WorldWideScience

Sample records for shell-type snr cassiopeia

  1. Cassiopeia

    Science.gov (United States)

    Murdin, P.

    2000-11-01

    (abbrev. Cas, gen. Cassiopeiae; area 598 sq. deg.) A northern constellation which lies between Cepheus and Andromeda, and culminates at midnight in early October. It is named after Queen Cassiopeia, wife of King Cepheus and mother of Andromeda in Greek mythology, and is usually shown on early celestial charts as a seated figure. Its brightest stars were cataloged by Ptolemy (c. AD 100-175) in the ...

  2. A cut-off in the TeV gamma-ray spectrum of the SNR Cassiopeia A

    Science.gov (United States)

    Ahnen, M. L.; Ansoldi, S.; Antonelli, L. A.; Arcaro, C.; Babić, A.; Banerjee, B.; Bangale, P.; Barres de Almeida, U.; Barrio, J. A.; Becerra González, J.; Bednarek, W.; Bernardini, E.; Berti, A.; Bhattacharyya, W.; Biasuzzi, B.; Biland, A.; Blanch, O.; Bonnefoy, S.; Bonnoli, G.; Carosi, R.; Carosi, A.; Chatterjee, A.; Colak, M.; Colin, P.; Colombo, E.; Contreras, J. L.; Cortina, J.; Covino, S.; Cumani, P.; Da Vela, P.; Dazzi, F.; De Angelis, A.; De Lotto, B.; de Oña Wilhelmi, E.; Di Pierro, F.; Doert, M.; Domínguez, A.; Dominis Prester, D.; Dorner, D.; Doro, M.; Einecke, S.; Eisenacher Glawion, D.; Elsaesser, D.; Engelkemeier, M.; Fallah Ramazani, V.; Fernández-Barral, A.; Fidalgo, D.; Fonseca, M. V.; Font, L.; Fruck, C.; Galindo, D.; García López, R. J.; Garczarczyk, M.; Gaug, M.; Giammaria, P.; Godinović, N.; Gora, D.; Guberman, D.; Hadasch, D.; Hahn, A.; Hassan, T.; Hayashida, M.; Herrera, J.; Hose, J.; Hrupec, D.; Inada, T.; Ishio, K.; Konno, Y.; Kubo, H.; Kushida, J.; Kuveždić, D.; Lelas, D.; Lindfors, E.; Lombardi, S.; Longo, F.; López, M.; Maggio, C.; Majumdar, P.; Makariev, M.; Maneva, G.; Manganaro, M.; Mannheim, K.; Maraschi, L.; Mariotti, M.; Martínez, M.; Mazin, D.; Menzel, U.; Minev, M.; Mirzoyan, R.; Moralejo, A.; Moreno, V.; Moretti, E.; Neustroev, V.; Niedzwiecki, A.; Nievas Rosillo, M.; Nilsson, K.; Ninci, D.; Nishijima, K.; Noda, K.; Nogués, L.; Paiano, S.; Palacio, J.; Paneque, D.; Paoletti, R.; Paredes, J. M.; Pedaletti, G.; Peresano, M.; Perri, L.; Persic, M.; Prada Moroni, P. G.; Prandini, E.; Puljak, I.; Garcia, J. R.; Reichardt, I.; Rhode, W.; Ribó, M.; Rico, J.; Righi, C.; Saito, T.; Satalecka, K.; Schroeder, S.; Schweizer, T.; Shore, S. N.; Sitarek, J.; Šnidarić, I.; Sobczynska, D.; Stamerra, A.; Strzys, M.; Surić, T.; Takalo, L.; Tavecchio, F.; Temnikov, P.; Terzić, T.; Tescaro, D.; Teshima, M.; Torres-Albà, N.; Treves, A.; Vanzo, G.; Vazquez Acosta, M.; Vovk, I.; Ward, J. E.; Will, M.; Zarić, D.

    2017-12-01

    It is widely believed that the bulk of the Galactic cosmic rays is accelerated in supernova remnants (SNRs). However, no observational evidence of the presence of particles of PeV energies in SNRs has yet been found. The young historical SNR Cassiopeia A (Cas A) appears as one of the best candidates to study acceleration processes. Between 2014 December and 2016 October, we observed Cas A with the MAGIC telescopes, accumulating 158 h of good quality data. We derived the spectrum of the source from 100 GeV to 10 TeV. We also analysed ∼8 yr of Fermi-LAT to obtain the spectral shape between 60 MeV and 500 GeV. The spectra measured by the LAT and MAGIC telescopes are compatible within the errors and show a clear turn-off (4.6σ) at the highest energies, which can be described with an exponential cut-off at E_c = 3.5(^{+1.6}_{-1.0})_{stat} (^{+0.8}_{-0.9})_{sys} TeV. The gamma-ray emission from 60 MeV to 10 TeV can be attributed to a population of high-energy protons with a spectral index of ∼2.2 and an energy cut-off at ∼10 TeV. This result indicates that Cas A is not contributing to the high energy (∼PeV) cosmic ray sea in a significant manner at the present moment. A one-zone leptonic model fails to reproduce by itself the multiwavelength spectral energy distribution. Besides, if a non-negligible fraction of the flux seen by MAGIC is produced by leptons, the radiation should be emitted in a region with a low magnetic field (B⪅180 μG) like in the reverse shock.

  3. MODELING SNR CASSIOPEIA A FROM THE SUPERNOVA EXPLOSION TO ITS CURRENT AGE: THE ROLE OF POST-EXPLOSION ANISOTROPIES OF EJECTA

    Energy Technology Data Exchange (ETDEWEB)

    Orlando, S.; Miceli, M.; Pumo, M. L.; Bocchino, F., E-mail: orlando@astropa.inaf.it [INAF—Osservatorio Astronomico di Palermo “G.S. Vaiana,” Piazza del Parlamento 1, I-90134 Palermo (Italy)

    2016-05-01

    The remnants of core-collapse supernovae (SNe) have complex morphologies that may reflect asymmetries and structures developed during the progenitor SN explosion. Here we investigate how the morphology of the supernova remnant Cassiopeia A (Cas A) reflects the characteristics of the progenitor SN with the aim of deriving the energies and masses of the post-explosion anisotropies responsible for the observed spatial distribution of Fe and Si/S. We model the evolution of Cas A from the immediate aftermath of the progenitor SN to the three-dimensional interaction of the remnant with the surrounding medium. The post-explosion structure of the ejecta is described by small-scale clumping of material and larger-scale anisotropies. The hydrodynamic multi-species simulations consider an appropriate post-explosion isotopic composition of the ejecta. The observed average expansion rate and shock velocities can be well reproduced by models with ejecta mass M {sub ej} ≈ 4 M {sub ⊙} and explosion energy E {sub SN} ≈ 2.3 × 10{sup 51} erg. The post-explosion anisotropies (pistons) reproduce the observed distributions of Fe and Si/S if they had a total mass of ≈0.25 M {sub ⊙} and a total kinetic energy of ≈1.5 × 10{sup 50} erg. The pistons produce a spatial inversion of ejecta layers at the epoch of Cas A, leading to the Si/S-rich ejecta physically interior to the Fe-rich ejecta. The pistons are also responsible for the development of the bright rings of Si/S-rich material which form at the intersection between the reverse shock and the material accumulated around the pistons during their propagation. Our result supports the idea that the bulk of asymmetries observed in Cas A are intrinsic to the explosion.

  4. Shell-type SNRs as sources of cosmic rays

    Science.gov (United States)

    Sinitsyna, V. G.; Andreeva, M. S.; Balygin, K. A.; Borisov, S. S.; Ivanov, I. A.; Kirichenko, A. M.; Klimov, A. I.; Kozhukhova, I. P.; Mirzafatikhov, R. M.; Moseiko, N. I.; Ostashev, I. E.; Palamarchuk, A. I.; Sinitsyna, V. Y.; Volokh, I. G.

    2017-06-01

    Investigations of VHE gamma-ray sources by any methods, including mirror Cherenkov telescopes, touch on the problem of the cosmic ray origin and, accordingly, the role of the Galaxy in their generation. SHALON observations have yielded results on Galactic supernova remnants (SNR) of different ages. Among them are: the shell-type SNRs Tycho's SNR (1572y), Cas A (1680y), IC 443 (age ˜ (3 ÷ 30) × 103 y), Cygni SNR (age ˜ (5 ÷ 7) × 103 y), G166.0 + 4.3 (age ˜ 24 × 103 y) and the classical nova GK Per (Nova 1901). Observation results are presented for each of the SNRs with spectral energy distributions by SHALON in comparison with other experiment data and images by SHALON together with data from X-rays by Chandra and radio-data by CGPS. The collected experimental data have confirmed the prediction of the theory about the hadronic generation mechanism of very high energy 800 GeV-100 TeV gamma-rays in Tycho's SNR, Cas A and IC443. For the first time, unique data on GK Per (Nova1901) TeV gamma-ray emission were obtained with the SHALON experiment. The X-ray data shows that the nova remnant of GK Per could be a younger remnant that will resemble older SNRs like IC 443 which interact with molecular clouds. GK Per is supposed to be a candidate for TeV gamma-ray emission due to accelerated particles in the reverse shock region.

  5. Analysis of Tutorials CEGV Cassiopeia in Terms of Primary Prevention

    OpenAIRE

    KURZ, Petr

    2015-01-01

    Analysis of teaching programs of CEGV Cassiopeia from the view of primary prevention. The paper deals with the topic of primary prevention in relation to teaching programs carried out by CEGV Cassiopeia. The Center of Ecologic and Global Education Cassiopeia (CEGV Cassiopeia) was established in 1995. At present its primary occupation is education, particularly education specialized in environmental, multicultural and personal-social topics. The center co-operates with nursery, primary, high s...

