiated in EBR-II to demonstrate the adequacy of the FFTF fuel pin design. The cladding material, dimensions, and fuel density are prototypic of FFTF. Because neutron flux in EBR-II is lower than in FFTF, the uranium enrichment is higher in these experimental fuel pins, irradiated in EBR-II, than the FFTF enrichment for comparable linear heat rates. Some pertinent oprating conditions for the center fuel pin in this experiment are listed. This 37-pin subassembly represents, at 110,000 MWd/MTM, the highest burnup yet attained by a prototypic FFTF subassembly. Similarly, this is the highest fluence presently attained by prototypic fuel pins. A cladding breach occurred in one fuel pin which is presently being examined. Results are presented and discussed

  17. Analysis of three idealized reactor configurations: plate, pin, and homogeneous

    International Nuclear Information System (INIS)

    McKnight, R.D.

    1983-01-01

    Detailed Monte Carlo calculations have been performed for three distinct configurations of an idealized fast critical assembly. This idealized assembly was based on the LMFBR benchmark critical assembly ZPR-6/7. In the first configuration, the entire core was loaded with the plate unit cell of ZPR-6/7. In the second configuration, the entire core was loaded with the ZPR sodium-filled pin calandria. The actual ZPR pin calandria are loaded with mixed (U,Pu) oxide pins which closely match the composition of the ZPR-6/7 plate unit cell. For the present study, slight adjustments were made in the atom concentrations and the length of the pin calandria in order to make the core boundaries and average composition for the pin-cell configuration identical to those of the plate-cell configuration. In the third configuration, the core was homogeneous, again with identical core boundaries and average composition as the plate and pin configurations

  18. Analytic models for fuel pin transient performance

    International Nuclear Information System (INIS)

    Bard, F.E.; Fox, G.L.; Washburn, D.F.; Hanson, J.E.

    1976-09-01

    HEDL's ability to analyze various mechanisms that operate within a fuel pin has progressed substantially through development of codes such as PECTCLAD, which solves cladding response, and DSTRESS, which solves fuel response. The PECTCLAD results show good correlation with a variety of mechanical tests on cladding material and also demonstrate the significance of cladding strength when applying the life fraction rule. The DSTRESS results have shown that fuel deforms sufficiently during overpower transient tests that available volumes are filled, whether in the form of a central cavity or start-up cracks

  19. Optimum Prestress of Tanks with Pinned Base

    DEFF Research Database (Denmark)

    Brøndum-Nielsen, Troels

    1998-01-01

    Amin Ghali and Eleanor Elliott presented in their paper an interesting suggestion for prestressing of circular tanks without sliding joints. For many prestressed tanks the following construction procedure is adopted:In order to ensure compressive hoop forces in the wall near the base, the wall...... is allowed to slide freely in the radial direction during tensioning (free base).After tensioning such displacements are prevented (pinned base). The present paper addresses the problem of prestress of such tanks.Keywords: circular prestressing; creep properties; prestressed concrete; redistribution...

  20. On the obstructions to non-Cliffordian pin structures

    Energy Technology Data Exchange (ETDEWEB)

    Chamblin, A. (Dept. of Applied Maths and Theoretical Physics, Univ. of Cambridge (United Kingdom))

    1994-07-01

    We derive the topological obstructions to the existence of non-Cliffordian pin structures on four-dimensional spacetimes. We apply these obstructions to the study of non-Cliffordian pin-Lorentz cobordism. We note that our method of derivation applies equally well in any dimension and in any signature, and we present a general format for calculating obstructions in these situations. Finally, we interpret the breakdown of pin structure and discuss the relevance of this to aspects of physics. (orig.)

  1. Sodium erosion of boron carbide from breached absorber pins

    International Nuclear Information System (INIS)

    Basmajian, J.A.; Baker, D.E.

    1981-03-01

    The purpose of the irradiation experiment was to provide an engineering demonstration of the irradiation behavior of breached boron carbide absorber pins. By building defects into the cladding of prototypic absorber pins, and performing the irradiation under typical FFTF operating conditions, a qualitative assessment of the consequences of a breach was achieved. Additionally, a direct comparison of pin behavior with that of the ex-reactor test could be made

  2. Cell homogenization methods for pin-by-pin core calculations tested in slab geometry

    International Nuclear Information System (INIS)

    Yamamoto, Akio; Kitamura, Yasunori; Yamane, Yoshihiro

    2004-01-01

    In this paper, performances of spatial homogenization methods for fuel or non-fuel cells are compared in slab geometry in order to facilitate pin-by-pin core calculations. Since the spatial homogenization methods were mainly developed for fuel assemblies, systematic study of their performance for the cell-level homogenization has not been carried out. Importance of cell-level homogenization is recently increasing since the pin-by-pin mesh core calculation in actual three-dimensional geometry, which is less approximate approach than current advanced nodal method, is getting feasible. Four homogenization methods were investigated in this paper; the flux-volume weighting, the generalized equivalence theory, the superhomogenization (SPH) method and the nonlinear iteration method. The last one, the nonlinear iteration method, was tested as the homogenization method for the first time. The calculations were carried out in simplified colorset assembly configurations of PWR, which are simulated by slab geometries, and homogenization performances were evaluated through comparison with the reference cell-heterogeneous calculations. The calculation results revealed that the generalized equivalence theory showed best performance. Though the nonlinear iteration method can significantly reduce homogenization error, its performance was not as good as that of the generalized equivalence theory. Through comparison of the results obtained by the generalized equivalence theory and the superhomogenization method, important byproduct was obtained; deficiency of the current superhomogenization method, which could be improved by incorporating the 'cell-level discontinuity factor between assemblies', was clarified

  3. Development of 3D pseudo pin-by-pin calculation methodology in ANC

    International Nuclear Information System (INIS)

    Zhang, B.; Mayhue, L.; Huria, H.; Ivanov, B.

    2012-01-01

    Advanced cores and fuel assembly designs have been developed to improve operational flexibility, economic performance and further enhance safety features of nuclear power plants. The simulation of these new designs, along with strong heterogeneous fuel loading, have brought new challenges to the reactor physics methodologies currently employed in the industrial codes for core analyses. Control rod insertion during normal operation is one operational feature in the AP1000 R plant of Westinghouse next generation Pressurized Water Reactor (PWR) design. This design improves its operational flexibility and efficiency but significantly challenges the conventional reactor physics methods, especially in pin power calculations. The mixture loading of fuel assemblies with significant neutron spectrums causes a strong interaction between different fuel assembly types that is not fully captured with the current core design codes. To overcome the weaknesses of the conventional methods, Westinghouse has developed a state-of-the-art 3D Pin-by-Pin Calculation Methodology (P3C) and successfully implemented in the Westinghouse core design code ANC. The new methodology has been qualified and licensed for pin power prediction. The 3D P3C methodology along with its application and validation will be discussed in the paper. (authors)

  4. Trending on Pinterest: an examination of pins about skin tanning.

    Science.gov (United States)

    Banerjee, Smita C; Rodríguez, Vivian M; Greene, Kathryn; Hay, Jennifer L

    2018-04-10

    Rates of melanoma and nonmelanoma skin cancers are on the rise in the USA with data revealing disproportionate increase in female young adults. The popularity of intentional skin tanning among U.S. adolescents is attributed to several factors, including prioritization of physical appearance, media images of tanned celebrities, ease of availability of artificial tanning facilities, and more recently, the prevalence and celebration of tanned skin on social media. Pinterest, as the third most popular social media platform, was searched for "pins" about skin tanning. The resultant "pins" were examined to understand the extent and characteristics of skin tanning portrayed on Pinterest. We analyzed pins on Pinterest about skin tanning (n = 501) through a quantitative content analysis. Overall, results indicated an overwhelmingly protanning characteristic of pins about skin tanning on Pinterest, with over 85% of pins promoting tanning behavior. The pins were generally characterized by the portrayal of a female subject (61%) and provided positive reinforcement for tanning (49%). Use of tanning for enhancing appearance was the main positive outcome expectancy portrayed in the pins (35%), and nudity or exposure of skin on arms (32%) and legs (31%) was evident in about a third of pins. With overwhelmingly positive pins promoting tanning, use of female subjects, exhibiting nudity, and appearance enhancement, there seems be to a consistent targeting of female users to accept tanning as a socially acceptable and popular behavior. The findings indicate a need for developing sun protection messages and the leveraging of social media for dissemination of skin cancer prevention and detection messages.

  5. The pin pixel detector--X-ray imaging

    CERN Document Server

    Bateman, J E; Derbyshire, G E; Duxbury, D M; Marsh, A S; Simmons, J E; Stephenson, R

    2002-01-01

    The development and testing of a soft X-ray gas pixel detector, which uses connector pins for the anodes is reported. Based on a commercial 100 pin connector block, a prototype detector of aperture 25.4 mm centre dot 25.4 mm can be economically fabricated. The individual pin anodes all show the expected characteristics of small gas detectors capable of counting rates reaching 1 MHz per pin. A 2-dimensional resistive divide readout system has been developed to permit the imaging properties of the detector to be explored in advance of true pixel readout electronics.

  6. Reconstruction calculation of pin power for ship reactor core

    International Nuclear Information System (INIS)

    Li Haofeng; Shang Xueli; Chen Wenzhen; Wang Qiao

    2010-01-01

    Aiming at the limitation of the software that pin power distribution for ship reactor core was unavailable, the calculation model and method of the axial and radial pin power distribution were proposed. Reconstruction calculations of pin power along axis and radius was carried out by bicubic and bilinear interpolation and cubic spline interpolation, respectively. The results were compared with those obtained by professional reactor physical soft with fine mesh difference. It is shown that our reconstruction calculation of pin power is simple and reliable as well as accurate, which provides an important theoretic base for the safety analysis and operating administration of the ship nuclear reactor. (authors)

  7. Vortex pinning landscape in MOD-TFA YBCO nanostroctured films

    Science.gov (United States)

    Gutierrez, J.; Puig, T.; Pomar, A.; Obradors, X.

    2008-03-01

    A methodology of general validity to study vortex pinning in YBCO based on Jc transport measurements is described. It permits to identify, separate and quantify three basic vortex pinning contributions associated to anisotropic-strong, isotropic-strong and isotropic-weak pinning centers. Thereof, the corresponding vortex pinning phase diagrams are built up. This methodology is applied to the new solution-derived YBCO nanostructured films, including controlled interfacial pinning by the growth of nanostructured templates by means of self-assembled processes [1] and YBCO-BaZrO3 nanocomposites prepared by modified solution precursors. The application of the methodology and comparison with a standard solution-derived YBCO film [2], enables us to identify the nature and the effect of the additional pinning centers induced. The nanostructured templates films show c-axis pinning strongly increased, controlling most of the pinning phase diagram. On the other hand, the nanocomposites have achieved so far, the highest pinning properties in HTc-superconductors [3], being the isotropic-strong defects contribution the origin of their unique properties. [1] M. Gibert et al, Adv. Mat. vol 19, p. 3937 (2007) [2] Puig.T et al, SuST EUCAS 2007 (to be published) [3] J. Gutierrez et al, Nat. Mat. vol. 6, p. 367 (2007) * Work supported by HIPERCHEM, NANOARTIS and MAT2005-02047

  8. ITP Hanford Type 40 pin electrical connector failure analysis

    International Nuclear Information System (INIS)

    Imrich, K.J.

    1993-01-01

    Corrosion products observed on the ITP Hanford Type 40 pin electrical connectors would be expected to adversely affect the power and control signals supplied to process equipment in the filter cell by the connectors. Corrosion products were consistent with those found on similar pins in DWPF. The recommendations based on the findings in this investigation are as follows: (1) Replace male and female rhodium plated pins with gold plated pins. (2) Replace the galvanized carbon steel spring on the male connector with a stainless steel spring. (3) Install protective caps over Hanford connectors when jumpers are removed

  9. Fuel-pin cladding transient failure strain criterion

    International Nuclear Information System (INIS)

    Bard, F.E.; Duncan, D.R.; Hunter, C.W.

    1983-01-01

    A criterion for cladding failure based on accumulated strain was developed for mixed uranium-plutonium oxide fuel pins and used to interpret the calculated strain results from failed transient fuel pin experiments conducted in the Transient Reactor Test (TREAT) facility. The new STRAIN criterion replaced a stress-based criterion that depends on the DORN parameter and that incorrectly predicted fuel pin failure for transient tested fuel pins. This paper describes the STRAIN criterion and compares its prediction with those of the stress-based criterion

  10. Dynamic Phases of Vortices in Superconductors with Periodic Pinning

    International Nuclear Information System (INIS)

    Reichhardt, C.; Olson, C.; Nori, F.

    1997-01-01

    We present results from extensive simulations of driven vortex lattices interacting with periodic arrays of pinning sites. Changing an applied driving force produces a rich variety of novel dynamical plastic flow phases which are very distinct from those observed in systems with random pinning arrays. Signatures of the transition between these different dynamical phases include sudden jumps in the current-voltage curves as well as marked changes in the vortex trajectories and vortex lattice order. Several dynamical phase diagrams are obtained as a function of commensurability, pinning strength, and spatial order of the pinning sites. copyright 1997 The American Physical Society

  11. Positioning and locking device for fuel pin to grid attachment

    International Nuclear Information System (INIS)

    Frick, T.M.; Wineman, A.L.

    1976-01-01

    A positioning and locking device for fuel pin to grid attachment provides an inexpensive means of positively positioning and locking the individual fuel pins which make up the driver fuel assemblies used in nuclear reactors. The device can be adapted for use with a currently used attachment grid assembly design and insures that the pins remain in their proper position throughout the in-reactor life of the assembly. This device also simplifies fuel bundle assembly in that a complete row of fuel pins can be added to the bundle during each step of assembly. 8 claims, 8 drawing figures

  12. Heat transfer in a fuel pin shipping container

    International Nuclear Information System (INIS)

    Ingham, J.G.

    1980-01-01

    Maximum cladding temperatures occur when the IDENT 1578 fuel pin shipping container is installed in the T-3 Cask. The maximum allowable cladding temperature of 800 0 F is reached when the rate of energy deposited in the 19-pin basket reaches 400 watts. Since 45% of the energy which is generated in the fuel escapes the 19-pin basket without being deposited, mostly gamma energy, the maximum allowable rate of heat generation is 400/.55 = 727 watts. Similarly, the maximum allowable cladding temperature of 800 0 F is reached when the rate of energy deposited in the 40-pin basket reaches 465 watts. Since 33% of the energy which is generated in the fuel escapes the 40-pin basket without being deposited, mostly gamma energy, the maximum allowable rate of heat generation is 465/.66 = 704 watts. The IDENT 1578 fuel pin shipping container therefore meets its thermal design criteria. IDENT 1578 can handle fuel pins with a decay heat load of 600 watts while maintaining the maximum fuel pin cladding temperature below 800 0 F. The emissivities which were determined from the test results for the basket tubes and container are relatively low and correspond to new, shiny conditions. As the IDENT 1578 container is exposed to high temperatures for extended periods of time during the transportation of fuel pins, the emissivities will probably increase. This will result in reduced temperatures

  13. Nano-engineered pinning centres in YBCO superconducting films

    Energy Technology Data Exchange (ETDEWEB)

    Crisan, A., E-mail: adrian.crisan@infim.ro [National Institute for Materials Physics Bucharest, 105 bis Atomistilor Str., 077125 Magurele (Romania); School of Metallurgy and Materials, University of Birmingham, Edgbaston, B15 2TT Birmingham (United Kingdom); Dang, V.S. [School of Metallurgy and Materials, University of Birmingham, Edgbaston, B15 2TT Birmingham (United Kingdom); Nano and Energy Center, VNU Hanoi University of Science, 334 Nguyen Trai, Thanh Xuan, Hanoi (Viet Nam); Mikheenko, P. [School of Metallurgy and Materials, University of Birmingham, Edgbaston, B15 2TT Birmingham (United Kingdom); Department of Physics, University of Oslo, P.O. Box 1048 Blindern, N-0316 Oslo (Norway)

    2017-02-15

    Highlights: • Power applications of YBCO films/coated conductors in technological relevant magnetic fields requires nano-engineered pinning centre. • Three approaches have been proposed: substrate decoration, quasi-multilayers, and targets with secondary phase nano-inclusions. • Combination of all three approaches greatly increased critical current in YBCO films. • Bulk pinning force, pinning potential, and critical current density are estimated and discussed in relation with the type and strength of pinning centres related to the defects evidenced by Transmission Electron Microscopy. - Abstract: For practical applications of superconducting materials in applied magnetic fields, artificial pinning centres in addition to natural ones are required to oppose the Lorentz force. These pinning centres are actually various types of defects in the superconductor matrix. The pinning centres can be categorised on their dimension (volume, surface or point) and on their character (normal cores or Δκ cores). Different samples have been produced by Pulsed Laser Deposition, with various thicknesses, temperatures and nanostructured additions to the superconducting matrix. They have been characterized by SQUID Magnetic Properties Measurement System and Physical Properties Measurement System, as well as by Transmission Electron Microscopy (TEM). Correlations between pinning architecture, TEM images, and critical currents at various fields and field orientations will be shown for a large number of YBa{sub 2}Cu{sub 3}O{sub x} films with various types and architectures of artificial pinning centres.

  14. FABRICE process for the refrabrication of experimental pins in a hot cell, from pins pre-irradiated in power reactors

    International Nuclear Information System (INIS)

    Vignesoult, N.; Atabek, R.; Ducas, S.

    1982-06-01

    The Fabrice ''hot cell refabrication'' process for small pins from very long irradiated fuel elements was developed at the CEA to allow parametric studies of the irradiation behavior of pins from nuclear power plants. Since this operation required complete assurance of the validity of the process, qualification of the fabrication was performed on test pins, refabricated in the hot cell, as well as irradiation qualification. The latter qualification was intended to demonstrate that, in identical experimental irradiation conditions, the refabricated Fabrice pins behaved in the same way as whole pins with the same initial characteristics. This qualification of the Fabrice process, dealing with more than twenty pins at different burnups, showed that fabrication did not alter: the inherent characteristics of the sampled fuel element and the irradiation behavior of the sampled fuel element [fr

  15. Material accountancy for metallic fuel pin casting

    International Nuclear Information System (INIS)

    Bucher, R.G.; Orechwa, Y.; Beitel, J.C.

    1995-01-01

    The operation of the Fuel Conditioning Facility (FCF) is based on the electrometallurgical processing of spent metallic reactor fuel. The pin casting operation, although only one of several operations in FCF, was the first to be on-line. As such, it has served to demonstrate the material accountancy system in many of its facets. This paper details, for the operation of the pin casting process with depleted uranium, the interaction between the mass tracking system (MTG) and some of the ancillary computer codes which generate pertinent information for operations and material accountancy. It is necessary to distinguish between two types of material balance calculations -- closeout for operations and material accountancy for safeguards. The two have much in common, for example, the mass tracking system database and the calculation of an inventory difference, but, in general, are not congruent with regard to balance period and balance spatial domain. Moreover, the objective, assessment, and reporting requirements of the calculated inventory difference are very different in the two cases

  16. The Egyptian Hair Pin: practical, sacred, fatal

    Directory of Open Access Journals (Sweden)

    Joann Fletcher

    2016-11-01

    Full Text Available Generally regarded as little more than a mundane tool employed in daily life, the humble hairpin occasionally played a rather more prominent role in history than has perhaps been appreciated. As the most ancient implements associated with hair styling, simple pins of bone and ivory were commonly employed in Egypt by c.4000 BC as a means of securing long hair in an upswept style (e.g. Petrie and Mace 1901, 21, 34. Although their occasional use by men undermines the assumption that hairpins are 'a relatively certain example of a “gendered” artefact' (Wilfong 1997, 67, the vast majority have been found in female burials. They can be made of bone and ivory, wood, steatite, glass, gold, silver and bronze, and two 12cm long bronze examples were found within the hair of Princess Ahmosi c.1550 BC (Fletcher 1995, 376, 441 while the hair of an anonymous woman at Gurob c.AD 110 had been secured in a bun with pins of bone, tortoiseshell and silver (Walker and Bierbrier 1997, 209.

  17. Method and device for cleaning fuel pins

    International Nuclear Information System (INIS)

    Matsumoto, Kaname; Oohigashi, Yoshiaki.

    1985-01-01

    Purpose: To remove clads or scales deposited on the outer surface of fuel pins in BWR type reactors. Method: A fuel assembly taken out of a reactor core is vertically contained without detaching a channel box in a scrubber tower disposed in a liquid tight manner within a fuel pool. Then, a specifically prepared slurry is caused to flow and uprise from the bottom of the scrubber tower into the channel box and then discharged from the top of the tower. The slurry is prepared by mixing pure water and granules (for example, as activated carbon, ion exchanger resin, iron and molecular sieve) of such a granular size as not causing clogging in the channel box of the fuel assembly and having a larger specific gravity than pure water. The slurry flown into the channel box scrubs the surface of fuel pins to scrape off clads or scales. Then, discharged slurry is sent to a hydraulic cyclone to separate the granules from the clads or scales. (Ikeda, J.)

  18. Lightning Pin Injection Testing on MOSFETS

    Science.gov (United States)

    Ely, Jay J.; Nguyen, Truong X.; Szatkowski, George N.; Koppen, Sandra V.; Mielnik, John J.; Vaughan, Roger K.; Wysocki, Philip F.; Celaya, Jose R.; Saha, Sankalita

    2009-01-01

    Lightning transients were pin-injected into metal-oxide-semiconductor field-effect transistors (MOSFETs) to induce fault modes. This report documents the test process and results, and provides a basis for subsequent lightning tests. MOSFETs may be present in DC-DC power supplies and electromechanical actuator circuits that may be used on board aircraft. Results show that unprotected MOSFET Gates are susceptible to failure, even when installed in systems in well-shielded and partial-shielded locations. MOSFET Drains and Sources are significantly less susceptible. Device impedance decreased (current increased) after every failure. Such a failure mode may lead to cascading failures, as the damaged MOSFET may allow excessive current to flow through other circuitry. Preliminary assessments on a MOSFET subjected to 20-stroke pin-injection testing demonstrate that Breakdown Voltage, Leakage Current and Threshold Voltage characteristics show damage, while the device continues to meet manufacturer performance specifications. The purpose of this research is to develop validated tools, technologies, and techniques for automated detection, diagnosis and prognosis that enable mitigation of adverse events during flight, such as from lightning transients; and to understand the interplay between lightning-induced surges and aging (i.e. humidity, vibration thermal stress, etc.) on component degradation.

  19. [Research on infrared radiation characteristics of skin covering two acupuncture points in the hand and forearm, NeiGuan and LaoGong points].

    Science.gov (United States)

    Wang, Zhen; Yu, Wenlong; Cui, Han; Shi, Huafeng; Jin, Lei

    2013-06-01

    In order to research the infrared radiation characteristics of the skin covering Traditional Chinese acupuncture points, which are NeiGuan in the forearm and LaoGong in the center of the palm, we detected continuously the infrared radiation spectra of the human body surface by using Fourier Transform Infrared Spectroscopy. The experimental results showed that firstly, the differences of the infrared radiation spectra of the human body surface were obvious between individuals. Secondly, the infrared radiation intensity of the human body surface changed with time changing. The infrared radiation intensity in two special wavelength ranges (wavelengths from 6. 79 microm to 6. 85 microm and from 13. 6 microm to 14. 0 microm) changed much more than that in other ranges obviously. Thirdly, the proportions of the infrared radiation spectra changed, which were calculated from the spectra of two different aupuncture points, were same in these two special wavelength ranges, but their magnitude changes were different. These results suggested that the infrared radiation of acupuncture points have the same biological basis, and the mechanism of the infrared radiation in these two special wavelength ranges is different from other tissue heat radiation.

  20. Violence against women in the context of war: experiences of Shi'i women and Palestinian refugee women in Lebanon.

    Science.gov (United States)

    Holt, Maria

    2013-03-01

    In times of war, women are likely to experience, in addition to the "normal" violence of peacetime, random cruelties perpetrated by the enemy against all members of the community. During research conducted with Palestinian refugees and Shi'i Muslims in Lebanon, women described various forms of violence and, in this article, I examine violence suffered by women in the context of conflict from three perspectives: victimization, trauma, and resistance. I argue that traumatic events have the effect of obliterating identity, but they can also strengthen the resolve to resist.

  1. BARS - a heterogeneous code for 3D pin-by-pin LWR steady-state and transient calculation

    International Nuclear Information System (INIS)

    Avvakumov, A.V.; Malofeev, V.M.

    2000-01-01

    A 3D pin-by-pin dynamic model for LWR detailed calculation was developed. The model is based on a coupling of the BARS neutronic code with the RELAP5/MOD3.2 thermal hydraulic code. This model is intended to calculate a fuel cycle, a xenon transient, and a wide range of reactivity initiated accidents in a WWER and a PWR. Galanin-Feinberg heterogeneous method was realized in the BARS code. Some results for a validation of the heterogeneous method are presented for reactivity coefficients, a pin-by-pin power distribution, and a fast pulse transient. (Authors)

  2. Chromatographic isolation of nanoparticles from Ma-Xing-Shi-Gan-Tang decoction and their characterization.

    Science.gov (United States)

    Zhou, Jianwu; Gao, Guanzhen; Chu, Qiuping; Wang, Huiqin; Rao, Pingfan; Ke, Lijing

    2014-02-12

    The herbal decoction is a complex dispersion system containing solutes, colloid, aggregates, emulsions and precipitates. In which phase bioactive phytochemicals are dispersed determines their delivery, action and metabolism. This study took ephedrine, a well-studied and widely used phytochemical, as an example to elucidate its exact distribution in the phases of Ma-Xing-Shi-Gan-Tang decoction (MXSGT), which is an Ephedra sinica Stapf. containing traditional Chinese medicinal formula, and the biological meaning of this distribution correspondingly. It may provide an important update to the safety and efficacy assessment of the herbal decoction and its active phytochemicals. In this study, the decoction was fractionated with size-exclusion chromatography coupled with multi-angle laser light scattering detector. The morphology of fractionated nanoparticles was observed with AFM and SEM. The bioactivities of the decoction, the ephedrine alkaloids loaded NPs (prepared by chromatography isolation) and the synthetic ephedrine were assessed by cell proliferation tests using five cell lines, namely Caco-2, L-02, Hep-G2, NR-8383, and Hela-229. Nanoparticles with radii of gyration ranged from 50 to 150 nm were isolated, in spherical shape. Further analysis of nanoparticles on the subsequent reversed phase chromatography revealed that the majority of ephedrine (99.7%) and pseudoephedrine (95.5%) were associated with these nanoparticles, rather than dispersed freely in the real solution. The addition of both the herbal decoction and the separated ephedrine-loaded nanoparticles reserved higher cell viability/proliferation than that of the sole synthetic ephedrine among the Caco-2, L-02, Hep-G2, and NR-8383 cells. In contrast, the nanoparticles reduced the proliferating power of ephedrine on Hela-229 cells. In general, the ephedrine-loaded NPs conducted the intermediate influences on the cell viability, in either way. The colloidal nanoparticles were separated from the decoction

  3. When people in close relationships are not prepared to listen to emotional disclosures. The role of social constraints in shy people’s functioning

    Directory of Open Access Journals (Sweden)

    Irena Dzwonkowska

    2007-12-01

    Full Text Available The following article comprises a presentation of research carried out on a group of 268 adults. The survey aimed at finding answers to questions posed about the meditative role played by social constraints in the relationship between shyness and certain aspects of emotional and social functioning. The results indicate that social constraints are a destructive factor in the everyday functioning of those facing everyday problems. Many shy people experience social constraints - people in close relationships: family, relatives, and friends react inadequately and negatively, demonstrating a lack of empathy, thus discouraging people who are shy from expressing their personal thoughts and emotions. Regression analyses, conducted in order to detect the meditative effects of social constraints, show that their destructive influence is particularly severe in the case of shy people leading to their low self-esteem, a high level of depressive symptoms and a low perception of social support.

  4. Pinning in BSCCO above the ordinary irreversibility line

    Science.gov (United States)

    Indenbom, M. V.; van der Beek, C. J.; Berseth, V.; Konczykowski, M.; Motohira, N.; Berger, H.; Benoit, W.

    1996-12-01

    Frequency-dependent observations of magnetic flux structures are used to show that pinning plays a principal role in the whole mixed state in Bi2Sr2CaCu2O8 (BSCCO) single crystals. We speculate that the random pinning force on the moving vortices may dominate over thermal fluctuations and considerably modify the position of the vortex lattice phase transition.

  5. Inscuteable Regulates the Pins-Mud Spindle Orientation Pathway

    Science.gov (United States)

    Mauser, Jonathon F.; Prehoda, Kenneth E.

    2012-01-01

    During asymmetric cell division, alignment of the mitotic spindle with the cell polarity axis ensures that the cleavage furrow separates fate determinants into distinct daughter cells. The protein Inscuteable (Insc) is thought to link cell polarity and spindle positioning in diverse systems by binding the polarity protein Bazooka (Baz; aka Par-3) and the spindle orienting protein Partner of Inscuteable (Pins; mPins or LGN in mammals). Here we investigate the mechanism of spindle orientation by the Insc-Pins complex. Previously, we defined two Pins spindle orientation pathways: a complex with Mushroom body defect (Mud; NuMA in mammals) is required for full activity, whereas binding to Discs large (Dlg) is sufficient for partial activity. In the current study, we have examined the role of Inscuteable in mediating downstream Pins-mediated spindle orientation pathways. We find that the Insc-Pins complex requires Gαi for partial activity and that the complex specifically recruits Dlg but not Mud. In vitro competition experiments revealed that Insc and Mud compete for binding to the Pins TPR motifs, while Dlg can form a ternary complex with Insc-Pins. Our results suggest that Insc does not passively couple polarity and spindle orientation but preferentially inhibits the Mud pathway, while allowing the Dlg pathway to remain active. Insc-regulated complex assembly may ensure that the spindle is attached to the cortex (via Dlg) before activation of spindle pulling forces by Dynein/Dynactin (via Mud). PMID:22253744

  6. IMp: The customizable LEGO(®) Pinned Insect Manipulator.

    Science.gov (United States)

    Dupont, Steen; Price, Benjamin; Blagoderov, Vladimir

    2015-01-01

    We present a pinned insect manipulator (IMp) constructed of LEGO® building bricks with two axes of movement and two axes of rotation. In addition we present three variants of the IMp to emphasise the modular design, which facilitates resizing to meet the full range of pinned insect specimens, is fully customizable, collapsible, affordable and does not require specialist tools or knowledge to assemble.

  7. SHI induced effects on the electrical and optical properties of HfO_2 thin films deposited by RF sputtering

    International Nuclear Information System (INIS)

    Manikanthababu, N.; Dhanunjaya, M.; Nageswara Rao, S.V.S.; Pathak, A.P.

    2016-01-01

    The continuous downscaling of Metal Oxide Semiconductor (MOS) devices has reached a limit with SiO_2 as a gate dielectric material. Introducing high-k dielectric materials as a replacement for the conservative SiO_2 is the only alternative to reduce the leakage current. HfO_2 is a reliable and an impending material for the wide usage as a gate dielectric in semiconductor industry. HfO_2 thin films were synthesized by RF sputtering technique. Here, we present a study of Swift Heavy Ion (SHI) irradiation with100 MeV Ag ions for studying the optical properties as well as 80 MeV Ni ions for studying the electrical properties of HfO_2/Si thin films. Rutherford Backscattering Spectrometry (RBS), Field Emission Scanning Electron Microscope (FESEM), energy-dispersive X-ray spectroscopy (EDS), profilometer and I–V (leakage current) measurements have been employed to study the SHI induced effects on both the structural, electrical and optical properties.

  8. Effect of swift heavy ion (SHI) irradiation on transparent conducting oxide electrodes for dye-sensitized solar cell applications

    Science.gov (United States)

    Singh, Hemant Kr.; Avasthi, D. K.; Aggarwal, Shruti

    2015-06-01

    Transparent conducting oxides (TCOs) are used as electrodes in dye-sensitized solar cells (DSSCs) because of their properties such as high transmittance and low resistivity. In the present work, the effects of swift heavy ion (SHI) irradiation on various types of TCOs are presented. The objective of this study is to investigate the effect of SHI on TCOs. For the present study, three different types of TCOs are considered, namely, (a) FTO (fluorine-doped tin oxide, SnO2:F) on a Nippon glass substrate, (b) ITO (indium tin oxide, In2O3:Sn) coated on polyethylene terephthalate (PET) on a Corning glass substrate, and (c) ITO on a Corning glass substrate. These films are irradiated with 120 MeV Ag+9 ions at fluences ranging from 3.0 × 1011 ions/cm2 to 3.0 × 1013 ions/cm2. The structural, morphological, optical and electrical properties are studied via X-ray diffraction (XRD), atomic force microscopy (AFM), UV-Vis absorption spectroscopy and four-probe resistivity measurements, respectively. The ITO-PET electrode is found to exhibit superior conductivity and transmittance properties in comparison with the others after irradiation and, therefore, to be the most suitable for solar cell applications.

  9. Cracking Bank PINs by Playing Mastermind

    Science.gov (United States)

    Focardi, Riccardo; Luccio, Flaminia L.

    The bank director was pretty upset noticing Joe, the system administrator, spending his spare time playing Mastermind, an old useless game of the 70ies. He had fought the instinct of telling him how to better spend his life, just limiting to look at him in disgust long enough to be certain to be noticed. No wonder when the next day the director fell on his chair astonished while reading, on the newspaper, about a huge digital fraud on the ATMs of his bank, with millions of Euros stolen by a team of hackers all around the world. The article mentioned how the hackers had 'played with the bank computers just like playing Mastermind', being able to disclose thousands of user PINs during the one-hour lunch break. That precise moment, a second before falling senseless, he understood the subtle smile on Joe's face the day before, while training at his preferred game, Mastermind.

  10. The lumped parameter model for fuel pins

    Energy Technology Data Exchange (ETDEWEB)

    Liu, W S [Ontario Hydro, Toronto, ON (Canada)

    1996-12-31

    The use of a lumped fuel-pin model in a thermal-hydraulic code is advantageous because of computational simplicity and efficiency. The model uses an averaging approach over the fuel cross section and makes some simplifying assumptions to describe the transient equations for the averaged fuel, fuel centerline and sheath temperatures. It is shown that by introducing a factor in the effective fuel conductivity, the analytical solution of the mean fuel temperature can be modified to simulate the effects of the flux depression in the heat generation rate and the variation in fuel thermal conductivity. The simplified analytical method used in the transient equation is presented. The accuracy of the lumped parameter model has been compared with the results from the finite difference method. (author). 4 refs., 2 tabs., 4 figs.

  11. Panoramic irradiator dose mapping with pin photodiodes

    International Nuclear Information System (INIS)

    Ferreira, Danilo Cardenuto; Napolitano, Celia Marina; Bueno, Carmen Cecilia

    2011-01-01

    In this work we study the possibility of using commercial silicon PIN photodiodes (Siemens, SFH 00206) for dose mapping in the Panoramic Irradiator facility at IPEN-CNEN/SP. The chosen photodiode, that is encased in 1.2 mm thickness polymer layer, displays promising dosimetric characteristics such as small size (sensitive area of 7.00 mm 2 ), high sensitivity and low dark current (≅ 300 pA, at 0 V) together with low-cost and wide availability. The Panoramic facility is an irradiator Type II with absorbed dose certificated by International Dose Assurance Service (IDAS) offered by the International Agency Energy Atomic (IAEA). The charge registered by the diode as a function of the absorbed dose was in excellent agreement with that one calibrated by IDAS. Besides this, the easy handling and fast response of the SFH00206 diode compared to Fricke chemical dosimeters encouraged us to perform dose mapping around the source. (author)

  12. Alpha particles spectrometer with photodiode PIN

    International Nuclear Information System (INIS)

    Chacon R, A.; Hernandez V, R.; Hernandez D, V. M.; Vega C, H. R.; Ramirez G, J.

    2009-10-01

    The radiation propagates in form of electromagnetic waves or corpuscular radiation; if the radiation energy causes ionization in environment that crosses it is considered ionizing radiation. To detect radiation several detectors types are used, if the radiation are alpha particles are used detectors proportional type or trace elements. In this work the design results, construction and tests of an alpha particles spectrometer are presented, which was designed starting from a photodiode PIN type. The system design was simulated with a code for electronic circuits. With results of simulation phase was constructed the electronic phase that is coupled to a multichannel analyzer. The resulting electronic is evaluated analyzing the electronic circuit performance before an alphas triple source and alpha radiation that produce two smoke detectors of domestic use. On the tests phase we find that the system allows obtain, in a multichannel, the pulses height spectrum, with which we calibrate the system. (Author)

  13. Effective augmentation of networked systems and enhancing pinning controllability

    Science.gov (United States)

    Jalili, Mahdi

    2018-06-01

    Controlling dynamics of networked systems to a reference state, known as pinning control, has many applications in science and engineering. In this paper, we introduce a method for effective augmentation of networked systems, while also providing high levels of pinning controllability for the final augmented network. The problem is how to connect a sub-network to an already existing network such that the pinning controllability is maximised. We consider the eigenratio of the augmented Laplacian matrix as a pinning controllability metric, and use graph perturbation theory to approximate the influence of edge addition on the eigenratio. The proposed metric can be effectively used to find the inter-network links connecting the disjoint networks. Also, an efficient link rewiring approach is proposed to further optimise the pinning controllability of the augmented network. We provide numerical simulations on synthetic networks and show that the proposed method is more effective than heuristic ones.

  14. Artificial pinning center technology to enhance vortex pinning in YBCO coated conductors

    International Nuclear Information System (INIS)

    Matsumoto, Kaname; Mele, Paolo

    2010-01-01

    Crystalline defects on the nano-scale, which are called artificial pinning centers (APCs), were successfully introduced into high-temperature superconductors (HTS) by nanotechnology, in order to strongly pin the quantized vortices. The critical current densities, J c , of the HTS films were dramatically improved by APCs. It is possible to form APCs in high-quality epitaxial films, keeping the desired dimensionality, volume fraction, spatial distribution and so on. The in-field J c of HTS films at 77 K was improved by one order of magnitude compared with previous values using APCs. This technology can be applied to the coated conductor technology in progress, and a high J c has already been reported. A current outline of the research is described in this review.

  15. Retractable Pin Tools for the Friction Stir Welding Process

    Science.gov (United States)

    1998-01-01

    Two companies have successfully commercialized a specialized welding tool developed at the Marshall Space Flight Center (MSFC). Friction stir welding uses the high rotational speed of a tool and the resulting frictional heat created from contact to crush, 'stir' together, and forge a bond between two metal alloys. It has had a major drawback, reliance on a single-piece pin tool. The pin is slowly plunged into the joint between two materials to be welded and rotated as high speed. At the end of the weld, the single-piece pin tool is retracted and leaves a 'keyhole,' something which is unacceptable when welding cylindrical objects such as drums, pipes and storage tanks. Another drawback is the requirement for different-length pin tools when welding materials of varying thickness. An engineer at the MSFC helped design an automatic retractable pin tool that uses a computer-controlled motor to automatically retract the pin into the shoulder of the tool at the end of the weld, preventing keyholes. This design allows the pin angle and length to be adjusted for changes in material thickness and results in a smooth hole closure at the end of the weld. Benefits of friction stir welding, using the MSFC retractable pin tool technology, include the following: The ability to weld a wide range of alloys, including previously unweldable and composite materials; provision of twice the fatigue resistance of fusion welds and no keyholes; minimization of material distortion; no creation of hazards such as welding fumes, radiation, high voltage, liquid metals, or arcing; automatic retraction of the pin at the end of the weld; and maintaining full penetration of the pin.

  16. A pinning puzzle: two similar, non-superconducting chemical deposits in YBCO-one pins, the other does not

    Energy Technology Data Exchange (ETDEWEB)

    Sawh, Ravi-Persad; Weinstein, Roy; Gandini, Alberto; Skorpenske, Harley; Parks, Drew, E-mail: Weinstein@uh.ed [Beam Particle Dynamics Laboratories, University of Houston, Houston, TX 77204-5005 (United States); Department of Physics, University of Houston, Houston, TX 77204-5005 (United States); Texas Center for Superconductivity at UH, University of Houston, Houston, TX 77204-5002 (United States)

    2009-09-15

    The pinning effects of two kinds of U-rich deposits in YBCO (YBa{sub 2}Cu{sub 3}O{sub 7-{delta}}) are compared. One is a five-element compound, (U{sub 0.6}Pt{sub 0.4})YBa{sub 2}O{sub 6}, which is a paramagnetic double perovskite which forms as profuse stable nanosize deposits, and pins very well. The other is a four-element compound, (U{sub 0.4}Y{sub 0.6})BaO{sub 3}, which is a ferromagnetic single perovskite which forms as profuse stable nanosize deposits and pins very weakly or not at all. The pinning comparison is done with nearly equal deposit sizes and number of deposits per unit volume for the two compounds. Evidence for the pinning capability, chemical makeup, x-ray diffraction signature, and magnetic properties of the two compounds is reported.

  17. Spatial variations of community structures and methane cycling across a transect of Lei-Gong-Hou mud volcanoes in eastern Taiwan

    Directory of Open Access Journals (Sweden)

    Pei-Ling eWang

    2014-03-01

    Full Text Available This study analyzed cored sediments retrieved from sites distributed across a transect of the Lei-Gong-Hou mud volcanoes in eastern Taiwan to uncover the spatial distributions of biogeochemical processes and community assemblages involved in methane cycling. The profiles of methane concentration and carbon isotopic composition revealed various orders of the predominance of specific methane-related metabolisms along depth. At a site proximal to the bubbling pool, the methanogenic zone was sandwiched by the anaerobic methanotrophic zones. For two sites distributed toward the topographic depression, the methanogenic zone overlaid the anaerobic methanotrophic zone. The predominance of anaerobic methanotrophy at specific depth intervals is supported by the enhanced copy numbers of the ANME-2a 16S rRNA gene and coincides with high dissolved Fe/Mn concentrations and copy numbers of the Desulfuromonas/Pelobacter 16S rRNA gene. Assemblages of 16S rRNA and mcrA genes revealed that methanogenesis was mediated by Methanococcoides and Methanosarcina. pmoA genes and a few 16S rRNA genes related to aerobic methanotrophs were detected in limited numbers of subsurface samples. While dissolved Fe/Mn signifies the presence of anaerobic metabolisms near the surface, the correlations between geochemical characteristics and gene abundances, and the absence of aerobic methanotrophs in top sediments suggest that anaerobic methanotrophy is potentially dependent on iron/manganese reduction and dominates over aerobic methanotrophy for the removal of methane produced in situ or from a deep source. Near-surface methanogenesis contributes to the methane emissions from mud platform. The alternating arrangements of methanogenic and methanotrophic zones at different sites suggest that the interactions between mud deposition, evaporation, oxidation and fluid transport modulate the assemblages of microbial communities and methane cycling in different compartments of terrestrial

  18. Spatial variations of community structures and methane cycling across a transect of Lei-Gong-Hou mud volcanoes in eastern Taiwan.

    Science.gov (United States)

    Wang, Pei-Ling; Chiu, Yi-Ping; Cheng, Ting-Wen; Chang, Yung-Hsin; Tu, Wei-Xain; Lin, Li-Hung

    2014-01-01

    This study analyzed cored sediments retrieved from sites distributed across a transect of the Lei-Gong-Hou mud volcanoes in eastern Taiwan to uncover the spatial distributions of biogeochemical processes and community assemblages involved in methane cycling. The profiles of methane concentration and carbon isotopic composition revealed various orders of the predominance of specific methane-related metabolisms along depth. At a site proximal to the bubbling pool, the methanogenic zone was sandwiched by the anaerobic methanotrophic zones. For two sites distributed toward the topographic depression, the methanogenic zone overlaid the anaerobic methanotrophic zone. The predominance of anaerobic methanotrophy at specific depth intervals is supported by the enhanced copy numbers of the ANME-2a 16S rRNA gene and coincides with high dissolved Fe/Mn concentrations and copy numbers of the Desulfuromonas/Pelobacter 16S rRNA gene. Assemblages of 16S rRNA and mcrA genes revealed that methanogenesis was mediated by Methanococcoides and Methanosarcina. pmoA genes and a few 16S rRNA genes related to aerobic methanotrophs were detected in limited numbers of subsurface samples. While dissolved Fe/Mn signifies the presence of anaerobic metabolisms near the surface, the correlations between geochemical characteristics and gene abundances, and the absence of aerobic methanotrophs in top sediments suggest that anaerobic methanotrophy is potentially dependent on iron/manganese reduction and dominates over aerobic methanotrophy for the removal of methane produced in situ or from a deep source. Near-surface methanogenesis contributes to the methane emissions from mud platform. The alternating arrangements of methanogenic and methanotrophic zones at different sites suggest that the interactions between mud deposition, evaporation, oxidation and fluid transport modulate the assemblages of microbial communities and methane cycling in different compartments of terrestrial mud volcanoes.

  19. Optimal pin enrichment distributions in nuclear reactor fuel bundles

    International Nuclear Information System (INIS)

    Lim, E.Y.

    1976-01-01

    A methodology has been developed to determine the fuel pin enrichment distribution that yields the best approximation to a prescribed power distribution in nuclear reactor fuel bundles. The problem is formulated as an optimization problem in which the optimal pin enrichments minimize the sum of squared deviations between the actual and prescribed fuel pin powers. A constant average enrichment constraint is imposed to ensure that a suitable value of reactivity is present in the bundle. When constraints are added that limit the fuel pins to a few enrichment types, one must determine not only the optimal values of the enrichment types but also the optimal distribution of the enrichment types amongst the pins. A matrix of boolean variables is used to describe the assignment of enrichment types to the pins. This nonlinear mixed integer programming problem may be rigorously solved with either exhaustive enumeration or branch and bound methods using a modification of the algorithm from the continuous problem as a suboptimization. Unfortunately these methods are extremely cumbersome and computationally overwhelming. Solutions which require only a moderate computational effort are obtained by assuming that the fuel pin enrichments in this problem are ordered as in the solution to the continuous problem. Under this assumption search schemes using either exhaustive enumeration or branch and bound become computationally attractive. An adaptation of the Hooke--Jeeves pattern search technique is shown to be especially efficient

  20. Roles of pinning strength and density in vortex melting

    International Nuclear Information System (INIS)

    Obaidat, I M; Khawaja, U Al; Benkraouda, M

    2008-01-01

    We have investigated the role of pinning strength and density on the equilibrium vortex-lattice to vortex-liquid phase transition under several applied magnetic fields. This study was conducted using a series of molecular dynamic simulations on several samples with different strengths and densities of pinning sites which are arranged in periodic square arrays. We have found a single solid-liquid vortex transition when the vortex filling factor n>1. We have found that, for fixed pinning densities and strengths, the melting temperature, T m , decreases almost linearly with increasing magnetic field. Our results provide direct numerical evidence for the significant role of both the strength and density of pinning centers on the position of the melting line. We have found that the vortex-lattice to vortex-liquid melting line shifts up as the pinning strength or the pinning density was increased. The effect on the melting line was found to be more pronounced at small values of strength and density of pinning sites

  1. Loss of Pin1 Suppresses Hedgehog-Driven Medulloblastoma Tumorigenesis

    Directory of Open Access Journals (Sweden)

    Tao Xu

    2017-03-01

    Full Text Available Medulloblastoma is the most common malignant brain tumor in children. Therapeutic approaches to medulloblastoma (combination of surgery, radiotherapy, and chemotherapy have led to significant improvements, but these are achieved at a high cost to quality of life. Alternative therapeutic approaches are needed. Genetic mutations leading to the activation of the Hedgehog pathway drive tumorigenesis in ~30% of medulloblastoma. In a yeast two-hybrid proteomic screen, we discovered a novel interaction between GLI1, a key transcription factor for the mediation of Hedgehog signals, and PIN1, a peptidylprolyl cis/trans isomerase that regulates the postphosphorylation fate of its targets. The GLI1/PIN1 interaction was validated by reciprocal pulldowns using epitope-tagged proteins in HEK293T cells as well as by co-immunoprecipiations of the endogenous proteins in a medulloblastoma cell line. Our results support a molecular model in which PIN1 promotes GLI1 protein abundance, thus contributing to the positive regulation of Hedgehog signals. Most importantly, in vivo functional analyses of Pin1 in the GFAP-tTA;TRE-SmoA1 mouse model of Hedgehog-driven medulloblastoma demonstrate that the loss of Pin1 impairs tumor development and dramatically increases survival. In summary, the discovery of the GLI1/PIN1 interaction uncovers PIN1 as a novel therapeutic target in Hedgehog-driven medulloblastoma tumorigenesis.

  2. Fuel pin design algorithm for conceptual design studies

    International Nuclear Information System (INIS)

    Uselman, J.P.

    1979-01-01

    Two models are available which are currently verified by part of the requirements and which are adaptable as algorithms for the complete range. Fuel thermal performance is described by the HEDL SIEX model. Cladding damage and total deformation are determined by the GE GRO-II structural analysis code. A preliminary fuel pin performance model for analysis of (U, P/sub U/)O 2 pins in the COROPT core conceptual design system has been constructed by combining the key elements of SIEX and GRO-II. This memo describes the resulting pin performance model and its interfacing with COROPT system. Some exemplary results are presented

  3. Self-organized critical behavior in pinned flux lattices

    International Nuclear Information System (INIS)

    Pla, O.; Nori, F.

    1991-01-01

    We study the response of pinned fluxed lattices, under small perturbations in the driving force, below and close to the pinning-depinning transition. For driving Lorentz forces below F c (the depinning force at which the whole flux lattice slides), the system has instabilities against small force increases, with a power-law distribution characteristic of self-organized criticality. Specifically, D(d)∼d -1,3 , where d is the displacement of a flux line after a very small force increase. We also study the initial stages of the motion of the lattice once the driving force overcomes the pinning forces

  4. Study of PIN diode energy traps created by neutrons

    International Nuclear Information System (INIS)

    Sopko, V; Dammer, J; Sopko, B; Chren, D

    2013-01-01

    Characterization of radiation defects is still ongoing and finds greater application in the increasing radiation doses on semiconductor detectors in experiments. Studying the changes of silicon PIN diode for high doses of radiation is the fundamental motivation for our measurements. In this article we describe the behavior of the PIN diode and development of the disorder caused by neutrons from a 252Cf and doses up to 8 Gy. The calibration curve for PIN diode shows the effect of disorders as the changes of the voltampere characteristics depending on the dose of neutron irradiation. The measured values for defects are in good agreement with created energy traps.

  5. Fabrication of oxide dispersion strengthened ferritic clad fuel pins

    International Nuclear Information System (INIS)

    Zirker, L.R.; Bottcher, J.H.; Shikakura, S.; Tsai, C.L.

    1991-01-01

    A resistance butt welding procedure was developed and qualified for joining ferritic fuel pin cladding to end caps. The cladding are INCO MA957 and PNC ODS lots 63DSA and 1DK1, ferritic stainless steels strengthened by oxide dispersion, while the end caps are HT9 a martensitic stainless steel. With adequate parameter control the weld is formed without a residual melt phase and its strength approaches that of the cladding. This welding process required a new design for fuel pin end cap and weld joint. Summaries of the development, characterization, and fabrication processes are given for these fuel pins. 13 refs., 6 figs., 1 tab

  6. Inverse crystallization if Abrikosov vortex system at periodic pinning

    CERN Document Server

    Zyubin, M V; Kashurnikov, V A

    2002-01-01

    The vortex system in the quasi-two-dimensional HTSC plate is considered in the case of the periodic pinning. The M(H) magnetization curves by various values of the external magnetic field and different temperatures are calculated through the Monte Carlo method. It is shown that in the case of the periodic pinning the crystallization of the vortex system is possible by the temperature increase. A number of peculiarities conditioned by the impact of the pinning centers periodic lattice are identified on the magnetization curves. The pictures of the vortex distribution corresponding to various points on the M(H) curve are obtained

  7. Analyzing the use of pins in safety bearings

    DEFF Research Database (Denmark)

    da Fonseca, Cesar A. L. L.; Weber, Hans I.; Fleischer, Philip F.

    2015-01-01

    A new concept for safety bearings is analyzed: useful in emergency situations, it shall protect the bearing from destruction by the use of pins which impact with a disc, both capable of good energy dissipation. Results of work in progress are presented by validating partial stages......–Kutta method is validated with experimental results. Simulations of rotor orbits due to the impact condition are analyzed and compared to data obtained from the experiment giving a good perspective on the use of pins. The contact interaction between rotor and pins uses an elastic-dissipative model. In addition...

  8. How Helpful is Colour-Cueing of PIN Entry?

    OpenAIRE

    Renaud, Karen; Ramsay, Judith

    2014-01-01

    21st Century citizens are faced with the need to remember numbers of PINs (Personal Identification Numbers) in order to do their daily business, and they often have difficulties due to human memory limitations. One way of helping them could be by providing cues during the PIN entry process. The provision of cues that would only be helpful to the PIN owner is challenging because the cue should only make sense to the legitimate user, and not to a random observer. In this paper we report on an e...

  9. Discovery of novel selenium derivatives as Pin1 inhibitors by high-throughput screening

    International Nuclear Information System (INIS)

    Subedi, Amit; Shimizu, Takeshi; Ryo, Akihide; Sanada, Emiko; Watanabe, Nobumoto; Osada, Hiroyuki

    2016-01-01

    Peptidyl prolyl cis/trans isomerization by Pin1 regulates various oncogenic signals during cancer progression, and its inhibition through multiple approaches has established Pin1 as a therapeutic target. However, lack of simplified screening systems has limited the discovery of potent Pin1 inhibitors. We utilized phosphorylation-dependent binding of Pin1 to its specific substrate to develop a screening system for Pin1 inhibitors. Using this system, we screened a chemical library, and identified a novel selenium derivative as Pin1 inhibitor. Based on structure-activity guided chemical synthesis, we developed more potent Pin1 inhibitors that inhibited cancer cell proliferation. -- Highlights: •Novel screening for Pin1 inhibitors based on Pin1 binding is developed. •A novel selenium compound is discovered as Pin1 inhibitor. •Activity guided chemical synthesis of selenium derivatives resulted potent Pin1 inhibitors.

  10. Getting to "No": Locating Critical Peace Education within Resistance and Anti-Oppression Pedagogy at a Shi'a Islamic School in Lebanon

    Science.gov (United States)

    Zakharia, Zeena

    2017-01-01

    This paper critically engages observations from a school that was aligned with a resistance movement in Lebanon during a post-war period of sustained political violence (2006-2007). Focusing on the pedagogical practices at one community-centered and community-led Shi'a Islamic urban school, the paper draws on extensive ethnographic data to…

  11. A PWR Thorium Pin Cell Burnup Benchmark

    Energy Technology Data Exchange (ETDEWEB)

    Weaver, Kevan Dean; Zhao, X.; Pilat, E. E; Hejzlar, P.

    2000-05-01

    As part of work to evaluate the potential benefits of using thorium in LWR fuel, a thorium fueled benchmark comparison was made in this study between state-of-the-art codes, MOCUP (MCNP4B + ORIGEN2), and CASMO-4 for burnup calculations. The MOCUP runs were done individually at MIT and INEEL, using the same model but with some differences in techniques and cross section libraries. Eigenvalue and isotope concentrations were compared on a PWR pin cell model up to high burnup. The eigenvalue comparison as a function of burnup is good: the maximum difference is within 2% and the average absolute difference less than 1%. The isotope concentration comparisons are better than a set of MOX fuel benchmarks and comparable to a set of uranium fuel benchmarks reported in the literature. The actinide and fission product data sources used in the MOCUP burnup calculations for a typical thorium fuel are documented. Reasons for code vs code differences are analyzed and discussed.

  12. Pinning Control Strategy of Multicommunity Structure Networks

    Directory of Open Access Journals (Sweden)

    Chao Ding

    2017-01-01

    Full Text Available In order to investigate the effects of community structure on synchronization, a pinning control strategy is researched in a class of complex networks with community structure in this paper. A feedback control law is designed based on the network community structure information. The stability condition is given and proved by using Lyapunov stability theory. Our research shows that as to community structure networks, there being a threshold hT≈5, when coupling strength bellows this threshold, the stronger coupling strength corresponds to higher synchronizability; vice versa, the stronger coupling strength brings lower synchronizability. In addition the synchronizability of overlapping and nonoverlapping community structure networks was simulated and analyzed; while the nodes were controlled randomly and intensively, the results show that intensive control strategy is better than the random one. The network will reach synchronization easily when the node with largest betweenness was controlled. Furthermore, four difference networks’ synchronizability, such as Barabási-Albert network, Watts-Strogatz network, Erdös-Rényi network, and community structure network, are simulated; the research shows that the community structure network is more easily synchronized under the same control strength.

  13. Ideal glass transitions by random pinning

    Science.gov (United States)

    Cammarota, Chiara; Biroli, Giulio

    2012-01-01

    We study the effect of freezing the positions of a fraction c of particles from an equilibrium configuration of a supercooled liquid at a temperature T. We show that within the random first-order transition theory pinning particles leads to an ideal glass transition for a critical fraction c = cK(T) even for moderate supercooling; e.g., close to the Mode-Coupling transition temperature. First we derive the phase diagram in the T - c plane by mean field approximations. Then, by applying a real-space renormalization group method, we obtain the critical properties for |c - cK(T)| → 0, in particular the divergence of length and time scales, which are dominated by two zero-temperature fixed points. We also show that for c = cK(T) the typical distance between frozen particles is related to the static point-to-set length scale of the unconstrained liquid. We discuss what are the main differences when particles are frozen in other geometries and not from an equilibrium configuration. Finally, we explain why the glass transition induced by freezing particles provides a new and very promising avenue of research to probe the glassy state and ascertain, or disprove, the validity of the theories of the glass transition. PMID:22623524

  14. Dynamic behaviour of FBR fuel pin bundles

    International Nuclear Information System (INIS)

    Martin, P.H.; Van Dorsselaere, J.P.; Ravenet, A.

    1990-01-01

    A programme of shock tests on a fast neutron reactor subassembly model (SPX1 geometry) including a complete bundle of fuel pins (dummy elements) is being carried out in the BELIER test facility at Cadarache. The purpose of these tests is: to determine the distribution of dynamic forces applied to the fuel rod clads under the impact conditions encountered in a reactor during a earthquake; to reduce as much as possible the conservatism of the methods presently used for the calculation of those forces. The test programme, now being completed, consists of the following steps: impacts on the mock-up in air with an non-compact bundle (situation of the subassembly at beginning of life (BOL) with clearances within the bundle); impacts under the same conditions but with fluid (water) in the subassembly; impacts on the mock-up in air and with a compacted bundle (simulating the conditions of an end-of-life (EOL) bundle with no clearance within the bundle). The accelerations studied in these tests cover the range encountered in design calculations for the subassembly frequencies in beam mode. (author)

  15. Transverse pinning versus intramedullary pinning in fifth metacarpal's neck fractures: A randomized controlled study with patient-reported outcome.

    Science.gov (United States)

    Galal, Sherif; Safwat, Wael

    2017-01-01

    The 5th metacarpal fractures accounts for 38% of all hand fractures given that the neck is the weakest point in metacarpals, so neck fracture is the most common metacarpal fracture. Surgical fixation is also advocated for such fractures to prevent mal-rotation of the little finger which will lead to fingers overlap in a clenched fist. Various methods are available for fixation of such fractures, like intramedullary & transverse pinning. There are very few reports in the literature comparing both techniques. Authors wanted to compare outcomes and complications of transverse pinning versus intramedullary pinning in fifth metacarpal's neck fractures. A single-center, parallel group, prospective, randomized study was conducted at an academic Level 1 Trauma Center from October 2014 to December 2016. A total of 80 patients with 5th metacarpal's neck fractures were randomized to pinning using either transverse pinning (group A) or intramedullary pinning (group B). Patients were assessed clinically on range of motion, patient-reported outcome using the Quick-DASH (Disabilities of the Arm, Shoulder, and Hand) questionnaire & radiographically. Two blinded observers assessed outcomes. At final follow up for each patient (12 months) the statistically significant differences were observed in operative time, the transverse pinning group showed shorter operative time, as well as complication rate as complications were observed only in intramedullary pinning group. No differences were found in range of motion or the Quick -DASH score. Both techniques are equally safe and effective treatment option for 5th metacarpal's neck fractures. The only difference was shorter operative time & less incidence of complications in transverse pinning group. Level II, Therapeutic study.

  16. Close Proximity Robotic Maneuvering through Flux Pinning Manipulation

    Data.gov (United States)

    National Aeronautics and Space Administration — Non-contacting actuation technology like flux pinning has never been demonstrated in space. The development of a nonphysical joint is critical for maneuvers such as...

  17. Pin failure modeling of the A series CABRI tests

    International Nuclear Information System (INIS)

    Young, M.F.; Portugal, J.L.

    1978-01-01

    The EXPAND pin fialure model, a research tool designed to model pin failure under prompt burst conditions, has been used to predict failure conditions for several of the A series CABRI tests as part of the United States participation in the CABRI Joint Project. The Project is an international program involving France, Germany, England, Japan, and the United States and has the goal of obtaining experimental data relating to the safety of LMFBR's. The A series, designed to simulate high ramp rate TOP conditions, initially utilizes single, fresh UO 2 pins of the PHENIX type in a flowing sodium loop. The pins are preheated at constant power in the CABRI reactor to establish steady state conditions (480 w/cm at the axial peak) and then subjected to a power pulse of 14 ms to 24 ms duration

  18. Progress in fuel pin modelling in the USA

    Energy Technology Data Exchange (ETDEWEB)

    Stephen, J D; Biancheria, A; Leibnitz, D; O' Reilly, B D; Liu, Y Y; Labar, M P; Gneiting, B C [General Electric Company, Sunnyvale, CA (United States)

    1979-12-01

    In the USA, the focus for theoretical fuel pin modeling is the LIFE system. This system of codes, algorithms, criteria and analysis guidelines is intended to provide a common basis for communication amongst the development groups, a reference set of analysis guidelines for design, and eventually a consensus on the state-of-the-art for licensing. The technical objective is to predict the effect of design options on fuel pin performance limits, which include fuel temperature, pin deformation and cladding breach during normal operation and design basis transients. The mechanistic approach to modeling is taken in LIFE to the extent possible. That is, the approach is to describe the key phenomena in sufficient detail to provide a fundamental understanding of their synergistic effect on the fuel pin performance limits.

  19. The treatment of burnable poison pins in LWRWIMS

    International Nuclear Information System (INIS)

    Halsall, M.J.

    1982-12-01

    This report describes an investigation into the modelling approximations normally made when the LWR lattice code LWRWIMS is used for design calculations on assemblies containing burnable poison pins. Parameters investigated include energy group structure, intervals between calculations in MWd/te and spatial subdivision of the poison pins. An estimate is made of the effect of using pin-cell smearing with diffusion theory for the assembly geometry, instead of a more exact heterogeneous transport theory calculation. The influence on reactivity of the minor gadolinium isotopes 152, 154, 156, 158 and 160 in a poison pin dominated by the isotopes 155 and 157 is presented, and finally, recommendations on the use of LWRWIMS for this type of calculation are made. (author)

  20. PIN architecture for ultrasensitive organic thin film photoconductors.

    Science.gov (United States)

    Jin, Zhiwen; Wang, Jizheng

    2014-06-17

    Organic thin film photoconductors (OTFPs) are expected to have wide applications in the field of optical communications, artificial vision and biomedical sensing due to their great advantages of high flexibility and low-cost large-area fabrication. However, their performances are not satisfactory at present: the value of responsivity (R), the parameter that measures the sensitivity of a photoconductor to light, is below 1 AW(-1). We believe such poor performance is resulted from an intrinsic self-limited effect of present bare blend based device structure. Here we designed a PIN architecture for OTFPs, the PIN device exhibits a significantly improved high R value of 96.5 AW(-1). The PIN architecture and the performance the PIN device shows here should represent an important step in the development of OTFPs.

  1. Investigation of pinning in MgB2 superconductors

    International Nuclear Information System (INIS)

    Mohammad, S.; Reissner, M.; Steiner, W.; Bauer, E.; Giovannini, M.

    2006-01-01

    Full text: The pinning behaviour of bulk MgB 2 superconductors is peculiar in many respects. Pinning seems to be stronger than in classical high T C materials and there seems to be no weak link problem in these compounds, giving hope to produce bulk samples and wires with current densities appropriate for technical applications. But, although many studies concerning the pinning behaviour in this compound appeared in recent years, the results are still contradictory. In the present work we present results of an investigation of the pinning behaviour by magnetic relaxation measurements of three MgB 2 samples: a pure one, a sample with 8 at% Al substitution and a sample with 10 wt% of SiC admixture. A comparison of different analyses methods is given. (author)

  2. SP-100 Fuel Pin Performance: Results from Irradiation Testing

    Science.gov (United States)

    Makenas, Bruce J.; Paxton, Dean M.; Vaidyanathan, Swaminathan; Marietta, Martin; Hoth, Carl W.

    1994-07-01

    A total of 86 experimental fuel pins with various fuel, liner, and cladding candidate materials have been irradiated in the Experimental Breeder Reactor-II (EBR-II) and the Fast Flux Test Facility (FFTF) reactor as part of the SP-100 fuel pin irradiation testing program. Postirradiation examination results from these fuel pins are key in establishing performance correlations and demonstrating the lifetime and safety of the reactor fuel system. This paper provides a brief description of the in-reactor fuel pin tests and presents the most recent irradiation data on the performance of wrought rhenium (Re) liner material and high density UN fuel at goal burnup of 6 atom percent (at. %). It also provides an overview of the significant variety of other fuel/liner/cladding combinations which were irradiated as part of this program and which may be of interest to more advanced efforts.

  3. Behavior of a bundle of fast fuel pins under irradiation

    International Nuclear Information System (INIS)

    Marbach, G.; Millet, P.; Robert, J.; Languille, A.

    1979-01-01

    In the French design of fuel elements for fast reactors, great deformation of pins can bring about interaction with the hexagonal tube through the spacer wires. The change in such bundles is described here when the diameter of the cladding increases and the outcome of this reaction (bending and ovalization of pins) is calculated with a simplified model. It is shown that the results achieved agree well with the experimental observations [fr

  4. Pin and roller attachment system for ceramic blades

    Science.gov (United States)

    Shaffer, J.E.

    1995-07-25

    In a turbine, a plurality of blades are attached to a turbine wheel by way of a plurality of joints which form a rolling contact between the blades and the turbine wheel. Each joint includes a pin and a pair of rollers to provide rolling contact between the pin and an adjacent pair of blades. Because of this rolling contact, high stress scuffing between the blades and the turbine wheel reduced, thereby inhibiting catastrophic failure of the blade joints. 3 figs.

  5. Cyclic movement pin mechanism for controlling a nuclear reactor

    International Nuclear Information System (INIS)

    Joly, J.G.; Martin, Jean.

    1981-01-01

    This invention concerns a recurring movement pin mechanism for controlling a nuclear reactor by shifting a neutron absorbing assembly, vertically mobile in the nuclear reactor, to adjust the power and for emergency shut-down. This mechanism ensures a continuous movement and accurate shut-down at any level of the travel height of the absorbing assembly in the core. It also prevents the impacts of the pivoting pins in the control rod slots [fr

  6. Theory of activated glassy dynamics in randomly pinned fluids

    Science.gov (United States)

    Phan, Anh D.; Schweizer, Kenneth S.

    2018-02-01

    We generalize the force-level, microscopic, Nonlinear Langevin Equation (NLE) theory and its elastically collective generalization [elastically collective nonlinear Langevin equation (ECNLE) theory] of activated dynamics in bulk spherical particle liquids to address the influence of random particle pinning on structural relaxation. The simplest neutral confinement model is analyzed for hard spheres where there is no change of the equilibrium pair structure upon particle pinning. As the pinned fraction grows, cage scale dynamical constraints are intensified in a manner that increases with density. This results in the mobile particles becoming more transiently localized, with increases of the jump distance, cage scale barrier, and NLE theory mean hopping time; subtle changes of the dynamic shear modulus are predicted. The results are contrasted with recent simulations. Similarities in relaxation behavior are identified in the dynamic precursor regime, including a roughly exponential, or weakly supra-exponential, growth of the alpha time with pinning fraction and a reduction of dynamic fragility. However, the increase of the alpha time with pinning predicted by the local NLE theory is too small and severely so at very high volume fractions. The strong deviations are argued to be due to the longer range collective elasticity aspect of the problem which is expected to be modified by random pinning in a complex manner. A qualitative physical scenario is offered for how the three distinct aspects that quantify the elastic barrier may change with pinning. ECNLE theory calculations of the alpha time are then presented based on the simplest effective-medium-like treatment for how random pinning modifies the elastic barrier. The results appear to be consistent with most, but not all, trends seen in recent simulations. Key open problems are discussed with regard to both theory and simulation.

  7. Incidence and risk factors for pin tract infection in external fixation of ...

    African Journals Online (AJOL)

    Incidence and risk factors for pin tract infection in external fixation of fractures ... for pin tract infection, there were 93 pins scored grade 1, 32 pins grade 2, 15 ... The incidence increased from 20.5% in closed fractures to 75.9% in open fractures.

  8. Vortex Avalanches with Periodic Arrays of Pinning Sites

    Science.gov (United States)

    Abbas, J.; Heckel, T.; Kakalios, J.

    2001-03-01

    Numerical simulations by Nori and co-workers of dynamical phase transitions for magnetic vortices in type II superconductors when the defects which act as pinning sites are arranged in a periodic array have found a dramatic non-linear relationship between vortex voltage and driving current.2,4 In order to experimentally test the predictions of these simulations, a macroscopic physical analog of an array of flux vortices in the presense of an ordered lattice of pinning sites has been constructed. This simple table-top experimental system consists of conventional household magnets, arranged in an ordered grid (serving as the lattice of fixed pinning centers). A plexiglass sheet is positioned above these fixed magnets, and another collection of magnets (representing the magnetic flux vortices), oriented so that they are attracted to the fixed magnets are placed on top of the sheet. The entire apparatus is then tilted to a given angle (the analog of the driving voltage) and the velocity of the avalanching magnets is recorded using the induced voltage in a pick-up coil. By varying the ratio of movable magnets to fixed pinning magnets, the filling fraction can be adjusted, as can the pinning strength, by adjusting the separation of the plexiglass sheet between the fixed and movable magnets. The velocity of the avalanching magnets as the filling fraction is varied displays a jamming transition, with a non-trivial dependence on the pinning strength of the lattice of fixed magnets below the sheet.

  9. JMCT Monte Carlo simulation analysis of full core PWR Pin-By-Pin and shielding

    International Nuclear Information System (INIS)

    Deng, L.; Li, G.; Zhang, B.; Shangguan, D.; Ma, Y.; Hu, Z.; Fu, Y.; Li, R.; Hu, X.; Cheng, T.; Shi, D.

    2015-01-01

    This paper describes the application of the JMCT Monte Carlo code to the simulation of Kord Smith Challenge H-M model, BEAVRS model and Chinese SG-III model. For H-M model, the 6.3624 millions tally regions and the 98.3 billion neutron histories do. The detailed pin flux and energy deposition densities obtain. 95% regions have less 1% standard deviation. For BEAVRS model, firstly, we performed the neutron transport calculation of 398 axial planes in the Hot Zero Power (HZP) status. Almost the same results with MC21 and OpenMC results are achieved. The detailed pin-power density distribution and standard deviation are shown. Then, we performed the calculation of ten depletion steps in 30 axial plane cases. The depletion regions exceed 1.5 million and 12,000 processors uses. Finally, the Chinese SG-III laser model is simulated. The neutron and photon flux distributions are given, respectively. The results show that the JMCT code well suits for extremely large reactor and shielding simulation. (author)

  10. A polygonal nodal SP3 method for whole core Pin-by-Pin neutronics calculation

    Energy Technology Data Exchange (ETDEWEB)

    Li, Yunzhao; Wu, Hongchun; Cao, Liangzhi, E-mail: xjtulyz@gmail.com, E-mail: hongchun@mail.xjtu.edu.cn, E-mail: caolz@mail.xjtu.edu.cn [School of Nuclear Science and Technology, Xi' an Jiaotong University, Shaanxi (China)

    2011-07-01

    In this polygonal nodal-SP3 method, neutron transport equation is transformed by employing an isotropic SP3 method into two coupled equations that are both in the same mathematic form with the diffusion equation, and then a polygonal nodal method is proposed to solve the two coupled equations. In the polygonal nodal method, adjacent nodes are coupled through partial currents, and a nodal response matrix between incoming and outgoing currents is obtained by expanding detailed nodal flux distribution into a sum of exponential functions. This method avoids the transverse integral technique, which is widely used in regular nodal method and can not be used in triangular geometry because of the mathematical singularity. It is demonstrated by the numerical results of the test problems that the k{sub eff} and power distribution agree well with other codes, the triangular nodal-SP3 method appears faster, and that whole core pin-by-pin transport calculation with fine meshes is feasible after parallelization and acceleration. (author)

  11. Development of modeling tools for pin-by-pin precise reactor simulation

    International Nuclear Information System (INIS)

    Ma Yan; Li Shu; Li Gang; Zhang Baoyin; Deng Li; Fu Yuanguang

    2013-01-01

    In order to develop large-scale transport simulation and calculation method (such as simulation of whole reactor core pin-by-pin problem), the Institute of Applied Physics and Computational Mathematics developed the neutron-photon coupled transport code JMCT and the toolkit JCOGIN. Creating physical calculation model easily and efficiently can essentially reduce problem solving time. Currently, lots of visual modeling programs have been developed based on different CAD systems. In this article, the developing idea of a visual modeling tool based on field oriented development was introduced. Considering the feature of physical modeling, fast and convenient operation modules were developed. In order to solve the storage and conversion problems of large scale models, the data structure and conversional algorithm based on the hierarchical geometry tree were designed. The automatic conversion and generation of physical model input file for JMCT were realized. By using this modeling tool, the Dayawan reactor whole core physical model was created, and the transformed file was delivered to JMCT for transport calculation. The results validate the correctness of the visual modeling tool. (authors)

  12. Repeat biopsy in patients with initial diagnosis of PIN; La biopsia ripetuta nei pazienti con diagnosi iniziale di PIN

    Energy Technology Data Exchange (ETDEWEB)

    De Matteis, Massimo [Azienda Ospedaliera Policlinico S. Orsola-Malpighi, Bologna (Italy). UO Radiologia Albertoni; Poggi, Cristina; De Martino, Antonietta; Pavlica, Pietro [Azienda Ospedaliera Policlinico S. Orsola-Malpighi, Bologna (Italy). UO Radiologia Palagi, Dipartimento area radiologica; Corti, Barbara [Azienda Ospedaliera Policlinico S. Orsola-Malpighi, Bologna (Italy). UO Anatomia ed istologia patologica, Dipartimento oncologico ed ematologico; Barozzi, Libero [Azienda Ospedaliera Policlinico S. Orsola-Malpighi, Bologna (Italy). UO Radiologia d' urgenza, Dipartimento emergenze ed accettazione

    2005-09-15

    Purpose. Prostatic intra-epithelial neoplasia (PIN) is considered a pre-malignant lesion and the main precursor of invasive prostatic adenocarcinoma. A PIN diagnosis established by prostate needle biopsy poses a difficult clinical management. problem. We retrospectively reviewed our three-year experience in order to identify criteria for referring patients to repeat biopsy. Materials and methods. We reviewed the repeat biopsy records of 72 patients in whom PIN had been detected on initial US-guided needle biopsy of the prostate. All the patients had a minimum of 6 biopsy cores taken, and they all had PSA > 4 ng/ml. Results. Adenocarcinoma was detected in 15 patients out of 50 (30%) with an initial diagnosis of low-grade PIN and in 10 patients out of 22 (45.4%) with high grade PIN, in 7 out of 18 (39%) in whom PSA levels had decreased during the observation interval, in 16 patients out of 46 (35%) in whom the PSA had increased and in 2 patients out of 8 (25%) with stable PSA. Conclusions. Our results seem to confirm that PIN can be considered a precursor of prostatic adenocarcinoma or a histological alteration often associated with it. Patients with low-grade PIN and particularly those with high-grade PIN should be regularly subjected to repeat biopsy at short intervals due to the high frequency of the final diagnosis of carcinoma. No agreement has been reached on the time interval between the first and the second biopsy. The PSA changes during the observation period are not a statistically significant parameter to suggest the repetition of prostatic biopsy. [Italian] Scopo. La neoplasia prostatica intraepiteliale (PIN) e considerata una lesione premaligna ed il precursore principale dell'adenocarcinoma prostatico infiltrante. La diagnosi di PIN ottenuta con l'agobiopsia della prostata rappresenta un difficile problema gestionale clinico. In una valutazione retrospettiva della nostra esperienza di 3 anni si e cercato di individuare i criteri che possano

  13. Interplay between collective pinning and artificial defects on domain wall propagation in Co/Pt multilayers

    International Nuclear Information System (INIS)

    Rodriguez-Rodriguez, G; Hierro-Rodriguez, A; Perez-Junquera, A; Montenegro, N; Alameda, J M; Velez, M; Menendez, J L; Ravelosona, D

    2010-01-01

    The interplay between collective pinning on intrinsic structural defects and artificial pinning at a patterned hole is studied in magnetic multilayers with perpendicular anisotropy. The pinning strength of a patterned hole is measured through its efficiency to stop domain wall (DW) propagation into a consecutive unpatterned nanowire section (using antisymmetric magnetoresistance to detect the direction of DW propagation) whereas collective pinning is characterized by the field dependence of DW velocity. Close to room temperature, collective pinning becomes weaker than artificial pinning so that pinning at the hole compensates nucleation-pad geometry, blocking DW propagation across the nanowire.