  6. Molecules and dust in Cassiopeia A

    DEFF Research Database (Denmark)

    Biscaro, Chiara; Cherchneff, Isabelle

    2016-01-01

    We study the dust evolution in the supernova remnant Cassiopeia A. We follow the processing of dust grains that formed in the Type II-b supernova ejecta by modelling the sputtering of grains. The dust is located in dense ejecta clumps that are crossed by the reverse shock. We also investigate......-rich clumps that correspond to the outermost carbon-rich ejecta zone. We consider the various dust components that form in the supernova, several reverse shock velocities and inter-clump gas temperatures, and derive grain-size distributions and masses for the dust as a function of time. Both non...... and size, and the shock velocity in the clump. A Type II-b SN forms small grains that are sputtered within the clumps and in the inter-clump medium. For Cas A, silicate grains do not survive thermal sputtering in the inter-clump medium, while alumina, silicon carbide, and carbon dust may survive...

  7. Autopsy of the Supernova Remnant Cassiopeia A

    Science.gov (United States)

    Milisavljevic, Dan; Fesen, Robert A.

    2014-01-01

    Three-dimensional kinematic reconstructions of optically emitting ejecta in the young Galactic supernova remnant Cassiopeia A (Cas A) are discussed. The reconstructions encompass the remnant's faint outlying ejecta knots, including the exceptionally high-velocity NE and SW streams of debris often referred to as `jets'. The bulk of Cas A's ejecta are arranged in several circular rings with diameters between approximately 30'' (0.5 pc) and 2' (2 pc). We suggest that similar large-scale ejecta rings may be a common phenomenon of young core-collapse remnants and may explain lumpy emission line profile substructure sometimes observed in spectra of extragalactic core-collapse supernovae years after explosion. A likely origin for these large ejecta rings is post-explosion input of energy from plumes of radioactive 56Ni-rich ejecta that rise, expand, and compress non-radioactive material to form bubble-like structures.

  8. SNR coolant system components

    International Nuclear Information System (INIS)

    De Haas Van Dorsser, A.H.; Mausbeck, H.

    1976-01-01

    The DEBENELUX prototype fast reactor power plant SNR 300 at Kalkar has a loop-type heat transfer system similar to that of the prototype LMFBR plants in the USA and Japan. There exist three 257 MW/sub th/ primary sodium loops, each with a hot leg centrifugal pump and three 85.6 MW/sub th/ intermediate heat exchangers in parallel. From there the heat is transferred to the steam generators via three secondary sodium loops with one cold leg sodium circulating pump in each. At a nominal reactor outlet temperature of 819 0 K and a turbine inlet power of 771 MW/sub th/ super heated steam of 166 bar and 733 0 K is produced, giving rise to a plant rating of 327 MW/sub e/ gross. The primary and secondary loops are described in detail

  9. Dynamics of an articulated shell type flexible rotor

    International Nuclear Information System (INIS)

    Suleman, M.; Khan, M.Z.; Nazeer, M.M.

    2001-01-01

    An ultra high speed articulated shell type flexible rotor supported by low stiffness flexible bearing encounters a number of dynamic problems while traversing towards or from the service speed. The major and critical problems that arise are: Synchronous and Sub-synchronous vibration due to instabilities. Structural resonances and rubs due to eccentricities of structure and magnetic bearing. The symptoms of these troubles, their root causes and remedial measures are highlighted and discussed in this work. (author)

  10. Hot spot manifestation in eclipsing dwarf nova HT Cassiopeiae

    OpenAIRE

    Bakowska, K.; Olech, A.

    2014-01-01

    We report the detection of the hot spot in light curves of the eclipsing dwarf nova HT Cassiopeiae during its superoutburst in 2010 November. Analysis of eight reconstructed light curves of the hot spot eclipses showed directly that the brightness of the hot spot was changing significantly during the superoutburst. Thereby, detected hot spot manifestation in HT Cas is the newest observational evidence for the EMT model for dwarf novae.

  11. EVOLUTION OF HIGH-ENERGY PARTICLE DISTRIBUTION IN MATURE SHELL-TYPE SUPERNOVA REMNANTS

    Energy Technology Data Exchange (ETDEWEB)

    Zeng, Houdun; Xin, Yuliang; Liu, Siming; Zhang, Shuinai [Key Laboratory of Dark Matter and Space Astronomy, Purple Mountain Observatory, Chinese Academy of Sciences, Nanjing 210008 (China); Jokipii, J. R. [University of Arizona, Tucson, Arizona, 85721 (United States); Zhang, Li, E-mail: zhd@pmo.ac.cn, E-mail: liusm@pmo.ac.cn [Key Laboratory of Astroparticle Physics of Yunnan Province, Kunming, 650091 (China)

    2017-01-10

    Multi-wavelength observations of mature supernova remnants (SNRs), especially with recent advances in γ -ray astronomy, make it possible to constrain energy distribution of energetic particles within these remnants. In consideration of the SNR origin of Galactic cosmic rays and physics related to particle acceleration and radiative processes, we use a simple one-zone model to fit the nonthermal emission spectra of three shell-type SNRs located within 2° on the sky: RX J1713.7−3946, CTB 37B, and CTB 37A. Although radio images of these three sources all show a shell (or half-shell) structure, their radio, X-ray, and γ -ray spectra are quite different, offering an ideal case to explore evolution of energetic particle distribution in SNRs. Our spectral fitting shows that (1) the particle distribution becomes harder with aging of these SNRs, implying a continuous acceleration process, and the particle distributions of CTB 37A and CTB 37B in the GeV range are harder than the hardest distribution that can be produced at a shock via the linear diffusive shock particle acceleration process, so spatial transport may play a role; (2) the energy loss timescale of electrons at the high-energy cutoff due to synchrotron radiation appears to be always a bit (within a factor of a few) shorter than the age of the corresponding remnant, which also requires continuous particle acceleration; (3) double power-law distributions are needed to fit the spectra of CTB 37B and CTB 37A, which may be attributed to shock interaction with molecular clouds.

  12. PIC simulations of magnetic field production by cosmic rays drifting upstream of SNR shocks

    International Nuclear Information System (INIS)

    Pohl, M.

    2008-01-01

    Turbulent magnetic-field amplification appears to operate near the forward shocks of young shell-type SNR. I review the observational constraints on the spatial distribution and amplitude of amplified magnetic field in this environment. I also present new PIC simulations of magnetic-field growth due to streaming cosmic rays. While the nature of the initial linear instability is largely determined by the choice of simulation parameters, the saturation always involves changing the bulk motion of cosmic rays and background plasma, which limits the field growth to amplitudes of a few times that of the homogeneous magnetic field. (author)

  13. Recent radio studies of SNR

    International Nuclear Information System (INIS)

    Dickel, J.R.

    1983-01-01

    SNR can generally be recognized as extended sources of continuum radio emission with non-thermal spectra located near the galactic plane. The author describes the kinds of observations currently being obtained and what they tell us about the objects. The data include continuum observations which can reach resolutions of about 1 arcsec using aperture synthesis techniques and also spectral line observations of the interstellar matter being encountered by the remnants. (Auth.)

  14. Safety design of SNR-300

    International Nuclear Information System (INIS)

    Traube, K.

    1976-01-01

    The joint German-Belgian-Dutch loop-type 300 MW(e) LMFBR prototype is being constructed at Kalkar on the lower Rhine in Germany. Among the many arguments put forward in defense of SNR-300, that of acquiring licensing exprience has proven to be of major importance to the international breeder scene. The severity of the licensing procedures and of the safety standards imposed are unique in several respects, including timing: generally growing scepticism towards nuclear power increased severity of the licensing practice; organizational features: the procedure and criteria developed for commercial light water reactors have been applied without exemptions. This relates to the commercial-type contract under which SNR-300 is being built for private utilities by a private company; and German nuclear safety standards, known worldwide to be most stringent. The following three important areas are discussed in which SNR-300 decidedly deviates from its forerunners: protection against the hypothetical core disruptive accident (HCDA), protection against external events, and provisions for in-service inspection

  15. Variable Stars in the M31 Dwarf Spheroidal Companion Cassiopeia

    Science.gov (United States)

    Pritzl, Barton J.; Armandroff, T. E.; Jacoby, G. H.; Da Costa, G. S.

    2007-12-01

    Dwarf spheroidal galaxies show very diverse star formation histories. For the Galactic dwarf spheroidal galaxies, a correlation exists between Galactocentric distance and the prominence of intermediate-age ( 2 - 10 Gyr) populations. To test whether this correlation exists for the M31 dwarf spheroidal galaxies, we observed the Cassiopeia (And VII) dwarf galaxy, which is one of the most distant M31 dwarf spheroidal galaxies. We will present the results of a variable star search using HST/ACS data, along with a preliminary color-magnitude diagram. From the RR Lyrae stars we can obtain an independent distance and metallicity estimate for the dwarf galaxy. These results will be compared to those found for the other M31 dwarf spheroidal galaxies.This research is supported in part by NASA through grant number GO-11081.11 from the Space Telescope Science Institute.

  16. Locating the most energetic electrons in Cassiopeia A

    DEFF Research Database (Denmark)

    Grefenstette, Brian W.; Reynolds, Stephen P.; Harrison, Fiona A.