  14. Fuel pin bowing and related investigation of WWER-440 control rod influence on power release inside of neighbouring fuel pins

    International Nuclear Information System (INIS)

    Mikus, J.

    2005-01-01

    The purpose of this work consists in investigation of the WWER-440 control rod (CR) influence on space power distribution, especially from viewpoint of the values and gradient occurrence that could result in static and cyclic loads with some consequences, e.g. fuel pin bowing. As known, CR can cause power peaks in periphery fuel pins of adjacent operating assemblies because of the butt joint design of the absorbing adapter to the CR fuel part, that is, presence of the water cavity resulting in a flash up of thermal neutrons. As a consequence, beside well-known peaks in axial power distribution, above power gradients can occur inside of mentioned fuel pins. Because of complicated geometry and material composition of the CR, the detailed calculations concerning both above phenomena are complicated, too. Therefore it is useful to acquire appropriate experimental data to investigate mentioned influence and compare them with calculations. Since detailed power distributions cannot be obtained in the NPP, needed information is provided by means of experiments on research reactors. In case of measurements inside of fuel pins, special (e.g. track) detectors placed between fuel pellets are used. Such works are relatively complicated and time consuming, therefore an evaluation based on mathematical modelling and numerical approximation was proposed by means of that, and using measured power release in some selected fuel pins, information about power release inside of one of these fuel pins, can be obtained. For this purpose, an experiment on light water, zero-power research reactor LR-0 was realized and axial power distribution measurements were performed in a WWER-440 type core near to an authentic CR model. Application of the above evaluation method is demonstrated on one ''investigated'' fuel pin neighbouring CR by means of following results: 1. Axial power distribution inside of investigated fuel pin in two opposite positions on its pellets surface that are situated to

  15. Complications after pinning of supracondylar distal humerus fractures.

    Science.gov (United States)

    Bashyal, Ravi K; Chu, Jennifer Y; Schoenecker, Perry L; Dobbs, Matthew B; Luhmann, Scott J; Gordon, J Eric

    2009-01-01

    Supracondylar distal humerus fractures are one of the most common skeletal injuries in children. The current treatment of choice in North America is closed reduction and percutaneous pin fixation. Often surgeons leave the pins exposed beneath a cast but outside the skin. Great variation exists with respect to preoperative skin preparation, and perioperative antibiotic administration. Few data exist regarding the rate of infection and other complications. The purpose of this study is to review a large series of children to evaluate the rate of infection and other complications. A retrospective review was carried out of all patients treated at our institution over an 11-year period. A total of 622 patients were identified that were followed for a minimum of 2 weeks after pin removal. Seventeen patients had flexion-type fractures, 294 had type II fractures, and 311 had type III fractures. Seventy-four fractures (11.9%) had preoperative nerve deficits with anterior interosseous palsies being the most common (33 fractures, 5.3%). Preoperative antibiotics were given to 163 patients (26.2%). Spray and towel draping were used in 362 patients, paint and towel draping were used in 65 patients, alcohol paint and towel draping were used in 146 patients, and a full preparation and draping were used in 13 patients. The pins were left exposed under the cast in 591 fractures (95%), and buried beneath the skin in 31 fractures (5.0%). A medial pin was placed in 311 fractures with a small incision made to aid placement in 18 of these cases. The most common complication was pin migration necessitating unexpected return to the operating room for pin removal in 11 patients (1.8%). One patient developed a deep infection with septic arthritis and osteomyelitis (0.2%). Five additional patients had superficial skin infections and were treated with oral antibiotics for a total infection rate of 6 of 622 patients (1.0%). One patient ultimately had a malunion and 4 others returned to the

  16. High-performance whole core Pin-by-Pin calculation based on EFEN-SP_3 method

    International Nuclear Information System (INIS)

    Yang Wen; Zheng Youqi; Wu Hongchun; Cao Liangzhi; Li Yunzhao

    2014-01-01

    The EFEN code for high-performance PWR whole core pin-by-pin calculation based on the EFEN-SP_3 method can be achieved by employing spatial parallelization based on MPI. To take advantage of the advanced computing and storage power, the entire problem spatial domain can be appropriately decomposed into sub-domains and the assigned to parallel CPUs to balance the computing load and minimize communication cost. Meanwhile, Red-Black Gauss-Seidel nodal sweeping scheme is employed to avoid the within-group iteration deterioration due to spatial parallelization. Numerical results based on whole core pin-by-pin problems designed according to commercial PWRs demonstrate the following conclusions: The EFEN code can provide results with acceptable accuracy; Communication period impacts neither the accuracy nor the parallel efficiency; Domain decomposition methods with smaller surface to volume ratio leads to greater parallel efficiency; A PWR whole core pin-by-pin calculation with a spatial mesh 289 × 289 × 218 and 4 energy groups could be completed about 900 s by using 125 CPUs, and its parallel efficiency is maintained at about 90%. (authors)

  17. Multilevel parallel strategy on Monte Carlo particle transport for the large-scale full-core pin-by-pin simulations

    International Nuclear Information System (INIS)

    Zhang, B.; Li, G.; Wang, W.; Shangguan, D.; Deng, L.

    2015-01-01

    This paper introduces the Strategy of multilevel hybrid parallelism of JCOGIN Infrastructure on Monte Carlo Particle Transport for the large-scale full-core pin-by-pin simulations. The particle parallelism, domain decomposition parallelism and MPI/OpenMP parallelism are designed and implemented. By the testing, JMCT presents the parallel scalability of JCOGIN, which reaches the parallel efficiency 80% on 120,000 cores for the pin-by-pin computation of the BEAVRS benchmark. (author)

  18. Development of a semiconductor neutron dosimeter with a PIN diode

    International Nuclear Information System (INIS)

    Kim, Seungho; Lee, Namho; Cho, Jaiwan; Youk, Geunuck

    2004-01-01

    When a Si PIN diode is exposed to fast neutrons, it produces displacement in Si lattice structure of the diode. Defects induced from structural dislocation become effective recombination centers for carriers which pass through the base of a PIN diode. Hence, increasing the resistivity of the diode decreases the current for the applied forward voltage. This paper involves the development of a neutron sensor based on the phenomena of the displacement effect damaged by neutron exposure. The neutron effect on the semiconductor was analyzed, and multi PIN diode arrays with various intrinsic layer (I layer) thicknesses and cross sections were fabricated. Under irradiation tests with a neutron beam, the manufactured diodes have good characteristics of linearity in a neutron irradiation experiment and give results that the increase of thickness of I layer and the decrease of the cross-section of the PIN diodes improve the sensitivity. Newly developed PIN diodes with a thicker I layer and various cross sections were retested and showed the best neutron sensitivity in the condition that the I layer thickness was similar to the length of a side of the cross-section. On the basis of two test results, final PIN diodes with a rectangular shape were manufactured and the characteristics for neutron detectors were analyzed through the neutron beam test using the on-line electronic dosimetry system. The developed PIN diode shows a good linearity to absorbed dose in the range of 0 to 1,000cGy (Tissue) and its neutron sensitivity is 13 mV/cGy at a constant current of 5 mA, that is three higher than that of similar commercially developed neutron detectors. Moreover the device shows less dependency on the orientation of the neutron beam and a considerable stability in an annealing test for a long period. (author)

  19. Fuel pin response to an overpower transient in an LMFBR

    International Nuclear Information System (INIS)

    Grosberg, A.J.; Head, J.L.

    1979-01-01

    This paper describes a method by which the ability of a whole-core code accurately to predict the time and location of the first fuel pin failures may be tested. The method involves the use of a relatively simple whole-core code to 'drive' a sophisticated fuel pin code, which is far too complex to be used within a whole-core code but which is potentially capable of modelling reliably the response of an individual fuel pin. The method cannot follow accurately the subsequent course of the transient because the simple whole-core code does not model the reactivity effects of events which may follow pin failure. The codes used were the simple whole-core code FUTURE and the fuel pin behaviour code FRUMP. The paper describes an application of the method to analyse a hypothetical LMFBR accident in which the control rods were assumed to be driven from the core at maximum speed, with all trip circuits failed. Taking 0.5% clad strain as a clad failure criterion, failure was predicted to occur at the top of the active core at about 10s into the transient. A repeat analysis, using an alternative clad yield criterion which is thought to be more realistic, indicated failure at the same position but 24s into the transient. This is after the onset of sodium boiling. Pin failure at the top of the core are likely to cause negative reactivity changes. In this hypothetical accident, pin failures are likely, therefore, to have a moderating effect on the course of the transient. (orig.)

  20. Alpha particles spectrometer with photodiode PIN; Espectrometro de particulas alfa con fotodiodo PIN

    Energy Technology Data Exchange (ETDEWEB)

    Chacon R, A.; Hernandez V, R.; Hernandez D, V. M.; Vega C, H. R. [Universidad Autonoma de Zacatecas, Unidades Academicas de Estudios Nucleares e Ingenieria Electrica, Calle Cipres No. 10, Fracc. La Penuela, 09869 Zacatecas (Mexico); Ramirez G, J. [Instituto Nacional de Estadistica Geografia e Informatica, Direccion General de Innovacion y Tecnologia de Informacion, Av. Heroes de Nacozari Sur 2301, Fracc. Jardines del Parque, 20276 Aguascalientes (Mexico)], e-mail: achruiz@hotmail.com

    2009-10-15

    The radiation propagates in form of electromagnetic waves or corpuscular radiation; if the radiation energy causes ionization in environment that crosses it is considered ionizing radiation. To detect radiation several detectors types are used, if the radiation are alpha particles are used detectors proportional type or trace elements. In this work the design results, construction and tests of an alpha particles spectrometer are presented, which was designed starting from a photodiode PIN type. The system design was simulated with a code for electronic circuits. With results of simulation phase was constructed the electronic phase that is coupled to a multichannel analyzer. The resulting electronic is evaluated analyzing the electronic circuit performance before an alphas triple source and alpha radiation that produce two smoke detectors of domestic use. On the tests phase we find that the system allows obtain, in a multichannel, the pulses height spectrum, with which we calibrate the system. (Author)

  1. Generation of clusters in complex dynamical networks via pinning control

    International Nuclear Information System (INIS)

    Li Kezan; Fu Xinchu; Small, Michael

    2008-01-01

    Many real-world networks show community structure, i.e., groups (or clusters) of nodes that have a high density of links within them but with a lower density of links between them. In this paper, by applying feedback injections to a fraction of network nodes, various clusters are synchronized independently according to the community structure generated by the group partition of the network (cluster synchronization). This control is achieved by pinning (i.e. applying linear feedback control) to a subset of the network nodes. Those pinned nodes are selected not randomly but according to the topological structure of communities of a given network. Specifically, for a given group partition of a network, those nodes with direct connections between groups must be pinned in order to achieve cluster synchronization. Both the local stability and global stability of cluster synchronization are investigated. Taking the tree-shaped network and the most modular network as two particular examples, we illustrate in detail how the pinning strategy influences the generation of clusters. The simulations verify the efficiency of the pinning schemes used in this paper

  2. A Flux-Pinning Mechanism for Segment Assembly and Alignment

    Science.gov (United States)

    Gersh-Range, Jessica A.; Arnold, William R.; Peck, Mason A.; Stahl, H. Philip

    2011-01-01

    Currently, the most compelling astrophysics questions include how planets and the first stars formed and whether there are protostellar disks that contain large organic molecules. Although answering these questions requires space telescopes with apertures of at least 10 meters, such large primaries are challenging to construct by scaling up previous designs; the limited capacity of a launch vehicle bounds the maximum diameter of a monolithic primary, and beyond a certain size, deployable telescopes cannot fit in current launch vehicle fairings. One potential solution is connecting the primary mirror segments edgewise using flux-pinning mechanisms, which are analogous to non-contacting damped springs. In the baseline design, a flux-pinning mechanism consists of a magnet and a superconductor separated by a predetermined gap, with the damping adjusted by placing aluminum near the interface. Since flux pinning is possible only when the superconductor is cooled below a critical temperature, flux-pinning mechanisms are uniquely suited for cryogenic space telescopes. By placing these mechanisms along the edges of the mirror segments, a primary can be built up over time. Since flux pinning requires no mechanical deployments, the assembly process could be robotic or use some other non-contacting scheme. Advantages of this approach include scalability and passive stability.

  3. Pin1 and neurodegeneration: a new player for prion disorders?

    Directory of Open Access Journals (Sweden)

    Elisa Isopi

    2015-07-01

    Full Text Available Pin1 is a peptidyl-prolyl isomerase that catalyzes the cis/trans conversion of phosphorylated proteins at serine or threonine residues which precede a proline. The peptidyl-prolyl isomerization induces a conformational change of the proteins involved in cell signaling process. Pin1 dysregulation has been associated with some neurodegenerative disorders such as Alzheimer's disease, Parkinson's disease and Huntington's disease. Proline-directed phosphorylation is a common regulator of these pathologies and a recent work showed that it is also involved in prion disorders. In fact, prion protein phosphorylation at the Ser-43-Pro motif induces prion protein conversion into a disease-associated form. Furthermore, phosphorylation at Ser-43-Pro has been observed to increase in the cerebral spinal fluid of sporadic Creutzfeldt-Jakob Disease patients. These findings provide new insights into the pathogenesis of prion disorders, suggesting Pin1 as a potential new player in the disease. In this paper, we review the mechanisms underlying Pin1 involvement in the aforementioned neurodegenerative pathologies focusing on the potential role of Pin1 in prion disorders.

  4. Exchange anisotropy pinning of a standing spin-wave mode

    Science.gov (United States)

    Magaraggia, R.; Kennewell, K.; Kostylev, M.; Stamps, R. L.; Ali, M.; Greig, D.; Hickey, B. J.; Marrows, C. H.

    2011-02-01

    Standing spin waves in a thin film are used as sensitive probes of interface pinning induced by an antiferromagnet through exchange anisotropy. Using coplanar waveguide ferromagnetic resonance, pinning of the lowest energy spin-wave thickness mode in Ni80Fe20/Ir25Mn75 exchange-biased bilayers was studied for a range of Ir25Mn75 thicknesses. We show that pinning of the standing mode can be used to amplify, relative to the fundamental resonance, frequency shifts associated with exchange bias. The shifts provide a unique “fingerprint” of the exchange bias and can be interpreted in terms of an effective ferromagnetic film thickness and ferromagnet-antiferromagnet interface anisotropy. Thermal effects are studied for ultrathin antiferromagnetic Ir25Mn75 thicknesses, and the onset of bias is correlated with changes in the pinning fields. The pinning strength magnitude is found to grow with cooling of the sample, while the effective ferromagnetic film thickness simultaneously decreases. These results suggest that exchange bias involves some deformation of magnetic order in the interface region.

  5. Automation of FBTR fuel pin inspection using FPGA

    International Nuclear Information System (INIS)

    Khare, K.M.; Pai, Siddhesh; Pant, Brijesh; Sendhil Raja, S.; Gupta, P.K.

    2011-01-01

    A non-contact metrology system for inspection of FBTR fuel pins has been developed. The system consists of a stepper motors driven mechanism for orientation and positioning of FBTR fuel pin, a telecentric imaging system, absolute linear encoder with 0.1 μm resolution and a Field Programmable Gate Array (FPCA) based controller. The FBTR pin assembly is telecentrically illuminated from bottom by a red LED and its shadow graph is imaged using a CCD camera through telecentric imaging lens system. For system control and automation we have used a FPGA that has integrated soft picoblaze processor, X-θ axis motion controller, custom IPs for encoder data acquisition, synchronization circuit, RS485 interface along with other l/Os. Using the Graphical User Interface (GUI) on a PC the system is initialized at home position and the controller provides the trigger signal for start of data acquisition of CCD camera. CCD image of pin and the corresponding X-θ information is captured. After the acquisition of one set of images, the imaging module is moved with a step size pre-programmed to ensure proper stitching of acquired images. The GUI is programmed to analyze these X-θ Images to calculate the required parameters of the fuel pin like the diameter variation, pitch and bow. The details of the instrument and measurements made with it will be presented. (author)

  6. Silicide Schottky Contacts to Silicon: Screened Pinning at Defect Levels

    Energy Technology Data Exchange (ETDEWEB)

    Drummond, T.J.

    1999-03-11

    Silicide Schottky contacts can be as large as 0.955 eV (E{sub v} + 0.165 eV) on n-type silicon and as large as 1.05 eV (E{sub c} {minus} 0.07 eV) on p-type silicon. Current models of Schottky barrier formation do not provide a satisfactory explanation of occurrence of this wide variation. A model for understanding Schottky contacts via screened pinning at defect levels is presented. In the present paper it is shown that most transition metal silicides are pinned approximately 0.48 eV above the valence band by interstitial Si clusters. Rare earth disilicides pin close to the divacancy acceptor level 0.41 eV below the conduction band edge while high work function silicides of Ir and Pt pin close to the divacancy donor level 0.21 eV above the valence band edge. Selection of a particular defect pinning level depends strongly on the relative positions of the silicide work function and the defect energy level on an absolute energy scale.

  7. Performance of electrical contact pins near a nuclear explosion

    International Nuclear Information System (INIS)

    Ragan, C.E.; Silbert, M.G.; Ellis, A.N.; Robinson, E.E.; Daddario, M.J.

    1977-09-01

    The pressures attainable in equation-of-state studies using nuclear-explosion-driven shock waves greatly exceed those that can be reached in normal laboratory conditions. However, the diagnostic instrumentation must survive in the high-radiation environment present near such an explosion. Therefore, a set of experiments were fielded on the Redmud event to test the feasibility of using electrical contact pins in this environment. In these experiments a 60-cm-high shield of boron-lead was placed on the rack lid approximately 1 m from the device. A sample consisting of slabs of molybdenum and 238 U was placed on top of the shield, and twelve electrical contact pins were embedded to five different depths in the materials. Five different multiplexing-charging circuits were used for the pins, and a piezoelectric quartz gauge was placed on top of the uranium to obtain an estimate of the fission-energy deposition. All of the charged pins survived the radiation and produced signals indicating shock arrival. The uncertainty in determining the pin-closure time was approximately 3 ns. The signal from the quartz gauge corresponded to a pressure that was consistent with the calculated neutron fluence

  8. Cluster synchronization for directed community networks via pinning partial schemes

    International Nuclear Information System (INIS)

    Hu Cheng; Jiang Haijun

    2012-01-01

    Highlights: ► Cluster synchronization for directed community networks is proposed by pinning partial schemes. ► Each community is considered as a whole. ► Several novel pinning criteria are derived based on the information of communities. ► A numerical example with simulation is provided. - Abstract: In this paper, we focus on driving a class of directed networks to achieve cluster synchronization by pinning schemes. The desired cluster synchronization states are no longer decoupled orbits but a set of un-decoupled trajectories. Each community is considered as a whole and the synchronization criteria are derived based on the information of communities. Several pinning schemes including feedback control and adaptive strategy are proposed to select controlled communities by analyzing the information of each community such as indegrees and outdegrees. In all, this paper answers several challenging problems in pinning control of directed community networks: (1) What communities should be chosen as controlled candidates? (2) How many communities are needed to be controlled? (3) How large should the control gains be used in a given community network to achieve cluster synchronization? Finally, an example with numerical simulations is given to demonstrate the effectiveness of the theoretical results.

  9. Irradiation of TZM: Uranium dioxide fuel pin at 1700 K

    Science.gov (United States)

    Mcdonald, G. E.

    1973-01-01

    A fuel pin clad with TZM and containing solid pellets of uranium dioxide was fission heated in a static helium-cooled capsule at a maximum surface temperature of 1700 K for approximately 1000 hr and to a total burnup of 2.0 percent of the uranium-235. The results of the postirradiation examination indicated: (1) A transverse, intergranular failure of the fuel pin occurred when the fuel pin reached 2.0-percent burnup. This corresponds to 1330 kW-hr/cu cm, where the volume is the sum of the fuel, clad, and void volumes in the fuel region. (2) The maximum swelling of the fuel pin was less than 1.5 percent on the fuel-pin diameter. (3) There was no visible interaction between the TZM clad and the UO2. (4) Irradiation at 1700 K produced a course-grained structure, with an average grain diameter of 0.02 centimeter and with some of the grains extending one-half of the thickness of the clad. (5) Below approximately 1500 K, the irradiation of the clad produced a moderately fine-grained structure, with an average grain diameter of 0.004 centimeter.

  10. Tai Chi and Qi Gong

    Science.gov (United States)

    ... of Grants and Contracts General Award Mechanisms Small Business Research Grant Program (SBIR) Funding for: Natural Product Research ... tai chi and qigong in older adults. Western Journal of Nursing Research. 2009;31(2):245–279. Saeed SA, Antonacci ...

  11. Reirradiation of mixed-oxide fuel pins at increased temperatures

    International Nuclear Information System (INIS)

    Lawrence, L.A.; Weber, E.T.

    1976-05-01

    Mixed-oxide fuel pins from EBR-II irradiations were reirradiated in the General Electric Test Reactor (GETR) at higher temperatures than experienced in EBR-II to study effects of the increased operating temperatures on thermal/mechanical and chemical behavior. The response of a mixed-oxide fuel pin to a power increase after having operated at a lower power for a significant portion of its life-time is an area of performance evaluation where little information currently exists. Results show that the cladding diameter changes resulting from the reirradiation are strongly dependent upon both prior burnup level and the magnitude of the temperature increase. Results provide the initial rough outlines of boundaries within which mixed-oxide fuel pins can or cannot tolerate power increases after substantial prior burnup at lower powers

  12. Pin Tool Geometry Effects in Friction Stir Welding

    Science.gov (United States)

    Querin, J. A.; Rubisoff, H. A.; Schneider, J. A.

    2009-01-01

    In friction stir welding (FSW) there is significant evidence that material can take one of two different flow paths when being displaced from its original position in front of the pin tool to its final position in the wake of the weld. The geometry of the pin tool, along with the process parameters, plays an important role in dictating the path that the material takes. Each flow path will impart a different thermomechanical history on the material, consequently altering the material microstructure and subsequent weld properties. The intention of this research is to isolate the effect that different pin tool attributes have on the flow paths imparted on the FSWed material. Based on published weld tool geometries, a variety of weld tools were fabricated and used to join AA2219. Results from the tensile properties and microstructural characterization will be presented.

  13. Control of Flux Pinning in MOD YBCO Coated Conductor

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, W. [American Superconductor Corporation, Westborough, MA; Huang, Y. [American Superconductor Corporation, Westborough, MA; Li, X. [American Superconductor Corporation, Westborough, MA; Kodenkandath, Thomas [American Superconductor Corporation, Westborough, MA; Rupich, Marty [American Superconductor Corporation, Westborough, MA; Schoop, U. [American Superconductor Corporation, Westborough, MA; Verebelyi, D. T. [American Superconductor Corporation, Westborough, MA; Thieme, C. L. H. [American Superconductor Corporation, Westborough, MA; Siegal, E. E. [American Superconductor Corporation, Westborough, MA; Holesinger, T. G. [Los Alamos National Laboratory (LANL); Maiorov, B. [Los Alamos National Laboratory (LANL); Miller, D. J. [Argonne National Laboratory (ANL); Maroni, V. A. [Argonne National Laboratory (ANL); Goyal, Amit [ORNL; Specht, Eliot D [ORNL; Paranthaman, Mariappan Parans [ORNL

    2007-01-01

    Two different types of defect structures have been identified to be responsible for the enhanced pinning in metal organic deposited YBCO films. Rare earth additions result in the formation of nanodots in the YBCO matrix, which form uncorrelated pinning centers, increasing pinning in all magnetic field orientations. 124-type intergrowths, which form as laminar structures parallel to the ab-plane, are responsible for the large current enhancement when the magnetic field is oriented in the ab-plane. TEM studies showed that the intergrowths emanate from cuprous containing secondary phase particles, whose density is partially controlled by the rare earth doping level. Critical process parameters have been identified to control this phase formation, and therefore, control the f 24 intergrowth formation. This work has shown that through process control and proper conductor design, either by adjusting the composition or by multiple coatings of different functional layers, the desired angular dependence can be achieved.

  14. Control of flux pinning in MOD YBCO coated conductor.

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, W.; Huang, Y.; Li, X.; Kodenkandath, T.; Rupich, M. W.; Schoop, U.; Verebelyi, D. T.; Thieme, C. L. H.; Siegal, E.; Holesinger, T. G.; Maiorov, B.; Civale, L.; Miller, D. J.; Maroni, V. A.; Li, J.; Martin, P. M.; Specht, E. D.; Goyal, A.; Paranthaman, M. P.; American Superconductor Corp.; LANL; ORNL

    2007-06-01

    NTwo different types of defect structures have been identified to be responsible for the enhanced pinning in metal organic deposited YBCO films. Rare earth additions result in the formation of nanodots in the YBCO matrix, which form uncorrelated pinning centers, increasing pinning in all magnetic field orientations. 124-type intergrowths, which form as laminar structures parallel to the ab-plane, are responsible for the large current enhancement when the magnetic field is oriented in the ab-plane. TEM studies showed that the intergrowths emanate from cuprous containing secondary phase particles, whose density is partially controlled by the rare earth doping level. Critical process parameters have been identified to control this phase formation, and therefore, control the f 24 intergrowth formation. This work has shown that through process control and proper conductor design, either by adjusting the composition or by multiple coatings of different functional layers, the desired angular dependence can be achieved.

  15. Practical synchronization on complex dynamical networks via optimal pinning control

    Science.gov (United States)

    Li, Kezan; Sun, Weigang; Small, Michael; Fu, Xinchu

    2015-07-01

    We consider practical synchronization on complex dynamical networks under linear feedback control designed by optimal control theory. The control goal is to minimize global synchronization error and control strength over a given finite time interval, and synchronization error at terminal time. By utilizing the Pontryagin's minimum principle, and based on a general complex dynamical network, we obtain an optimal system to achieve the control goal. The result is verified by performing some numerical simulations on Star networks, Watts-Strogatz networks, and Barabási-Albert networks. Moreover, by combining optimal control and traditional pinning control, we propose an optimal pinning control strategy which depends on the network's topological structure. Obtained results show that optimal pinning control is very effective for synchronization control in real applications.

  16. Symmetric Pin Diversion Detection using a Partial Defect Detector (PDET)

    International Nuclear Information System (INIS)

    Sitaraman, S.; Ham, Y.S.

    2009-01-01

    Since the signature from the Partial Defect Detector (PDET) is principally dependent on the geometric layout of the guide tube locations, the capability of the technique in detecting symmetric diversion of pins needs to be determined. The Monte Carlo simulation study consisted of cases where pins were removed in a symmetric manner and the resulting signatures were examined. In addition to the normalized gamma-to-neutron ratios, the neutron and gamma signatures normalized to their maximum values, were also examined. Examination of the shape of the three curves as well as of the peak-to-valley differences in excess of the maximum expected in intact assemblies, indicated pin diversion. A set of simulations with various symmetric patterns of diversion were examined. The results from these studies indicated that symmetric diversions as low as twelve percent could be detected by this methodology

  17. Flux pinning in La70 Cu30 disordered system

    International Nuclear Information System (INIS)

    Esquinazi, P.; Guillet, B.; Dussell, H.

    1983-09-01

    Superconducting critical currents were measured as a function of a perpendicular applied magnetic field in disordered La 70 Cu 30 . It is shown that the pinning force is very sensitive to inhomogeneties already present in the as quenched samples, although these inhomogeneties have no obvious influence on other superconducting and transport properties. A simple series resistance model is used to explain the magnetic field dependence of the pinning force. A large decrease of the pinning force was obtained for the annealed samples. This behaviour is consistent with the phase separation model that explains the evolution of the superconductive penetration depth. In order to obtain a better characterization of the structural evolution with annealing of the La 70 Cu 30 system, behaviour of the electrical resistivity, superconducting critical temperature and differential thermal analysis were measured. (author)

  18. Radiation detectors of PIN type for X-rays

    International Nuclear Information System (INIS)

    Ramirez-Jimenez, F.J.

    2003-01-01

    In this laboratory session, tree experiments are proposed: the measurement of X-ray energy spectra from radioactive sources with a high resolution cooled Si-Li detector, with a room temperature PIN diode and the measurement of the response of a PIN diode to the intensity of X-rays of radio-diagnostic units. The spectra obtained with the Si-Li detector help to understand the energy distribution of X-rays and are used as a reference to compare the results obtained with the PIN diode. Measurements in medical X-ray machines are proposed. Low cost, simple electronic instruments and systems are used as tools to make measurements in X-ray units used in radio-diagnostic

  19. Development of wire wrapping technology for FBR fuel pin

    International Nuclear Information System (INIS)

    Nogami, Tetsuya; Seki, Nobuo; Sawayama, Takeo; Ishibashi, Takashi

    1991-01-01

    For the FBR fuel assembly, the spacer wire is adopted to maintain the space between fuel pins. The developments have been carried out to achieve automatically wire wrapping with high precision. Based on the fundamental technology developed through the mock-up test operation, Joyo 'MK-I', fuel pin fabrication was started using partially mechanized wire wrapping machine in 1973. In 1978, an automated wire wrapping machine for Joyo 'MK-II' was developed by the adoption of some improvements for the wire inserting system to end plug hole and the precision of wire pitch. On the bases of these experiences, fully automated wire wrapping machine for 'Monju' fuel pin was installed at Plutonium Fuel Production Facility (PFPF) in 1987. (author)

  20. Component Pin Recognition Using Algorithms Based on Machine Learning

    Science.gov (United States)

    Xiao, Yang; Hu, Hong; Liu, Ze; Xu, Jiangchang

    2018-04-01

    The purpose of machine vision for a plug-in machine is to improve the machine’s stability and accuracy, and recognition of the component pin is an important part of the vision. This paper focuses on component pin recognition using three different techniques. The first technique involves traditional image processing using the core algorithm for binary large object (BLOB) analysis. The second technique uses the histogram of oriented gradients (HOG), to experimentally compare the effect of the support vector machine (SVM) and the adaptive boosting machine (AdaBoost) learning meta-algorithm classifiers. The third technique is the use of an in-depth learning method known as convolution neural network (CNN), which involves identifying the pin by comparing a sample to its training. The main purpose of the research presented in this paper is to increase the knowledge of learning methods used in the plug-in machine industry in order to achieve better results.

  1. FFTF/IEM cell fuel pin weighing system

    International Nuclear Information System (INIS)

    Gibbons, P.W.

    1987-01-01

    The Interim Examination and Maintenance (IEM) cell in the Fast Flux Test Facility (FFTF) is used for remote disassembly of irradiated fuel and materials experiments. For those fuel experiments where the FFTF tag-gas detection system has indicated a fuel pin cladding breach, a weighing system is used in identifying that fuel pin with a reduced weight due to the escape of gaseous and volatile fission products. A fuel pin weighing machine, originally purchased for use in the Fuels and Materials Examination Facility (FMEF), was the basis for the IEM cell system. Design modifications to the original equipment were centered around adapting the machine to the differences between the two facilities and correcting deficiencies discovered during functional testing in the IEM cell mock-up

  2. Treatment of Common Cold Patients with the Shi-Cha Capsule: A Multicenter, Double-Blind, Randomized, Placebo-Controlled, Dose-Escalation Trial

    Science.gov (United States)

    Chang, Jing; Dong, Shou-Jin; She, Bin; Zhang, Rui-Ming; Meng, Mao-Bin; Xu, Yan-Ling; Wan, Li-Ling; Shi, Ke-Hua; Pan, Jun-Hun; Mao, Bing

    2012-01-01

    This study was designed to determine the therapeutic efficacy and safety of the Shi-cha capsule, a Chinese herbal formula, in the treatment of patients with wind-cold type common cold. In our multi-center, prospective, double-blind, randomized, placebo-controlled, dose-escalation trial, patients with wind-cold type common cold received 0.6 g of Shi-cha capsule plus 0.6 g placebo (group A), 1.2 g of Shi-cha capsule (group B), or 1.2 g placebo (group C), three times daily for 3 days and followed up to 10 days. The primary end point was all symptom duration. The secondary end points were main symptom duration, minor symptom duration, the changes in cumulative symptom score, main symptom score, and minor symptom score 4 days after the treatment, as well as adverse events. A total of 377 patients were recruited and 360 met the inclusive criteria; 120 patients constituted each treatment group. Compared with patients in group C, patients in groups A and B had significant improvement in the all symptom duration, main symptom duration, minor symptom duration, as well as change from baseline of cumulative symptom score, main symptom score, and minor symptom score at day 4. The symptom durations and scores showed slight superiority of group B over group A, although these differences were not statistically significant. There were no differences in adverse events. The Shi-cha capsule is efficacious and safe for the treatment of patients with wind-cold type common cold. Larger trials are required to fully assess the benefits and safety of this treatment for common cold. PMID:23346193

  3. See Religious Influences from Su Shi and John Milton's Memorial Poems%苏轼与弥尔顿悼亡诗中不同的宗教影响

    Institute of Scientific and Technical Information of China (English)

    Liu Lili; Li Feng

    2008-01-01

    Based on comparative study between the poetic works of John Milton and Su Shi,this thesis takes the only love sonnet of John Milton Methought l Saw My Late EspouscM Saint(On His Deceased Wife)and Su Shi's first memorial poem Jiangchengzi(Riverside Town)as examples tries to analyze the different religious influences between the two memorial poems.

  4. Fabrication of Fast Reactor Fuel Pins for Test Irradiations

    Energy Technology Data Exchange (ETDEWEB)

    Karsten, G. [Institute for Applied Reactor Physics, Kernforschungszentrum Karlsruhe, Karlsruhe, Federal Republic of Germany (Germany); Dippel, T. [Institute for Radiochemistry, Kernforschungszentrum Karlsruhe, Karlsruhe, Federal Republic of Germany (Germany); Laue, H. J. [Institute for Applied Reactor Physics, Kernforschungszentrum Karlsruhe, Karlsruhe, Federal Republic of Germany (Germany)

    1967-09-15

    An extended irradiation programme is being carried out for the fuel element development of the Karlsruhe fast breeder project. A very important task within the programme is the testing of plutonium-containing fuel pins in a fast-reactor environment. This paper deals with fabrication of such pins by our laboratories at Karlsruhe. For the fast reactor test positions at present envisaged a fuel with 15% plutonium and the uranium fully enriched is appropriate. Hie mixed oxide is both pelletized and vibro-compacted with smeared densities between 80 and 88% theoretical. The pin design is, for example, such that there are two gas plena at the top and bottom, and one blanket above the fuel with the fuel zone fitting to the test reactor core length. The specifications both for fuel and cladding have been adapted to the special purpose of a fast-breeder reactor - the outer dimensions, the choice of cladding and fuel types, the data used and the kind of tests outline the targets of the development. The fuel fabrication is described in detail, and also the powder line used for vibro-compaction. The source materials for the fuel are oxalate PuO{sub 2} and UO{sub 2} from the UF{sub 6} process. The special problems of mechanical mixing and of plutonium homogeneity have been studied. The development of the sintering technique and grain characteristics for vibratory compactive fuel had to overcome serious problems in order to reach 82-83% theoretical. The performance of the pin fabrication needed a major effort in welding, manufacturing of fits and decontamination of the pin surfaces. This was a stimulation for the development of some very subtle control techniques, for example taking clear X-ray photographs and the tube testing. In general the selection of tests was a special task of the production routine. In conclusion the fabrication of the pins resulted in valuable experiences for the further development of fast reactor fuel elements. (author)

  5. Velocity distribution measurement in wire-spaced fuel pin bundle

    International Nuclear Information System (INIS)

    Mizuta, Hiroshi; Ohtake, Toshihide; Uruwashi, Shinichi; Takahashi, Keiichi

    1974-01-01

    Flow distribution measurement was made in the subchannels of a pin bundle in air flow. The present paper is interim because the target of this work is the decision of temperature of the pin surface in contact with wire spacers. The wire-spaced fuel pin bundle used for the experiment consists of 37 simulated fuel pins of stainless steel tubes, 3000 mm in length and 31.6 mm in diameter, which are wound spirally with 6 mm stainless steel wire. The bundle is wrapped with a hexagonal tube, 3500 mm in length and 293 mm in flat-to-flat distance. The bundle is fixed with knock-bar at the entrance of air flow in the hexagonal tube. The pitch of pins in the bundle is 37.6 mm (P/D=1.19) and the wrapping pitch of wire is 1100 mm (H/D=34.8). A pair of arrow-type 5-hole Pitot tubes are used to measure the flow velocity and the direction of air flow in the pin bundle. The measurement of flow distribution was made with the conditions of air flow rate of 0.33 m 3 /sec, air temperature of 45 0 C, and average Reynolds number of 15100 (average air velocity of 20.6 m/sec.). It was found that circular flow existed in the down stream of wire spacers, that axial flow velocity was slower in the subchannels, which contained wire spacers, than in those not affected by the wire, and that the flow angle to the axial velocity at the boundary of subchannels was two thirds smaller than wire wrapping angle. (Tai, I.)

  6. SHiP: a new facility for searching for long-lived neutral particles and studying the tau neutrino properties

    CERN Document Server

    AUTHOR|(SzGeCERN)658186

    2016-01-01

    SHiP (Search for Hidden Particles) is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In its initial phase, the 400 GeV proton beam will be dumped on a heavy target, integrating $2\\times 10^{20}$ protons on target in 5 years. A dedicated detector located downstream of the target, based on a long vacuum tank and a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived neutral and very weakly interacting particles and masses below 10 GeV. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutrinos. The sensitivity to Heavy Neutrinos will allow for the first time to probe, in the mass range between the kaon and the charm meson mass, a coupling range for which the baryon asymmetry of the Universe could be explained. Direct detection of light and long-lived SUSY particles, such as RPV neutralinos and pseudo-Dirac gauginos could als...

  7. Cumulative approaches to track formation under swift heavy ion (SHI) irradiation: Phenomenological correlation with formation energies of Frenkel pairs

    Energy Technology Data Exchange (ETDEWEB)

    Crespillo, M.L., E-mail: mcrespil@utk.edu [Centro de Microanálisis de Materiales, CMAM-UAM, Cantoblanco, Madrid 28049 (Spain); Department of Materials Science & Engineering, University of Tennessee, Knoxville, TN 37996 (United States); Agulló-López, F., E-mail: fal@uam.es [Centro de Microanálisis de Materiales, CMAM-UAM, Cantoblanco, Madrid 28049 (Spain); Zucchiatti, A. [Centro de Microanálisis de Materiales, CMAM-UAM, Cantoblanco, Madrid 28049 (Spain)

    2017-03-01

    Highlights: • Extensive survey formation energies Frenkel pairs and electronic stopping thresholds. • Correlation: track formation thresholds and the energies for Frenkel pair formation. • Formation energies Frenkel pairs discussed in relation to the cumulative mechanisms. • Amorphous track formation mechanisms: defect accumulation models versus melting. • Advantages cumulative models to deal with new hot topics: nuclear-electronic synergy. - Abstract: An extensive survey for the formation energies of Frenkel pairs, as representative candidates for radiation-induced point defects, is presented and discussed in relation to the cumulative mechanisms (CM) of track formation in dielectric materials under swift heavy ion (SHI) irradiation. These mechanisms rely on the generation and accumulation of point defects during irradiation followed by collapse of the lattice once a threshold defect concentration is reached. The physical basis of those approaches has been discussed by Fecht as a defect-assisted transition to an amorphous phase. Although a first quantitative analysis of the CM model was previously performed for LiNbO{sub 3} crystals, we have, here, adopted a broader phenomenological approach. It explores the correlation between track formation thresholds and the energies for Frenkel pair formation for a broad range of materials. It is concluded that the threshold stopping powers can be roughly scaled with the energies required to generate a critical Frenkel pair concentration in the order of a few percent of the total atomic content. Finally, a comparison with the predictions of the thermal spike model is discussed within the analytical Szenes approximation.

  8. Method and apparatus for enhancing vortex pinning by conformal crystal arrays

    Science.gov (United States)

    Janko, Boldizsar; Reichhardt, Cynthia; Reichhardt, Charles; Ray, Dipanjan

    2015-07-14

    Disclosed is a method and apparatus for strongly enhancing vortex pinning by conformal crystal arrays. The conformal crystal array is constructed by a conformal transformation of a hexagonal lattice, producing a non-uniform structure with a gradient where the local six-fold coordination of the pinning sites is preserved, and with an arching effect. The conformal pinning arrays produce significantly enhanced vortex pinning over a much wider range of field than that found for other vortex pinning geometries with an equivalent number of vortex pinning sites, such as random, square, and triangular.

  9. Pinning synchronization of delayed complex dynamical networks with nonlinear coupling

    Science.gov (United States)

    Cheng, Ranran; Peng, Mingshu; Yu, Weibin

    2014-11-01

    In this paper, we find that complex networks with the Watts-Strogatz or scale-free BA random topological architecture can be synchronized more easily by pin-controlling fewer nodes than regular systems. Theoretical analysis is included by means of Lyapunov functions and linear matrix inequalities (LMI) to make all nodes reach complete synchronization. Numerical examples are also provided to illustrate the importance of our theoretical analysis, which implies that there exists a gap between the theoretical prediction and numerical results about the minimum number of pinning controlled nodes.

  10. Creep relaxation of fuel pin bending and ovalling stresses

    International Nuclear Information System (INIS)

    Chan, D.P.; Jackson, R.J.

    1979-06-01

    Analytical methods for calculating fuel pin cladding bending and ovalling stresses due to pin bundle-duct mechanical interaction taking into account nonlinear creep are presented. Calculated results are in close agreement with finite element results by MARC-CDC program. The methods are used to investigate the effect of creep on the FTR fuel cladding bending and ovalling stresses. It is concluded that the cladding of 316 SS 20% CW and reference design has high creep rates in the FTR core region to keep the bending and ovalling stresses to low levels

  11. Nuclear fuel assemblies and fuel pins usable in such assemblies

    International Nuclear Information System (INIS)

    Jolly, R.

    1982-01-01

    A novel end cap for a nuclear fuel assembly is described in detail. It consists of a trisection arrangement which is received within a cell of a cellular grid. The cell contains abutment means with which the trisection comes into abutment. The grid also contains an abutment means for preventing the trisections from being inserted into the cell in an incorrect orientation. The present design allows fuel pins to be securely held in a hold-down grid of a sub-assembly. The design also allows easier dis-assembly of the swollen and embrittled fuel pins prior to reprocessing. (U.K.)

  12. 8 Pin RIC Socket for Hearing Aid Applications

    DEFF Research Database (Denmark)

    Islam, Aminul; Hansen, Hans Nørgaard; Davids, Søren

    2012-01-01

    process and the other one is fully automated process. This paper presents the entire process chain for both the concepts and makes a comparative analysis based on the experimental investigation and validation. The work presented here can be a source of valuable information for industrial users...... of them. 8 Pin RIC Socket is a functionally versatile product which can combine many different functions and presents many advantages compared with the previous 3 Pin RIC Socket. For the demonstrator production of the new Socket, two different production concepts were chosen- one based on semi-automated...

  13. Fuel pin failure in the PFR/TREAT experiments

    International Nuclear Information System (INIS)

    Herbert, R.; Hunter, C.W.; Kramer, J.M.; Wood, M.H.; Wright, A.E.

    1986-01-01

    The PFR/TREAT safety testing programme involves the transient testing of fresh and pre-irradiated UK and US fuel pins. This paper summarizes the experimental and calculational results obtained to date on fuel pin failure during transient overpower (resulting from an accidental addition of resolivity) and transient undercooling followed by overpower (arising from an accidental stoppage of the primary sodium circulating pumps) accidents. Companion papers at this conference address: (I) the progress and future plans of the programme, and (II) post-failure material movements

  14. Influence of LMFBR fuel pin temperature profiles on corrosion rate

    International Nuclear Information System (INIS)

    Shiels, S.A.; Bagnall, C.; Schrock, S.L.; Orbon, S.J.

    1976-01-01

    The paper describes the sodium corrosion behavior of 20 percent cold worked Type 316 stainless steel fuel pin cladding under a simulated reactor thermal environment. A temperature gradient, typical of a fuel pin, was generated in a 0.9 m long heater section by direct resistance heating. Specimens were located in an isothermal test section immediately downstream of the heater. A comparison of the measured corrosion rates with available data showed an enhancement factor of between 1.5 and 2 which was attributed to the severe axial temperature gradient through the heater. Differences in structure and surface chemistry were also noted

  15. Establishment of the PIN within the Colombian party system

    Directory of Open Access Journals (Sweden)

    Vanessa Ortiz López

    2012-12-01

    Full Text Available This paper is a review of the legislative elections held in Colombia in 2010 and one of their main results, the establishment of the National Integration Party (PIN. The authors offer an analysis of articles that appeared in printed media, taking into consideration such variables as financing, legal constitution, popular acceptance and settling time. In this way, the authors attempt to demonstrate how the PIN managed to get a place in the political system and what are the consequences of this development, in particular, as the Department of Valle del Cauca is concerned.

  16. Analysis of the porosity distribution of mixed oxide pins

    International Nuclear Information System (INIS)

    Lieblich, M.; Lopez, J.

    1987-01-01

    In the frame of the Joint Irradiation Program IVO-FR2-Vg7 between the Centre of Nuclear Research of Karlsruhe (KfK), the irradiation of 30 mixed-oxide fuel rods in the FR2 experimental reactor was carried out. The pins were located in 10 single-walled NaK capsules. The behaviour of the fuel during its burnup was studied, mainly, the rest-porosity and cracking distribution in the pellet, partial densification, etc. In this work 3 pins from the capsule No. 165 were analyzed. The experimental results (pore and cracking profiles) were interpreted by the fuel rod code SATURN. (Author) 20 refs

  17. Overexpression of PvPin1, a Bamboo Homolog of PIN1-Type Parvulin 1, Delays Flowering Time in Transgenic Arabidopsis and Rice

    Directory of Open Access Journals (Sweden)

    Zhigang Zheng

    2017-09-01

    Full Text Available Because of the long and unpredictable flowering period in bamboo, the molecular mechanism of bamboo flowering is unclear. Recent study showed that Arabidopsis PIN1-type parvulin 1 (Pin1At is an important floral activator and regulates floral transition by facilitating the cis/trans isomerization of the phosphorylated Ser/Thr residues preceding proline motifs in suppressor of overexpression of CO 1 (SOC1 and agamous-like 24 (AGL24. Whether bamboo has a Pin1 homolog and whether it works in bamboo flowering are still unknown. In this study, we cloned PvPin1, a homolog of Pin1At, from Phyllostachys violascens (Bambusoideae. Bioinformatics analysis showed that PvPin1 is closely related to Pin1-like proteins in monocots. PvPin1 was widely expressed in all tested bamboo tissues, with the highest expression in young leaf and lowest in floral bud. Moreover, PvPin1 expression was high in leaves before bamboo flowering then declined during flower development. Overexpression of PvPin1 significantly delayed flowering time by downregulating SOC1 and AGL24 expression in Arabidopsis under greenhouse conditions and conferred a significantly late flowering phenotype by upregulating OsMADS56 in rice under field conditions. PvPin1 showed subcellular localization in both the nucleus and cytolemma. The 1500-bp sequence of the PvPin1 promoter was cloned, and cis-acting element prediction showed that ABRE and TGACG-motif elements, which responded to abscisic acid (ABA and methyl jasmonate (MeJA, respectively, were characteristic of P. violascens in comparison with Arabidopsis. On promoter activity analysis, exogenous ABA and MeJA could significantly inhibit PvPin1 expression. These findings suggested that PvPin1 may be a repressor in flowering, and its delay of flowering time could be regulated by ABA and MeJA in bamboo.

  18. Overexpression of PvPin1, a Bamboo Homolog of PIN1-Type Parvulin 1, Delays Flowering Time in Transgenic Arabidopsis and Rice.

    Science.gov (United States)

    Zheng, Zhigang; Yang, Xiaoming; Fu, Yaping; Zhu, Longfei; Wei, Hantian; Lin, Xinchun

    2017-01-01

    Because of the long and unpredictable flowering period in bamboo, the molecular mechanism of bamboo flowering is unclear. Recent study showed that Arabidopsis PIN1-type parvulin 1 (Pin1At) is an important floral activator and regulates floral transition by facilitating the cis/trans isomerization of the phosphorylated Ser/Thr residues preceding proline motifs in suppressor of overexpression of CO 1 (SOC1) and agamous-like 24 (AGL24). Whether bamboo has a Pin1 homolog and whether it works in bamboo flowering are still unknown. In this study, we cloned PvPin1 , a homolog of Pin1At , from Phyllostachys violascens (Bambusoideae). Bioinformatics analysis showed that PvPin1 is closely related to Pin1-like proteins in monocots. PvPin1 was widely expressed in all tested bamboo tissues, with the highest expression in young leaf and lowest in floral bud. Moreover, PvPin1 expression was high in leaves before bamboo flowering then declined during flower development. Overexpression of PvPin1 significantly delayed flowering time by downregulating SOC1 and AGL24 expression in Arabidopsis under greenhouse conditions and conferred a significantly late flowering phenotype by upregulating OsMADS56 in rice under field conditions. PvPin1 showed subcellular localization in both the nucleus and cytolemma. The 1500-bp sequence of the PvPin1 promoter was cloned, and cis -acting element prediction showed that ABRE and TGACG-motif elements, which responded to abscisic acid (ABA) and methyl jasmonate (MeJA), respectively, were characteristic of P. violascens in comparison with Arabidopsis . On promoter activity analysis, exogenous ABA and MeJA could significantly inhibit PvPin1 expression. These findings suggested that PvPin1 may be a repressor in flowering, and its delay of flowering time could be regulated by ABA and MeJA in bamboo.

  19. Assessment of pin-by-pin fission rate distribution within MOX/UO{sub 2} fuel assembly using MCNPX code

    Energy Technology Data Exchange (ETDEWEB)

    Louis, Heba Kareem; Amin, Esmat [Nuclear and Radiological Regulation Authority (NRRA), Cairo (Egypt). Safety Engineering Dept.

    2016-03-15

    The aim of the present paper is to assess the calculations of pin-by-pin group integrated fission rates within MOX/UO{sub 2} Fuel assemblies using the Monte Carlo code MCNP2.7c with two sets of the available latest nuclear data libraries used for calculating MOX-fueled systems. The data that are used in this paper are based on the benchmark by the NEA Nuclear Science Committee (NSC). The k{sub ∞} and absorption/fission reaction rates per isotope, k{sub eff} and pin-by-pin group integrated fission rates on 1/8 fraction of the geometry are determined. To assess the overall pin-by-pin fission rate distribution, the collective per cent error measures were investigated. The results of AVG, MRE and RMS error measures were less than 1 % error. The present results are compared with other participants using other Monte Carlo codes and with CEA results that were taken in the benchmark as reference. The results with ENDF/B-VI.6 are close to the results received by MVP (JENDL3.2) and SCALE 4.2 (JEF2.2). The results with ENDF/BVII.1 give higher values of k{sub ∞} reflecting the changes in the newer evaluations. In almost all results presented here, the MCNP calculated results with ENDF/B VII.1 should be considered more than those obtained by using other Monte Carlo codes and nuclear data libraries. The present calculations may be consider a reference for evaluating the numerical schemes in production code systems, as well as the global performance including cross-section data reduction methods as the calculations used continuous energy and no geometrical approximations.

  20. 3D geomechanical modeling and numerical simulation of in-situ stress fields in shale reservoirs: A case study of the lower Cambrian Niutitang formation in the Cen'gong block, South China

    Science.gov (United States)

    Liu, Jingshou; Ding, Wenlong; Yang, Haimeng; Wang, Ruyue; Yin, Shuai; Li, Ang; Fu, Fuquan

    2017-08-01

    An analysis of the in-situ state of stress in a shale reservoir was performed based on comprehensive information about the subsurface properties from wellbores established during the development of an oil and gas field. Industrial-level shale gas production has occurred in the Niutitang formation of the lower Cambrian Cen'gong block, South China. In this study, data obtained from hydraulic fracturing, drilling-induced fractures, borehole breakout, global positioning system (GPS), and well deviation statistics have been used to determine the orientation of the maximum horizontal principal stress. Additionally, hydraulic fracturing and multi-pole array acoustic logging (XMAC) were used to determine the vertical variations in the in-situ stress magnitude. Based on logging interpretation and mechanical experiments, the spatial distributions of mechanical parameters were obtained by seismic inversion, and a 3D heterogeneous geomechanical model was established using a finite element stress analysis approach to simulate the in-situ stress fields. The effects of depth, faults, rock mechanics, and layer variations on the principal stresses, horizontal stress difference (Δσ), horizontal stress difference coefficient (Kh), and stress type coefficient (Sp) were determined. The results show that the direction of the maximum principal stress is ESE 120°. Additionally, the development zones of natural fractures appear to correlate with regions with high principal stress differences. At depths shallower than 375 m, the stress type is mainly a thrust faulting stress regime. At depths ranging from 375 to 950 m, the stress type is mainly a strike-slip faulting stress regime. When the depth is > 950 m, the stress type is mainly a normal faulting stress regime. Depth, fault orientation, and rock mechanics all affect the type of stress. The knowledge regarding the Cen'gong block is reliable and can improve borehole stability, casing set point determination, well deployment

  1. Evaluation of PWR and BWR pin cell benchmark results

    International Nuclear Information System (INIS)

    Pijlgroms, B.J.; Gruppelaar, H.; Janssen, A.J.; Hoogenboom, J.E.; Leege, P.F.A. de; Voet, J. van der; Verhagen, F.C.M.

    1991-12-01

    Benchmark results of the Dutch PINK working group on PWR and BWR pin cell calculational benchmark as defined by EPRI are presented and evaluated. The observed discrepancies are problem dependent: a part of the results is satisfactory, some other results require further analysis. A brief overview is given of the different code packages used in this analysis. (author). 14 refs., 9 figs., 30 tabs

  2. Evaluation of PWR and BWR pin cell benchmark results

    Energy Technology Data Exchange (ETDEWEB)

    Pijlgroms, B.J.; Gruppelaar, H.; Janssen, A.J. (Netherlands Energy Research Foundation (ECN), Petten (Netherlands)); Hoogenboom, J.E.; Leege, P.F.A. de (Interuniversitair Reactor Inst., Delft (Netherlands)); Voet, J. van der (Gemeenschappelijke Kernenergiecentrale Nederland NV, Dodewaard (Netherlands)); Verhagen, F.C.M. (Keuring van Electrotechnische Materialen NV, Arnhem (Netherlands))

    1991-12-01

    Benchmark results of the Dutch PINK working group on PWR and BWR pin cell calculational benchmark as defined by EPRI are presented and evaluated. The observed discrepancies are problem dependent: a part of the results is satisfactory, some other results require further analysis. A brief overview is given of the different code packages used in this analysis. (author). 14 refs., 9 figs., 30 tabs.

  3. Pinning and creep in high-Tc superconductors

    International Nuclear Information System (INIS)

    Ovchinnikov, Yu.N.; Ivlev, B.I.

    1992-01-01

    The angular and magnetic field dependence of a critical current parallel to the layers in the layered superconductors is studied. The critical current value is found for a superconductor with strong pinning centers. Quantum flux creep in sufficiently perfect layered high-Tc superconductors is discussed. The cross-over temperature between activated and quantum creep is found. (orig.)

  4. Percutaneous Pin Fixation of Gartland Type I11 Supraconylar ...

    African Journals Online (AJOL)

    S G Lungu M.Med (Orth). Specialist Orthopaedic Surgeon. Zambian Italian Orthopaedic Hospital, Lusaka. Key words: Percutaneous, pin fixation, Gartland type Ill, supracondylar, fractures, and humerus. This was a prospective study of 40 children with severely displaced (Gartland Type 111) supracondylar fractures of the ...

  5. Modeling the pinning of Au and Ni clusters on graphite

    NARCIS (Netherlands)

    Smith, R.; Nock, C.; Kenny, S.D.; Belbruno, J.J.; Di Vece, M.; Paloma, S.; Palmer, R.E.

    2006-01-01

    The pinning of size-selected AuN and NiN clusters on graphite, for N=7–100, is investigated by means of molecular dynamics simulations and the results are compared to experiment and previous work with Ag clusters. Ab initio calculations of the binding of the metal adatom and dimers on a graphite

  6. Flux pinning in MOD YBCO films by chemical doping

    International Nuclear Information System (INIS)

    Zhou, Y X; Ghalsasi, S; Rusakova, I; Salama, K

    2007-01-01

    A novel nanomaterial synthesis technique has been developed to introduce 0D (particles), 1D (columnar defects) and 3D (domains) nanoscale pinning centres in MOD Y 1 Ba 2 Cu 3 O 7 (YBCO) coated conductors. We have succeeded in introducing nanoscale Y enriched particles, nanoscale 90 0 rotated Y 1/3 Sm 2/3 Ba 2 Cu 3 O 7 domains and nanoscale Zr enriched columnar defects into YBCO layers by different chemical doping. The pinning force density in Y 2 O 3 -doped YBCO film is found to be larger than that of pure YBCO film at all fields. Also it was found that YBCO films with Sm substituting for Y have yielded improved critical current density characteristics over a wide range of magnetic fields. Maximum pinning force densities exceeding 7 and 8 GN m -3 are obtained in 5% BZO-doped and Sm substituted YBCO films, respectively. Additionally, TEM studies revealed nanoscale Zr enriched columnar defects distributing in the matrix of the c-oriented YBCO film throughout the whole cross section. This indicates that chemical doping is a promising fabrication technique to create specific pinning landscapes in YBCO coated conductors

  7. Temperature dependent pinning landscapes in REBCO thin films

    Science.gov (United States)

    Jaroszynski, Jan; Constantinescu, Anca-Monia; Hu, Xinbo Paul

    2015-03-01

    The pinning landscapes of REBCO (RE=rare earth elements) thin films have been a topic of study in recent years due to, among other reasons, their high ability to introduce various phases and defects. Pinning mechanisms studies in high temperature superconductors often require detailed knowledge of critical current density as a function of magnetic field orientation as well as field strength and temperature. Since the films can achieve remarkably high critical current, challenges exist in evaluating these low temperature (down to 4.2 K) properties in high magnetic fields up to 30 T. Therefore both conventional transport, and magnetization measurements in a vibrating coil magnetometer equipped with rotating sample platform were used to complement the study. Our results clearly show an evolution of pinning from strongly correlated effects seen at high temperatures to significant contributions from dense but weak pins that thermal fluctuations render ineffective at high temperatures but which become strong at lower temperatures Support for this work is provided by the NHMFL via NSF DRM 1157490

  8. Flux vortex dynamics and electric fields in matched pinning systems

    International Nuclear Information System (INIS)

    Blamire, M.G.

    1987-01-01

    The pinning of flux vortices in type II superconductors has been the subject of extensive research. Certain experiments have attempted to investigate this problem by the use of specially prepared pinning structures consisting of regular arrays of pinning centers. In this paper a theory relating to such experiments is described. This theory is based on the existence and properties of defects in an otherwise perfect vortex lattice which is commensurate with a pinning array consisting of a triangular lattice of holes in a superconducting thin film. A quantitative treatment predicts the existence and position of substructure on the critical current versus magnetic field curves in addition to the main peaks previously predicted to occur when the vortex and hole lattices are exactly matched. The theory also qualitatively describes the overall shape of these curves. An analysis of the temperature dependence of this substructure shows broad agreement with existing experimental results. The application of this theory to future experiments should allow a detailed investigation of vortex lattice elasticity and flux flow

  9. Performance of advanced oxide fuel pins in EBR-II

    International Nuclear Information System (INIS)

    Lawrence, L.A.; Jensen, S.M.; Hales, J.W.; Karnesky, R.A.; Makenas, B.J.

    1986-05-01

    The effects of design and operating parameters on mixed-oxide fuel pin irradiation performance were established for the Hanford Engineering Development Laboratory (HEDL) advanced oxide EBR-II test series. Fourteen fuel pins breached in-reactor with reference 316 SS cladding. Seven of the breaches are attributed to FCMI. Of the remaining seven breached pins, three are attributed to local cladding over-temperatures similar to the breach mechanism for the reference oxide pins irradiated in EBR-II. FCCI was found to be a contributing factor in two high burnup, i.e., 11.7 at. % breaches. The remaining two breaches were attributed to mechanical interaction of UO 2 fuel and fission products accumulated in the lower cladding insulator gap, and a loss of cladding ductility possibly due to liquid metal embrittlement. Fuel smear density appears to have the most significant impact on lifetime. Quantitative evaluations of cladding diameter increases attributed to FCMI, established fuel smear density, burnup, and cladding thickness-to-diameter ratio as the major parameters influencing the extent of cladding strain

  10. Image analysis for remote examination of fuel pins

    International Nuclear Information System (INIS)

    Cook, J.H.; Nayak, U.P.

    1982-01-01

    An image analysis system operating in the Wing 9 Hot Cell Facility at Los Alamos National Laboratory provides quantitative microstructural analyses of irradiated fuels and materials. With this system, fewer photomicrographs are required during postirradiation microstructural examination and data are available for analysis much faster. The system has been used successfully to examine Westinghouse Advanced Reactors Division experimental fuel pins

  11. Flux-Vortex Pinning and Neutron Star Evolution

    Indian Academy of Sciences (India)

    M. Ali Alpar

    2017-09-12

    Sep 12, 2017 ... M. ALI ALPAR. Faculty of Engineering and Natural Sciences, Sabancı University, 34956, Istanbul, Turkey. E-mail: ... netic field of the neutron star were B ∼ 109 G. At the ..... across pinning energy barriers by thermal activation.

  12. The behaviour of Phenix fuel pin bundle under irradiation

    International Nuclear Information System (INIS)

    Marbach, G.; Millet, P.; Blanchard, P.; Huillery, R.

    1979-07-01

    An entire Phenix sub-assembly has been mounted and sectioned after irradiation. The examination of cross-sections revealed the effects of mechanical interaction in the bundle (ovalisations and contacts between clads). According to analysis of the sodium channels, cooling of the pin bundle remained uniform. (author)

  13. Pin Tract Infection after Uniplanar External Fixation of Open ...

    African Journals Online (AJOL)

    ADMIN

    Regionally, a study by Jellis et al in Lusaka, Zambia, compared the rate of severe pin tract infection in HIV negative and positive ... likelihood of infection such as human immunodeficiency virus infection, diabetes mellitus, liver failure, renal failure, tumours ... Combined Open Tibia-Fibular. And Femur Fractures. 2. 2.7. Totals.

  14. Review of HEDL fuel pin transient analyses analytical programs

    International Nuclear Information System (INIS)

    Scott, J.H.; Baars, R.E.

    1975-05-01

    Methods for analysis of transient fuel pin performance are described, as represented by the steady-state SIEX code and the PECT series of codes used for steady-state and transient mechanical analyses. The empirical fuel failure correlation currently in use for analysis of transient overpower accidents is described. (U.S.)

  15. Propagation of spiral waves pinned to circular and rectangular obstacles.

    Science.gov (United States)

    Sutthiopad, Malee; Luengviriya, Jiraporn; Porjai, Porramain; Phantu, Metinee; Kanchanawarin, Jarin; Müller, Stefan C; Luengviriya, Chaiya

    2015-05-01

    We present an investigation of spiral waves pinned to circular and rectangular obstacles with different circumferences in both thin layers of the Belousov-Zhabotinsky reaction and numerical simulations with the Oregonator model. For circular objects, the area always increases with the circumference. In contrast, we varied the circumference of rectangles with equal areas by adjusting their width w and height h. For both obstacle forms, the propagating parameters (i.e., wavelength, wave period, and velocity of pinned spiral waves) increase with the circumference, regardless of the obstacle area. Despite these common features of the parameters, the forms of pinned spiral waves depend on the obstacle shapes. The structures of spiral waves pinned to circles as well as rectangles with the ratio w/h∼1 are similar to Archimedean spirals. When w/h increases, deformations of the spiral shapes are observed. For extremely thin rectangles with w/h≫1, these shapes can be constructed by employing semicircles with different radii which relate to the obstacle width and the core diameter of free spirals.

  16. Neutron radiography for quality assurance of PHWR fuel pins

    International Nuclear Information System (INIS)

    Chandrasekharan, K.N.; Patil, B.P.; Ghosh, J.K.; Ganguly, C.

    1993-01-01

    Neutron radiography was employed for quality assurance (QA) for advanced PHWR experimental fuel pins containing mixed uranium-plutonium dioxide and thorium-plutonium dioxide pellets. Direct, transfer and track-etch techniques were utilised. The thermal neutron beam facility of APSARA research reactor at Bhabha Atomic Research Centre was used. (author). 5 refs., 16 figs., 2 tabs

  17. Calculation of fuel pin failure timing under LOCA conditions

    International Nuclear Information System (INIS)

    Jones, K.R.; Wade, N.L.; Siefken, L.J.; Straka, M.; Katsma, K.R.

    1991-10-01

    The objective of this research was to develop and demonstrate a methodology for calculation of the time interval between receipt of the containment isolation signals and the first fuel pin failure for loss-of-coolant accidents (LOCAs). Demonstration calculations were performed for a Babcock and Wilcox (B ampersand W) design (Oconee) and a Westinghouse (W) 4-loop design (Seabrook). Sensitivity studies were performed to assess the impacts of fuel pin burnup, axial peaking factor, break size, emergency core cooling system (ECCS) availability, and main coolant pump trip on these items. The analysis was performed using a four-code approach, comprised of FRAPCON-2, SCDAP/RELAP5/MOD3, TRAC-PF1/MOD1, and FRAP-T6. In addition to the calculation of timing results, this analysis provided a comparison of the capabilities of SCDAP/RELAP5/MOD3 with TRAC-PF1/MOD1 for large-break LOCA analysis. This paper discusses the methodology employed and the code development efforts required to implement the methodology. The shortest time intervals calculated between initiation of containment isolation and fuel pin failure were 11.4 s and 19.1 for the B ampersand W and W plants, respectively. The FRAP-T6 fuel pin failure times calculated using thermal-hydraulic data generated by SCDAP/RELAP5/MOD3 were more conservative than those calculated using data generated by TRAC-PF1/MOD1. 18 refs., 7 figs., 4 tabs

  18. Investigation on flow and heat transfer characteristics in rectangular channel with drop-shaped pin fins

    Directory of Open Access Journals (Sweden)

    Fengming Wang

    2012-12-01

    Full Text Available The flow and heat transfer characteristics inside a rectangular channel embedded with pin fins were numerically and experimentally investigated. Several differently shaped pin fins (i.e., circular, elliptical, and drop-shaped with the same cross-sectional areas were compared in a staggered arrangement. The Reynolds number based on the obstructed section hydraulic diameter (defined as the ratio of the total wetted surface area to the open duct volume available for flow was varied from 4800 to 8200. The more streamlined drop-shaped pin fins were better at delaying or suppressing separation of the flow passing through them, which decreased the aerodynamic penalty compared to circular pin fins. The heat transfer enhancement of the drop-shaped pin fins was less than that of the circular pin fins. In terms of specific performance parameters, drop-shaped pin fins are a promising alternative configuration to circular pin fins.

  19. Vortex Dynamics in Superconductors with Different Types of Pinning Potentials

    International Nuclear Information System (INIS)

    Laguna, Maria Fabiana

    2001-01-01

    In this work we study the behavior of the vortex system in the mixed state of a type II superconductor when it interacts with different kinds of pinning potentials. To do this, we perform numerical simulations in the presence of an external magnetic field, by making use of two different approaches.One corresponds to a Langevin simulation of the three dimensional XY model or Josephson-junction network, whereas the other corresponds to a Molecular dynamics simulation of two dimensional point-like vortices.We analyze the transport properties of highly anisotropic superconductors with different kinds of topological disorder in the configuration in which the external field is applied perpendicular to the CuO planes.We found that for systems with point defects the activation energy is the same for the two components of the resistivity, while in systems with columnar defects the activation energies can be different.We also study the structure, phase transitions and transport properties of the vortex system when the external magnetic field lies parallel to the planes in layered superconductors. We analyze the stability of different phases at low temperatures and show under which conditions the smectic phase is stable.Our results indicate the presence of the smectic phase in an intermediate range of temperatures.We have studied a vortex array in a periodic pinning potential with triangular and kagome geometries.We obtain the ground state vortex configurations and calculate some thermodynamic quantities for different magnetic fields.We observe several stages of lattice pinning and melting and we characterize different phases and transitions between them.Finally, simulating the Bitter pinning effect over the vortex system, we study static and dynamic properties of the vortex system in the presence of the surface Bitter pinning and the bulk pinning.We found low temperature structures similar to those obtained experimentally.We analyze the dynamics of the nucleation and growth

  20. One- and two-dimension effects on fuel pin lifetime

    International Nuclear Information System (INIS)

    Stephen, J.D.; Biancheria, A.; Leibnitz, D.; O'Reilly, B.D.; Liu, Y.Y.; Labar, M.P.; Gneiting, B.C.

    1979-01-01

    Lifetime, or breach of the cladding, is a difficult performance limit to establish in fuel pin design. The significant benefits of high plant capacity factor favor conservative design to eliminate downtime or partial power operation caused by the breach limit; however, overly conservative design produces significant penalties. The LIFE system is being applied to help understand the range between operation and breach so that appropriate design margins can be selected. Standards are being developed in the USA to assure the structural integrity of all core components. These standards will provide guidelines to account for the failure mechanisms observed in the high temperature, high fluence core environment. The work to date indicates that creep rupture is the most important failure mechanism for mixed-oxide fuel pins during normal operation and slow power changes. The local cumulative creep rupture damage fraction (CDF) has been adopted as the parameter to assess the approach to failure. Several oxide breached pins and siblings have been studied For example, the P23B-73 pin was an FFTR driver design pin irradiated in EBR-II which failed at 10 at,% burnup. Initial evaluation based on LIFE3 led to the conclusion that the pin should not have failed. Further analyses determined the sensitivity of the breach prediction to the time-to-rupture correlation, cladding temperature, and fuel-fission product swelling (which had not been modeled in LIFE3). The uncertainties in the time-to-rupture correlation have been established. But LIFE is a one-dimensional model. The TWOD code is complete, and development of the best way to couple LIFE and TWOD for lifetime analysis is in progress. Two preliminary conclusions from analysis of representative oxide pin geometries are, first, that the circumferential stress distribution may not peak at the hot spot, but the damage (CDF) does. And second, that the effect of stress concentrations near fuel cracks on cladding creep damage is small

  1. Transfixation pinning and casting of radial-ulnar fractures in calves: A review of three cases

    OpenAIRE

    St-Jean, Guy; Debowes, Richard M.

    1992-01-01

    We reviewed the medical records of three calves with radial-ulnar fractures which were reduced and stabilized by transfixation pinning and casting. Multiple Steinmann pins were placed transversely through proximal and distal fracture fragments and the pin ends were incorporated in fiberglass cast material after fracture reduction. Cast material was placed from proximal to distal radius and served as an external frame to maintain pin position and fracture reduction.

  2. Serviceability of rod ceramic fuel pins on motoring conditions of FTP or NEMF reactor

    International Nuclear Information System (INIS)

    Deryavko, I.I.

    2004-01-01

    The operation conditions of rod ceramic fuel pins in the running hydrogen-cooled technological canals of FTP or NEMF reactor on the motoring conditions are considered. The available postreactor researches of the fuel pins are presented and the additional postreactor researches of fuel pins, tested on this mode in IVG.1 and IRGIT reactors, are carried out. The fuel pins serviceability on motoring conditions of FTP or NEF reactor operation is concluded. (author)

  3. Effect of SHI irradiation on structural, surface morphological and optical studies of CVT grown ZnSSe single crystals

    International Nuclear Information System (INIS)

    Kannappan, P.; Asokan, K.; Krishna, J.B.M.; Dhanasekaran, R.

    2013-01-01

    Highlights: •CVT grown ZnSSe single crystals were irradiated with 120 MeV Au ion. •The GIXRD results show the FWHM increases with increasing ion fluency. •The AFM study show the surface roughness increases with ion fluency. •The optical band gap energy vary with increasing ion fluency. •The PL emission decreases with increasing ion fluency. -- Abstract: The ZnSSe single crystals grown by chemical vapour transport (CVT) method have been irradiated by 120 MeV Au 9+ ions at room temperature with fluences of 1 × 10 12 and 5 × 10 12 ions/cm 2 . The grazing incidence X-ray diffraction (GIXRD) results show that the full width at half maximum (FWHM) value for the as grown ZnSSe crystal is 0.215°; and for the irradiated samples, the FWHM values are 0.413° and 0.625°, with the increase of ion fluences. The atomic force microscopy (AFM) studies reveal the formation of the pits and islands due to irradiation. The optical absorption cut off wavelength is found to be 441 nm for as grown ZnSSe crystal. The cut off values are increased to 447 nm and 457 nm for the irradiated samples with increasing ion fluency. The photoluminescence studies show the emission for the as grown ZnSSe is 590 nm whereas for the irradiated samples in the emission range it is 580–590 nm and 575–595 nm due to SHI irradiation. FT-Raman spectra analysis has been made for the ZnSSe single crystals and irradiated samples. The results are discussed in detail

  4. Effect of SHI irradiation on structural, surface morphological and optical studies of CVT grown ZnSSe single crystals

    Energy Technology Data Exchange (ETDEWEB)

    Kannappan, P. [Crystal Growth Centre, Anna University, Chennai 600 025 (India); Asokan, K. [Inter University Accelerator Centre, Aruna Asaf Ali Marg, New Delhi 110 067 (India); Krishna, J.B.M. [UGC-DAE Consortium for Scientific Research, III-/LB-8, Bidhan nagar, Kolkata 700 098 (India); Dhanasekaran, R., E-mail: rdcgc@yahoo.com [Crystal Growth Centre, Anna University, Chennai 600 025 (India)

    2013-12-15

    Highlights: •CVT grown ZnSSe single crystals were irradiated with 120 MeV Au ion. •The GIXRD results show the FWHM increases with increasing ion fluency. •The AFM study show the surface roughness increases with ion fluency. •The optical band gap energy vary with increasing ion fluency. •The PL emission decreases with increasing ion fluency. -- Abstract: The ZnSSe single crystals grown by chemical vapour transport (CVT) method have been irradiated by 120 MeV Au{sup 9+} ions at room temperature with fluences of 1 × 10{sup 12} and 5 × 10{sup 12} ions/cm{sup 2}. The grazing incidence X-ray diffraction (GIXRD) results show that the full width at half maximum (FWHM) value for the as grown ZnSSe crystal is 0.215°; and for the irradiated samples, the FWHM values are 0.413° and 0.625°, with the increase of ion fluences. The atomic force microscopy (AFM) studies reveal the formation of the pits and islands due to irradiation. The optical absorption cut off wavelength is found to be 441 nm for as grown ZnSSe crystal. The cut off values are increased to 447 nm and 457 nm for the irradiated samples with increasing ion fluency. The photoluminescence studies show the emission for the as grown ZnSSe is 590 nm whereas for the irradiated samples in the emission range it is 580–590 nm and 575–595 nm due to SHI irradiation. FT-Raman spectra analysis has been made for the ZnSSe single crystals and irradiated samples. The results are discussed in detail.