    2015-01-01

    We present deep (>2.4 Ms) observations of the Cassiopeia A supernova remnant with NuSTAR, which operates in the 3-79 keV bandpass and is the first instrument capable of spatially resolving the remnant above 15 keV. We find that the emission is not entirely dominated by the forward shock nor...... that of the radio emission nor that of the low energy (15 keV emission an open mystery. Even at the forward shock front we find less steepening of the spectrum than expected from an exponentially cut off electron distribution with a single cutoff energy. Finally, we find that the GeV emission is not associated...

  17. Hubble Space Telescope Image, Supernova Remnant Cassiopeia A

    Science.gov (United States)

    2000-01-01

    The colorful streamers that float across the sky in this photo taken by NASA's Hubble Space Telescope (HST) were created by the universe's biggest firecracker, the titanic supernova explosion of a massive star. The light from the exploding star reached Earth 320 years ago, nearly a century before the United States celebrated its birth with a bang. The dead star's shredded remains are called Cassiopeia A, or 'Cas A' for short. Cas A is the youngest known supernova remnant in our Milky Way Galaxy and resides 10,000 light-years away in the constellation Cassiopeia, so the star actually blew up 10,000 years before the light reached Earth in the late 1600s. This HST image of Cas A shows for the first time that the debris is arranged into thousands of small, cooling knots of gas. This material eventually will be recycled into building new generations of stars and planets. Our own Sun and planets are constructed from the debris of supernovae that exploded billions of years ago. This photo shows the upper rim of the super nova remnant's expanding shell. Near the top of the image are dozens of tiny clumps of matter. Each small clump, originally just a small fragment of the star, is tens of times larger than the diameter of our solar system. The colors highlight parts of the debris where chemical elements are glowing. The dark blue fragments, for example, are richest in oxygen; the red material is rich in sulfur. The images were taken with the Wide Field and Planetary Camera 2 in January 2000 and January 2002. Image Credit: NASA and HST team (Stoics/AURA). Acknowledgment: R. Fesen (Darmouth) and J. Morse ( Univ. of Colorado).

  18. Core–shell-typed Ag-SiO2 nanoparticles as solar selective coating materials

    International Nuclear Information System (INIS)

    Gao, Tao; Jelle, Bjørn Petter; Gustavsen, Arild

    2013-01-01

    Silver (Ag) nanoparticles with typical diameter of about 50 nm have been prepared via a polyol process. The as-prepared Ag nanoparticles are well crystallized and exhibit a characteristic surface plasmon resonance (SPR) band centered at ∼423 nm. The SPR band shows a strong dependence on the sizes of Ag nanoparticles and the types of the dielectric medium. Core–shell-typed Ag-SiO 2 nanoparticles have also been prepared by depositing a thin layer (∼25 nm) of silica on Ag nanoparticles. The core–shell-typed Ag-SiO 2 nanoparticles show similar optical behaviors (absorption, transmission, and reflection) but enhanced stability compared to those of the Ag nanoparticles, indicating that the core–shell-typed Ag-SiO 2 nanoparticles may be used as solar selective coating materials for architectural window applications.

  19. Cassiopeia A Comes Alive Across Time and Space

    Science.gov (United States)

    2009-01-01

    Two new efforts have taken a famous supernova remnant from the static to the dynamic. A new movie of data from NASA's Chandra X-ray Observatory shows changes in time never seen before in this type of object. And, an unprecedented and dramatic three-dimensional visualization of the same remnant by a separate team is being released. Nearly ten years ago, Chandra's "First Light" image of Cassiopeia A (Cas A) revealed previously unseen structures and detail. Now, after eight years of observation, scientists have been able to construct a movie that tracks the remnant's expansion and changes over time. "With Chandra, we have watched Cas A over a relatively small amount of its life, but so far the show has been amazing," said Daniel Patnaude of the Smithsonian Astrophysical Observatory in Cambridge, Mass. "And, we can use this to learn more about the aftermath of the star's explosion." A separate, but equally fascinating visualization featuring Cas A was presented, along with the Patnaude team's results, at a press conference at the American Astronomical Society meeting in Long Beach, Calif. Based on data from Chandra, NASA's Spitzer Space Telescope, and ground-based optical telescopes, Tracey Delaney and her colleagues have created the first threedimensional fly-through of a supernova remnant. Cas A animation Brief Time-lapse Movie of Cassiopeia A "We have always wanted to know how the pieces we see in two dimensions fit together with each other in real life," said Delaney of the Massachusetts Institute of Technology. "Now we can see for ourselves with this 'hologram' of supernova debris." This ground-breaking visualization of Cas A was made possible through a collaboration with the Astronomical Medicine project based at Harvard. The goal of this project is to bring together the best techniques from two very different fields, astronomy and medical imaging. "Right now, we are focusing on improving three-dimensional visualization in both astronomy and medicine

  20. Anomalous strength of the 2200 Angstroem feature in Cassiopeia-Taurus association

    International Nuclear Information System (INIS)

    Morales, C.; Ruiz del Arbol, J.A.; Llorente de Andres, F.

    1980-01-01

    From a large sample of reddened stars we computed the individual extinction curves which agree with that calculated by Nandy et al. (1976), except for four stars which show that the extinction at the 2200 Angstroem feature is greater than that deduced for the rest of stars. These four stars belong to the Cassiopeia-Taurus association. (orig.)

  1. Constraints on the kinematics of the 44Ti ejecta of Cassiopeia A from INTEGRAL/SPI

    NARCIS (Netherlands)

    Martin, P; Knödlseder, J.; Vink, J.; Decourchelle, A.; Renaud, M.

    2009-01-01

    Context. The medium-lived 44Ti isotope is synthesised by explosive Si-burning in core-collapse supernovae. It is extremely sensitive to the dynamics of the explosion and therefore can be used to indirectly probe the explosion scenario. The young supernova remnant Cassiopeia A is to date the only

  2. The signature of 44Ti in Cassiopeia a Revealed by IBIS/ISGRI on INTEGRAL

    NARCIS (Netherlands)

    Renaud, M.; Vink, J.; Decourchelle, A.; Lebrun, F.; den Hartog, P.R.; Terrier, R.; Couvreur, C.; Knödlseder, J.; Martin, P; Prantzos, N.; Bykov, A.M.; Bloemen, H.

    2006-01-01

    We report the detection of both the 67.9 and 78.4 keV 44Sc g-ray lines in Cassiopeia A with the INTEGRAL IBIS/ISGRI instrument. Besides the robustness provided by spectroimaging observations, the main improvements compared to previous measurements are a clear separation of the two 44Sc lines

  3. Membrane versus shell type elements in F.E. analysis of box type buildings

    International Nuclear Information System (INIS)

    Canetta, G.

    1979-01-01

    Finite element analysis of box-type buildings is discussed under typical loading conditions - gravity, seismic and temperature loads. The computation effort is recognized to be noticeably different, according to whether membrane or shell type elements are used. The relevance of membrane and bending stress components to the total stress distribution is outlined in the table below; the different role of the typical members under the various loading conditions is emphasized. (orig.)

  4. Methods and findings of the SNR study

    International Nuclear Information System (INIS)

    Koeberlein, K.; Schaefer, H.; Spindler, H.

    1983-01-01

    A featfinding committee of the German Federal Parliament in July 1980 recommended to perform a ''risk-oriented study'' of the SNR-300, the German 300 MW fast breeder prototype reactor being under construction in Kalkar. The main aim of this study was to allow a comparative safety evaluation between the SNR-300 and a modern PWR, thus to prepare a basis for a political decision on the SNR-300. Methods and main results of the study are presented in this paper. In the first step of the risk analysis six groups of accidents have been identified which may initiate core destruction. These groups comprise all conceivable courses, potentially leading to core destruction. By reliability analyses, expected frequency of each group has been calculated. In the accident analysis potential failure modes of the reactor tank have been investigated. Core destruction may be accompanied by the release of significant amounts of mechanical energy. The primary coolant system of SNR-300 is designed to withstand mechanical energy releases up to 370 MJ. Design features make it possible to cool the molten core inside the reactor tank. (orig./RW) [de

  5. Development of a toroidal shell-type shock absorber for an irradiated fuel shipping cask

    International Nuclear Information System (INIS)

    Sugita, Y.; Mochizuki, S.

    1983-01-01

    This study described the design method of a toroidal shell-type shock absorber and the dynamic responses of the cask body, the internal structure and water when this shock absorber was used. Conclusions are: the calculated results on the basis of the master curves of non-dimensionalized force-deflection relations by static compression tests show a close agreement with the experimental results; the internal structure moves together with the cask body in every position; and the maximum water pressure is larger by a factor of 1.2 than the static pressure multiplied by the maximum deceleration in every direction due to the low-frequency wave propagation

  6. Quench performance of a 4-m long Nb3Sn shell-type dipole coil

    International Nuclear Information System (INIS)

    Chlachidze, G.; Ambrosio, G.; Andreev, N.; Barzi, E.; Bossert, R.; Carcagno, R.; Kashikhin, V.S.; Kashikhin, V.V.; Lamm, M.J.; Nobrega, F.; Novitski, I.

    2008-01-01

    Fermilab has finished the first phase of Nb 3 Sn technology scale up by testing 2-m and 4-m long shell-type dipole coils in a 'magnetic mirror' configuration. The 2-m long coil, made of Powder-in-Tube (PIT) Nb 3 Sn strand, reached its short sample limit at a field level of 10 T. The 4-m long coil, made of advanced Nb 3 Sn strand based on the Restack Rod Process (RRP) of 108/127 design, has been recently fabricated and tested. Coil test results at 4.5 K and 2.2 K are reported and discussed

  7. Core design aspects of SNR 2

    International Nuclear Information System (INIS)

    Wehmann, U.K.

    1987-01-01

    The paper describes in its first part the main characteristics of the core of the SNR 2 fast breeder reactor which is being planned within the European collaboration on fast breeder reactors. In the second part some core design aspects are discussed. The fuel element management with an inwards shuffling after each cycle is illustrated which offers advantages with respect to linear rating, steel damage and average discharge burnup. For this management, the full three-dimensional power and burnup history has been calculated and some typical results are presented. The shutdown requirements and the capabilities of the two shutdown systems of SNR 2 are discussed. The necessity for a reliable surveillance of the power distribution is demonstrated by the pronounced power tilts in case of the unintentional withdrawal of an absorber rod. Finally, a short review of the main nuclear design methods and their validation with help of the evaluation of experiments in zero power facilities and power reactors is given

  8. Steam generator in the SNR-project

    International Nuclear Information System (INIS)

    van Westenbrugge, J.K.

    1979-01-01

    The design philosophy of steam generators for 1300 MWe LMFBR's is presented. The basis for this philosophy is the present experience with the licensing of the SNR-300. This experience is reported. The approach for the steam generators for the 1300 MWe LMFBR is elaborated on, both for accident prevention and damage limitation, for the component itself as well as for the system design. Both Design Base Accident and Hypothetical Accidents are discussed. 8 refs

  9. X-ray imaging of the Cr and Fe lines from Cassiopeia A

    NARCIS (Netherlands)

    Maeda, Y.; Sato, T.; Tsunemi, H.; Bamba, A.; Vink, J.; Terada, Y.; Takeda, T.; Sawada, M.; Gandhi, P.; Matsumoto, H.; Uchiyama, Y.; Helder, E.A.; Hiraga, J.; Hughes, J.P.; Kokubun, M.; Tamagawa, T.; Tsuboi, Y.; Ishida, M.; Petre, R.; Mitsuda, K.

    2014-01-01

    Follow-up Suzaku X-ray observations of a young supernova remnant Cassiopeia A carried out with a long exposure of ˜ 165 ksec in 2012. Owing to the high statistics of the data, the map of Cr-K line is made. The flux map of Cr-K line is similar to that of Fe-K. The similarity indicates that the

  10. Study of errors in absolute flux density measurements of Cassiopeia A

    International Nuclear Information System (INIS)

    Kanda, M.

    1975-10-01

    An error analysis for absolute flux density measurements of Cassiopeia A is discussed. The lower-bound quadrature-accumulation error for state-of-the-art measurements of the absolute flux density of Cas A around 7 GHz is estimated to be 1.71% for 3 sigma limits. The corresponding practicable error for the careful but not state-of-the-art measurement is estimated to be 4.46% for 3 sigma limits

  11. Low-frequency radio absorption in Cassiopeia A

    Science.gov (United States)

    Arias, M.; Vink, J.; de Gasperin, F.; Salas, P.; Oonk, J. B. R.; van Weeren, R. J.; van Amesfoort, A. S.; Anderson, J.; Beck, R.; Bell, M. E.; Bentum, M. J.; Best, P.; Blaauw, R.; Breitling, F.; Broderick, J. W.; Brouw, W. N.; Brüggen, M.; Butcher, H. R.; Ciardi, B.; de Geus, E.; Deller, A.; van Dijk, P. C. G.; Duscha, S.; Eislöffel, J.; Garrett, M. A.; Grießmeier, J. M.; Gunst, A. W.; van Haarlem, M. P.; Heald, G.; Hessels, J.; Hörandel, J.; Holties, H. A.; van der Horst, A. J.; Iacobelli, M.; Juette, E.; Krankowski, A.; van Leeuwen, J.; Mann, G.; McKay-Bukowski, D.; McKean, J. P.; Mulder, H.; Nelles, A.; Orru, E.; Paas, H.; Pandey-Pommier, M.; Pandey, V. N.; Pekal, R.; Pizzo, R.; Polatidis, A. G.; Reich, W.; Röttgering, H. J. A.; Rothkaehl, H.; Schwarz, D. J.; Smirnov, O.; Soida, M.; Steinmetz, M.; Tagger, M.; Thoudam, S.; Toribio, M. C.; Vocks, C.; van der Wiel, M. H. D.; Wijers, R. A. M. J.; Wucknitz, O.; Zarka, P.; Zucca, P.

    2018-05-01

    Context. Cassiopeia A is one of the best-studied supernova remnants. Its bright radio and X-ray emission is due to shocked ejecta. Cas A is rather unique in that the unshocked ejecta can also be studied: through emission in the infrared, the radio-active decay of 44Ti, and the low-frequency free-free absorption caused by cold ionised gas, which is the topic of this paper. Aims: Free-free absorption processes are affected by the mass, geometry, temperature, and ionisation conditions in the absorbing gas. Observations at the lowest radio frequencies can constrain a combination of these properties. Methods: We used Low Frequency Array (LOFAR) Low Band Antenna observations at 30-77 MHz and Very Large Array (VLA) L-band observations at 1-2 GHz to fit for internal absorption as parametrised by the emission measure. We simultaneously fit multiple UV-matched images with a common resolution of 17″ (this corresponds to 0.25 pc for a source at the distance of Cas A). The ample frequency coverage allows us separate the relative contributions from the absorbing gas, the unabsorbed front of the shell, and the absorbed back of the shell to the emission spectrum. We explored the effects that a temperature lower than the 100-500 K proposed from infrared observations and a high degree of clumping can have on the derived physical properties of the unshocked material, such as its mass and density. We also compiled integrated radio flux density measurements, fit for the absorption processes that occur in the radio band, and considered their effect on the secular decline of the source. Results: We find a mass in the unshocked ejecta of M = 2.95 ± 0.48 M⊙ for an assumed gas temperatureof T = 100 K. This estimate is reduced for colder gas temperatures and, most significantly, if the ejecta are clumped. We measure the reverse shock to have a radius of 114″± 6″ and be centred at 23:23:26, +58:48:54 (J2000). We also find that a decrease in the amount of mass in the unshocked ejecta

  12. Quench performance of a 4-m long Nb3Sn shell-type dipole coil

    Energy Technology Data Exchange (ETDEWEB)

    Chlachidze, G.; Ambrosio, G.; Andreev, N.; Barzi, E.; Bossert, R.; Carcagno, R.; Kashikhin, V.S.; Kashikhin, V.V.; Lamm, M.J.; Nobrega, F.; Novitski, I.; /Fermilab

    2008-08-01

    Fermilab has finished the first phase of Nb{sub 3}Sn technology scale up by testing 2-m and 4-m long shell-type dipole coils in a 'magnetic mirror' configuration. The 2-m long coil, made of Powder-in-Tube (PIT) Nb{sub 3}Sn strand, reached its short sample limit at a field level of 10 T. The 4-m long coil, made of advanced Nb{sub 3}Sn strand based on the Restack Rod Process (RRP) of 108/127 design, has been recently fabricated and tested. Coil test results at 4.5 K and 2.2 K are reported and discussed.

  13. A newly-recognized galactic supernova remnant with shell-type and filled-center features

    International Nuclear Information System (INIS)

    Barnes, D.J.; Turtle, A.J.

    1988-01-01

    While the number of galactic supernova remnants (SNRs) now known is fairly large (>150), the subset among these that are known to resemble the Crab Nebula is still distressingly small, about 15 or so. Thus any object that can be unambiguously included in this exclusive club forms a valuable addition to knowledge of this class. The authors report observations of a newly recognized nonthermal galactic object, G18.94-1.06, having all the hallmarks of the classical shell-type SNRs, while also appearing to have a filled-centre component located inside the shell. Among the known Crab-like remnants, about one third show this dual nature. This diagnosis of G18.94-1.06 is supported mainly by the variations in spectral index across the source, as seen between the two observation frequencies, 408 MHz and 5.0 GHz

  14. Polyaniline Coated Core-Shell Typed Stimuli-Responsive Microspheres and Their Electrorheology

    Directory of Open Access Journals (Sweden)

    Yu Zhen Dong

    2018-03-01

    Full Text Available Functional core-shell-structured particles have attracted considerable attention recently. This paper reviews the synthetic methods and morphologies of various electro-stimuli responsive polyaniline (PANI-coated core-shell-type microspheres, including PANI-coated Fe3O4, SiO2, Fe2O3, TiO2, poly(methyl methacrylate, poly(glycidyl methacrylate, and polystyrene along with their electrorheological (ER characteristics when prepared by dispersing these particles in an insulating medium. In addition to the various rheological characteristics and their analysis, such as shear stress and yield stress of their ER fluids, this paper summarizes some of the mechanisms proposed for ER fluids to further understand the responses of ER fluids to an externally applied electric field.

  15. Risk oriented analysis of the SNR-300

    International Nuclear Information System (INIS)

    Koeberlein, K.