  5. Bridging the Divide: Literature, Dao and the Case for Subjective Access in the Thought of Su Shi

    Directory of Open Access Journals (Sweden)

    Curie Virág

    2014-10-01

    Full Text Available In the 11th century in China, there was an unusual moment in which a number of philosophers, later associated with the Daoxue—or Neo-Confucian—school, confronted what they perceived as a long-standing sense of disjunction between inner, subjective reality and the structured patterns of the cosmos. One way they sought to overcome this disjunction was by positing new theories of the cosmos that focused on the underlying, shared reality behind the myriad differentiations of phenomena. A potential tension was born that affected how thinkers understood the relationship between wen 文 (writing, literature, culture and Dao 道 (the cosmic process, the ultimate reality, the normative path. Some thinkers, like Zhou Dunyi 周敦頤 (1017–1073, believed that wen was simply a vehicle for carrying the Dao, and was thus, implicitly, dispensable. This idea was met with resistance from one of the leading intellectual figures of the time—the philosopher, poet and statesman Su Shi 蘇軾 (1037–1101. While some of Su’s contemporaries, in their attempts to demonstrate that the world was real, and that truth was knowable, downplayed the role of individual experience and perception, Su stressed the necessity of subjective, individual experience as giving access, and concrete expression, to Dao. Su’s philosophical project came in the form of defending the enterprise of wen—writing as a creative, individual endeavor—and asserting that the quest for unity with the Dao could only be realized through direct, personal engagement in wen and other forms of meaningful practice. Through his philosophy of wen, Su sought to show that the search for truth, meaning and order did not—and could not—be achieved by transcending subjective experience. Instead, it had to be carried out at the point of encounter between self and the world, in the realm of practice.

  6. New Universal Tribometer as Pin or Ball-on-Disc and Reciprocating Pin-on-Plate Types

    Directory of Open Access Journals (Sweden)

    H. Kaleli

    2016-06-01

    Full Text Available The present paper contains a description of a new Universal Tribometer design which enables simulation of different contact and test types such as pin-on-disc, ball-on-disc and linear reciprocating tests. There are many models of wear Tribometer in the world market. These devices are manufactured by various companies abroad and are imported to our country. Cost of this devices start from 50.000 euros and goes to hundreds of thousands of euros. One of the most commonly used of this device is Reciprocating Pin-on-Plate Tribo Test Machine. This wear tester is produced at a low limited cost within the KAP (Scientifical Research Project Coordinator of Yıldız Technical University. The test machine can work including three types of Tribotest rigs (Reciprocating Pin-on-Plate, Pin-on-Disc and Ball-on-Disc. It is designed to operate also at high temperatures up to 500 ˚C. The new piece of equipment allows instrumented tribological testing of piston ring and cylinder liner samples at low and high temperatures and boundary lubrication conditions of any typical gasoline or Diesel engines. Some friction results were shown in boundary lubricating conditions between piston ring and cylinder liner sliding pairs describing Tribotest machine is driven by AC servo motor which is more accurate than DC motor.

  7. Development of spectral history methods for pin-by-pin core analysis method using three-dimensional direct response matrix

    International Nuclear Information System (INIS)

    Mitsuyasu, T.; Ishii, K.; Hino, T.; Aoyama, M.

    2009-01-01

    Spectral history methods for pin-by-pin core analysis method using the three-dimensional direct response matrix have been developed. The direct response matrix is formalized by four sub-response matrices in order to respond to a core eigenvalue k and thus can be recomposed at each outer iteration in the core analysis. For core analysis, it is necessary to take into account the burn-up effect related to spectral history. One of the methods is to evaluate the nodal burn-up spectrum obtained using the out-going neutron current. The other is to correct the fuel rod neutron production rates obtained the pin-by-pin correction. These spectral history methods were tested in a heterogeneous system. The test results show that the neutron multiplication factor error can be reduced by half during burn-up, the nodal neutron production rates errors can be reduced by 30% or more. The root-mean-square differences between the relative fuel rod neutron production rate distributions can be reduced within 1.1% error. This means that these methods can accurately reflect the effects of intra- and inter-assembly heterogeneities during burn-up and can be used for core analysis. Core analysis with the DRM method was carried out for an ABWR quarter core and it was found that both thermal power and coolant-flow distributions were smoothly converged. (authors)

  8. Design fix for vibration-induced wear in fuel pin bundles

    International Nuclear Information System (INIS)

    Naas, D.F.; Heck, E.N.

    1976-01-01

    In summary, results at 45,000 MWd/MTM burnup from the FFTF mixed oxide fuel pin irradiation tests in EBR-II show that reduction of the initial fuel pin bundle clearance and use of 20 percent cold-worked stainless steel ducts virtually eliminate vibration and wear observed in an initial series of 61-pin tests

  9. The Effect of Insertion Technique on Temperatures for Standard and Self-Drilling External Fixation Pins.

    Science.gov (United States)

    Manoogian, Sarah; Lee, Adam K; Widmaier, James C

    2017-08-01

    No studies have assessed the effects of parameters associated with insertion temperature in modern self-drilling external fixation pins. The current study assessed how varying the presence of irrigation, insertion speed, and force impacted the insertion temperatures of 2 types of standard and self-drilling external fixation half pins. Seventy tests were conducted with 10 trials for 4 conditions on self-drilling pins, and 3 conditions for standard pins. Each test used a thermocouple inside the pin to measure temperature rise during insertion. Adding irrigation to the standard pin insertion significantly lowered the maximum temperature (P drilling pin tests dropped average rise in temperature from 151.3 ± 21.6°C to 124.1 ± 15.3°C (P = 0.005). When the self-drilling pin insertion was decreased considerably from 360 to 60 rpm, the temperature decreased significantly from 151.3 ± 21.6°C to 109.6 ± 14.0°C (P drilling pin temperature increase was not significant. The standard pin had lower peak temperatures than the self-drilling pin for all conditions. Moreover, slowing down the insertion speed and adding irrigation helped mitigate the temperature increase of both pin types during insertion.

  10. Use of a modified transfixation pin cast for treatment of comminuted phalangeal fractures in horses.

    Science.gov (United States)

    Rossignol, Fabrice; Vitte, Amélie; Boening, Josef

    2014-01-01

    To (1) report a modified transfixation pin cast technique, using dorsal recumbency for fracture reduction, distal positioning of the pins in the epiphysis and distal metaphysis, and a hybrid cast, combining plaster of Paris (POP) and fiberglass casting, and (2) report outcome in 11 adult horses. Case series. Adult horses (n = 11) with comminuted phalangeal fractures. Horses were anesthetized and positioned in dorsal recumbency. The phalangeal fracture was reduced by limb traction using a cable attached to the hoof. Screw fixation in lag fashion of fracture fragments was performed when possible. Transfixation casting was performed using two 6.3 mm positive profile centrally threaded pins with the 1st pin placed in the epiphysis of the metacarpus/tarsus at the center of, or slightly proximal to, the condylar fossa and the 2nd one 3-4 cm proximal. A hybrid cast was applied. Forelimbs were involved in 9 horses and the hind limb in 2. Pins were maintained for a minimum of 6 weeks. No pin loosening was observed at the time of removal (6-8 weeks). A pony fractured the distal aspect of the metacarpus at the proximal pin. Nine horses survived (82%); none of the horses developed septic arthritis despite the distal location of the distal pin, close to the fetlock joint. This modified transfixation pin casting technique was associated with good pin longevity and could reduce the risk of secondary pin hole fractures and pin loosening. © Copyright 2013 by The American College of Veterinary Surgeons.

  11. A pin-assisted retention technique for resin-bonded restorations.

    Science.gov (United States)

    Miara, P; Touati, B

    1992-09-01

    The value of pins for auxiliary retention has been demonstrated many times. The use of pins with resin-bonded restorations allows for improved aesthetics and less tooth reduction while increasing resistance to dislodging forces. Clinical and technical procedures for resin-bonded bridges with pin-assisted retention are presented.

  12. The PIN family of proteins in potato and their putative role in tuberisation

    Directory of Open Access Journals (Sweden)

    Efstathios eRoumeliotis

    2013-12-01

    Full Text Available The PIN family of trans-membrane proteins mediates auxin efflux throughout the plant and during various phases of plant development. In Arabidopsis thaliana, the PIN family comprised of 8 members, divided into ‘short’ and ‘long’ PINs according to the length of the hydrophilic domain of the protein. Based on sequence homology using the recently published potato genome sequence (Solanum tuberosum group Phureja we identified ten annotated potato StPIN genes. Mining the publicly available gene expression data, we constructed a catalogue tissue specificity of StPIN gene expression, focusing on the process of tuberization. A total of four StPIN genes exhibited increased expression four days after tuber induction, prior to the onset of stolon swelling. For two PIN genes, StPIN4 and StPIN2, promoter sequences were cloned and fused to the GUS reporter protein to study tissue specificity in more detail. StPIN4 promoter driven GUS staining was detected in the flower stigma, in the flower style, below the ovary and petals, in the root tips, in the vascular tissue of the stolons and in the tuber parenchyma cells. StPIN2 promoter driven GUS staining was detected in flower buds, in the vascular tissue of the swelling stolons and in the storage parenchyma of the growing tubers. Based on our results, we postulate a role for the StPINs in redistributing auxin in the swelling stolon during early events in tuber development.

  13. Probabilistic distributions of pin gaps within a wire-spaced fuel subassembly and sensitivities of the related uncertainties to pin gap

    International Nuclear Information System (INIS)

    Sakai, K.; Hishida, H.

    1978-01-01

    Probabilistic fuel pin gap distributions within a wire-spaced fuel subassembly and sensitivities of the related uncertainties to fuel pin gaps are discussed. The analyses consist mainly of expressing a local fuel pin gap in terms of sensitivity functions of the related uncertainties and calculating the corresponding probabilistic distribution through taking all the possible combinations of the distribution of uncertainties. The results of illustrative calculations show that with the reliability level of 0.9987, the maximum deviation of the pin gap at the cladding hot spot of a center fuel subassembly is 8.05% from its nominal value and the corresponding probabilistic pin gap distribution is shifted to the narrower side due to the external confinement of a pin bundle with a wrapper tube. (Auth.)

  14. Percutaneous external fixator pins with bactericidal micron-thin sol-gel films for the prevention of pin tract infection.

    Science.gov (United States)

    Qu, Haibo; Knabe, Christine; Radin, Shula; Garino, Jonathan; Ducheyne, Paul

    2015-09-01

    Risk of infection is considerable in open fractures, especially when fracture fixation devices are used to stabilize the fractured bones. Overall deep infection rates of 16.2% have been reported. The infection rate is even greater, up to 32.2%, with external fixation of femoral fractures. The use of percutaneous implants for certain clinical applications, such as percutaneous implants for external fracture fixation, still represents a challenge today. Currently, bone infections are very difficult to treat. Very potent antibiotics are needed, which creates the risk of irreversible damage to other organs, when the antibiotics are administered systemically. As such, controlled, local release is being pursued, but no such treatments are in clinical use. Herein, the use of bactericidal micron-thin sol-gel films on metallic fracture fixation pins is reported. The data demonstrates that triclosan (2,4,4'-trichloro-2'-hydroxydiphenylether), an antimicrobial agent, can be successfully incorporated into micron-thin sol-gel films deposited on percutaneous pins. The sol-gel films continuously release triclosan in vitro for durations exceeding 8 weeks (longest measured time point). The bactericidal effect of the micron-thin sol-gel films follows from both in vitro and in vivo studies. Inserting percutaneous pins in distal rabbit tibiae, there were no signs of infection around implants coated with a micron-thin sol-gel/triclosan film. Healing had progressed normally, bone tissue growth was normal and there was no epithelial downgrowth. This result was in contrast with the results in rabbits that received control, uncoated percutaneous pins, in which abundant signs of infection and epithelial downgrowth were observed. Thus, well-adherent, micron-thin sol-gel films laden with a bactericidal molecule successfully prevented pin tract infection. Copyright © 2015 Elsevier Ltd. All rights reserved.

  15. Dependence of J c on pinning center morphology: An explanation of record J c observed for discontinuous columnar pinning of vortices

    International Nuclear Information System (INIS)

    Weinstein, R.; Gandini, A.; Parks, D.; Sawh, R.; Mayes, B.

    2006-01-01

    An experimental study of defects caused by ion irradiation has proven that very discontinuous multiple-in-line-damage results in much higher J c than continuous columnar pinning centers. This is contrary to conventional wisdom. We develop a first approximation to a theory relating J c to the morphology of pinning centers. Qualitative agreement with experiment is achieved. Conclusions indicate the relative importance of pinning potential, percolation, and critical temperature for various morphologies. Results suggest the leading importance of pinning, compared to texture, weak links and oxygenation in achievement of the goal of high J c especially in large grain HTS

  16. Regional asymmetry of metabolic and antioxidant profile in the sciaenid fish shi drum (Umbrina cirrosa white muscle. Response to starvation and refeeding

    Directory of Open Access Journals (Sweden)

    M. Carmen Hidalgo

    2017-04-01

    Full Text Available The objective of the present study is to characterize the metabolic and antioxidant profile of white muscle of shi drum in two sites of the body, anterior dorsal (AM and posterior dorsal (PM portions. In addition, it will be analyzed the possible effect of starvation and a subsequent refeeding, with two different protocols, pair feeding and ad libitum. Activities of key enzymes of intermediary metabolism and of antioxidant enzymes, as well as lipid peroxidation, as an index of oxidative stress, were evaluated. The results indicate the existence of a regional asymmetry of the metabolic capacities of the white muscle of shi drum, which is likely related to the different contribution to swimming of the body regions examined. Starvation induces a metabolic depression that is more marked in those activities that support burst swimming in PM, while those activities supporting maintenance requirements are conserved. The greatest energy demands during starvation appear to lie in AM, which showed the highest oxidative metabolism rate. The increased use of fatty acids as energy source for AM leads to oxidative stress. A period of more than four weeks of refeeding for full restoration of metabolic capacities in AM is needed, probably related to the higher muscle mass located in this region. On the contrary, all enzyme activities in PM returned to control levels in both refeeding protocols, but pair feeding seems to be advantageous since compensatory growth has been taking place without signs of oxidative stress. This work was addressed to gain knowledge on the physiology of a promising fish species in aquaculture like shi drum. The results displayed here show how the starving and further re-feeding events could generate oxidative stress situations characterized by high lipid peroxidation levels which may influence negatively on the quality of the edible part of the fish. This study opens an interesting field on this fish species which deserves being

  17. Clinical and histomorphometrical study on titanium dioxide-coated external fixation pins.

    Science.gov (United States)

    Koseki, Hironobu; Asahara, Tomohiko; Shida, Takayuki; Yoda, Itaru; Horiuchi, Hidehiko; Baba, Koumei; Osaki, Makoto

    2013-01-01

    Pin site infection is the most common and significant complication of external fixation. In this work, the efficacy of pins coated with titanium dioxide (TiO(2)) for inhibition of infection was compared with that of stainless steel control pins in an in vivo study. Pins contaminated with an identifiable Staphylococcus aureus strain were inserted into femoral bone in a rat model and exposed to ultraviolet A light for 30 minutes. On day 14, the animals were sacrificed and the bone and soft tissue around the pin were retrieved. The clinical findings and histological findings were evaluated in 60 samples. Clinical signs of infection were present in 76.7% of untreated pins, but in only 36.7% of TiO(2)-coated pins. The histological bone infection score and planimetric rate of occupation for bacterial colonies and neutrophils in the TiO(2)-coated pin group were lower than those in the control group. The bone-implant contact ratio of the TiO(2)-coated pin group was significantly higher (71.4%) than in the control pin group (58.2%). The TiO(2) was successful in decreasing infection both clinically and histomorphometrically. The photocatalytic bactericidal effect of TiO(2) is thought to be useful for inhibiting pin site infection after external fixation.

  18. Wear-Induced Changes in FSW Tool Pin Profile: Effect of Process Parameters

    Science.gov (United States)

    Sahlot, Pankaj; Jha, Kaushal; Dey, G. K.; Arora, Amit

    2018-06-01

    Friction stir welding (FSW) of high melting point metallic (HMPM) materials has limited application due to tool wear and relatively short tool life. Tool wear changes the profile of the tool pin and adversely affects weld properties. A quantitative understanding of tool wear and tool pin profile is crucial to develop the process for joining of HMPM materials. Here we present a quantitative wear study of H13 steel tool pin profile for FSW of CuCrZr alloy. The tool pin profile is analyzed at multiple traverse distances for welding with various tool rotational and traverse speeds. The results indicate that measured wear depth is small near the pin root and significantly increases towards the tip. Near the pin tip, wear depth increases with increase in tool rotational speed. However, change in wear depth near the pin root is minimal. Wear depth also increases with decrease in tool traverse speeds. Tool pin wear from the bottom results in pin length reduction, which is greater for higher tool rotational speeds, and longer traverse distances. The pin profile changes due to wear and result in root defect for long traverse distance. This quantitative understanding of tool wear would be helpful to estimate tool wear, optimize process parameters, and tool pin shape during FSW of HMPM materials.

  19. Study of the Radiation-Hardness of VCSEL and PIN

    CERN Document Server

    Gan, K K; Fernando, W; Kagan, H P; Kass, R D; Lebbai, M R M; Merritt, H; Moore, J R; Nagarkar, A; Rizatdinova, F; Skubic, P L; Smith, D S; Strang, M

    2009-01-01

    The silicon trackers of the ATLAS experiment at the Large Hadron Collider (LHC) at CERN (Geneva) use optical links for data transmission. An upgrade of the trackers is planned for the Super LHC (SLHC), an upgraded LHC with ten times higher luminosity. We study the radiation-hardness of VCSELs (Vertical-Cavity Surface-Emitting Laser) and GaAs and silicon PINs using 24 GeV/c protons at CERN for possible application in the data transmission upgrade. The optical power of VCSEL arrays decreases significantly after the irradiation but can be partially annealed with high drive currents. The responsivities of the PIN diodes also decrease significantly after irradiation, but can be recovered by operating at higher bias voltage. This provides a simple mechanism to recover from the radiation damage.

  20. Performance of refractory alloy-clad fuel pins

    International Nuclear Information System (INIS)

    Dutt, D.S.; Cox, C.M.; Millhollen, M.K.

    1984-12-01

    This paper discusses objectives and basic design of two fuel-cladding tests being conducted in support of SP-100 technology development. Two of the current space nuclear power concepts use conventional pin type designs, where a coolant removes the heat from the core and transports it to an out-of-core energy conversion system. An extensive irradiation testing program was conducted in the 1950's and 1960's to develop fuel pins for space nuclear reactors. The program emphasized refractory metal clad uranium nitride (UN), uranium carbide (UC), uranium oxide (UO 2 ), and metal matrix fuels (UCZr and BeO-UO 2 ). Based on this earlier work, studies presented here show that UN and UO 2 fuels in conjunction with several refractory metal cladding materials demonstrated high potential for meeting space reactor requirements and that UC could serve as an alternative but higher risk fuel

  1. Flux-pinning-induced stress and magnetostriction in bulk superconductors

    International Nuclear Information System (INIS)

    Johansen, Tom H.

    2000-01-01

    The development of bulk high-temperature superconductors (HTSs) and their applications has today come to a point where the mechanical response to high magnetic fields may be more important than their critical-current density and large-grain property. Reviewed in this article are the recent studies of the magneto-elastic effects which are caused by flux pinning in the superconductors. This includes the work on the giant irreversible magnetostriction and internal stress, which often cause fatal cracking of the HTS bulks as they become magnetized. The cracking is a problem that today accompanies the quest for the highest trapped field values, and the latest development in this area is also presented. While the first part is an overview of experimental efforts, the second summarizes the work done to model the pinning-induced stress and strain under various magnetic and geometrical conditions. (author)

  2. Superconducting pinning in BCC niobium-base alloys

    International Nuclear Information System (INIS)

    Hu, S.

    1981-01-01

    The structure dependence of critical current density J/sub c/ in superconducting alloys Nb--Zr and Nb--Ti was studied by means of x-ray analysis and tensile test. Experimental results indicate that, in the absence of second phase particles, annealing increases J/sub c/ in deformed alloys due to rearrangement of dislocations into cell structure and the cell walls are effective pinning centers for magnetic flux. In the precipitation process of second phase particles, new dislocations are formed due to the relaxation of coherent stress field. These new dislocations increases the dislocation density and the flux pinning ability of the cell walls, which in turn lead to a further increase of J/sub c/. The mechanism that causes precipitates to increase the current-carrying ability in Nb--Zr and Nb--Ti alloys is therefore the same as that of cold-work deformation

  3. Single absorbable polydioxanone pin fixation for distal chevron bunion osteotomies.

    Science.gov (United States)

    Deorio, J K; Ware, A W

    2001-10-01

    The distal chevron osteotomy is a well-established technique for correction of symptomatic mild to moderate metatarsus primus varus with hallux valgus deformity. Fixation of the osteotomy ranges from none to bone pegs, Kirschner wires, screws, or absorbable pins. We evaluated one surgeon's (J.K.D.) results of distal chevron osteotomy fixation with a single, nonpredrilled, 1.3-mm poly-p-dioxanone pin and analyzed any differences in patients with unilateral or bilateral symptomatic metatarsus primus varus with hallux valgus deformities. All osteotomies healed without evidence of infection, osteolysis, nonunion, or necrosis. Equal correction was achieved in unilateral and bilateral procedures. The technique is quick and easy, and adequate fixation is achieved.

  4. Magnetization pinning in conducting films demonstrated using broadband ferromagnetic resonance

    Science.gov (United States)

    Kostylev, M.; Stashkevich, A. A.; Adeyeye, A. O.; Shakespeare, C.; Kostylev, N.; Ross, N.; Kennewell, K.; Magaraggia, R.; Roussigné, Y.; Stamps, R. L.

    2010-11-01

    The broadband microstrip ferromagnetic resonance (FMR), cavity FMR, and Brillouin light scattering spectroscopy techniques have been applied for detection and characterization of a magnetic inhomogeneity in a film sample. In the case of a 100 nm thick permalloy film, an additional magnetically depleted top sublayer has been detected due to pinning effect it produces on the magnetization in the bulk of the film. The pinning results in appearance of an exchange standing spin wave mode in the broadband FMR absorption spectrum, whose amplitudes are different depending on whether the film or the film substrate faces the microstrip transducer. Comparison of the experimental amplitudes for this mode with results of our theory for both film placements revealed that the depleted layer is located at the film surface facing away from the film substrate. Subsequent broadband FMR characterization of a large number of other presumably single-layer films with thicknesses in the range 30-100 nm showed the same result.

  5. Leituras semióticas de Pinóquio

    Directory of Open Access Journals (Sweden)

    Rafael Giardini Lenzi

    2013-12-01

    Full Text Available Esta resenha faz breve exposição do conteúdo de Pinocchio: nuove avventure tra segni e linguaggi, organizado por Paolo Fabbri e Isabella Pezzini, que apresenta dez artigos e um tautograma que tratam do tema Pinóquio, alternando entre elementos do texto original, elementos presentes em variações do romance e abordagens sobre a tradução ou a variação em si, sob a óptica da semiótica discursiva. A perseverança e forte proliferação do tema Pinóquio, originalmente ou sob outros pontos de vista trazidos pelos meios de comunicação, estabelece o texto como uma fábula da atualidade que sempre atraiu o olhar científico.

  6. Intrinsic pinning in superconductors with extremely small coherence lengths

    International Nuclear Information System (INIS)

    Schimmele, L.; Kronmueller, H.; Teichler, H.

    1988-01-01

    By means of a Ginsburg-Landau-type theory which takes into account the discrete lattice structure the variation of the energy ('Peierls potential') of an isolated flux line is calculated when shifted relatively to the crystal lattice. In particular, a primitive cubic lattice is considered with a straight flux line, aligned parallel to a cubic axis. The resulting Peierls potential may lead to intrinsic pinning if the coherence length is smaller than about two nearest neighbour distances. The coherence lengths at low temperatures determined for the recently discovered high T c superconductors of the YBa 2 Cu 3 O 7 class come very close to this value so that intrinsic pinning might possibly be relevant for these superconductors. (author)

  7. Polarization of concave domains by traveling wave pinning.

    Directory of Open Access Journals (Sweden)

    Slawomir Bialecki

    Full Text Available Pattern formation is one of the most fundamental yet puzzling phenomena in physics and biology. We propose that traveling front pinning into concave portions of the boundary of 3-dimensional domains can serve as a generic gradient-maintaining mechanism. Such a mechanism of domain polarization arises even for scalar bistable reaction-diffusion equations, and, depending on geometry, a number of stationary fronts may be formed leading to complex spatial patterns. The main advantage of the pinning mechanism, with respect to the Turing bifurcation, is that it allows for maintaining gradients in the specific regions of the domain. By linking the instant domain shape with the spatial pattern, the mechanism can be responsible for cellular polarization and differentiation.

  8. Design and Operation of 3-Pin FTL HVAC System

    International Nuclear Information System (INIS)

    Chi, D. Y.; Sim, B. S.; Park, S. K.; Park, K. N.; Lee, J. M.; Ahn, S. H.; Lee, C. Y.; Kim, Y. J.

    2005-01-01

    According to the increasing demand for irradiation tests to develop new fuels, the 3-Pin FTL(Fuel Test Loop for 3 pin test fuel) facility has now been under design to conduct in-core fuel performance tests at the operating conditions, which will be installed at HANARO. The HVAC system of the FTL will be dependent on that of the HANARO. The FTL has three equipments rooms, which are the room 1, room 2 and the control room. The high pressure and high temperature equipments will be installed in the room 1. The atmosphere of the room 1 shall be maintained under the designed condition. This paper describes the design of the FTL HVAC system in the room 1

  9. Exponential synchronization of complex delayed dynamical networks via pinning periodically intermittent control

    Energy Technology Data Exchange (ETDEWEB)

    Cai Shuiming, E-mail: caishuiming2008@yahoo.com.c [Department of Mathematics, Shanghai University, Shanghai 200444 (China); Institute of System Biology, Shanghai University, Shanghai 200444 (China); Hao Junjun [Institute of System Biology, Shanghai University, Shanghai 200444 (China); He, Qinbin [Department of Mathematics, Taizhou University, Linhai 317000 (China); Institute of System Biology, Shanghai University, Shanghai 200444 (China); Liu Zengrong, E-mail: zrongliu@126.co [Department of Mathematics, Shanghai University, Shanghai 200444 (China) and Institute of System Biology, Shanghai University, Shanghai 200444 (China)

    2011-05-09

    The problem of synchronization for a class of complex delayed dynamical networks via pinning periodically intermittent control is considered in this Letter. Some novel and useful exponential synchronization criteria are obtained by utilizing the methods which are different from the techniques employed in the existing works, and the derived results are less conservative. Especially, the traditional assumptions on control width and time delays are released in our results. Moreover, a pinning scheme deciding what nodes should be chosen as pinned candidates and how many nodes are needed to be pinned for a fixed coupling strength is provided. A Barabasi-Albert network example is finally given to illustrate the effectiveness of the theoretical results. - Highlights: Pinning control problem of complex networks via intermittent control is investigated. The traditional assumptions on control width and time delays are removed. A scheme deciding what nodes should be chosen as pinned candidates is proposed. A scheme deciding how many nodes are needed to be pinned is provided.

  10. Evaluation of PWR and BWR pin cell benchmark results

    Energy Technology Data Exchange (ETDEWEB)

    Pilgroms, B.J.; Gruppelaar, H.; Janssen, A.J. (Netherlands Energy Research Foundation (ECN), Petten (Netherlands)); Hoogenboom, J.E.; Leege, P.F.A. de (Interuniversitair Reactor Inst., Delft (Netherlands)); Voet, J. van der (Gemeenschappelijke Kernenergiecentrale Nederland NV, Dodewaard (Netherlands)); Verhagen, F.C.M. (Keuring van Electrotechnische Materialen NV, Arnhem (Netherlands))

    1991-12-01

    Benchmark results of the Dutch PINK working group on the PWR and BWR pin cell calculational benchmark as defined by EPRI are presented and evaluated. The observed discrepancies are problem dependent: a part of the results is satisfactory, some other results require further analysis. A brief overview is given of the different code packages used in this analysis. (author). 14 refs.; 9 figs.; 30 tabs.

  11. Axial migratin of cesium in LMFBR fuel pins

    International Nuclear Information System (INIS)

    Karnesky, R.A.; Bridges, A.E.; Jost, J.W.

    1981-11-01

    A correlated model for quantitatively predicting the behavior of cesium in LMFBR fuel pins has been developed. This correlation was shown to be in good agreement with experimental data. It has been used to predict the behavior of cesium in the FFTF driver fuel and as the result of this analysis it has been shown that the accumulation of cesium in the insulator pellets at the ends of the fuel column will not be life limiting

  12. Anticipating WPS PIN Vulnerability to Secure Wireless Network

    Directory of Open Access Journals (Sweden)

    Indra Dwi Rianto

    2013-12-01

    Full Text Available WiFi Protected Setup (WPS is a standardized function supported by numerous vendors of wireless routers and access point to help set up connection to a wireless local area network. It is designed to simplify the set up and generally enabled by default. Due to design flaw, the WPS or QSS PIN is susceptible to a brute forceattack. In this paper, we test the security vulnerability occurred, evaluate the performance and give recommendations to anticipate the attack.

  13. X-ray measurement with Pin type semiconductor detectors

    International Nuclear Information System (INIS)

    Ramirez J, F.J.

    1999-01-01

    Here are presented the experimental results of the applications of Pin type radiation detectors developed in a National Institute of Nuclear Research (ININ) project, in the measurement of low energy gamma and X-rays. The applications were oriented mainly toward the Medical Physics area. It is planned other applications which are in process of implementation inside the National Institute of Nuclear Research in Mexico. (Author)

  14. Pinning by oxygen vacancies in high-Tc superconductors

    International Nuclear Information System (INIS)

    Chudnovsky, E.M.

    1990-01-01

    It is shown that recent data of Murray et al. on spatial correlations in flux lattices of Bi-Sr-Ca-Cu-O (BSCCO) may be explained if one assumes that 1% of oxygen atoms in CuO 2 layers are missing. This estimate, being in remarkable agreement with that deduced by Kes and van der Beek from ac-susceptibility measurements, provides strong confidence that oxygen vacancies are the major source of pinning in BSCCO

  15. Pins and posters: paradigms for content publication on situated displays

    OpenAIRE

    José, Rui; Pinto, Helder; Siva, Bruno; Melro, Ana

    2013-01-01

    Public display systems are still far from being a communication medium that people can appropriate to serve diverse communication goals. Moving towards open displays will require new publication paradigms that can overcome the challenges of meaningful engagement and enable users to fully understand and control the entire publication process. In this paper, we report on the study of two novel and complimentary communication paradigms for public displays inspired by the metaphors of pin badges ...

  16. Prevention of pin tract infection with titanium-copper alloys.

    Science.gov (United States)

    Shirai, Toshiharu; Tsuchiya, Hiroyuki; Shimizu, Tohru; Ohtani, Kaori; Zen, Yo; Tomita, Katsuro

    2009-10-01

    The most frequent complication in external fixation is pin tract infection. To reduce the incidence of implant-associated infection, many published reports have looked at preventing bacterial adhesion by treating the pin surface. This study aimed to evaluate the antibacterial activity of a Titanium-Copper (Ti-Cu) alloy on implant infection, and to determine the potential use of the Ti-Cu alloy as a biomaterial. Two forms of Ti-Cu alloys were synthesized: one with 1% Cu and the other with 5% Cu. For analyzing infectious behavior, the implants were exposed to Staphylococcus aureus and Escherichia coli. The reaction of pathogens to the Ti-Cu alloys was compared with their reaction to stainless steel and pure titanium as controls. Both Ti-Cu alloys evidently inhibited colonization by both bacteria. Conversely, cytocompatibility studies were performed using fibroblasts and colony formation on the metals was assessed by counting the number of colonies. Ti-1% Cu alloy showed no difference in the number of colonies compared with the control. External fixator pins made of Ti-Cu alloys were evaluated in a rabbit model. The tissue-implant interactions were analyzed for the presence of infection, inflammatory changes and osteoid-formation. Ti-1% Cu alloy significantly inhibited inflammation and infection, and had excellent osteoid-formation. Copper blood levels were measured before surgery and at 14 days postoperatively. Preoperative and postoperative blood copper values were not statistically different. Overall, it was concluded that Ti-Cu alloys have antimicrobial activity and substantially reduce the incidence of pin tract infection. Ti-1% Cu alloy shows particular promise as a biomaterial. (c) 2009 Wiley Periodicals, Inc.

  17. Effective temperature in driven vortex lattices with random pinning

    International Nuclear Information System (INIS)

    Kolton, Alejandro B.; Dominguez, Daniel; Exartier, Raphael; Cugliandolo, Leticia F.; Groenbech-Jensen, N.

    2003-09-01

    We study numerically correlation and response functions in non-equilibrium driven vortex lattices with random pinning. From a generalized fluctuation-dissipation relation we calculate an effective transverse temperature in the fluid moving phase. We find that the effective temperature decreases with increasing driving force and becomes equal to the equilibrium melting temperature when the dynamic transverse freezing occurs. We also discuss how the effective temperature can be measured experimentally from a generalized Kubo formula. (author)

  18. FFTF metal fuel pin sodium bond quality verification

    International Nuclear Information System (INIS)

    Pitner, A.L.; Dittmer, J.O.

    1988-12-01

    The Fast Flux Test Facility (FFTF) Series III driver fuel design consists of U-10Zr fuel slugs contained in a ferritic alloy cladding. A liquid metal, sodium bond between the fuel and cladding is required to prevent unacceptable temperatures during operation. Excessive voiding or porosity in the sodium thermal bond could result in localized fuel melting during irradiation. It is therefore imperative that bond quality be verified during fabrication of these metal fuel pins prior to irradiation. This document discusses this verification

  19. The dynamics of plant plasma membrane proteins: PINs and beyond.

    Science.gov (United States)

    Luschnig, Christian; Vert, Grégory

    2014-08-01

    Plants are permanently situated in a fixed location and thus are well adapted to sense and respond to environmental stimuli and developmental cues. At the cellular level, several of these responses require delicate adjustments that affect the activity and steady-state levels of plasma membrane proteins. These adjustments involve both vesicular transport to the plasma membrane and protein internalization via endocytic sorting. A substantial part of our current knowledge of plant plasma membrane protein sorting is based on studies of PIN-FORMED (PIN) auxin transport proteins, which are found at distinct plasma membrane domains and have been implicated in directional efflux of the plant hormone auxin. Here, we discuss the mechanisms involved in establishing such polar protein distributions, focusing on PINs and other key plant plasma membrane proteins, and we highlight the pathways that allow for dynamic adjustments in protein distribution and turnover, which together constitute a versatile framework that underlies the remarkable capabilities of plants to adjust growth and development in their ever-changing environment. © 2014. Published by The Company of Biologists Ltd.

  20. Optimization of geometric parameters of heat exchange pipes pin finning

    Science.gov (United States)

    Akulov, K. A.; Golik, V. V.; Voronin, K. S.; Zakirzakov, A. G.

    2018-05-01

    The work is devoted to optimization of geometric parameters of the pin finning of heat-exchanging pipes. Pin fins were considered from the point of view of mechanics of a deformed solid body as overhang beams with a uniformly distributed load. It was found out under what geometric parameters of the nib (diameter and length); the stresses in it from the influence of the washer fluid will not exceed the yield strength of the material (aluminum). Optimal values of the geometric parameters of nibs were obtained for different velocities of the medium washed by them. As a flow medium, water and air were chosen, and the cross section of the nibs was round and square. Pin finning turned out to be more than 3 times more compact than circumferential finning, so its use makes it possible to increase the number of fins per meter of the heat-exchanging pipe. And it is well-known that this is the main method for increasing the heat transfer of a convective surface, giving them an indisputable advantage.

  1. Contact and Non-contact Measurements of Grinding Pins

    Directory of Open Access Journals (Sweden)

    Magdziak Marek

    2015-01-01

    Full Text Available The paper presents the results of contact and non-contact measurements of external profiles of selected grinding pins. The measurements were conducted in order to choose the appropriate measuring technique in the case of the considered measurement task. In the case of contact measurements the coordinate measuring machine ACCURA II was applied. The used coordinate measuring machine was equipped with the contact scanning probe VAST XT and the Calypso inspection software. Contact coordinate measurements were performed by using of different measurement strategies. The applied strategies included different scanning velocities and distances between measured points. Non-contact measurements were conducted by means of the tool presetter produced by the Mahr company. On the basis of gained results the guidelines concerning measurements of grinding pins were formulated. The measurements of analyzed grinding pins performed by means of the non-contact measuring system are characterized by higher reproducibility than the contact measurements. The low reproducibility of contact measurements may be connected with the inaccuracy of the selected coordinate measuring machine and the measuring probe, the measurement parameters and environmental conditions in the laboratory where the coordinate measuring machine is located. Moreover, the paper presents the possible application of results of conducted investigations. The results of non-contact measurements can be used in the simulation studies of grinding processes. The simulations may reduce the costs of machining processes.