    1982-01-01

    The Fact Finding Committee on 'Future Nuclear Power Policy' established by the 8th German Federal Parliament in its report of June 1980 among other items published the recommendation to commission a 'risk oriented analysis' of the SNR-300 in order to enable a pragmatic comparison to be made of the safety of the German prototype fast breeder reactor and a modern light water reactor (a Biblis B PWR). The Federal Minister for Research and Technology in August 1981 officially commissioned the Gesellschaft fuer Reaktorsicherheit (GRS) to conduct the study. Following a recommendation by the Fact Finding Committee, additional studies were performed also by a group of opponents of the breeder reactor. On the instigation of the group of opponents the delivery date of the study was altered several times and finally set at April 30, 1982. GRS submitted its report by this deadline. However, a joint report by the two groups could not be compiled, as had been requested by the client, because the contributions of the opponents were not made available until mid-May 1982 and then only as an 'interim report'. In summary, the GRS study indicates that the frequency and severity of major accidents is lower for the SNR-300 at the Kalkar site than for a PWR as covered in the German Nuclear Power Plant Risk Study. (orig.) [de

  16. Inelastic analysis of SNR-300 piping

    Energy Technology Data Exchange (ETDEWEB)

    Huebel, H [INTERATOM, Bergisch Gladbach (Germany); Di Luna, L J; Moy, G [Teledyne Engineering Services, Waltham, MA (United States)

    1983-05-01

    This paper investigates plasticity, creep, and elastic follow-up effects on a full size hot primary piping system of the German fast breeder reactor prototype, the SNR-300. A large model (327 elements, 419 nodes) of straight pipe, special elbow and hanger elements of the general purpose finite element program, MARC-CDC, is used to predict piping behavior for a heat-up, sodium loading-unloading-reloading cycle and other significant operating conditions. Included in this work are many time-dependent solution increments for a 5,000 hour creep period. Creep strains and relaxed stress results, after 5,000 hours, for the complete model are used with uniaxial and biaxial models and results to extrapolate conclusions for a 100,000 hour operating life. (author)

  17. Inelastic analysis of SNR-300 piping

    International Nuclear Information System (INIS)

    Huebel, H.; Di Luna, L.J.; Moy, G.

    1983-01-01

    This paper investigates plasticity, creep, and elastic follow-up effects on a full size hot primary piping system of the German fast breeder reactor prototype, the SNR-300. A large model (327 elements, 419 nodes) of straight pipe, special elbow and hanger elements of the general purpose finite element program, MARC-CDC, is used to predict piping behavior for a heat-up, sodium loading-unloading-reloading cycle and other significant operating conditions. Included in this work are many time-dependent solution increments for a 5,000 hour creep period. Creep strains and relaxed stress results, after 5,000 hours, for the complete model are used with uniaxial and biaxial models and results to extrapolate conclusions for a 100,000 hour operating life. (author)

  18. Main heat transfer components for SNR-300

    International Nuclear Information System (INIS)

    De Haas Van Dorsser, A.H.

    1976-01-01

    Early in the joint German-Belgium-Dutch fast breeder programme it was decided that all main components should be tested, if possible at full scale, before fabrication of the actual SNR-300 components. Descriptions are given of the results of testing, and subsequent modifications, of the pumps, intermediate heat exchangers, and steam generators. A full scale model of the primary pump, free surface vertical shaft centrifugal type, was constructed and tested in the 5000 cubic metres per hour pump test facility erected at Bensberg. A 70 MW model of an intermediate heat exchanger, straight tube type with floating head, was tested in the 50 MW steam generator test station at Hengelo. Also tested in the Hengelo facility was an almost full scale straight tube 50 MW steam generator and subsequently a 50 MW helical tube evaporator. The latter tests were of more than 3000 h operation and resulted in minor changes in design and manufacturing operation. (U.K.)

  19. Stratification in SNR-300 outlet plenum

    International Nuclear Information System (INIS)

    Reinders, R.

    1983-01-01

    In the inner outlet plenum of the SNR-300 under steady state conditions a large toroidal vortex is expected. The main flow passes through the gap between dipplate and shield vessel to the outer annular space. Only 3% of the flow pass the 24 emergency cooling holes, situated in the shield vessel. The sodium leaves the reactor tank through the 3 symmetrically arranged outlet nozzles. For a scram flow rates and temperatures are decreased simultaneously, so it is expected, that stratification occurs in the inner outlet plenum. A measure of stratification effects is the Archimedes Number Ar, which is the relation of buoyancy forces (negative) to kinetic energy. (The Archimedes Number is nearly identical with the Richardson Number). For values Ar>1 stratification can occur. Under the assumption of stratification the code TIRE was developed, which is only applicable for the period of time after some 50 sec after scram. This code serves for long term calculations. As the equations are very simple, it is a very fast code which gives the possibility to calculate transients for some hours real time. This code mainly has to take into account the pressure difference between inner plenum and outlet annulus caused by geodatic pressure. That force is in equilibrium with the pressure drop over the gap and holes in the shield vessel. For more detailed calculations of flow pattern and temperature distribution the code MIX and INKO 2T are applied. MIX was developed and validated at ANL, INKO 2T is a development of INTERATOM. INKO 2T is under validation. Mock up experiments were carried out with water to simulate the transient behavior of the SNR-300 outlet plenum. Calculations obtained by INKO 2T for steady state and the transient are shown for the flow pattern. Results of measurements also prove that stratification begins after about 30 sec. Measurements and detailed calculations show that it is admissible to use the code TIRE for the long term calculations. Calculations for a scram

  20. A Semi-Empirical SNR Model for Soil Moisture Retrieval Using GNSS SNR Data

    Directory of Open Access Journals (Sweden)

    Mutian Han

    2018-02-01

    Full Text Available The Global Navigation Satellite System-Interferometry and Reflectometry (GNSS-IR technique on soil moisture remote sensing was studied. A semi-empirical Signal-to-Noise Ratio (SNR model was proposed as a curve-fitting model for SNR data routinely collected by a GNSS receiver. This model aims at reconstructing the direct and reflected signal from SNR data and at the same time extracting frequency and phase information that is affected by soil moisture as proposed by K. M. Larson et al. This is achieved empirically through approximating the direct and reflected signal by a second-order and fourth-order polynomial, respectively, based on the well-established SNR model. Compared with other models (K. M. Larson et al., T. Yang et al., this model can improve the Quality of Fit (QoF with little prior knowledge needed and can allow soil permittivity to be estimated from the reconstructed signals. In developing this model, we showed how noise affects the receiver SNR estimation and thus the model performance through simulations under the bare soil assumption. Results showed that the reconstructed signals with a grazing angle of 5°–15° were better for soil moisture retrieval. The QoF was improved by around 45%, which resulted in better estimation of the frequency and phase information. However, we found that the improvement on phase estimation could be neglected. Experimental data collected at Lamasquère, France, were also used to validate the proposed model. The results were compared with the simulation and previous works. It was found that the model could ensure good fitting quality even in the case of irregular SNR variation. Additionally, the soil moisture calculated from the reconstructed signals was about 15% closer in relation to the ground truth measurements. A deeper insight into the Larson model and the proposed model was given at this stage, which formed a possible explanation of this fact. Furthermore, frequency and phase information

  1. Assessment of broadband SNR estimation for hearing aid applications

    DEFF Research Database (Denmark)

    May, Tobias; Kowalewski, Borys; Fereczkowski, Michal

    2017-01-01

    was systematically investigated. The most accurate approach utilized an estimation of the clean speech power spectral density (PSD) and the noisy speech power across a sliding window of 1280 ms and achieved an total SNR estimation error below 3 dB across a wide variety of background noises and input SNRs......An accurate estimation of the broadband input signal-to-noise ratio (SNR) is a prerequisite for many hearing-aid algorithms. An extensive comparison of three SNR estimation algorithms was performed. Moreover, the influence of the duration of the analysis window on the SNR estimation performance...

  2. Stimulated Respiration and Net Photosynthesis in Cassiopeia sp. during Glucose Enrichment Suggests in hospite CO2 Limitation of Algal Endosymbionts

    KAUST Repository

    Radecker, Nils; Pogoreutz, Claudia; Wild, Christian; Voolstra, Christian R.

    2017-01-01

    such as corals is CO -limited. Here we show that glucose enrichment stimulates respiration and gross photosynthesis rates by 80 and 140%, respectively, in the symbiotic upside-down jellyfish Cassiopeia sp. from the Central Red Sea. Our findings show that glucose

  3. A CHANDRA OBSERVATION OF SNR 0540 - 697

    International Nuclear Information System (INIS)

    Seward, F. D.; Williams, R. M.; Chu, Y.-H.; Gruendl, R. A.; Dickel, J. R.

    2010-01-01

    This paper describes a Chandra observation of SNR 0540 - 697 within the H II complex N159 in the Large Magellanic Cloud (LMC). Scattering from the nearby bright source LMC X-1, which obscures the western edge of the remnant, has been removed. Larger than previously believed, the 2.'0 x 2.'8 remnant is defined by optical filaments and two lobes of X-ray emission. A band of intervening material absorbs X-rays from the central part of the remnant. The N Lobe of the remnant is relatively bright and well defined, while emission from the S Lobe is much weaker. There is structure within the N Lobe but no clear X-ray emission from an outer shell indicating a shock in the interstellar medium. The X-ray spectrum is thermal with emission lines from Fe, Mg, and Si. The observed temperature and luminosity of the hot gas are 0.6 keV and 6 x 10 35 erg s -1 , respectively. These are consistent with characteristics expected for older remnants. There is also diffuse thermal X-ray emission north of N159 extending into N160, evidence for a larger remnant or bubble.

  4. A Family of Maximum SNR Filters for Noise Reduction

    DEFF Research Database (Denmark)

    Huang, Gongping; Benesty, Jacob; Long, Tao

    2014-01-01

    significantly increase the SNR but at the expense of tremendous speech distortion. As a consequence, the speech quality improvement, measured by the perceptual evaluation of speech quality (PESQ) algorithm, is marginal if any, regardless of the number of microphones used. In the STFT domain, the maximum SNR...

  5. Synchronization of OFDM at low SNR over an AWGN channel

    NARCIS (Netherlands)

    Kokkeler, Andre B.J.; Smit, Gerardus Johannes Maria; Dimitrova, D.C.; Blom, K.C.H.; Meratnia, Nirvana

    2011-01-01

    This paper is based on Extended Symbol OFDM (ES-OFDM) where symbols are extended in time. This way ES-OFDM can operate at low SNR. Each doubling of the symbol length improves the SNR performance by 3 dB in case of a coherent receiver. One of the basic questions is how to synchronize to signals far

  6. Low-SNR Capacity of MIMO Optical Intensity Channels

    KAUST Repository

    Chaaban, Anas

    2017-09-18

    The capacity of the multiple-input multiple-output (MIMO) optical intensity channel is studied, under both average and peak intensity constraints. We focus on low SNR, which can be modeled as the scenario where both constraints proportionally vanish, or where the peak constraint is held constant while the average constraint vanishes. A capacity upper bound is derived, and is shown to be tight at low SNR under both scenarios. The capacity achieving input distribution at low SNR is shown to be a maximally-correlated vector-binary input distribution. Consequently, the low-SNR capacity of the channel is characterized. As a byproduct, it is shown that for a channel with peak intensity constraints only, or with peak intensity constraints and individual (per aperture) average intensity constraints, a simple scheme composed of coded on-off keying, spatial repetition, and maximum-ratio combining is optimal at low SNR.

  7. Low-SNR Capacity of MIMO Optical Intensity Channels

    KAUST Repository

    Chaaban, Anas; Rezki, Zouheir; Alouini, Mohamed-Slim

    2017-01-01

    The capacity of the multiple-input multiple-output (MIMO) optical intensity channel is studied, under both average and peak intensity constraints. We focus on low SNR, which can be modeled as the scenario where both constraints proportionally vanish, or where the peak constraint is held constant while the average constraint vanishes. A capacity upper bound is derived, and is shown to be tight at low SNR under both scenarios. The capacity achieving input distribution at low SNR is shown to be a maximally-correlated vector-binary input distribution. Consequently, the low-SNR capacity of the channel is characterized. As a byproduct, it is shown that for a channel with peak intensity constraints only, or with peak intensity constraints and individual (per aperture) average intensity constraints, a simple scheme composed of coded on-off keying, spatial repetition, and maximum-ratio combining is optimal at low SNR.

  8. Bellows for the DEBENE SNR-Project

    International Nuclear Information System (INIS)

    Warmerdam, C.P.; Lievense, K.

    1980-01-01

    Liquid Metal cooled Fast Breeder Reactors (LMFBR) are designed to work at temperature levels up to 600 deg C. The components and piping systems are submitted to changing temperature fields varying between room temperature and temperatures in operational, incidental or accidental conditions. Bellows are generally used to introduce a higher flexibility of piping systems and for the leak tight connection of components with relative displacements. The total piping length of a loop type LMFBR is principally determined by thermal expansion requirements. The application of bellows could reduce piping length and building volume. In certain cases a reduction of the nozzle loads can be realized. In cooperation between Neratoom and TNO a feasibility study concerning the applicability of bellows as compensating elements in a primary piping system of a loop type LMFBR has been studied. Different configurations are compared with each other. TNO has performed dimension calculations, with the criteria from the ASME Code Section III and Code Case N-47, as guideline. In this paper a review of the results of these calculations will be given. The development of the expansion bellows, in the shells of the SNR 300 straight tube steam generators to compensate the difference in the thermal expansion between shell and tube bundle, has been concluded by a series of full scale fatigue tests under design conditions, except for the sodium environment. In this paper a summary is given of these tests and of the procedure used to prove that the bellows in the actual steam generators will withstand the design fatigue loads. (This is the LMFBR project of the DEBENE states: Federal Republic of Germany, Belgium and The Netherlands)

  9. Armature reaction of permanent magnet-excited small dc motors with shell type magnets and possibilities of power increase

    Energy Technology Data Exchange (ETDEWEB)

    Gutt, H J; Tran, Q N

    1983-07-01

    Permanent magnet-excited small dc motors allow an increase of power up to 30% compared with present permanent excited motors. The calculation of immediate irreversible demagnetization of the air-gap situated shell type magnets is necessary for a good motor design. Numerical calculated field line plots show the critical zones of the irreversible demagnetization at high armature reaction and refer how to avoid the flux loss and to increase the motor power.

  10. Optimum SNR data compression in hardware using an Eigencoil array.

    Science.gov (United States)

    King, Scott B; Varosi, Steve M; Duensing, G Randy

    2010-05-01

    With the number of receivers available on clinical MRI systems now ranging from 8 to 32 channels, data compression methods are being explored to lessen the demands on the computer for data handling and processing. Although software-based methods of compression after reception lessen computational requirements, a hardware-based method before the receiver also reduces the number of receive channels required. An eight-channel Eigencoil array is constructed by placing a hardware radiofrequency signal combiner inline after preamplification, before the receiver system. The Eigencoil array produces signal-to-noise ratio (SNR) of an optimal reconstruction using a standard sum-of-squares reconstruction, with peripheral SNR gains of 30% over the standard array. The concept of "receiver channel reduction" or MRI data compression is demonstrated, with optimal SNR using only four channels, and with a three-channel Eigencoil, superior sum-of-squares SNR was achieved over the standard eight-channel array. A three-channel Eigencoil portion of a product neurovascular array confirms in vivo SNR performance and demonstrates parallel MRI up to R = 3. This SNR-preserving data compression method advantageously allows users of MRI systems with fewer receiver channels to achieve the SNR of higher-channel MRI systems. (c) 2010 Wiley-Liss, Inc.

  11. The SNR-300 steam generator small leak detection system

    International Nuclear Information System (INIS)

    Dumm, K.

    1984-01-01

    Small leak detection in the SNR-300 steam generator moduls is achieved by hydrogen meters. Development and design of the Nickel membrane - ion getter pump combination are described and sensitivity requests derived. Results of calibration tests by water/steam injections in a sodium loop are presented. The arrangement and interconnection of signals in SNR-300 are given and possibilities for inservice calibrations are discussed, supported by long time operation tests in the KNK-reactor plant. (author)

  12. Rapid Cooling of the Neutron Star in Cassiopeia A Triggered by Neutron Superfluidity in Dense Matter

    International Nuclear Information System (INIS)

    Page, Dany; Prakash, Madappa; Lattimer, James M.; Steiner, Andrew W.

    2011-01-01

    We propose that the observed cooling of the neutron star in Cassiopeia A is due to enhanced neutrino emission from the recent onset of the breaking and formation of neutron Cooper pairs in the 3 P 2 channel. We find that the critical temperature for this superfluid transition is ≅0.5x10 9 K. The observed rapidity of the cooling implies that protons were already in a superconducting state with a larger critical temperature. This is the first direct evidence that superfluidity and superconductivity occur at supranuclear densities within neutron stars. Our prediction that this cooling will continue for several decades at the present rate can be tested by continuous monitoring of this neutron star.

  13. Asymmetries in core-collapse supernovae from maps of radioactive 44Ti in Cassiopeia A

    DEFF Research Database (Denmark)

    Grefenstette, B W; Harrison, F A; Boggs, S E

    2014-01-01

    Asymmetry is required by most numerical simulations of stellar core-collapse explosions, but the form it takes differs significantly among models. The spatial distribution of radioactive (44)Ti, synthesized in an exploding star near the boundary between material falling back onto the collapsing...... core and that ejected into the surrounding medium, directly probes the explosion asymmetries. Cassiopeia A is a young, nearby, core-collapse remnant from which (44)Ti emission has previously been detected but not imaged. Asymmetries in the explosion have been indirectly inferred from a high ratio...... and iron X-ray emission, the latter being visible only in shock-heated material. The observed spatial distribution rules out symmetric explosions even with a high level of convective mixing, as well as highly asymmetric bipolar explosions resulting from a fast-rotating progenitor. Instead...

  14. Multiengine Speech Processing Using SNR Estimator in Variable Noisy Environments

    Directory of Open Access Journals (Sweden)

    Ahmad R. Abu-El-Quran

    2012-01-01

    Full Text Available We introduce a multiengine speech processing system that can detect the location and the type of audio signal in variable noisy environments. This system detects the location of the audio source using a microphone array; the system examines the audio first, determines if it is speech/nonspeech, then estimates the value of the signal to noise (SNR using a Discrete-Valued SNR Estimator. Using this SNR value, instead of trying to adapt the speech signal to the speech processing system, we adapt the speech processing system to the surrounding environment of the captured speech signal. In this paper, we introduced the Discrete-Valued SNR Estimator and a multiengine classifier, using Multiengine Selection or Multiengine Weighted Fusion. Also we use the SI as example of the speech processing. The Discrete-Valued SNR Estimator achieves an accuracy of 98.4% in characterizing the environment's SNR. Compared to a conventional single engine SI system, the improvement in accuracy was as high as 9.0% and 10.0% for the Multiengine Selection and Multiengine Weighted Fusion, respectively.

  15. The single SNR fuel assembly container (ESBB) to transport unirradiated SNR 300 fuel assemblies

    International Nuclear Information System (INIS)

    Hilbert, F.; Hottenrott, G.