  2. End-threaded intramedullary positive profile screw ended self-tapping pin (Admit pin) - A cost-effective novel implant for fixing canine long bone fractures.

    Science.gov (United States)

    Chanana, Mitin; Kumar, Adarsh; Tyagi, Som Prakash; Singla, Amit Kumar; Sharma, Arvind; Farooq, Uiase Bin

    2018-02-01

    The current study was undertaken to evaluate the clinical efficacy of end-threaded intramedullary pinning for management of various long bone fractures in canines. This study was conducted in two phases, managing 25 client-owned dogs presented with different fractures. The technique of application of end-threaded intramedullary pinning in long bone fractures was initially standardized in 6 clinical patients presented with long bone fractures. In this phase, end-threaded pins of different profiles, i.e., positive and negative, were used as the internal fixation technique. On the basis of results obtained from standardization phase, 19 client-owned dogs clinically presented with different fractures were implanted with end-threaded intramedullary positive profile screw ended self-tapping pin in the clinical application phase. The patients, allocated randomly in two groups, when evaluated postoperatively revealed slight pin migration in Group-I (negative profile), which resulted in disruption of callus site causing delayed union in one case and large callus formation in other two cases whereas no pin migration was observed in Group-II (positive profile). Other observations in Group-I was reduced muscle girth and delayed healing time as compared to Group-II. In clinical application, phase 21 st and 42 nd day post-operative radiographic follow-up revealed no pin migration in any of the cases, and there was no bone shortening or fragment collapse in end-threaded intramedullary positive profile screw ended self-tapping pin. The end-threaded intramedullary positive profile screw ended self-tapping pin used for fixation of long bone fractures in canines can resist pin migration, pin breakage, and all loads acting on the bone, i.e., compression, tension, bending, rotation, and shearing to an extent with no post-operative complications.

  3. Pin-wise Reactor Analysis Based on the Generalized Equivalence Theory

    Energy Technology Data Exchange (ETDEWEB)

    Yu, Hwan Yeal; Heo, Woong; Kim, Yong Hee [KAIST, Daejeon (Korea, Republic of)

    2016-05-15

    In this paper, a pin-wise reactor analysis is performed based on the generalized equivalence theory. From the conventional fuel assembly lattice calculations, pin-wise 2-group cross sections and pin DFs are generated. Based on the numerical results on a small PWR benchmark, it is observed that the pin-wise core analysis provide quite accurate prediction on the effective multiplication factor and the peak pin power error is bounded by about 3% in peripheral fuel assemblies facing the baffle-reflector. Also, it was found that relatively large pin power errors occur along the interface between clearly different fuel assemblies. It is expected that the GET-based pin-by-pin core calculation can be further developed as an advanced method for reactor analysis via improving the group constants and discontinuity factors. Recently, high-fidelity multi-dimensional analysis tools are gaining more attention because of their accurate prediction of local parameters for core design and safety assessment. In terms of accuracy, direct whole-core transport is quite promising. However, it is clear that it is still very costly in terms of the computing time and memory requirements. Another possible solution is the pin-by-pin core analysis in which only small fuel pins are homogenized and the 3-D core analysis is still performed using a low-order operator such as the diffusion theory. In this paper, a pin-by-pin core analysis is performed using the hybrid CMFD (HCMFD) method. Hybrid CMFD is a new global-local iteration method that has been developed for efficient parallel calculation of pinby-pin heterogeneous core analysis. For the HCMFD method, the one-node CMFD scheme is combined with a local two-node CMFD method in a non-linear way. Since the SPH method is iterative and SPH factors are not direction dependent, it is clear that SPH method takes more computing cost and cannot take into account the different heterogeneity and transport effects at each pin interface. Unlike the SPH

  4. Once Bitten, Twice Shy

    DEFF Research Database (Denmark)

    Andersen, Steffen; Hanspal, Tobin; Meisner Nielsen, Kasper

    We study how personal experiences affect individual risk taking. To separate the intertwining effects of personal experiences and wealth changes, our identification strategy relies on the decision to keep unexpected inheritances of risky assets. Experience derives from investments in banks...... that defaulted in the aftermath of the financial crisis. To differentiate the effect of personal experiences, we classify the degrees of experiences into first-hand experiences from personal losses, second-hand experiences from the losses of close family members, and third-hand experiences from living...... in municipalities where banks defaulted. We find that third-hand experiences result in marginally lower risk taking. Second-hand experiences have a relatively stronger negative effect, whereas the effect of first-hand experiences on risk taking is strongly negative. Overall, our results demonstrate that personal...

  5. Once Bitten, Twice Shy

    DEFF Research Database (Denmark)

    Andersen, Steffen; Hanspal, Tobin; Meisner Nielsen, Kasper

    We study how inertia and personal experiences affect individual risk taking. Our research design relies on active portfolio decisions relating to inheritances to separate the effect of personal experiences from inertia, which otherwise would be observationally equivalent. Experience derives from...... results demonstrate that experiences gained personally, aside from inertia or common shocks, explain substantial heterogeneity in individuals' risk taking....

  6. HLM fuel pin bundle experiments in the CIRCE pool facility

    Energy Technology Data Exchange (ETDEWEB)

    Martelli, Daniele, E-mail: daniele.martelli@ing.unipi.it [University of Pisa, Department of Civil and Industrial Engineering, Pisa (Italy); Forgione, Nicola [University of Pisa, Department of Civil and Industrial Engineering, Pisa (Italy); Di Piazza, Ivan; Tarantino, Mariano [Italian National Agency for New Technologies, Energy and Sustainable Economic Development, C.R. ENEA Brasimone (Italy)

    2015-10-15

    Highlights: • The experimental results represent the first set of values for LBE pool facility. • Heat transfer is investigated for a 37-pin electrical bundle cooled by LBE. • Experimental data are presented together with a detailed error analysis. • Nu is computed as a function of the Pe and compared with correlations. • Experimental Nu is about 25% lower than Nu derived from correlations. - Abstract: Since Lead-cooled Fast Reactors (LFR) have been conceptualized in the frame of GEN IV International Forum (GIF), great interest has focused on the development and testing of new technologies related to HLM nuclear reactors. In this frame the Integral Circulation Experiment (ICE) test section has been installed into the CIRCE pool facility and suitable experiments have been carried out aiming to fully investigate the heat transfer phenomena in grid spaced fuel pin bundles providing experimental data in support of European fast reactor development. In particular, the fuel pin bundle simulator (FPS) cooled by lead bismuth eutectic (LBE), has been conceived with a thermal power of about 1 MW and a uniform linear power up to 25 kW/m, relevant values for a LFR. It consists of 37 fuel pins (electrically simulated) placed on a hexagonal lattice with a pitch to diameter ratio of 1.8. The FPS was deeply instrumented by several thermocouples. In particular, two sections of the FPS were instrumented in order to evaluate the heat transfer coefficient along the bundle as well as the cladding temperature in different ranks of sub-channels. Nusselt number in the central sub-channel was therefore calculated as a function of the Peclet number and the obtained results were compared to Nusselt numbers obtained from convective heat transfer correlations available in literature on Heavy Liquid Metals (HLM). Results reported in the present work, represent the first set of experimental data concerning fuel pin bundle behaviour in a heavy liquid metal pool, both in forced and

  7. Vortex dynamics in supraconductors in the presence of anisotropic pinning

    International Nuclear Information System (INIS)

    Soroka, O.K.

    2004-01-01

    Vortex dynamics in two different classes of superconductors with anisotropic unidirected pinning sites was experimentally investigated by magnetoresistivity measurements: YBCO-films with unidirected twins and Nb-films deposited on faceted Al 2 O 3 substrate surfaces. For the interpretation of the experimental results a theoretical model based on the Fokker-Planck equation was used. It was proved by X-ray measurements that YBCO films prepared on (001) NdGaO 3 substrates exhibit only one twin orientation in contrast to YBCO films grown on (100) SrTiO 3 substrates. The magnetoresistivity measurements of the YBCO films with unidirected twin boundaries revealed the existence of two new magnetoresistivity components, which is a characteristic feature of a guided vortex motion: an odd longitudinal component with respect to the magnetic field sign reversal and an even transversal component. However, due to the small coherence length in YBCO and the higher density of point-like defects comparing to high-quality YBCO single crystals, the strength of the isotropic point pinning was comparable with the strength of the pinning produced by twins. This smeared out all e ects caused by the pinning anisotropy. The behaviour of the odd longitudinal component was found to be independent of the transport current direction with respect to the twin planes. The magnetoresistivity measurements of faceted Nb films demonstrated the appearance of an odd longitudinal and even transversal component of the magnetoresistivity. The temperature and magnetic field dependences of all relevant magnetoresistivity components were measured. The angles between the average vortex velocity vector and the transport current direction calculated from the experimental data for the different transport current orientations with respect to the facet ridges showed that the vortices moved indeed along the facet ridges. An anomalous Hall effect, i.e. a sign change of the odd transversal magnetoresistivity, has been

  8. Correlations between fuel pins irradiated in fast and thermal fluxes using the frump fuel pin modelling program

    International Nuclear Information System (INIS)

    Hayns, M.R.; Adam, J.

    1975-08-01

    There is no experimental facilities in which a fuel pin can be irradiated in a fast environment under well defined conditions of over power or flow run down. Consequently most of the infor mation which is being accumulated on the behaviour of fuel pins under severe conditions is obtained from either capsule or loop rigs in thermal reactors. It is the purpose of this paper to highlight the differences between the behaviour of fuel pins irradiated in a thermal flux and a fast flux. A typical set of conditions is taken from an overpower experiment in a thermal flux and the behaviour of the system is analysed using the fuel modelling program FRUMP. A second numerical experiment is then performed in which the same conditions prevail, except that a fast flux is assumed, the criterion for comparison being that the total power input to the system is the same in both cases. From the many possible correlations which result from such an exercise the fuel tempreature has been selected to highlight various important features of the two irradiations. It is demonstrated that the flux depression can cause differences in the pin behaviour, even to altering the order of events in a transient. For example fuel melting will occur at different times and at different positions in the fuel in the two cases. It is concluded that the techniques of fuel modelling, as typified in the program FRUMP can provide a very useful tool indeed for the analysis of such experiments and for guiding the establishment of the appropriate correlations for the extrapolation to the fast flux case. (author)

  9. X-ray measurement with Pin type semiconductor detectors; Medicion de rayos X con detectores de semiconductor tipo PIN

    Energy Technology Data Exchange (ETDEWEB)

    Ramirez J, F.J. [Instituto Nacional de Investigaciones Nucleares, Departamento de Electronica, C.P. 52045 Salazar, Estado de Mexico (Mexico)

    2000-07-01

    Here are presented the experimental results of the applications of Pin type radiation detectors developed in a National Institute of Nuclear Research (ININ) project, in the measurement of low energy gamma and X-rays. The applications were oriented mainly toward the Medical Physics area. It is planned other applications which are in process of implementation inside the National Institute of Nuclear Research in Mexico. (Author)

  10. Os efeitos do Lian Gong em hipertensos assistidos em unidade de saúde da família do município de Parnaíba, Piauí - doi: 10.5020/18061230.2012.p435

    Directory of Open Access Journals (Sweden)

    Elce de Seixas Nascimento

    2013-07-01

    Full Text Available Objetivo: Conhecer os efeitos do Lian Gong em pacientes hipertensos usuários da Unidade de Saúde da Família. Métodos: Estudo qualitativo descritivo, envolvendo 20 voluntários, independente do sexo, com idade entre 45 e 70 anos, residentes no município de ParnaíbaPI, Brasil. A intervenção foi realizada em ambiente calmo e livre de ruídos, no período de agosto a setembro de 2011, três vezes por semana, com um total de 30 sessões. Utilizouse a ferramenta Grupo Focal no início e ao final da intervenção. Aplicou-se a técnica de análise temática do discurso do sujeito coletivo (DSC, utilizando três figuras metodológicas: ideia central, expressões-chave e DSC. Foram utilizadas operações estatísticas simples (percentagens para quantificar as falas. Resultados: Antes da intervenção, o grupo referiu ter percebido a hipertensão pela manifestação de sintomas físicos e/ou psíquicos a partir do diagnóstico e da rejeição ao tratamento, revelando ter um nível superficial de conhecimento ou informações equivocadas acerca da doença. Após a intervenção, foi referido melhora dos sintomas físicos e emocionais, nas relações sociais e familiares, bem como na dificuldade de mudanças de hábitos, que pode ser atenuada com o apoio multiprofissional e a continuação dos exercícios físicos. Considerações finais: A prática de Lian Gong se mostrou eficaz para a melhoria do estado físico e emocional de pacientes hipertensos, podendo ser uma terapia coadjuvante ao controle da hipertensão arterial sistêmica na atenção primária à saúde.

  11. French approach in fuel pin modelling for fast reactors

    Energy Technology Data Exchange (ETDEWEB)

    Pascard, R [CEA-Centre de Fontenay-aux-Roses, Fontenay-aux-Roses (France)

    1979-12-01

    The purpose of this paper is to present the general philosophy on the problem of fuel modelling now prevailing in France after a twelve years period of tremendously increasing knowledge on fuel behavior. When the Rapsodie fuel pin was designed in 1962 , little was known about the behavior of a mixed oxide fuel pin under fast flux ; but a large body of knowledge on UO{sub 2} behavior in thermal reactor was available together with some sparse irradiation results on (U Pu)O{sub 2} in French experimental reactors. The performances assigned to the pin were then rather modest in rating (400 w/cm) and in burnup (30,000 MWd/t). The AISI 316 steel in solution annealed state was chosen as cladding material. The clad itself was supposed to deform by thermal creep due to fission gas pressure (100% release), and was affected consequently by a strain limit criteria. The importance of clad temperature ({approx}650 deg.) was considered only in connection with thermal creep, the possibility of a chemical reaction between mixed oxide and clad being at that time hardly suspected. Rapsodie had only been at full power for a few months when appeared the evidence of stainless steel swelling under a fast neutrons flux. This swelling was observed on Rapsodie pins as soon as they experienced sufficient neutrons dose, roughly one year later. This entirely new problem came immediately in the front stage (and is still of major importance today), and was at the origin of the change from the Rapsodie to the Fortissimo core in order to accelerate materials testing versus void swelling by multiplying the flux by a factor two. Even with unforeseen swelling, the design of the Rapsodie and later on Fortissimo pin, allowed not only to reach the goal burnup, but to increase it steadily to roughly 100,000 MWd/t. Since then, the French approach in fuel pin design has still retained something of its original simplicity, and technological efficiency, attitude which is justified by the following

  12. Establishing the need for an engineering standard for agricultural hitch pins.

    Science.gov (United States)

    Deboy, G R; Knapp, W M; Field, W E; Krutz, G W; Corum, C L

    2012-04-01

    Documented incidents have occurred in which failure or unintentional disengagement of agricultural hitch pins has contributed to property damage and personal injury. An examination of current hitch pin use on a convenience sample of farm operations in Indiana revealed a variety of non-standard, worn and damaged, and inappropriately sized hitch pins in use. Informal interviews with the farm operators confirmed that hitch pin misuse, failure, or disengagement is a relatively widespread problem that remains largely unaddressed. On-site observations also suggested a low use of hitch pin retaining devices or safety chains. A review of prior research revealed that little attention has been given to this problem, and currently no documentation allows for an estimate of the frequency or severity of losses associated with hitch pin misuse, failure, or disengagement. No specific engineering standards were found that directly applied to the design, appropriate selection, or loading capacity of agricultural hitch pins. Major suppliers of replacement hitch pins currently provide little or no information on matching hitch pin size to intended applications, and most replacement hitch pins examined were of foreign origin, with the overwhelming majority imported from China or India. These replacement hitch pins provided no specifications other than diameter, length, and, in some cases, labeling that indicated that the pins had been "heat treated. " Testing of a sample of 11 commercially available replacement hitch pins found variation along the length of the pin shaft and between individual pins in surface hardness, a potential predictor of pin failure. Examination of 17 commercially available replacement pins also revealed a variety of identifiers used to describe pin composition and fabrication methods, e.g., "heat treated." None of the pins examined provided any specifications on loading capacity. It was therefore concluded that there is a need to develop an agricultural hitch

  13. Postirradiation examinations of fuel pins from the GCFR F-1 series of mixed-oxide fuel pins at 5.5 at. % burnup

    International Nuclear Information System (INIS)

    Strain, R.V.; Johnson, C.E.

    1978-05-01

    Postirradiation examinations were performed on five fuel pins from the Gas-Cooled Fast-Breeder Reactor F-1 experiment irradiated in EBR-II to a peak burnup of approximately 5.5 at. %. These encapsulated fuel pins were irradiated at peak-power linear ratings from approximately 13 to 15 kW/ft and peak cladding inside diameter temperatures from approximately 625 to 760 0 C. The maximum diametral change that occurred during irradiation was 0.2% ΔD/D 0 . The maximum fuel-cladding chemical interaction depth was 2.6 mils in fuel pin G-1 and 1 mil or less in the other three pins examined destructively. Significant migration of the volatile fission products occurred axially to the fuel-blanket interfaces. Teh postirradiation examination data indicate that fuel melted at the inner surface of the annular fuel pellets in the two highest power rating fuel pins, but little axial movement of fuel occurred

  14. SHiP: a new facility with a dedicated detector to search for new neutral particles and studying tau neutrino properties

    Directory of Open Access Journals (Sweden)

    Shevchenko V.

    2017-01-01

    Full Text Available SHiP (Search for Hidden Particles is a new general purpose fixed target facility, whose Technical Proposal has been recently reviewed by the CERN SPS Committee and by the CERN Research Board. The two boards recommended that the experiment proceeds further to a Comprehensive Design phase in the context of the new CERNWorking group "Physics Beyond Colliders", aiming at presenting a CERN strategy for the European Strategy meeting of 2019. In the initial phase of SHiP, the 400 GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating 2×1020 pot in 5 years. A dedicated detector, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below O(10 GeV/c2. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutrinos. The sensitivity to Heavy Neutrinos will allow for the first time to probe, in the mass range between the kaon and the charm meson mass, a coupling range for which Baryogenesis and active neutrino masses could also be explained. Another dedicated detector will allow the study of neutrino cross-sections and angular distributions.

  15. SHI induced effects on the electrical and optical properties of HfO{sub 2} thin films deposited by RF sputtering

    Energy Technology Data Exchange (ETDEWEB)

    Manikanthababu, N.; Dhanunjaya, M.; Nageswara Rao, S.V.S.; Pathak, A.P., E-mail: appsp@uohyd.ernet.in

    2016-07-15

    The continuous downscaling of Metal Oxide Semiconductor (MOS) devices has reached a limit with SiO{sub 2} as a gate dielectric material. Introducing high-k dielectric materials as a replacement for the conservative SiO{sub 2} is the only alternative to reduce the leakage current. HfO{sub 2} is a reliable and an impending material for the wide usage as a gate dielectric in semiconductor industry. HfO{sub 2} thin films were synthesized by RF sputtering technique. Here, we present a study of Swift Heavy Ion (SHI) irradiation with100 MeV Ag ions for studying the optical properties as well as 80 MeV Ni ions for studying the electrical properties of HfO{sub 2}/Si thin films. Rutherford Backscattering Spectrometry (RBS), Field Emission Scanning Electron Microscope (FESEM), energy-dispersive X-ray spectroscopy (EDS), profilometer and I–V (leakage current) measurements have been employed to study the SHI induced effects on both the structural, electrical and optical properties.

  16. Raman and time resolved photoluminescence studies on the effect of temperature on disorder production in SHI irradiated N-doped 6H-SiC crystals

    Energy Technology Data Exchange (ETDEWEB)

    Sivaji, K., E-mail: sivaji.krishnan@yahoo.com [Materials Science Centre, Department of Nuclear Physics, University of Madras, Guindy Campus, Chennai 600025 (India); Viswanathan, E. [Materials Science Centre, Department of Nuclear Physics, University of Madras, Guindy Campus, Chennai 600025 (India); Selvakumar, S. [Materials Science Centre, Department of Nuclear Physics, University of Madras, Guindy Campus, Chennai 600025 (India); University of Tsukuba Tandem Accelerator Complex, University of Tsukuba, Tennodai 1-1-1, Ibaraki 305-8577 (Japan); Sankar, S. [Department of Physics, MIT Campus, Anna University, Chennai 600044 (India); Kanjilal, D. [Inter-University Accelerator Centre, Aruna Asaf Ali Marg, P.O. Box 10502, New Delhi 110067 (India)

    2014-02-25

    Highlights: • N doped SiC were irradiated with 150 MeV Ag{sup 12+} (1 × 10{sup 12} to 5 × 10{sup 13} ions/cm{sup 2}). • Local disorder are analyzed by studying the LO Raman mode of the irradiated sample. • The TRPL studies provided evidence of the formation of radiative centers at 80 K. -- Abstract: In this report, the effect of disorder accumulation in Swift Heavy Ion (SHI) irradiated 6H-SiC is distinguished with respect to the irradiation temperature, viz., 80 K and 300 K. The samples were irradiated with 150 MeV Ag{sup 12+} ions with different fluences ranging from 1 × 10{sup 12} to 5 × 10{sup 13} ions/cm{sup 2}. The structural and optical properties of N-doped 6H-SiC in its pristine condition and after SHI irradiation have been studied. The changes observed by Raman spectroscopy and Time resolved photoluminescence (TRPL) spectroscopy were ascribed to the disorder accumulation in 6H-SiC. The local disorder has been analyzed by studying the LO Raman mode of the irradiated sample in comparison to the pristine sample. The TRPL studies have provided evidence of the formation of radiative centers after irradiation at 80 K.

  17. Effect of the partial replacement of fish meal and oil by vegetable products on performance and quality traits of juvenile shi drum (Umbrina cirrosa L.

    Directory of Open Access Journals (Sweden)

    Igino Andrighetto

    2010-01-01

    Full Text Available A four-month growth trial was carried out in order to evaluate performance and quality traits of juvenile shi drum fedwith two isonitrogenous and isoenergetic diets having different amounts of vegetable products (Vegetable diet vs. Controldiet. Compared to the Control diet, the Vegetable diet was formulated by increasing the replacement of fish meal (14%with soybean and cereal products, and fish oil (12% with a mixture of vegetable oil. On June, 4 groups of 225 fish (2replicates per dietary treatment were sorted according to live weight and reared in fibreglass tanks over a four- monthlong experimental period. Fish were hand fed to apparent satiety. Offered feed, growth parameters and feed efficiencywere recorded as productive performance. At the end of the trial (October biometric, chemical and reological traits wereexamined to assess fish quality. The dietary treatments showed similar productive performance. The relatively high inclusionof vegetable sources led to a significant modification of body shape, mesenteric fat and viscera weight. Among qualitytraits, Vegetable diet-fed fish demonstrated a significantly lower whole body and fillet crude protein content.Yellowness value of the cooked fillet was significantly lower in the Control diet-fed fish, whereas fillet texture was similar.The results of this research showed that shi drum is a suitable candidate for Mediterranean marine aquaculture andits dietary formulation might include at least the amount of vegetable sources used in this trial.

  18. Thermal and stress analyses in thermoelectric generator with tapered and rectangular pin configurations

    International Nuclear Information System (INIS)

    Yilbas, Bekir Sami; Akhtar, S.S.; Sahin, A.Z.

    2016-01-01

    Thermal stress developed in thermoelectric generators is critical for long service applications. High temperature gradients, due to a large temperature difference across the junctions, causes excessive stress levels developed in the device pins and electrodes at the interfaces. In the present study, a thermoelectric generator with horizontal pin configuration is considered and thermal stress analysis in the device is presented. Ceramic wafer is considered to resemble the high temperature plate and copper electrodes are introduced at the pin junctions to reduce the electrical resistance between the pins and the high and low temperature junction plates during the operation. Finite element code is used to simulate temperature and stress fields in the thermoelectric generator. In the simulations, convection and radiation losses from the thermoelectric pins are considered and bismuth telluride pin material with and without tapering is incorporated. It is found that von Mises stress attains high values at the interface between the hot and cold junctions and the copper electrodes. Thermal stress developed in tapered pin configuration attains lower values than that of rectangular pin cross-section. - Highlights: • Different cold junction temperatures improves thermoelectric generator performance. • von Mises stress remains high across copper electrodes and hot junction ceramics. • von Mises stress reduces along pin length towards cold junction. • Pin tapering lowers stress levels in thermoelectric generator.

  19. Excessive Cellular S-nitrosothiol Impairs Endocytosis of Auxin Efflux Transporter PIN2

    Directory of Open Access Journals (Sweden)

    Min Ni

    2017-11-01

    Full Text Available S-nitrosoglutathione reductase (GSNOR1 is the key enzyme that regulates cellular levels of S-nitrosylation across kingdoms. We have previously reported that loss of GSNOR1 resulted in impaired auxin signaling and compromised auxin transport in Arabidopsis, leading to the auxin-related morphological phenotypes. However, the molecular mechanism underpinning the compromised auxin transport in gsnor1-3 mutant is still unknown. Endocytosis of plasma-membrane (PM-localized efflux PIN proteins play critical roles in auxin transport. Therefore, we investigate whether loss of GSNOR1 function has any effects on the endocytosis of PIN-FORMED (PIN proteins. It was found that the endocytosis of either the endogenous PIN2 or the transgenically expressed PIN2-GFP was compromised in the root cells of gsnor1-3 seedlings relative to Col-0. The internalization of PM-associated PIN2 or PIN2-GFP into Brefeldin A (BFA bodies was significantly reduced in gsnor1-3 upon BFA treatment in a manner independent of de novo protein synthesis. In addition, the exogenously applied GSNO not only compromised the endocytosis of PIN2-GFP but also inhibited the root elongation in a concentration-dependent manner. Taken together, our results indicate that, besides the reduced PIN2 level, one or more compromised components in the endocytosis pathway could account for the reduced endocytosis of PIN2 in gsnor1-3.

  20. A three-dimensional pin-wise analysis for CEA ejection accident

    Energy Technology Data Exchange (ETDEWEB)

    Park, Guen-Tae; Park, Min-Ho; Park, Jin-Woo; Um, Kil-Sup; Choi, Tong-Soo [KEPCO NF, Daejeon (Korea, Republic of)

    2016-10-15

    The ejection of a control element assembly (CEA) with high reactivity worth causes the sudden insertion of reactivity into the core. Immediately after the CEA ejection, the nuclear power of the reactor dramatically increases in an exponential behavior until the doppler effect becomes important and turns the reactivity balance and power down to lower levels. The 3-D CEA ejection analysis methodology has been developed using the multi-dimensional code coupling system, CHASER, which couples three dimensional core neutron kinetics code ASTRA, subchannel analysis code THALES, and fuel performance analysis code FROST using message passing interface (MPI). This paper presents the pin-by-pin level analysis result with the 3-D CEA ejection analysis methodology using the CHASER. The pin-by-pin level analysis consists of DNBR, enthalpy and Pellet/Clad Mechanical Interaction (PCMI) analysis. All the evaluations are simulated for APR1400 plant loaded with PLUS7 fuel. In this paper, the pin-by-pin analysis using the multidimensional core transient code, CHASER, is presented with respect to enthalpy, DNBR and PCMI for APR1400 plant loaded with PLUS7 fuel. For the pin-by-pin enthalpy and DNBR analysis, the quarter core for HFP case or 15 - 20 assemblies around the most severe assembly for part powers or HZP cases are selected. And PCMI calculation is performed for all the rods in the whole core during a conservative time period. The pin-by-pin analysis results show that the regulatory guidelines of CEA ejection accident are satisfied.

  1. Relationships between head fixation pins for radiosurgery and the skull bone. Usefulness of a torque wrench

    International Nuclear Information System (INIS)

    Toyota, Shun; Seta, Hidetoshi; Muramatsu, Masatoshi; Kubo, Hitoshi; Takeda, Kan

    2003-01-01

    In stereotactic radiosurgery (SRS), fixation devices are secured to the patient's head with pins. However, there have been no standards for the use of such pins, which must be inserted with appropriate torque based on the surgeon's clinical judgment. Therefore, the pins may sometimes be tightened excessively and penetrate too deeply into the patient's skull. To improve safety in SRS, a torque wrench was used for pin insertion. The usefulness of the torque wrench was then evaluated by examining the relationships between the pins and skull bone and identifying differences according to the wrench used and the patient's bone thickness. CT images of patients who had previously undergone SRS were used to assess the relationships between the pins and skull bone. Differences according to the wrench used and pin insertion site were investigated. Compared with a standard wrench, use of the torque wrench decreased the insertion depth of pins in the skull bone. In terms of site, pins in the forehead were inserted more deeply. No differences related to the frontal sinus were observed. The use of a torque wrench improved safety during pin insertion for SRS procedures. (author)

  2. Finite Element Analysis of Laser Engineered Net Shape (LENS™) Tungsten Clad Squeeze Pins

    Science.gov (United States)

    Sakhuja, Amit; Brevick, Jerald R.

    2004-06-01

    In the aluminum high-pressure die-casting and indirect squeeze casting processes, local "squeeze" pins are often used to minimize internal solidification shrinkage in heavy casting sections. Squeeze pins frequently fail in service due to molten aluminum adhering to the H13 tool steel pins ("soldering"). A wide variety of coating materials and methods have been developed to minimize soldering on H13. However, these coatings are typically very thin, and experience has shown their performance on squeeze pins is highly variable. The LENS™ process was employed in this research to deposit a relatively thick tungsten cladding on squeeze pins. An advantage of this process was that the process parameters could be precisely controlled in order to produce a satisfactory cladding. Two fixtures were designed and constructed to enable the end and outer diameter (OD) of the squeeze pins to be clad. Analyses were performed on the clad pins to evaluate the microstructure and chemical composition of the tungsten cladding and the cladding-H13 substrate interface. A thermo-mechanical finite element analysis (FEA) was performed to assess the stress distribution as a function of cladding thickness on the pins during a typical casting thermal cycle. FEA results were validated via a physical test, where the clad squeeze pins were immersed into molten aluminum. Pins subjected to the test were evaluated for thermally induced cracking and resistance to soldering of the tungsten cladding.

  3. Finite element analysis of laser engineered net shape (LENSTM) tungsten clad squeeze pins

    International Nuclear Information System (INIS)

    Sakhuja, Amit; Brevick, Jerald R.

    2004-01-01

    In the aluminum high-pressure die-casting and indirect squeeze casting processes, local 'squeeze' pins are often used to minimize internal solidification shrinkage in heavy casting sections. Squeeze pins frequently fail in service due to molten aluminum adhering to the H13 tool steel pins ('soldering'). A wide variety of coating materials and methods have been developed to minimize soldering on H13. However, these coatings are typically very thin, and experience has shown their performance on squeeze pins is highly variable. The LENS TM process was employed in this research to deposit a relatively thick tungsten cladding on squeeze pins. An advantage of this process was that the process parameters could be precisely controlled in order to produce a satisfactory cladding. Two fixtures were designed and constructed to enable the end and outer diameter (OD) of the squeeze pins to be clad. Analyses were performed on the clad pins to evaluate the microstructure and chemical composition of the tungsten cladding and the cladding-H13 substrate interface. A thermo-mechanical finite element analysis (FEA) was performed to assess the stress distribution as a function of cladding thickness on the pins during a typical casting thermal cycle. FEA results were validated via a physical test, where the clad squeeze pins were immersed into molten aluminum. Pins subjected to the test were evaluated for thermally induced cracking and resistance to soldering of the tungsten cladding

  4. Liquid-metal pin-fin pressure drop by correlation in cross flow

    International Nuclear Information System (INIS)

    Wang, Zhibi; Kuzay, T.M.; Assoufid, L.

    1994-01-01

    The pin-fin configuration is widely used as a heat transfer enhancement method in high-heat-flux applications. Recently, the pin-fin design with liquid-metal coolant was also applied to synchrotron-radiation beamline devices. This paper investigates the pressure drop in a pin-post design beamline mirror with liquid gallium as the coolant. Because the pin-post configuration is a relatively new concept, information in literature about pin-post mirrors or crystals is rare, and information about the pressure drop in pin-post mirrors with liquid metal as the coolant is even more sparse. Due to this the authors considered the cross flow in cylinder-array geometry, which is very similar to that of the pin-post, to examine the pressure drop correlation with liquid metals over pin fins. The cross flow of fluid with various fluid characteristics or properties through a tube bank was studied so that the results can be scaled to the pin-fin geometry with liquid metal as the coolant. Study lead to two major variables to influence the pressure drop: fluid properties, viscosity and density, and the relative length of the posts. Correlation of the pressure drop between long and short posts and the prediction of the pressure drop of liquid metal in the pin-post mirror and comparison with an existing experiment are addressed

  5. Displaced humeral lateral condyle fractures in children: should we bury the pins?

    Science.gov (United States)

    Das De, Soumen; Bae, Donald S; Waters, Peter M

    2012-09-01

    The purpose of this investigation was to determine if leaving Kirschner wires exposed is more cost-effective than burying them subcutaneously after open reduction and internal fixation (ORIF) of humeral lateral condyle fractures. A retrospective cohort study of all lateral condyle fractures treated over a 10-year period at a single institution was performed. Data on surgical technique, fracture healing, and complications were analyzed, as well as treatment costs. A decision analysis model was then constructed to compare the strategies of leaving the pins exposed versus buried. Finally, sensitivity analyses were performed, assessing cost-effectiveness when infection rates and costs of treating deep infections were varied. A total of 235 children with displaced fractures were treated with ORIF using Kirschner wires. Pins were left exposed in 41 cases (17.4%) and buried in 194 cases (82.6%); the age, sex, injury mechanisms, and fracture patterns were similar in both the groups. The median time to removal of implants was shorter with exposed versus buried pins (4 vs. 6 wk, Pfracture union or loss of reduction rates. The rate of superficial infection was higher with exposed pins (9.8% vs. 3.1%), but this was not statistically significant (P=0.076). There were no deep infections with exposed pins, whereas the rate of deep infection was 0.5% with buried pins (P=1.00). Buried pins were associated with additional complications, including symptomatic implants (7.2%); pins protruding through the skin (16%); internal pin migration necessitating additional surgery (1%); and skin necrosis (1%). The decision analysis revealed that leaving pins exposed resulted in an average cost savings of $3442 per patient. This strategy remained cost-effective even when infection rates with exposed pins approached 40%. Leaving the pins exposed after ORIF of lateral condyle fractures is safe and more cost-effective than burying the pins subcutaneously. Retrospective cohort study (level III).

  6. Identification of C-geranylated flavonoids from Paulownia catalpifolia Gong Tong fruits by HPLC-DAD-ESI-MS/MS and their anti-aging effects on 2BS cells induced by H2O2.

    Science.gov (United States)

    Tang, Wen-Zhao; Wang, Ying-Ai; Gao, Tian-Yang; Wang, Xiao-Jing; Zhao, Yun-Xue

    2017-05-01

    The fruits of Paulownia catalpifolia Gong Tong are used as a Chinese folk herbal medicine for the treatment of enteritis, tonsillitis, bronchitis, and dysentery, etc. Our previous study has identified new C-geranylated flavanones with obvious anti-proliferative effects in lung cancer A549 cells. In the present study, a new C-geranylated flavone, paucatalinone C (1) and five known C-geranylated flavanones (2-6) were isolated. In addition, a total of 34 C-geranylated flavonoids were detected by HPLC-DAD-ESI-MS/MS coupling techniques from the CH 2 Cl 2 extract of P. catalpifolia. Futhermore, anti-aging effects of isolated compounds were evaluated in vitro with premature senescent 2BS cells induced by H 2 O 2 . Phytochemical results indicated that P. catalpifolia was a natural resource of abundant C-geranylated flavonoids. Diplacone (3) and paucatalinone A (5) were the potent anti-aging agents in the premature senescent 2BS cells induced by H 2 O 2 and the C-geranyl substituent may be an important factor because of its lipophilic character. Copyright © 2017 China Pharmaceutical University. Published by Elsevier B.V. All rights reserved.

  7. Magnetic relaxation, flux pinning and critical currents in superconductors

    International Nuclear Information System (INIS)

    Lichtenberger, K.S.

    1991-01-01

    A systematic study of the magnetic flux pinning properties in superconductors has been undertaken in an attempt to understand the differences between the flux creep behavior of classical superconductors and high-temperature superconductors (HTSC's). In HTSC's, the ratio of the effective flux pinning energy to the thermal energy, U 0 /kT, is much smaller than that of conventional superconductors, often approaching unity. This results in much larger creep rates in HTSC's than in conventional superconductors. It is necessary to find suitable models that describe flux creep in both classical superconductors and HTSC's. Results show that while these two classes of materials are quantitatively very different, a single pinning barrier mode adequately describes both, within the proper region of the H-T plane. The model is applied to a variety of superconductors and the results are contrasted. Although the H-T plane appears to be very different HTSC's than for conventional superconductors, qualitatively the same physics describes both. In HTSC's, near the upper critical field there exists a relatively wide region of superconducting fluctuations, followed successively by regions of thermodynamic reversibility, thermally assisted flux, flux creep, and finally rigid flux lattice where little, if any, motion of the flux lattice occurs. All of these regions are also present in conventional superconductors, but often much more difficult, especially the irreversibility transition and the fluctuation region. The central finding of the flux creep analysis is that the region of flux creep is defined as a band in the H-T plane in which 2 ≤ U 0 /kT ≤ 100, and that the flux creep model applies best within this band

  8. Progress on DEMO blanket attachment concept with keys and pins

    International Nuclear Information System (INIS)

    Vizvary, Zsolt; Iglesias, Daniel; Cooper, David; Crowe, Robert; Riccardo, Valeria

    2015-01-01

    Highlights: • DEMO blanket attachment system with keys and pins (without using bolts). • Blanket segments are preloaded by progressively designed springs. • Blanket back plate flexibility has a major impact on spring design. • Mechanical analysis of other components indicates no unresolvable issues. • Thermal analysis indicates acceptable temperatures for the support system. - Abstract: The blanket attachment has to cope with gravity, thermal and electromagnetic loads, also it has to be installed and serviced by remote handling. Pre-stressed components suffer from stress relaxation in irradiated environments such as DEMO. To circumvent this problem pre-stressed component should be either avoided or shielded, and where possible keys and pins should be used. This strategy has been proposed for the DEMO multi-module segments (MMS). The blanket segments are held by two tapered keys each, designed to allow thermal expansions while providing contact with the vacuum vessel and to resist the poloidal and radial moments the latter being dominant at 9.1 MNm inboard and 15 MNm outboard. On the top of the blanket segment there is a pin which provides vertical support. At the bottom another vertical support has to lock them in position after installation and manage the pre-load on the segments. The pre-load is required to deal with the electromagnetic loads during disruption. This is provided by a set of springs, which require shielding as they are preloaded. These are sized to cope with the force (3 MN inboard, 1.4 MN outboard) due to halo currents and the toroidal moment which can reverse. Calculations show that the flexibility of the blanket segment itself plays a significant role in defining the required support system. The blanket segment acts as a preloaded spring and it has to be part of the attachment design as well.