    1998-01-01

    In this paper a new type B(U) package design is presented. The Single SNR Fuel Assembly Container (ESBB) is designed for the transport and storage of a single SNR 300 fuel assembly. This package is the main component for the future interim storage of the fuel assemblies in heavy storage casks. Its benefits are that it is compatible with the Category I transport system of Nuclear Cargo + Service NCS) used in Germany and that it can be easily handled at the current storage locations as well as in an interim storage facility. In total 205 fuel assemblies are currently stored in Hanau, Germany and Dounreay, U.K. Former studies have shown, that heavy transport and storage casks can be handled there only with considerable efforts. But the required category I transport to an interim storage is not reasonably feasible. To overcome these problems the ESBB was designed. It consists of a stainless steel tube with welded bottom, a welded plug as closure system and shock absorbers 26 packages at maximum can be transported in one batch with the NCS security vehicle. The safety analysis shows that the package complies with IAEA 1996. Standard calculations methods and computer codes like HEATING 7.2 (Childs 1993) have been used for the analysis. Criticality safety assessment is based on conservative assumptions as required in IAEA 1996. Drop tests carried out by BAM will be used to verify the design. These tests are scheduled for mid 1998. For the validation of the design prototypes have already been manufactured. Handling tests show that the design complies with the requirements. Preliminary drop tests show that the certification drop tests will be passed positively. (authors)

  16. Production of core–shell type conducting FTO/TiO2 photoanode for dye sensitized solar cells

    International Nuclear Information System (INIS)

    Icli, Kerem Cagatay; Yavuz, Halil Ibrahim; Ozenbas, Macit

    2014-01-01

    Core–shell type photoanode composed of electrically conducting fluorine doped tin dioxide (FTO) matrix and TiO 2 shell layer was prepared and applied in dye sensitized solar cells. Effects of fluorine doping on tin dioxide based cells and precursor material on shell layer were investigated. Fluorine doped tin dioxide nanoparticles were synthesized under hydrothermal conditions and resistivity value down to 17 Ω cm was achieved. Cells constructed from FTO nanoparticles show enhanced performance compared to intrinsic SnO 2 . Deposition of thin blocking TiO 2 layers was conducted using ammonium hexafluorotitanate and titanium tetrachloride aqueous solutions for different dipping durations which yielded significant deviations in the layer morphology and affected cell parameters. Best results were obtained with titanium tetrachloride treated cells giving 11.51 mA/cm 2 photocurrent density and they were comparable with that of pure TiO 2 based cells prepared under identical conditions. - Graphical abstract: Core shell type FTO matrix was formed as TiO 2 is the shell material to create a blocking layer between FTO core and the electrolyte for suppressed recombination and efficiency enhancement. Display Omitted - Highlights: • Core–shell type photoanode using conducting FTO matrix and TiO 2 shell was prepared. • FTO nanoparticles having resistivity value down to 17 Ω cm was achieved. • Best cell parameters were obtained with TiCl 4 treated cells. • FTO nanoparticle based cells show enhanced performance compared to intrinsic SnO 2 . • Photocurrent in TiCl 4 treated cells is found as comparable to pure TiO 2 cell

  17. Production of core–shell type conducting FTO/TiO{sub 2} photoanode for dye sensitized solar cells

    Energy Technology Data Exchange (ETDEWEB)

    Icli, Kerem Cagatay [Micro and Nanotechnology Graduate Program, Middle East Technical University, Dumlupinar Bulvari, 06800 Ankara (Turkey); Center for Solar Energy Research and Applications (GUNAM), Middle East Technical University, Dumlupinar Bulvari, 06800 Ankara (Turkey); Yavuz, Halil Ibrahim [Center for Solar Energy Research and Applications (GUNAM), Middle East Technical University, Dumlupinar Bulvari, 06800 Ankara (Turkey); Department of Metallurgical and Materials Engineering, Middle East Technical University, Dumlupinar Bulvari, 06800 Ankara (Turkey); Ozenbas, Macit, E-mail: ozenbas@metu.edu.tr [Center for Solar Energy Research and Applications (GUNAM), Middle East Technical University, Dumlupinar Bulvari, 06800 Ankara (Turkey); Department of Metallurgical and Materials Engineering, Middle East Technical University, Dumlupinar Bulvari, 06800 Ankara (Turkey)

    2014-02-15

    Core–shell type photoanode composed of electrically conducting fluorine doped tin dioxide (FTO) matrix and TiO{sub 2} shell layer was prepared and applied in dye sensitized solar cells. Effects of fluorine doping on tin dioxide based cells and precursor material on shell layer were investigated. Fluorine doped tin dioxide nanoparticles were synthesized under hydrothermal conditions and resistivity value down to 17 Ω cm was achieved. Cells constructed from FTO nanoparticles show enhanced performance compared to intrinsic SnO{sub 2}. Deposition of thin blocking TiO{sub 2} layers was conducted using ammonium hexafluorotitanate and titanium tetrachloride aqueous solutions for different dipping durations which yielded significant deviations in the layer morphology and affected cell parameters. Best results were obtained with titanium tetrachloride treated cells giving 11.51 mA/cm{sup 2} photocurrent density and they were comparable with that of pure TiO{sub 2} based cells prepared under identical conditions. - Graphical abstract: Core shell type FTO matrix was formed as TiO{sub 2} is the shell material to create a blocking layer between FTO core and the electrolyte for suppressed recombination and efficiency enhancement. Display Omitted - Highlights: • Core–shell type photoanode using conducting FTO matrix and TiO{sub 2} shell was prepared. • FTO nanoparticles having resistivity value down to 17 Ω cm was achieved. • Best cell parameters were obtained with TiCl{sub 4} treated cells. • FTO nanoparticle based cells show enhanced performance compared to intrinsic SnO{sub 2}. • Photocurrent in TiCl{sub 4} treated cells is found as comparable to pure TiO{sub 2} cell.

  18. A CLT on the SNR of Diagonally Loaded MVDR Filters

    Science.gov (United States)

    Rubio, Francisco; Mestre, Xavier; Hachem, Walid

    2012-08-01

    This paper studies the fluctuations of the signal-to-noise ratio (SNR) of minimum variance distorsionless response (MVDR) filters implementing diagonal loading in the estimation of the covariance matrix. Previous results in the signal processing literature are generalized and extended by considering both spatially as well as temporarily correlated samples. Specifically, a central limit theorem (CLT) is established for the fluctuations of the SNR of the diagonally loaded MVDR filter, under both supervised and unsupervised training settings in adaptive filtering applications. Our second-order analysis is based on the Nash-Poincar\\'e inequality and the integration by parts formula for Gaussian functionals, as well as classical tools from statistical asymptotic theory. Numerical evaluations validating the accuracy of the CLT confirm the asymptotic Gaussianity of the fluctuations of the SNR of the MVDR filter.

  19. Small leak detection requirements for SNR-300 steam generator operation

    International Nuclear Information System (INIS)

    Dumm, K.

    1975-01-01

    The leak detection philosophy of the SNR-300 steam generators is described. Due to operational demands small leaks have already to be detectable at a stage where secondary tube damage has not yet occurred. The requirements on a leak detection instrument are developed and the instrument itself is described. (author)

  20. Present status and further objectives of SNR fuel element development

    International Nuclear Information System (INIS)

    Karsten, G.

    Within the scope of the fuel element development program for the fast breeder reactor SNR 300, 500 fuel pins have been irradiated since 1964, 250 of them in fast flux. Results indicate that the maximum nominal target burnup of 90.000 MWd/t of the SNR 300 Mk Ia possibly can be reached. The main problems, which arise from clad swelling and internal corrosion, can be met by special pretreatments of the austenitic stainless steel 1.4970 and a fuel stoichiometry of 1.97. Beyond this target burnup either material property improvements have to be made or burnup reductions have to be accepted. The remaining questions can be answered by the use of the SNR 300 as a test reactor. A further target is the development of a carbide fuel element, which should be very effective in a high power breeder reactor because of its low fissile inventory and high breeding gain. This development program will also be finalized in the SNR 300. (U.S.)

  1. Weighted-SNR-based fair scheduling for uplink OFDMA

    KAUST Repository

    Ma, Yao

    2009-11-01

    In this paper, we study the sum rate maximization algorithms with long-term proportional rate fairness (PRF) for uplink orthogonal frequency division multiple access (OFDMA) systems. In contrast to the rate-maximization schemes which used short-term PRF in the literature, we propose to use a selective multiuser diversity (SMuD) scheme to achieve a long-term PRF and improved sum rate performance. This scheme implements weighted channel signal-to-noise ratio (w-SNR)-based ranking for user selection on each subchannel, and then uses either water-filling (WF) or equal power allocation (EPA) along the assigned channels of each user. Both offline and online methods to find the optimal SNR weight factors are designed to achieve the target proportional rates for different users. The offline optimization technique requires to know the channel distribution information (CDI) at the scheduler. The online method uses the weight adaption combined with individual user rate tracking, which avoids the need to know the CDI. Analytical throughput metrics for the proposed w-SNR scheme with WF and EPA over Rayleigh channels are derived, and verified by simulations. Simulation results show that the proposed w-SNR PRF scheme can achieve significantly higher sum rates than the frequency diversity-based short-term and long-term fairness schemes. Besides the improved performance, the proposed schemes have a low complexity which is linear to numbers of users and subchannels.