  9. Spatial chaotic behavior of vortices in type-II superconductors with different pinning strength

    International Nuclear Information System (INIS)

    Lin, H.-T.; Pan, M.; Cheng, C.H.; Cui, Y.J.; Zhao, Y.

    2008-01-01

    Spatial chaotic character in systems where defects are arranged in periodic arrays has been investigated by computer simulation. Due to the high nonlinearity of the vortex-defect interaction, arrangement of the vortices in a periodic pinning array can be chaotic (glassy), depending on the vortex-defect interaction state and vortex-vortex interaction. Two types of disordered vortex states in the system are observed. The type-I disorder arises from the intrinsically chaotic nature of the nonlinear system, existing when the pinning disorder is low and the pinning strength is weak. The type-II disordered state is related to the pinning disorder, which is dominating when both the pinning disorder and the pinning strength are strong

  10. Tips Under the Skin: A Simple Modification of Extension Block Pinning for Mallet Fractures.

    Science.gov (United States)

    Shin, Seung-Han; Lee, Yong-Suk; Kang, Jin-Woo; Kang, Wonwoo; Chung, Yang-Guk

    2018-03-01

    Pins exposed out of the skin after surgery for mallet fractures keep patients from washing their hands. The authors buried the tips of all pins under the skin while performing extension block pinning for 14 patients with mallet fractures. The patients were allowed to wash their hands 4 to 5 days postoperatively, without any dressing or splinting. The pins were removed at a mean of 8 weeks postoperatively. Solid union was achieved in all 14 fractures. No pull-out or subsidence of the pin was observed. No patient developed infection or other pin-related complications. Mean extension lag at final follow-up was 4°. [Orthopedics. 2018; 41(2):e299-e302.]. Copyright 2018, SLACK Incorporated.

  11. Physics evaluation for testino. of RAPS and TAPS fuel pins in CIRUS pressurised water loop

    International Nuclear Information System (INIS)

    John, Benjamin; Paul, O.P.K.

    1976-01-01

    Relevant calculations carried out to assess the reactivity effect, heat generation and other parameters for testing of RAPS and TAPS fuel pins in the Cirus pressurised water loop are summarised. The Cirus neutron flux level being low, in order to simulate the RAPS design heat rating of ∫ Kdtheta = 40 w/cm, the required plutonium enrichment in mixed plutonium uranium oxide fuel pin was worked out. The results showed that a PuO 2 enrichment of 1.5 wt percent would be necessary to meet the above requirement. The analysis for the TAPS pin indicated that the desired heat flux of 115w/cm 2 cannot be obtained in the Cirus loop with either a 7 pin cluster geometry, or with a single pin with the enrichment level as used in TAPS pin. Lattice code DUMLAC and the core simulation code AECLHEX were used for these studies. (author)

  12. Spatial chaotic behavior of vortices in type-II superconductors with different pinning strength

    Energy Technology Data Exchange (ETDEWEB)

    Lin, H.-T. [Faculty of Information Management, Cheng Shui University, Taiwan (China); Pan, M. [Key Laboratory of Magnetic Levitation Technologies and Maglev Trains, Ministry of Education of China, Superconductivity R and D Center, Southwest Jiaotong University, Chengdu, Sichuan 610031 (China); Cheng, C.H. [Key Laboratory of Magnetic Levitation Technologies and Maglev Trains, Ministry of Education of China, Superconductivity R and D Center, Southwest Jiaotong University, Chengdu, Sichuan 610031 (China); School of Materials Science and Engineering, University of New South Wales, Sydney (Australia); Cui, Y.J. [Key Laboratory of Magnetic Levitation Technologies and Maglev Trains, Ministry of Education of China, Superconductivity R and D Center, Southwest Jiaotong University, Chengdu, Sichuan 610031 (China); Zhao, Y. [Key Laboratory of Magnetic Levitation Technologies and Maglev Trains, Ministry of Education of China, Superconductivity R and D Center, Southwest Jiaotong University, Chengdu, Sichuan 610031 (China); School of Materials Science and Engineering, University of New South Wales, Sydney (Australia)], E-mail: yzhao@swjtu.edu.cn

    2008-09-15

    Spatial chaotic character in systems where defects are arranged in periodic arrays has been investigated by computer simulation. Due to the high nonlinearity of the vortex-defect interaction, arrangement of the vortices in a periodic pinning array can be chaotic (glassy), depending on the vortex-defect interaction state and vortex-vortex interaction. Two types of disordered vortex states in the system are observed. The type-I disorder arises from the intrinsically chaotic nature of the nonlinear system, existing when the pinning disorder is low and the pinning strength is weak. The type-II disordered state is related to the pinning disorder, which is dominating when both the pinning disorder and the pinning strength are strong.

  13. Pin cell discontinuity factors in the transient 3-D discrete ordinates code TORT-TD - 237

    International Nuclear Information System (INIS)

    Seubert, A.

    2010-01-01

    This paper describes the application of generalized equivalence theory to the time-dependent 3-D discrete ordinates neutron transport code TORT-TD. The introduction of pin cell discontinuity factors into the discrete ordinates transport equation is described by assuming a linear dependence of the homogenized neutron angular flux within a pin cell which may be discontinuous at the interfaces to adjacent cells. The homogenized flux discontinuity at cell interfaces is expressed by pin cell discontinuity factors which in turn are determined from fuel assembly lattice calculations using HELIOS. Application of TORT-TD to the all rods in state of the PWR MOX/UO 2 Core Transient Benchmark with pin cell homogenized nuclear cross sections demonstrate the potential of pin cell discontinuity factors to reduce pin cell homogenization errors. (authors)

  14. Novel pinning control strategies for synchronisation of complex networks with nonlinear coupling dynamics

    International Nuclear Information System (INIS)

    Zhao-Bing, Liu; Hua-Guang, Zhang; Qiu-Ye, Sun

    2010-01-01

    This paper considers the global stability of controlling an uncertain complex network to a homogeneous trajectory of the uncoupled system by a local pinning control strategy. Several sufficient conditions are derived to guarantee the network synchronisation by investigating the relationship among pinning synchronisation, network topology, and coupling strength. Also, some fundamental and yet challenging problems in the pinning control of complex networks are discussed: (1) what nodes should be selected as pinned candidates? (2) How many nodes are needed to be pinned for a fixed coupling strength? Furthermore, an adaptive pinning control scheme is developed. In order to achieve synchronisation of an uncertain complex network, the adaptive tuning strategy of either the coupling strength or the control gain is utilised. As an illustrative example, a network with the Lorenz system as node self-dynamics is simulated to verify the efficacy of theoretical results. (general)

  15. Evaluation of integrally finned cladding for LMFBR fuel pins

    International Nuclear Information System (INIS)

    Cantley, D.A.; Sutherland, W.H.

    1975-01-01

    An integral fin design effectively reduces the coolant temperature gradients within an LMFBR subassembly by redistributing coolant flow so as to reduce the maximum cladding temperature and increase the duct wall temperature. The reduced cladding temperatures are offset by strain concentrations resulting from the fin geometry, so there is little net effect on predicted fuel pin performance. The increased duct wall temperatures, however, significantly reduce the duct design lifetime so that the final conclusion is that the integral fin design is inferior to the standard wire wrap design. This result, however, is dependent upon the material correlations used. Advanced alloys with improved irradiation properties could alter this conclusion

  16. Axial gap formation in P.W.R. fuel pins

    International Nuclear Information System (INIS)

    Roberts, G.; Jones, K.W.

    1978-07-01

    The potential mechanisms of axial gap formation in PWR fuel pins are examined analytically and also using evidence from post-irradiation examination (p.i.e.) investigation. It is concluded that fuel and cladding cannot remain in contact during densification and so the settling of of the fuel stack, which forms the gaps, must be prevented by such things as asperities in the cladding, fuel chips or tilted pellets. Examples from the p.i.e. examination programme are used to support this conclusion. (author)

  17. Strain scaling law for flux pinning in practical superconductors

    International Nuclear Information System (INIS)

    Ekin, J.W.

    1980-01-01

    Detailed experimental data are reported on the critical current and pinning force density of a number of different Nb 3 Sn conductors measured over an extensive range of magnetic fields and strain. Strain scaling in terms of the upper-critical field as scaling parameter is tested and a strain scaling relation formulated. This is compared with the data and its application to practical conductors described. The relation between this strain scaling law and the usual temperature scaling law is discussed and an empirical expression is obtained unifying the two. (U.K.)

  18. Onset of bulk pinning in BSCCO single crystals

    Science.gov (United States)

    van der Beek, C. J.; Indenbom, M. V.; Berseth, V.; Li, T. W.; Benoit, W.

    1996-11-01

    The long growth defects often found in Bi2Sr2CaCu2O8, “single” crystals effectively weaken the geometrical barrier and lower the field of first flux penetration. This means that the intrinsic (bulk) magnetic properties can be more easily accessed using magnetic measurements. Thus, the onset of strong bulk flux pinning in the sample bulk is determined to lie at T ≈ 40 K, indepedent of whether the field strength is above or below the field of the second peak in the magnetisation.

  19. Accurate analysis of pins irradiated in fast neutron reactors

    International Nuclear Information System (INIS)

    Regnaud, F.; Guichard, C.

    1976-01-01

    A device was developed for the chemical analysis of fissile materials in a whole fuel pin in order to determine U and Pu with an accuracy of about 0.1% in samples from 100 to 200g, irradiated at burn-up between 50 and 100.000MWd/t. This unit is provided with two shielded α hot cells. A dissolving device was developed which enables the dissolution of residues. Pu is determined by oxydation-reduction titration and U by the isotopic dilution method [fr

  20. FFTF fuel pin design procedure verification for transient operation

    International Nuclear Information System (INIS)

    Baars, R.E.

    1975-05-01

    The FFTF design procedures for evaluating fuel pin transient performance are briefly reviewed, and data where available are compared with design procedure predictions. Specifically, burst conditions derived from Fuel Cladding Transient Tester (FCTT) tests and from ANL loss-of-flow tests are compared with burst pressures computed using the design procedure upon which the cladding integrity limit was based. Failure times are predicted using the design procedure for evaluation of rapid reactivity insertion accidents, for five unterminated TREAT experiments in which well characterized fuel failures were deliberately incurred. (U.S.)

  1. Etat des lieux et perspectives du pin sylvestre en Wallonie

    OpenAIRE

    Thibaut, K.; Colson, Vincent; Lecomte, H.; Claessens, Hugues

    2007-01-01

    Si le pin sylvestre fut l’un des pionniers de la reforestation de nos contrées, l’engouement qu’il suscita au XIXe siècle semble aujourd’hui bien retombé. À travers l’analyse de la ressource disponible et d’une rapide enquête auprès des cantonnements de la DNF, l’article propose un état des lieux de cette essence et discute de ses perspectives dans le contexte actuel.

  2. Improving tribological and anti-bacterial properties of titanium external fixation pins through surface ceramic conversion.

    Science.gov (United States)

    Dong, Huan; Mukinay, Tatiana; Li, Maojun; Hood, Richard; Soo, Sein Leung; Cockshott, Simon; Sammons, Rachel; Li, Xiaoying

    2017-01-01

    In this study, an advanced ceramic conversion surface engineering technology has been applied for the first time to self-drilling Ti6Al4V external fixation pins to improve their performance in terms of biomechanical, bio-tribological and antibacterial properties. Systematic characterisation of the ceramic conversion treated Ti pins was carried out using Scanning electron microscope, X-ray diffraction, Glow-discharge optical emission spectroscopy, nano- and micro-indentation and scratching; the biomechanical and bio-tribological properties of the surface engineered Ti pins were evaluated by insertion into high density bone simulation material; and the antibacterial behaviour was assessed with Staphylococcus aureus NCTC 6571. The experimental results have demonstrated that the surfaces of Ti6Al4V external fixation pins were successfully converted into a TiO 2 rutile layer (~2 μm in thickness) supported by an oxygen hardened case (~15 μm in thickness) with very good bonding due to the in-situ conversion nature. The maximum insertion force and temperature were reduced from 192N and 31.2 °C when using the untreated pins to 182N and 26.1 °C when the ceramic conversion treated pins were tested. This is mainly due to the significantly increased hardness (more than three times) and the effectively enhanced wear resistance of the cutting edge of the self-drilling Ti pins following the ceramic conversion treatment. The antibacterial tests also revealed that there was a significantly reduced number of bacteria isolated from the ceramic conversion treated pins compared to the untreated pins of around 50 % after 20 h incubation, P < 0.01 (0.0024). The results reported are encouraging and could pave the way towards high-performance anti-bacterial titanium external fixation pins with reduced pin-track infection and pin loosing.

  3. The PIN1 family gene PvPIN1 is involved in auxin-dependent root emergence and tillering in switchgrass

    Directory of Open Access Journals (Sweden)

    Kaijie Xu

    2016-03-01

    Full Text Available Abstract Switchgrass (Panicum virgatum L.; family Poaceae is a warm-season C4 perennial grass. Tillering plays an important role in determining the morphology of aboveground parts and the final biomass yield of switchgrass. Auxin distribution in plants can affect a variety of important growth and developmental processes, including the regulation of shoot and root branching, plant resistance and biological yield. Auxin transport and gradients in plants are mediated by influx and efflux carriers. PvPIN1, a switchgrass PIN1-like gene that is involved in regulating polar transport, is a putative auxin efflux carrier. Neighbor-joining analysis using sequences deposited in NCBI databases showed that the PvPIN1gene belongs to the PIN1 family and is evolutionarily closer to the Oryza sativa japonica group. Tiller emergence and development was significantly promoted in plants subjected toPvPIN1 RNA interference (RNAi, which yielded a phenotype similar to that of wild-type plants treated with the auxin transport inhibitor TIBA (2,3,5-triiodobenzoic acid. A transgenic approach that inducedPvPIN1 gene overexpression or suppression altered tiller number and the shoot/root ratio. These data suggest that PvPIN1plays an important role in auxin-dependent adventitious root emergence and tillering.

  4. Investigation on Bond-Slip Behavior of Z-Pin Interfaces in X-Cor® Sandwich Structures Using Z-Pin Pull-Out Test

    Science.gov (United States)

    Shan, Hangying; Xiao, Jun; Chu, Qiyi

    2018-05-01

    The Z-Pin interfacial bond properties play an important role in the structural performance of X-Cor® sandwich structures. This paper presents an experimental investigation on bond-slip behavior of Z-Pin interfaces using Z-Pin pull-out test. Based on the experimental data the whole Z-Pin pull-out process consists of three stages: initial bonding, debonding and frictional sliding. Comparative experimental study on the influence of design parameters on bond-slip behavior of Z-Pin interfaces has also been performed. Numerical analyses were conducted with the ABAQUS finite element (FE) program to simulate the Z-Pins bond-slip response of the pull-out test. The Z-Pins interfacial bond-slip behavior was implemented using nonlinear spring elements characterized with the constitutive relation from experimental results. Numerical results were validated by comparison with experimental data, and reasonably good agreement was achieved between experimental and analytical pull-out force-slip curves.

  5. Functionally different PIN proteins control auxin flux during bulbil development in Agave tequilana.

    Science.gov (United States)

    Abraham Juárez, María Jazmín; Hernández Cárdenas, Rocío; Santoyo Villa, José Natzul; O'Connor, Devin; Sluis, Aaron; Hake, Sarah; Ordaz-Ortiz, José; Terry, Leon; Simpson, June

    2015-07-01

    In Agave tequilana, reproductive failure or inadequate flower development stimulates the formation of vegetative bulbils at the bracteoles, ensuring survival in a hostile environment. Little is known about the signals that trigger this probably unique phenomenon in agave species. Here we report that auxin plays a central role in bulbil development and show that the localization of PIN1-related proteins is consistent with altered auxin transport during this process. Analysis of agave transcriptome data led to the identification of the A. tequilana orthologue of PIN1 (denoted AtqPIN1) and a second closely related gene from a distinct clade reported as 'Sister of PIN1' (denoted AtqSoPIN1). Quantitative real-time reverse transcription-PCR (RT-qPCR) analysis showed different patterns of expression for each gene during bulbil formation, and heterologous expression of the A. tequilana PIN1 and SoPIN1 genes in Arabidopsis thaliana confirmed functional differences between these genes. Although no free auxin was detected in induced pedicel samples, changes in the levels of auxin precursors were observed. Taken as a whole, the data support the model that AtqPIN1 and AtqSoPIN1 have co-ordinated but distinct functions in relation to auxin transport during the initial stages of bulbil formation. © The Author 2015. Published by Oxford University Press on behalf of the Society for Experimental Biology.

  6. Enquiry into the Topology of Plasma Membrane-Localized PIN Auxin Transport Components.

    Science.gov (United States)

    Nodzyński, Tomasz; Vanneste, Steffen; Zwiewka, Marta; Pernisová, Markéta; Hejátko, Jan; Friml, Jiří

    2016-11-07

    Auxin directs plant ontogenesis via differential accumulation within tissues depending largely on the activity of PIN proteins that mediate auxin efflux from cells and its directional cell-to-cell transport. Regardless of the developmental importance of PINs, the structure of these transporters is poorly characterized. Here, we present experimental data concerning protein topology of plasma membrane-localized PINs. Utilizing approaches based on pH-dependent quenching of fluorescent reporters combined with immunolocalization techniques, we mapped the membrane topology of PINs and further cross-validated our results using available topology modeling software. We delineated the topology of PIN1 with two transmembrane (TM) bundles of five α-helices linked by a large intracellular loop and a C-terminus positioned outside the cytoplasm. Using constraints derived from our experimental data, we also provide an updated position of helical regions generating a verisimilitude model of PIN1. Since the canonical long PINs show a high degree of conservation in TM domains and auxin transport capacity has been demonstrated for Arabidopsis representatives of this group, this empirically enhanced topological model of PIN1 will be an important starting point for further studies on PIN structure-function relationships. In addition, we have established protocols that can be used to probe the topology of other plasma membrane proteins in plants. Copyright © 2016 The Authors. Published by Elsevier Inc. All rights reserved.

  7. Research on Pin Tumbler Locks and the Characteristics of Surface Traces Formed by Unlocking Guns

    Science.gov (United States)

    Yi, Gao; Yifeng, Jin; Yanping, Bai; Hongcheng, Mei; Zhen, Xu

    2018-02-01

    In this paper, taking the structure of the pin tumbler locks and the principle of opening and closing locks as breakthrough point, we have studied the machining traces of pin tumbler components and trace characters of pin surface during normal operating. At the same time, taking the unlocking gun as an example, the paper analyzes the unlocking technology and the formation of traces, and summarizes the changing rules of the surface traces of elastic bead locks by comparing the positions and the characteristics of the traces, which provides technical support for the future study of traces of pin tumbler locks.

  8. Nominal power density analysis of thermoelectric pins with non-constant cross sections

    International Nuclear Information System (INIS)

    Shi, Yaoguang; Mei, Deqing; Yao, Zhehe; Wang, Yancheng; Liu, Haiyan; Chen, Zichen

    2015-01-01

    Highlights: • Nominal power density of TEGs with non-constant cross sections pins is analyzed. • An analytical model of nominal power density (NPD) is developed. • Influences of shape parameter on NPD for different geometric pins are investigated. • Effects of dimensionless efficiency and the temperature ratio on NPD are examined. - Abstract: The investigation of the geometric structure of TEG (thermoelectric generator) pins is essential, as their geometry determines the performance of devices. In this study, nominal power density (NPD) is used to find a better geometric structure of thermoelectric pins of TEGs, since a comparison of maximum dimensionless efficiencies for different geometric pins cannot be used to identify the optimum geometry. The influence of shape parameter on NPD for TEG pins in linear, quadratic and exponential cross-sectional functions is studied. The NPD decreases when the shape parameter increases for different geometric pins, while the maximum values of NPD are the same. Then, the effects of dimensionless efficiency and the temperature ratio on the NPD are analyzed. The NPD decreases with the increase in dimensionless efficiency and temperature ratio. Pins with linear variation in cross section have the highest NPD among the three geometries of pins evaluated

  9. Peptidyl Prolyl Isomerase PIN1 Directly Binds to and Stabilizes Hypoxia-Inducible Factor-1α.

    Directory of Open Access Journals (Sweden)

    Hyeong-Jun Han

    Full Text Available Peptidyl prolyl isomerase (PIN1 regulates the functional activity of a subset of phosphoproteins through binding to phosphorylated Ser/Thr-Pro motifs and subsequently isomerization of the phosphorylated bonds. Interestingly, PIN1 is overexpressed in many types of malignancies including breast, prostate, lung and colon cancers. However, its oncogenic functions have not been fully elucidated. Here, we report that PIN1 directly interacts with hypoxia-inducible factor (HIF-1α in human colon cancer (HCT116 cells. PIN1 binding to HIF-1α occurred in a phosphorylation-dependent manner. We also found that PIN1 interacted with HIF-1α at both exogenous and endogenous levels. Notably, PIN1 binding stabilized the HIF-1α protein, given that their levels were significantly increased under hypoxic conditions. The stabilization of HIF-1α resulted in increased transcriptional activity, consequently upregulating expression of vascular endothelial growth factor, a major contributor to angiogenesis. Silencing of PIN1 or pharmacologic inhibition of its activity abrogated the angiogenesis. By utilizing a bioluminescence imaging technique, we were able to demonstrate that PIN1 inhibition dramatically reduced the tumor volume in a subcutaneous mouse xenograft model and angiogenesis as well as hypoxia-induced transcriptional activity of HIF-1α. These results suggest that PIN1 interacting with HIF-1α is a potential cancer chemopreventive and therapeutic target.

  10. Flux pinning by voids in surface-oxidized superconducting niobium and vanadium

    International Nuclear Information System (INIS)

    Meij, G.P. van der.

    1984-03-01

    The volume pinning force in several niobium and vanadium samples with voids is determined at various temperatures. Reasonable agreement is found with the collective pinning theory of Larkin and Ovchinnikov above the field of maximum pinning, if the flux line lattice is assumed to be amorphous in this region and if the elementary pinning force is calculated from the quasi-classical theory of Thuneberg, Kurkijaervi, and Rainer. Also some history and relaxation effects are studied in an alternating field. A qualitative explanation is given in terms of flux line dislocations, which reduce the shear strength of the flux line lattice. (Auth.)

  11. Study of fuel bundle geometry on inter subchannel flow in a 19 pin wire wrapped bundle

    International Nuclear Information System (INIS)

    Naveen Raj, M.; Velusamy, D.K.

    2015-01-01

    In typical sodium cooled fast reactor (SFR) fuel pin bundle, gap between the pins is maintained by helically wound wire wrap around each pin. The presence of wire induces large inter-subchannel transverse flow, eventually promoting mixing and heat transfer. The magnitude of the transverse flow is highly dependent on the various pin-bundle dimensions. Appropriate modeling of these transverse flows in subchannel codes is necessary to predict realistic temperature distribution in pin bundle. Hence, detailed parametric study of transverse flow on pin-bundle geometric parameters has been conducted. The parameters taken for the present study are pin diameter, wire diameter, helical wire pitch and edge gap. Towards this 3-D computational fluid dynamic analysis on a structured mesh of 19 pin bundle is carried out using k-epsilon turbulence model. Periodic oscillations along the primacy flow direction were found in subchannel transverse flow and peripheral pin clad temperatures with periodicity over one pitch length. Based on parametric studies, correlations for transverse flow in central subchannels are proposed. (author)

  12. Comparative analysis of different methods of modelling of most loaded fuel pin in transients

    International Nuclear Information System (INIS)

    Ovdiyenko, Y.; Khalimonchuk, V.; Ieremenko, M.

    2007-01-01

    Different methods of modeling of most loaded fuel pin are presented at the work. Calculation studies are performed on example of accident related to WWER-1000 cluster rod ejection with using of spatial kinetic code DYN3D that uses nodal method to calculate distribution of neutron flux in the core. Three methods of modeling of most loaded fuel pin are considered - flux reconstruction in fuel macrocell, pin-by-pin calculation by using of DYN3D/DERAB package and by introducing of additional 'hot channel'. Obtained results of performed studies could be used for development of calculation kinetic models during preparing of safety analysis report (Authors)

  13. A model of high-rate indentation of a cylindrical striking pin into a deformable body

    Science.gov (United States)

    Zalazinskaya, E. A.; Zalazinsky, A. G.

    2017-12-01

    Mathematical modeling of an impact and high-rate indentation to a significant depth of a flat-faced hard cylindrical striking pin into a massive deformable target body is carried out. With the application of the kinematic extreme theorem of the plasticity theory and the kinetic energy variation theorem, the phase trajectories of the striking pin are calculated, the initial velocity of the striking pin in the body, the limit values of the inlet duct length, and the depth of striking pin penetration into the target are determined.

  14. Tailoring the vortex pinning strength of YBCO thin films by systematic incorporation of hybrid artificial pinning centers

    International Nuclear Information System (INIS)

    Jha, Alok K; Matsumoto, Kaname; Horide, Tomoya; Saini, Shrikant; Mele, Paolo; Ichinose, Ataru; Yoshida, Yutaka; Awaji, Satoshi

    2015-01-01

    The effect of hybrid (columnar and spherical together) artificial pinning centers (APCs) on the vortex pinning properties of YBa 2 Cu 3 O 7−δ (YBCO) thin films is investigated in detail on the basis of variation of critical current density (J C ) with applied magnetic field and also with the orientation of the applied magnetic field at 65 K and 77 K. Premixed YBCO + BaSnO 3 composite targets are used for the deposition of the YBCO films which consist of self-assembled BaSnO 3 nanocolumns (1D APCs); on the other hand, for the deposition of the YBCO films with hybrid APCs (BaSnO 3 nanocolumns together with Y 2 O 3 nanoparticles), the surface of the premixed YBCO + BaSnO 3 composite targets are modified by putting a thin Y 2 O 3 sectored piece on the premixed YBCO + BaSnO 3 composite targets by means of silver paste. F pmax value increases systematically with incorporation of 1D and 1D and 3D APCs and it also shifts towards higher applied magnetic fields. Films with 1D APCs exhibit a strong J C peak at Θ = 0° (H//c-axis) whereas films consisting of hybrid APCs exhibit enhanced J C at all the investigated angular regimes. A possible mechanism of vortex pinning in samples with hybrid APCs is also discussed suggesting the role of 1D and 3D APCs. (paper)

  15. International experience with the bundle behavior of fuel elements of sodium cooled reactors; derivation of a figure of merit for the judgement of fuel pin bundle parameters with respect to abrasion due to thermoelastic pin-pin interaction

    International Nuclear Information System (INIS)

    Toebbe, H.

    1987-10-01

    The report describes the status of experience with respect to the abrasion behavior of bundles in standard fuel elements and test elements with wire or grid spacing in the reactors Rapsodie fortissimo, Phenix, DFR, PFR, EBR-II, FFTF, JOYO and KNK II. With the help of simple considerations concerning thermoelastic pin-pin interactions a figure of merit is deduced from the different bundle parameters, which allows a comparative judgement of the parameters of different bundle concepts [de

  16. Test of Shi et al. Method to Infer the Magnetic Reconnection Geometry from Spacecraft Data: MHD Simulation with Guide Field and Antiparallel Kinetic Simulation

    Science.gov (United States)

    Denton, R.; Sonnerup, B. U. O.; Swisdak, M.; Birn, J.; Drake, J. F.; Heese, M.

    2012-01-01

    When analyzing data from an array of spacecraft (such as Cluster or MMS) crossing a site of magnetic reconnection, it is desirable to be able to accurately determine the orientation of the reconnection site. If the reconnection is quasi-two dimensional, there are three key directions, the direction of maximum inhomogeneity (the direction across the reconnection site), the direction of the reconnecting component of the magnetic field, and the direction of rough invariance (the "out of plane" direction). Using simulated spacecraft observations of magnetic reconnection in the geomagnetic tail, we extend our previous tests of the direction-finding method developed by Shi et al. (2005) and the method to determine the structure velocity relative to the spacecraft Vstr. These methods require data from four proximate spacecraft. We add artificial noise and calibration errors to the simulation fields, and then use the perturbed gradient of the magnetic field B and perturbed time derivative dB/dt, as described by Denton et al. (2010). Three new simulations are examined: a weakly three-dimensional, i.e., quasi-two-dimensional, MHD simulation without a guide field, a quasi-two-dimensional MHD simulation with a guide field, and a two-dimensional full dynamics kinetic simulation with inherent noise so that the apparent minimum gradient was not exactly zero, even without added artificial errors. We also examined variations of the spacecraft trajectory for the kinetic simulation. The accuracy of the directions found varied depending on the simulation and spacecraft trajectory, but all the directions could be found within about 10 for all cases. Various aspects of the method were examined, including how to choose averaging intervals and the best intervals for determining the directions and velocity. For the kinetic simulation, we also investigated in detail how the errors in the inferred gradient directions from the unmodified Shi et al. method (using the unperturbed gradient

  17. Sensitive pre-amplifier to load for Pin diodes

    International Nuclear Information System (INIS)

    Jacobo V, R. Y.; Hernandez D, V.; Ramirez J, F. J.

    2013-10-01

    The electronic instrumentation is indispensable for the measurement and characterization of the radiation. By means of this essential characteristics of the radiation are determined, as activity and their energy components. The nuclear instrumentation is based on the technical characteristics of the radiation detectors and the electronic devices associates (amplifiers, ana logical and digital converters, multichannel analyzers, etc.) The radiation detectors are very important instruments in fields as the nuclear physics, medicine, radiological protection, industry and in other fields, since they are the only method to capture the radiation and to be able to quantify it in precise form. To detect radiation diverse detector types are used, as the semiconductor type, inside them are the photodiodes type Pin. In this work the results that were obtained of the design, simulation, construction and tests of a preamplifier that was designed starting from a photodiode type Pin are presented. The system was designed and simulated with a program for electronic circuits, in this were carried out many tests being obtained a compact design and achieving the best necessary characteristics for its optimization. With the results of the simulation phase the electronics phase was built, which was couples to a spectroscopic amplifier and a multichannel analyzer. The total of the system was evaluated analyzing its performance before a triple source of alphas. Of the tests phase we find that the system allows obtaining, in a multichannel analyzer, the pulses height spectrum, with a good resolution and with this was calibrated the multichannel analyzer

  18. Temperature dependent simulation of diamond depleted Schottky PIN diodes

    International Nuclear Information System (INIS)

    Hathwar, Raghuraj; Dutta, Maitreya; Chowdhury, Srabanti; Goodnick, Stephen M.; Koeck, Franz A. M.; Nemanich, Robert J.

    2016-01-01

    Diamond is considered as an ideal material for high field and high power devices due to its high breakdown field, high lightly doped carrier mobility, and high thermal conductivity. The modeling and simulation of diamond devices are therefore important to predict the performances of diamond based devices. In this context, we use Silvaco ® Atlas, a drift-diffusion based commercial software, to model diamond based power devices. The models used in Atlas were modified to account for both variable range and nearest neighbor hopping transport in the impurity bands associated with high activation energies for boron doped and phosphorus doped diamond. The models were fit to experimentally reported resistivity data over a wide range of doping concentrations and temperatures. We compare to recent data on depleted diamond Schottky PIN diodes demonstrating low turn-on voltages and high reverse breakdown voltages, which could be useful for high power rectifying applications due to the low turn-on voltage enabling high forward current densities. Three dimensional simulations of the depleted Schottky PIN diamond devices were performed and the results are verified with experimental data at different operating temperatures

  19. Temperature dependent simulation of diamond depleted Schottky PIN diodes

    Science.gov (United States)

    Hathwar, Raghuraj; Dutta, Maitreya; Koeck, Franz A. M.; Nemanich, Robert J.; Chowdhury, Srabanti; Goodnick, Stephen M.

    2016-06-01

    Diamond is considered as an ideal material for high field and high power devices due to its high breakdown field, high lightly doped carrier mobility, and high thermal conductivity. The modeling and simulation of diamond devices are therefore important to predict the performances of diamond based devices. In this context, we use Silvaco® Atlas, a drift-diffusion based commercial software, to model diamond based power devices. The models used in Atlas were modified to account for both variable range and nearest neighbor hopping transport in the impurity bands associated with high activation energies for boron doped and phosphorus doped diamond. The models were fit to experimentally reported resistivity data over a wide range of doping concentrations and temperatures. We compare to recent data on depleted diamond Schottky PIN diodes demonstrating low turn-on voltages and high reverse breakdown voltages, which could be useful for high power rectifying applications due to the low turn-on voltage enabling high forward current densities. Three dimensional simulations of the depleted Schottky PIN diamond devices were performed and the results are verified with experimental data at different operating temperatures

  20. Temperature dependent simulation of diamond depleted Schottky PIN diodes

    Energy Technology Data Exchange (ETDEWEB)

    Hathwar, Raghuraj; Dutta, Maitreya; Chowdhury, Srabanti; Goodnick, Stephen M. [Department of Electrical Engineering, Arizona State University, Tempe, Arizona 85287-8806 (United States); Koeck, Franz A. M.; Nemanich, Robert J. [Department of Physics, Arizona State University, Tempe, Arizona 85287-8806 (United States)

    2016-06-14

    Diamond is considered as an ideal material for high field and high power devices due to its high breakdown field, high lightly doped carrier mobility, and high thermal conductivity. The modeling and simulation of diamond devices are therefore important to predict the performances of diamond based devices. In this context, we use Silvaco{sup ®} Atlas, a drift-diffusion based commercial software, to model diamond based power devices. The models used in Atlas were modified to account for both variable range and nearest neighbor hopping transport in the impurity bands associated with high activation energies for boron doped and phosphorus doped diamond. The models were fit to experimentally reported resistivity data over a wide range of doping concentrations and temperatures. We compare to recent data on depleted diamond Schottky PIN diodes demonstrating low turn-on voltages and high reverse breakdown voltages, which could be useful for high power rectifying applications due to the low turn-on voltage enabling high forward current densities. Three dimensional simulations of the depleted Schottky PIN diamond devices were performed and the results are verified with experimental data at different operating temperatures.

  1. Alternatives for water basin spent fuel storage using pin storage

    International Nuclear Information System (INIS)

    Viebrock, J.M.; Carlson, R.W.

    1979-09-01

    The densest tolerable form for storing spent nuclear fuel is storage of only the fuel rods. This eliminates the space between the fuel rods and frees the hardware to be treated as non-fuel waste. The storage density can be as much as 1.07 MTU/ft 2 when racks are used that just satisfy the criticality and thermal limitations. One of the major advantages of pin storage is that it is compatible with existing racks; however, this reduces the storage density to 0.69 MTU/ft 2 . Even this is a substantial increase over the 0.39 MTU/ft 2 that is achievable with current high capacity stainless steel racks which have been selected as the bases for comparison. Disassembly requires extensive operation on the fuel assembly to remove the upper end fitting and to extract the fuel rods from the assembly skeleton. These operations will be performed with the aid of an elevator to raise the assembly where each fuel rod is grappled. Lowering the elevator will free the fuel rod for transfer to the storage canister. A storage savings of $1510 per MTU can be realized if the pin storage concept is incorporated at a new away-from-reactor facility. The storage cost ranges from $3340 to $7820 per MTU of fuel stored with the lower cost applying to storage at an existing away-from-reactor storage facility and the higher cost applying to at-reactor storage

  2. Pinning mode of integer quantum Hall Wigner crystal of skyrmions

    Science.gov (United States)

    Zhu, Han; Sambandamurthy, G.; Chen, Y. P.; Jiang, P.-H.; Engel, L. W.; Tsui, D. C.; Pfeiffer, L. N.; West, K. W.

    2009-03-01

    Just away from integer Landau level (LL) filling factors ν, the dilute quasi-particles/holes at the partially filled LL form an integer-quantum-Hall Wigner crystal, which exhibits microwave pinning mode resonances [1]. Due to electron-electron interaction, it was predicted that the elementary excitation around ν= 1 is not a single spin flip, but a larger-scale spin texture, known as a skyrmion [2]. We have compared the pinning mode resonances [1] of integer quantum Hall Wigner crystals formed in the partly filled LL just away from ν= 1 and ν= 2, in the presence of an in-plane magnetic field. As an in-plane field is applied, the peak frequencies of the resonances near ν= 1 increase, while the peak frequencies below ν= 2 show neligible dependence on in-plane field. We interpret this observation as due to a skyrmion crystal phase around ν= 1 and a single-hole Wigner crystal phase below ν= 2. The in-plane field increases the Zeeman gap and causes shrinking of the skyrmion size toward single spin flips. [1] Yong P. Chen et al., Phys. Rev. Lett. 91, 016801 (2003). [2] S. L. Sondhi et al., Phys. Rev. B 47, 16 419 (1993); L. Brey et al., Phys. Rev. Lett. 75, 2562 (1995).

  3. Hydrophobic pinning with copper nanowhiskers leads to bactericidal properties.

    Directory of Open Access Journals (Sweden)

    Ajay Vikram Singh

    Full Text Available The considerable morbidity associated with hospitalized patients and clinics in developed countries due to biofilm formation on biomedical implants and surgical instruments is a heavy economic burden. An alternative to chemically treated surfaces for bactericidal activity started emerging from micro/nanoscale topographical cues in the last decade. Here, we demonstrate a putative antibacterial surface using copper nanowhiskers deposited by molecular beam epitaxy. Furthermore, the control of biological response is based on hydrophobic pinning of water droplets in the Wenzel regime, causing mechanical injury and cell death. Scanning electron microscopy images revealed the details of the surface morphology and non-contact mode laser scanning of the surface revealed the microtopography-associated quantitative parameters. Introducing the bacterial culture over nanowhiskers produces mechanical injury to cells, leading to a reduction in cell density over time due to local pinning of culture medium to whisker surfaces. Extended culture to 72 hours to observe biofilm formation revealed biofilm inhibition with scattered microcolonies and significantly reduced biovolume on nanowhiskers. Therefore, surfaces patterned with copper nanowhiskers can serve as potential antibiofilm surfaces. The topography-based antibacterial surfaces introduce a novel prospect in developing mechanoresponsive nanobiomaterials to reduce the risk of medical device biofilm-associated infections, contrary to chemical leaching of copper as a traditional bactericidal agent.

  4. Testing of the KRI-developed Silicon PIN Radioxenon Detector

    International Nuclear Information System (INIS)

    Foxe, Michael P.; McIntyre, Justin I.

    2015-01-01

    Radioxenon detectors are used for the verification of the Comprehensive Nuclear-Test-Ban Treaty (CTBT) in a network of detectors throughout the world called the International Monitoring System (IMS). The Comprehensive Nuclear-Test-Ban Treaty Organization (CTBTO) Provisional Technical Secretariat (PTS) has tasked Pacific Northwest National Laboratory (PNNL) with testing a V.G. Khlopin Radium Institute (KRI) and Lares Ltd-developed Silicon PIN detector for radioxenon detection. PNNL measured radioxenon with the silicon PIN detector and determined its potential compared to current plastic scintillator beta cells. While the PNNL tested Si detector experienced noise issues, a second detector was tested in Russia at Lares Ltd, which did not exhibit the noise issues. Without the noise issues, the Si detector produces much better energy resolution and isomer peak separation than a conventional plastic scintillator cell used in the SAUNA systems in the IMS. Under the assumption of 1 cm 3 of Xe in laboratory-like conditions, 24-hr count time (12-hr count time for the SAUNA), with the respective shielding the minimum detectable concentrations for the Si detector tested by Lares Ltd (and a conventional SAUNA system) were calculated to be: 131m Xe - 0.12 mBq/m 3 (0.12 mBq/m 3 ); 133 Xe - 0.18 mBq/m 3 (0.21 mBq/m 3 ); 133m Xe - 0.07 mBq/m 3 (0.15 mBq/m 3 ); 135 Xe - 0.45 mBq/m 3 (0.67 mBq/m 3 ). Detection limits, which are one of the important factors in choosing the best detection technique for radioxenon in field conditions, are significantly better than for SAUNA-like detection systems for 131m Xe and 133m Xe, but similar for 133 Xe and 135 Xe. Another important factor is the amount of ''memory effect'' or carry over signal from one radioxenon measurement to the subsequent sample. The memory effect is reduced by a factor of 10 in the Si PIN detector compared to the current plastic scintillator cells. There is potential for further reduction with the

  5. Thermal-Hydraulic Simulations of Single Pin and Assembly Sector for IVG- 1M Reactor

    Energy Technology Data Exchange (ETDEWEB)

    Kraus, A. [Argonne National Lab. (ANL), Argonne, IL (United States); Garner, P. [Argonne National Lab. (ANL), Argonne, IL (United States); Hanan, N. [Argonne National Lab. (ANL), Argonne, IL (United States)

    2015-01-15

    Thermal-hydraulic simulations have been performed using computational fluid dynamics (CFD) for the highly-enriched uranium (HEU) design of the IVG.1M reactor at the Institute of Atomic Energy (IAE) at the National Nuclear Center (NNC) in the Republic of Kazakhstan. Steady-state simulations were performed for both types of fuel assembly (FA), i.e. the FA in rows 1 & 2 and the FA in row 3, as well as for single pins in those FA (600 mm and 800 mm pins). Both single pin calculations and bundle sectors have been simulated for the most conservative operating conditions corresponding to the 10 MW output power, which corresponds to a pin unit cell Reynolds number of only about 7500. Simulations were performed using the commercial code STAR-CCM+ for the actual twisted pin geometry as well as a straight-pin approximation. Various Reynolds-Averaged Navier-Stokes (RANS) turbulence models gave different results, and so some validation runs with a higher-fidelity Large Eddy Simulation (LES) code were performed given the lack of experimental data. These singled out the Realizable Two-Layer k-ε as the most accurate turbulence model for estimating surface temperature. Single-pin results for the twisted case, based on the average flow rate per pin and peak pin power, were conservative for peak clad surface temperature compared to the bundle results. Also the straight-pin calculations were conservative as compared to the twisted pin simulations, as expected, but the single-pin straight case was not always conservative with regard to the straight-pin bundle. This was due to the straight-pin temperature distribution being strongly influenced by the pin orientation, particularly near the outer boundary. The straight-pin case also predicted the peak temperature to be in a different location than the twisted-pin case. This is a limitation of the straight-pin approach. The peak temperature pin was in a different location from the peak power pin in every case simulated, and occurred at an

  6. Experimental Qualification of the Sleeved Pin Multilink Attachment for Divertor PFC's

    International Nuclear Information System (INIS)

    Poutanen, J.; McCallum, A.; Turner, A.; Merola, M.

    2006-01-01

    The latest design for connecting the limited life ITER divertor plasma facing components (PFC's) to the reusable cassette body is the so called sleeved pin multilink attachment. The connection is made by expanding a 43 mm diameter hollow AlBr pin inside the fixation holes of components of the cassette body and PFC by a swaging process. The multilink is an easy, safe and fast assembly method, but the original dismantling method of drilling out the pin was found troublesome. Therefore, in the latest attachment design a thin sleeve is incorporated between the pin and the holes, which makes it possible to dismantle the joint by simply pulling out the pin and sleeve sequentially. Experimental qualification of the new sleeved design is now proceeding. The aim of the experimental qualification is to prove that the sleeved design meets the requirements of load carrying capability, clearance free connection, and easy and safe removal. Associated analytical studies were performed to develop and verify theoretical models and correlations for use in design. Results from the experimental qualification will provide reference information for developing tools for making and removing the connection. Theoretical finite element models in association with the results of earlier test campaigns with nonsleeved design were used to determine pin expansion parameters. The expansion parameters were verified with plate-pin tests measuring contact pressures produced by pin expansion. The plate-pin tests were also used to demonstrate the feasibility of pin removal and develop pin removal methodology. The mechanical capabilities of the connection design are being examined with test series of cyclic tensile loading plus articulation-induced loading of a single connection mock-up. Remaking properties of the attachment are being studied with multiple swaging and removing of the pin into the fixation holes. Finally the dismantling of the connection will be examined with full length pin extraction

  7. Studies for the electro-magnetic calorimeter {\\em SplitCal} for the SHiP experiment at CERN with shower direction reconstruction capability

    CERN Document Server

    2018-01-01

    This paper describes the basic ideas and the first simulation results of a new electro-magnetic calorimeter concept, named {\\it SplitCal}, aimed at optimising the measurement of photon direction in fixed-target experiment configuration, with high photon detection efficiency. This calorimeter was designed for the invariant mass reconstruction of axion-like particles decaying into two photons in the mass range 200~MeV to 1~GeV for the proposed proton beam dump experiment SHiP at CERN. Preliminary results indicate that angular resolutions better than obtained by past experiments can be achieved with this design. An implementation of this concept with real technologies is under study.

  8. Studies for the electro-magnetic calorimeter SplitCal for the SHiP experiment at CERN with shower direction reconstruction capability

    Science.gov (United States)

    Bonivento, Walter M.

    2018-02-01

    This paper describes the basic ideas and the first simulation results of a new electro-magnetic calorimeter concept, named SplitCal, aimed at optimising the measurement of photon direction in fixed-target experiment configuration, with high photon detection efficiency. This calorimeter was designed for the invariant mass reconstruction of axion-like particles decaying into two photons in the mass range 200 MeV to 1 GeV for the proposed proton beam dump experiment SHiP at CERN. Preliminary results indicate that angular resolutions better than obtained by past experiments can be achieved with this design. An implementation of this concept with real technologies is under study.

  9. Measurement of parameters of scintillating bars with wavelength-shifting fibres and silicon photomultiplier readout for the SHiP Muon Detector

    CERN Document Server

    Montanari, Alessandro; Baldini, Wander; Calcaterra, Alessandro; Lanfranchi, Gaia; Saputi, Alessandro; Khotyantsev, Alexey; Kudenko, Yury; Mefodev, Aleksandr; Mineev, Oleg

    2016-01-01

    The light yield and the time resolution of different types of 3 m long scintillating bars instrumented with wavelength shifting fibres and read out by different models of silicon photomultipliers have been measured at a test beam at the T9 area at the CERN Proton Synchrotron. The results obtained with different configurations are presented. A time resolution better than 800 ps, constant along the bar length within 20%, and a light yield of 140 (70) photo-electrons are obtained for bars 3 m long, 4.5 (5) cm wide and 2 (0.7) cm thick. These results nicely match the requirements for the Muon Detector of the SHiP experiment.

  10. [Non-pharmaceutical therapy of candidates for geriatric rehabilitation: Non-pharmaceutical therapy prescribed by SHI-accredited doctors after application for outpatient geriatric rehabilitative care].

    Science.gov (United States)

    Krupp, Sonja; Schnoor, Maike; Lohse, Kristina; Katalinic, Alexander; Willkomm, Martin

    2015-06-01

    The rejection of an application for ambulant geriatric rehabilitation (AGRV) is usually justified by the argument that non-pharmaceutical therapy prescribed by doctors accredited by social housing institutions (SHI) would suffice. The reality in healthcare during the 6 months following an application is unknown. In this study 203 patients who had made an application for AGRV in the second half of 2010 in Flensburg, Lübeck or Ratzeburg were interviewed by telephone. The survey revealed that 25.7% of the applications for AGRV had been rejected. The majority of these patients received no ambulant non-pharmaceutical therapy (e.g. physical therapy, physiotherapy, occupational therapy, speech therapy or psychological therapy), less than 20% received more than 12 therapy sessions and in most cases exclusively physiotherapy. The 141 successful AGRV applicants received additional ambulant therapies of a similar magnitude. The difference between the intensified interdisciplinary therapy offered in the AGRV and additionally and the offer to rejected applicants is substantial.

  11. Improved Retrieval Technique of pin-wise composition for spent fuel recycling

    Energy Technology Data Exchange (ETDEWEB)

    Park, YunSeo; Kim, Myung Hyun [Kyung Hee University , Yongin (Korea, Republic of)

    2016-10-15

    New reutilization method which does not require fabrication processing was suggested and showed feasibility by Dr. Aung Tharn Daing. This new reutilization method is predict spent nuclear fuel pin composition, reconstruct new fuel assembly by spent nuclear pin, and directly reutilize in same PWR core. There are some limitation to predict spent nuclear fuel pin composition on his methodology such as spatial effect was not considered enough. This research suggests improving Dr. Aung Tharn Daing's retrieval technique of pin-wise composition. This new method classify fuel pin groups by its location effect in fuel assembly. Most of fuel pin composition along to burnup in fuel assembly is not highly dependent on location. However, compositions of few fuel pins where near water hole and corner of fuel assembly are quite different in same burnup. Required number of nuclide table is slightly increased from 3 to 6 for one fuel assembly with this new method. Despite of this little change, prediction of the pin-wise composition became more accurate. This new method guarantees two advantages than previous retrieving technique. First, accurate pin-wise isotope prediction is possible by considering location effect in a fuel assembly. Second, it requires much less nuclide tables than using full single assembly database. Retrieving technique of pin-wise composition can be applied on spent fuel management field useful. This technique can be used on direct use of spent fuel such as Dr. Aung Tharn Daing showed or applied on pin-wise waste management instead of conventional assembly-wise waste management.

  12. Clinical and histomorphometrical study on titanium dioxide-coated external fixation pins

    Directory of Open Access Journals (Sweden)

    Koseki H

    2013-02-01

    Full Text Available Hironobu Koseki,1 Tomohiko Asahara,1 Takayuki Shida,1 Itaru Yoda,1 Hidehiko Horiuchi,1 Koumei Baba,2 Makoto Osaki11Department of Orthopedic Surgery, Graduate School of Medicine, Nagasaki University, 2Industrial Technology Center of Nagasaki, Nagasaki, JapanBackground: Pin site infection is the most common and significant complication of external fixation. In this work, the efficacy of pins coated with titanium dioxide (TiO2 for inhibition of infection was compared with that of stainless steel control pins in an in vivo study.Methods: Pins contaminated with an identifiable Staphylococcus aureus strain were inserted into femoral bone in a rat model and exposed to ultraviolet A light for 30 minutes. On day 14, the animals were sacrificed and the bone and soft tissue around the pin were retrieved. The clinical findings and histological findings were evaluated in 60 samples.Results: Clinical signs of infection were present in 76.7% of untreated pins, but in only 36.7% of TiO2-coated pins. The histological bone infection score and planimetric rate of occupation for bacterial colonies and neutrophils in the TiO2-coated pin group were lower than those in the control group. The bone-implant contact ratio of the TiO2-coated pin group was significantly higher (71.4% than in the control pin group (58.2%. The TiO2 was successful in decreasing infection both clinically and histomorphometrically.Conclusion: The photocatalytic bactericidal effect of TiO2 is thought to be useful for inhibiting pin site infection after external fixation.Keywords: titanium dioxide, external fixation, bactericidal activity, Staphylococcus aureus

  13. Development of disassembly and pin chopping technology for FBR spent fuels

    International Nuclear Information System (INIS)

    Kobayashi, Tsuguyuki; Namba, Takashi; Kawabe, Yukinari; Washiya, Tadahiro

    2008-01-01

    Japan Atomic Power Company (JAPC) and Japan Atomic Energy Agency (JAEA) have been developing fuel disassembly and fuel pin chopping systems for a future Japanese commercial FBR. At first, the wrapper tube is cut by the slit-cut to pull it out, then the fuel pins are cut by the crop-cut at their end-plugs to separate them from the entrance nozzle. The pins are transferred to the magazine of the chopping machine. A series of tests were performed to develop this procedure. As the result of mechanical cutting tests, the CBN wheel was selected. The slit-cut tests were carried out to evaluated the cutting performance of the wheel. The wrapper tube is normally slit-cut in the circumferential direction. One CBN wheel could cut more than 5 fuel assemblies in this direction. The slit-cut in the axial direction is prepared as provision when the tube is difficult to put out. More work is needed to cut 5mm thick PNC-FMS plate in this direction without damaging the pins beneath it. As the result of the crop-cut tests of end-plugs made of ODS steel, the CBN wheel could cut the 61 pin bundle by two strokes. More work is needed to cut the 217 pin bundle. Fuel pin handling tests were performed to transfer them from the disassembly machine to the chopping machine. The Saucer tray was selected to receive the disassembled pins. All the pins were transferred and loaded into a magazine of the chopping machine. Fuel pin loading tests were conducted to optimize the magazine configuration to make the chopping length within 1.0±0.5 cm. In order to decrease the disturbance during chopping, the width of the magazine was adjusted to be 12 cm and installation of a height adjuster is favourable to control the free space above the pins. (author)

  14. Fabrication of uranium-plutonium mixed nitride fuel pins (88F-5A) for first irradiation test at JMTR

    International Nuclear Information System (INIS)

    Suzuki, Yasufumi; Iwai, Takashi; Arai, Yasuo; Sasayama, Tatsuo; Shiozawa, Ken-ichi; Ohmichi, Toshihiko; Handa, Muneo

    1990-07-01

    A couple of uranium-plutonium mixed nitride fuel pins was fabricated for the first irradiation tests at JMTR for the purpose of understanding the irradiation behavior and establishing the feasibility of nitride fuels as advanced FBR fuels. The one of the pins was fitted with thermocouples in order to observe the central fuel temperature. In this report, the fabrication procedure of the pins such as pin design, fuel pellet fabrication and characterizations, welding of fuel pins, and inspection of pins are described, together with the outline of the new TIG welder installed recently. (author)

  15. Sensitive pre-amplifier to load for Pin diodes; Pre-amplificador sensible a carga para diodos PIN

    Energy Technology Data Exchange (ETDEWEB)

    Jacobo V, R. Y.; Hernandez D, V. [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98060 Zacatecas (Mexico); Ramirez J, F. J., E-mail: yoshimarv@gmail.com [ININ, Carretera Mexico-Toluca s/n, 52750 Ocoyoacac, Estado de Mexico (Mexico)

    2013-10-15

    The electronic instrumentation is indispensable for the measurement and characterization of the radiation. By means of this essential characteristics of the radiation are determined, as activity and their energy components. The nuclear instrumentation is based on the technical characteristics of the radiation detectors and the electronic devices associates (amplifiers, ana logical and digital converters, multichannel analyzers, etc.) The radiation detectors are very important instruments in fields as the nuclear physics, medicine, radiological protection, industry and in other fields, since they are the only method to capture the radiation and to be able to quantify it in precise form. To detect radiation diverse detector types are used, as the semiconductor type, inside them are the photodiodes type Pin. In this work the results that were obtained of the design, simulation, construction and tests of a preamplifier that was designed starting from a photodiode type Pin are presented. The system was designed and simulated with a program for electronic circuits, in this were carried out many tests being obtained a compact design and achieving the best necessary characteristics for its optimization. With the results of the simulation phase the electronics phase was built, which was couples to a spectroscopic amplifier and a multichannel analyzer. The total of the system was evaluated analyzing its performance before a triple source of alphas. Of the tests phase we find that the system allows obtaining, in a multichannel analyzer, the pulses height spectrum, with a good resolution and with this was calibrated the multichannel analyzer.

  16. Whole core pin-by-pin coupled neutronic-thermal-hydraulic steady state and transient calculations using COBAYA3 code

    International Nuclear Information System (INIS)

    Jimenez, J.; Herrero, J. J.; Cuervo, D.; Aragones, J. M.

    2010-10-01

    Nowadays coupled 3-dimensional neutron kinetics and thermal-hydraulic core calculations are performed by applying a radial average channel approach using a meshing of one quarter of assembly in the best case. This approach does not take into account the subchannels effects due to the averaging of the physical fields and the loose of heterogeneity in the thermal-hydraulic model. Therefore the models do not have enough resolution to predict those subchannels effects which are important for the fuel design safety margins, because it is in the local scale, where we can search the hottest pellet or the maximum heat flux. The Polytechnic University of Madrid advanced multi-scale neutron-kinetics and thermal-hydraulics methodologies being implemented in COBAYA3 include domain decomposition by alternate core dissections for the local 3-dimensional fine-mesh scale problems (pin cells/subchannels) and an analytical nodal diffusion solver for the coarse mesh scale coupled with the thermal-hydraulic using a model of one channel per assembly or per quarter of assembly. In this work, we address the domain decomposition by the alternate core dissections methodology applied to solve coupled 3-dimensional neutronic-thermal-hydraulic problems at the fine-mesh scale. The neutronic-thermal-hydraulic coupling at the cell-subchannel scale allows the treatment of the effects of the detailed thermal-hydraulic feedbacks on cross-sections, thus resulting in better estimates of the local safety margins at the pin level. (Author)

  17. Effect of oil around the pin boss bearing on bearing friction force; Piston pin jikuukebu kinbo no junkatsuyu ga masatsuryoku ni oyobosu eikyo

    Energy Technology Data Exchange (ETDEWEB)

    Takiguchi, M; Suhara, T; Ato, S; Someya, T [Musashi Institute of Technology, Tokyo (Japan)

    1997-10-01

    Piston pin bearings are engine parts placed under severe lubricating condition because of the high unit load and temperature and the low sliding speeds. Therefore, they are vulnerable to many lubrication problems such as abnormal wear, scuffs and seizures. In our recent study, the bearing friction were measured using a original measuring device and it was found out that the lubricating conditions of piston pin boss bearings are non-fluid lubrication due to the oil starvation. In this study, we have also measured the lubricating oil behavior around the pin boss bearing using a special cylinder with glass window, and analyzed the relationship between the friction force and the oil behavior at the pin boss bearings in a actual operating gasoline engine. 2 refs., 9 figs., 1 tab.

  18. Functional characterisation of parvulin-type peptidyl prolyl cis-trans isomerase, PinA in Dictyostelium discoideum

    International Nuclear Information System (INIS)

    Haokip, Nemneineng; Naorem, Aruna

    2017-01-01

    Pin1-type parvulins are unique among PPIases that can catalyse an otherwise slow cis-trans isomerisation of phosphorylated peptide bond preceding proline in target proteins. This prolyl isomerisation process can regulate activity, stability and localisation of target proteins and thus control cellular processes like eukaryotic cell proliferation, cell cycle progression and gene regulation. Towards understanding the function of Pin1-type prolyl isomerisation in Dictyostelium discoideum, a slime mould with distinct growth and developmental phases, we identified PinA as a novel Pin1-type parvulin by its ability to complement the temperature sensitivity phenotype associated with a mutation in ESS1 in S. cerevisiae. In D. discoideum, pinA is temporally and spatially regulated during growth and development. PinA is both nuclear as well as cytoplasmic in the growing cells. We further show that loss of pinA (pinA − ) leads to decreased growth rate, reduced spore formation and abnormal prespore-prestalk patterning. We conclude that PinA is required for normal growth as well as development in D. discoideum. - Highlights: • PinA is a bona fide homologue of S. cerevisiae Ess1. • PinA is required for normal cell proliferation of D. discoideum. • PinA is spatially localised in developmental structures. • PinA is important for cell differentiation and patterning.

  19. Electric arc apparatus for severing split-pin assemblies of guide tubes of nuclear reactors

    International Nuclear Information System (INIS)

    Burns, D.C.; Kauric, C.E.; Persang, J.C.

    1987-01-01

    This patent describes an apparatus for use in the replacement of an old split-pin assembly of a guide tube of a nuclear reactor by a new split-pin assembly, the old split-pin assembly including an old split pin and an old nut securing the old split pin to the guide tube, the old split-pin assembly and the guide tube being radioactive. The apparatus includes a metal disintegration machining tool, the tool having an electrode, means for mounting the tool submerged in a pool of water in engagement with the guide tube and with the old split-pin assembly secured to the guide tube, the tool being so mounted with the electrode in position to coact electrically with the last-named old split-pin assembly but not with the guide tube, and means, connected to the tool, for firing a disintegrating arc between the electrode and the assembly to disintegrate the assembly into readily removable fragments

  20. Evaluating Approaches to Rendering Braille Text on a High-Density Pin Display.

    Science.gov (United States)

    Morash, Valerie S; Russomanno, Alexander; Gillespie, R Brent; OModhrain, Sile

    2017-10-13

    Refreshable displays for tactile graphics are typically composed of pins that have smaller diameters and spacing than standard braille dots. We investigated configurations of high-density pins to form braille text on such displays using non-refreshable stimuli produced with a 3D printer. Normal dot braille (diameter 1.5 mm) was compared to high-density dot braille (diameter 0.75 mm) wherein each normal dot was rendered by high-density simulated pins alone or in a cluster of pins configured in a diamond, X, or square; and to "blobs" that could result from covering normal braille and high-density multi-pin configurations with a thin membrane. Twelve blind participants read MNREAD sentences displayed in these conditions. For high-density simulated pins, single pins were as quickly and easily read as normal braille, but diamond, X, and square multi-pin configurations were slower and/or harder to read than normal braille. We therefore conclude that as long as center-to-center dot spacing and dot placement is maintained, the dot diameter may be open to variability for rendering braille on a high density tactile display.

  1. Effect of Pin Geometry on the Mechanical Strength of Friction-Stir-Welded Polypropylene Composite Plates

    Science.gov (United States)

    Kordestani, F.; Ashenai Ghasemi, F.; Arab, N. B. M.

    2017-09-01

    Friction stir welding (FSW) is a solid-state welding process, which has successfully been applied in aerospace and automotive industries for joining materials. The friction stir tool is the key element in the FSW process. In this study, the effect of four different tool pin geometries on the mechanical properties of two types of polypropylene composite plates, with 30% glass and carbon fiber, respectively, were investigated. For this purpose, four pins of different geometry, namely, a threaded-tapered pin, square pin, four-flute threaded pin, and threaded-tapered pin with a chamfer were made and used to carry out the butt welding of 5-mm-thick plates. The standard tensile and Izod impact tests were performed to evaluate the tensile strength and impact toughness of welded specimens. The results indicated that the threaded-tapered pin with a chamfer produced welds with a better surface appearance and higher tensile and impact strengths. The tests also showed that, with the threaded-tapered pin with a chamfer, the impact strength of the glass- and carbon-fiber composite welds were about 40 and 50%, respectively, of that of the base materials.

  2. Effects of variations in fuel pellet composition and size on mixed-oxide fuel pin performance

    International Nuclear Information System (INIS)

    Makenas, B.J.; Jensen, B.W.; Baker, R.B.

    1980-10-01

    Experiments have been conducted which assess the effects on fuel pin performance of specific minor variations from nominal in both fuel pellet size and pellet composition. Such pellets are generally referred to in the literature as rogue pellets. The effect of these rogue pellets on fuel pin and reactor performance is shown to be minimal

  3. Circuit reliability boosted by soldering pins of disconnect plugs to sockets

    Science.gov (United States)

    Pierce, W. B.

    1964-01-01

    Where disconnect pins must be used for wiring and testing a circuit, improved system reliability is obtained by making a permanent joint between pins and sockets of the disconnect plug. After the circuit has been tested, contact points may be fused through soldering, brazing, or welding.

  4. Transfixation pinning and casting of radial-ulnar fractures in calves: A review of three cases.

    Science.gov (United States)

    St-Jean, G; Debowes, R M

    1992-04-01

    We reviewed the medical records of three calves with radial-ulnar fractures which were reduced and stabilized by transfixation pinning and casting. Multiple Steinmann pins were placed transversely through proximal and distal fracture fragments and the pin ends were incorporated in fiberglass cast material after fracture reduction. Cast material was placed from proximal to distal radius and served as an external frame to maintain pin position and fracture reduction.At the time of injury, the calves ranged in age from one day to two months and weighed from 37-102 kg. Two fractures were comminuted and one was transverse. All fractures were closed. After surgery, all calves could walk within 24 hours. Radiographic and clinical evidence of fracture healing was present five to seven weeks (mean 6) after surgery. At that time, the pins and cast material were removed. Return to normal function was rapid and judged to be excellent at follow-up evaluation five to nine months later.Advantages of transfixation pinning and casting in management of radial-ulnar fractures include flexibility in pin positioning, adequate maintenance of reduction, early return to weight-bearing status, preservation of joint mobility, and ease of ambulation. The inability to adjust fixation and alignment after cast application is a disadvantage of this technique compared with other external fixators. We concluded that transfixation pinning is a useful means of stabilizing radial-ulnar fractures in pediatric bovine patients.

  5. Characterization of holding brake friction pad surface after pin-on-plate wear test

    DEFF Research Database (Denmark)

    Drago, N.; Gonzalez Madruga, D.; De Chiffre, L.

    2018-01-01

    This article concerns the metrological characterization of the surface on a holding brake friction material pin after a pin-on-plate (POP) wear test. The POP test induces the formation of surface plateaus that affect brake performances such as wear, friction, noise and heat. Three different...

  6. The Pinning by Particles of Low and High Angle Grain Boundaries during Grain Growth

    DEFF Research Database (Denmark)

    Tweed, C.J.; Ralph, B.; Hansen, Niels

    1984-01-01

    A study has been made using transmission electron microscopy of the pinning of grain boundaries in aluminium during grain growth by fine dispersions of alumina particles. The boundary parameters have been determined with precision and the pinning effects measured using an approach due to Ashby...

  7. Chemical Emulation of Radiation Pinning Center Geometries in High Temperature Superconductors

    National Research Council Canada - National Science Library

    Weinstein, Roy

    2004-01-01

    ...). Discovery of an entire class of 200-400 nm size, double perovskite pinning centers, (A,B)REBa(sub 2)O(sub 6), led to 20 new chemical "point" pinning centers, and enabled replacement of successful but expensive and radioactive...

  8. COBRA-3M: a digital computer code for analyzing thermal-hydraulic behavior in pin bundles

    International Nuclear Information System (INIS)

    Marr, W.W.

    1975-03-01

    The COBRA-3M computer program is a modification of the thermal-hydraulic subchannel-analysis program COBRA-III. It includes detailed thermal models of fuel pin and duct wall. It is especially suitable for analyzing small pin bundles used in in-reactor or out-of-reactor experiments. (U.S.)

  9. Integrated quality status and inventory tracking system for FFTF driver fuel pins

    International Nuclear Information System (INIS)

    Gottschalk, G.P.

    1979-11-01

    An integrated system for quality status and inventory tracking of Fast Flux Test Facility (FFTF) driver fuel pins has been developed. Automated fuel pin identification systems, a distributed computer network, and a data base are used to implement the tracking system

  10. Antagonistic regulation of PIN phosphorylation by PP2A and PINOID directs auxin flux

    NARCIS (Netherlands)

    Michniewicz, M.; Zago, M.K.; Abas, L.; Weijers, D.; Schweighofer, A.; Meskiene, I.; Heisler, M.G.; Ohno, C.; Zhang, J.; Huang, F.; Schwab, R.; Weigel, D.; Meyerowitz, E.M.; Luschnig, C.; Offringa, R.; Friml, J.

    2007-01-01

    In plants, cell polarity and tissue patterning are connected by intercellular flow of the phytohormone auxin, whose directional signaling depends on polar subcellular localization of PIN auxin transport proteins. The mechanism of polar targeting of PINs or other cargos in plants is largely

  11. Artificial pinning centers using the barrier layer of ordered nanoporous alumina templates

    DEFF Research Database (Denmark)

    Hallet, X.; Mátéfi-Tempfli, Stefan; Mátéfi-Tempfli, M.

    2009-01-01

    of approximately 50nm. Using this surface as a template for controlling the pinning in thin superconducting films, superconducting Nb was deposited with different thicknesses and under different deposition angles. The evaporation under a 30° angle shows an asymmetric pinning potential composed of two triangular...

  12. hPIN/hTAN: Low-Cost e-Banking Secure against Untrusted Computers

    Science.gov (United States)

    Li, Shujun; Sadeghi, Ahmad-Reza; Schmitz, Roland

    We propose hPIN/hTAN, a low-cost token-based e-banking protection scheme when the adversary has full control over the user's computer. Compared with existing hardware-based solutions, hPIN/hTAN depends on neither second trusted channel, nor secure keypad, nor computationally expensive encryption module.

  13. Reliability studies on Si PIN photodiodes under Co-60 gamma radiation

    Energy Technology Data Exchange (ETDEWEB)

    Prabhakara Rao, Y. P. [Integrated Circuits Division, Bharat Electronics Limited, Bangalore, Karnataka-560013 (India) and Department of Studies in Physics, University of Mysore, Manasagangotri, Mysore, Karnataka-570006 (India); Praveen, K. C.; Gnana Prakash, A. P. [Department of Studies in Physics, University of Mysore, Manasagangotri, Mysore, Karnataka-570006 (India); Rani, Y. Rejeena [Integrated Circuits Division, Bharat Electronics Limited, Bangalore, Karnataka-560013 (India)

    2013-02-05

    Silicon PIN photodiodes were fabricated with 250 nm SiO{sub 2} antireflective coating (ARC). The changes in the electrical characteristics, capacitance-voltage characteristics and spectral response after gamma irradiation are systematically studied to estimate the radiation tolerance up to 10 Mrad. The different characteristics studied in this investigation demonstrate that Si PIN photodiodes are suitable for high radiation environment.

  14. Effects of magnetizing on flux pinning force for sintered YBCO superconductor

    International Nuclear Information System (INIS)

    Ding, S.Y.; Yan, J.L.; Yu, Z.; Shi, K.X.; Tong, H.W.; Qiu, L.

    1989-01-01

    It is shown that magnitude and course of magnetizing field influence magnetization and transport current. Effective flux pinning force density with two types is extracted by an iterative procedure based on the critical state equation. One of the types is attributed to the weak links and the other is considered to be resulted from the intragrain flux pinning centers

  15. The "Good, Bad and Ugly" pin site grading system: A reliable and memorable method for documenting and monitoring ring fixator pin sites.

    Science.gov (United States)

    Clint, S A; Eastwood, D M; Chasseaud, M; Calder, P R; Marsh, D R

    2010-02-01

    Although there is much in the literature regarding pin site infections, there is no accepted, validated method for documenting their state. We present a system for reliably labelling pin sites on any ring fixator construct and an easy-to-remember grading system to document the state of each pin site. Each site is graded in terms of erythema, pain and discharge to give a 3-point scale, named "Good", "Bad" and "Ugly" for ease of recall. This system was tested for intra- and inter-observer reproducibility. 15 patients undergoing elective limb reconstruction were recruited. A total of 218 pin sites were independently scored by 2 examiners. 82 were then re-examined later by the same examiners. 514 pin sites were felt to be "Good", 80 "Bad" and 6 "Ugly". The reproducibility of the system was found to be excellent. We feel our system gives a quick, reliable and reproducible method to monitor individual pin sites and their response to treatment. Crown Copyright 2009. Published by Elsevier Ltd. All rights reserved.

  16. Influence of irradiation on defects creation in pin diode structure

    International Nuclear Information System (INIS)

    Sopko, V.; Dammer, J.; Sopko, B.; Chren, D.

    2012-01-01

    In this paper the manufacture of type S1 PIN diodes and radiation defect induce by fast neutrons were studied. A shift from VV"- to VV (neutral) is observed in neutron irradiated diodes. From the results obtained, an explanation that clearly offers itself is that the nature of the defects produced by irradiation of material exhibiting N type conductivity is different from those for type P material. Given that the experiments were conducted with the same material, i.e., the dopant present in the material remained unchanged, it can be stated that simply by changing the type of conductivity with increasing dose, a different kind of defects is produced, having different activation energies in the forbidden band. All these results are consistent with the ongoing RD 50 experiments at CERN.

  17. Possible application of nonredundant pinhole arrays to fuel pin imaging

    International Nuclear Information System (INIS)

    Berzins, G.J.; Han, K.S.

    1975-11-01

    LMFBR Safety Test Facility imaging experiments rely on emission of radiation by the fuel pins and thus appear to strongly complement radiographic techniques in that they are most employable during peak excursion--a time of least favorable radiographic signal--to--noise ratio. Radiography, on the other hand, can provide information long before or after the excursion--times of below threshold signal for direct imaging techniques. An underlying premise of any imaging experiment is that, in addition to sufficient brightness, sufficient contrast exists in the scene. A further restriction is imposed by intervening materials, such as the wall of a containment vessel, that not only absorb but also scatter the radiation. These questions are approached by examining the properties of potential recording instrumentation, of pinhole apertures, and of the necessary radiation sources

  18. Statistical mechanics of homogeneous partly pinned fluid systems.

    Science.gov (United States)

    Krakoviack, Vincent

    2010-12-01

    The homogeneous partly pinned fluid systems are simple models of a fluid confined in a disordered porous matrix obtained by arresting randomly chosen particles in a one-component bulk fluid or one of the two components of a binary mixture. In this paper, their configurational properties are investigated. It is shown that a peculiar complementarity exists between the mobile and immobile phases, which originates from the fact that the solid is prepared in presence of and in equilibrium with the adsorbed fluid. Simple identities follow, which connect different types of configurational averages, either relative to the fluid-matrix system or to the bulk fluid from which it is prepared. Crucial simplifications result for the computation of important structural quantities, both in computer simulations and in theoretical approaches. Finally, possible applications of the model in the field of dynamics in confinement or in strongly asymmetric mixtures are suggested.

  19. FLUX PINNING EFFECTS IN Ag-DOPED YBCO (123 SUPERCONDUCTOR

    Directory of Open Access Journals (Sweden)

    Madelen Pérez

    2010-07-01

    Full Text Available Polycrystalline samples of Ag+-doped YBCO (123 (YBa2 (Cu1-xAgx3O7-δwith 0≤x≤0.3 were produced by solid state reaction method. The Ag- doped YBCO samples showed higher critical current densities (Jc with a Jc maximum for samples doped with x=0.05. This behavior can be assigned to an increase of pinning forces. The irreversibility temperature (Tirr, also increased in doped samples as a function of Ag content, with the highest temperature for the sample doped with x=0.05, wich correlates well with the observed Jc increasing. However, samples doped with x>0.05 displayed a decreasing of electrical properties (less Tirr, less Jc, etc. atributed to an excess of Ag in the grain boundaries which, reduces the grain sizes and increases the number of weak- links.

  20. Linear nanometric tunnel junction sensors with exchange pinned sensing layer

    International Nuclear Information System (INIS)

    Leitao, D. C.; Silva, A. V.; Cardoso, S.; Ferreira, R.; Paz, E.; Deepack, F. L.; Freitas, P. P.

    2014-01-01

    Highly sensitive nanosensors with high spatial resolution provide the necessary features for high accuracy imaging of isolated magnetic nanoparticles. In this work, we report the fabrication and characterization of MgO-barrier magnetic tunnel junction nanosensors, with two exchange-pinned electrodes. The perpendicular magnetization configuration for field sensing is set using a two-step annealing process, where the second annealing temperature was optimized to yield patterned sensors responses with improved linearity. The optimized circular nanosensors show sensitivities up to 0.1%/Oe, larger than previously reported for nanometric sensors and comparable to micrometric spin-valves. Our strategy avoids the use of external permanent biasing or demagnetizing fields (large for smaller structures) to achieve a linear response, enabling the control of the linear operation range using only the stack and thus providing a small footprint device