  2. Small leak detection requirements for SNR-300 steam generator operation

    Energy Technology Data Exchange (ETDEWEB)

    Dumm, K

    1975-07-01

    The leak detection philosophy of the SNR-300 steam generators is described. Due to operational demands small leaks have already to be detectable at a stage where secondary tube damage has not yet occurred. The requirements on a leak detection instrument are developed and the instrument itself is described. (author)

  3. A DECADE-BASELINE STUDY OF THE PLASMA STATES OF EJECTA KNOTS IN CASSIOPEIA A

    Energy Technology Data Exchange (ETDEWEB)

    Rutherford, John; Dewey, Daniel; Figueroa-Feliciano, Enectali; Heine, Sarah N. T.; Canizares, C. R.; Bastien, Fabienne A.; Sato, Kosuke, E-mail: enectali@mit.edu, E-mail: jmrv@mit.edu [Department of Physics and Kavli Institute for Astrophysics and Space Research, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States)

    2013-05-20

    We present the analysis of 21 bright X-ray knots in the Cassiopeia A supernova remnant from observations spanning 10 yr. We performed a comprehensive set of measurements to reveal the kinematic and thermal state of the plasma in each knot, using a combined analysis of two high energy resolution High Energy Transmission Grating (HETG) and four medium energy resolution Advanced CCD Imaging Spectrometer (ACIS) sets of spectra. The ACIS electron temperature estimates agree with the HETG-derived values for approximately half of the knots studied, yielding one of the first comparisons between high resolution temperature estimates and ACIS-derived temperatures. We did not observe the expected spectral evolution-predicted from the ionization age and density estimates for each knot-in all but three of the knots studied. The incompatibility of these measurements with our assumptions has led us to propose a dissociated ejecta model, with the metals unmixed inside the knots, which could place strong constraints on supernova mixing models.

  4. Scattered-Light Echoes from the Historical Galactic Supernovae Cassiopeia A and Tycho (SN 1572)

    Energy Technology Data Exchange (ETDEWEB)

    Rest, A; Welch, D L; Suntzeff, N B; Oaster, L; Lanning, H; Olsen, K; Smith, R C; Becker, A C; Bergmann, M; Challis, P; Clocchiatti, A; Cook, K H; Damke, G; Garg, A; Huber, M E; Matheson, T; Minniti, D; Prieto, J L; Wood-Vasey, W M

    2008-05-06

    We report the discovery of an extensive system of scattered light echo arclets associated with the recent supernovae in the local neighborhood of the Milky Way: Tycho (SN 1572) and Cassiopeia A. Existing work suggests that the Tycho SN was a thermonuclear explosion while the Cas A supernova was a core collapse explosion. Precise classifications according to modern nomenclature require spectra of the outburst light. In the case of ancient SNe, this can only be done with spectroscopy of their light echo, where the discovery of the light echoes from the outburst light is the first step. Adjacent light echo positions suggest that Cas A and Tycho may share common scattering dust structures. If so, it is possible to measure precise distances between historical Galactic supernovae. On-going surveys that alert on the development of bright scattered-light echo features have the potential to reveal detailed spectroscopic information for many recent Galactic supernovae, both directly visible and obscured by dust in the Galactic plane.

  5. Scattered-Light Echoes from the Historical Galactic Supernovae Cassiopeia A and Tycho (SN 1572)

    International Nuclear Information System (INIS)

    Rest, A.; Welch, D.L.; Suntzeff, N.B.; Oaster, L.; Lanning, H.; Olsen, K.; Smith, R.C.; Becker, A.C.; Bergmann, M.; Challis, P.; Clocchiatti, A.; Cook, K.H.; Damke, G.; Garg, A.; Huber, M.E.; Matheson, T.; Minniti, D.; Prieto, J.L.; Wood-Vasey, W.M.

    2008-01-01

    We report the discovery of an extensive system of scattered light echo arclets associated with the recent supernovae in the local neighborhood of the Milky Way: Tycho (SN 1572) and Cassiopeia A. Existing work suggests that the Tycho SN was a thermonuclear explosion while the Cas A supernova was a core collapse explosion. Precise classifications according to modern nomenclature require spectra of the outburst light. In the case of ancient SNe, this can only be done with spectroscopy of their light echo, where the discovery of the light echoes from the outburst light is the first step. Adjacent light echo positions suggest that Cas A and Tycho may share common scattering dust structures. If so, it is possible to measure precise distances between historical Galactic supernovae. On-going surveys that alert on the development of bright scattered-light echo features have the potential to reveal detailed spectroscopic information for many recent Galactic supernovae, both directly visible and obscured by dust in the Galactic plane

  6. Image of the Supernova Remnant Cassiopeia A Taken by the High Energy Astronomy Observatory (HEAO)-2

    Science.gov (United States)

    1980-01-01

    This x-ray photograph of the Supernova remnant Cassiopeia A, taken with the High Energy Astronomy Observatory (HEAO) 2/Einstein Observatory, shows that the regions with fast moving knots of material in the expanding shell are bright and clear. A faint x-ray halo, just outside the bright shell, is interpreted as a shock wave moving ahead of the expanding debris. The HEAO-2, the first imaging and largest x-ray telescope built to date, was capable of producing actual photographs of x-ray objects. Shortly after launch, the HEAO-2 was nicknamed the Einstein Observatory by its scientific experimenters in honor of the centernial of the birth of Albert Einstein, whose concepts of relativity and gravitation have influenced much of modern astrophysics, particularly x-ray astronomy. The HEAO-2, designed and developed by TRW, Inc. under the project management of the Marshall Space Flight Center, was launched aboard an Atlas/Centaur launch vehicle on November 13, 1978.

  7. Image of the Supernova Cassiopeia Taken by the High Energy Astronomy Observatory (HEAO)-2

    Science.gov (United States)

    1980-01-01

    This supernova in the constellation Cassiopeia was observed by Tycho Brahe in 1572. In this x-ray image from the High Energy Astronomy Observatory (HEAO-2/Einstein Observatory produced by nearly a day of exposure time, the center region appears filled with emissions that can be resolved into patches or knots of material. However, no central pulsar or other collapsed object can be seen. The HEAO-2, the first imaging and largest x-ray telescope built to date, was capable of producing actual photographs of x-ray objects. Shortly after launch, the HEAO-2 was nicknamed the Einstein Observatory by its scientific experimenters in honor of the centernial of the birth of Albert Einstein, whose concepts of relativity and gravitation have influenced much of modern astrophysics, particularly x-ray astronomy. The HEAO-2, designed and developed by TRW, Inc. under the project management of the Marshall Space Flight Center, was launched aboard an Atlas/Centaur launch vehicle on November 13, 1978.

  8. Mapping low-frequency carbon radio recombination lines towards Cassiopeia A at 340, 148, 54, and 43 MHz

    Science.gov (United States)

    Salas, P.; Oonk, J. B. R.; van Weeren, R. J.; Wolfire, M. G.; Emig, K. L.; Toribio, M. C.; Röttgering, H. J. A.; Tielens, A. G. G. M.

    2018-04-01

    Quantitative understanding of the interstellar medium requires knowledge of its physical conditions. Low-frequency carbon radio recombination lines (CRRLs) trace cold interstellar gas and can be used to determine its physical conditions (e.g. electron temperature and density). In this work, we present spatially resolved observations of the low-frequency (≤390 MHz) CRRLs centred around C268α, C357α, C494α, and C539α towards Cassiopeia A on scales of ≤1.2 pc. We compare the spatial distribution of CRRLs with other interstellar medium tracers. This comparison reveals a spatial offset between the peak of the CRRLs and other tracers, which is very characteristic for photodissociation regions and that we take as evidence for CRRLs being preferentially detected from the surfaces of molecular clouds. Using the CRRLs, we constrain the gas electron temperature and density. These constraints on the gas conditions suggest variations of less than a factor of 2 in pressure over ˜1 pc scales, and an average hydrogen density of 200-470 cm-3. From the electron temperature and density maps, we also constrain the ionized carbon emission measure, column density, and path length. Based on these, the hydrogen column density is larger than 1022 cm-2, with a peak of ˜4 × 1022 cm-2 towards the south of Cassiopeia A. Towards the southern peak, the line-of-sight length is ˜40 pc over a ˜2 pc wide structure, which implies that the gas is a thin surface layer on a large (molecular) cloud that is only partially intersected by Cassiopeia A. These observations highlight the utility of CRRLs as tracers of low-density extended H I and CO-dark gas halo's around molecular clouds.

  9. The Use of Multiwavelength Archival Observational Data for Scientific Discoveries: a Case of the Supernova Remnant Cassiopeia A

    Directory of Open Access Journals (Sweden)

    Docenko Dmitrijs

    2012-12-01

    Full Text Available Most of the high-quality astronomical data after a proprietary period of typically one year are provided to open access, allowing researchers to complement their observations with the archival data in other wavelength bands, thus improving quality of the data analysis. This paper presents one example of such a use - studies of the reverse shock front passing through an oxygen-rich material in the young supernova remnant Cassiopeia A. The paper is based on the contribution to the “Baltic Applied Astroinformatics and Space Data Processing” conference, held on 2012 May 7-8 in Ventspils, Latvia.

  10. SNR Estimation in Linear Systems with Gaussian Matrices

    KAUST Repository

    Suliman, Mohamed Abdalla Elhag; Alrashdi, Ayed; Ballal, Tarig; Al-Naffouri, Tareq Y.

    2017-01-01

    This letter proposes a highly accurate algorithm to estimate the signal-to-noise ratio (SNR) for a linear system from a single realization of the received signal. We assume that the linear system has a Gaussian matrix with one sided left correlation. The unknown entries of the signal and the noise are assumed to be independent and identically distributed with zero mean and can be drawn from any distribution. We use the ridge regression function of this linear model in company with tools and techniques adapted from random matrix theory to achieve, in closed form, accurate estimation of the SNR without prior statistical knowledge on the signal or the noise. Simulation results show that the proposed method is very accurate.

  11. SNR Estimation in Linear Systems with Gaussian Matrices

    KAUST Repository

    Suliman, Mohamed Abdalla Elhag

    2017-09-27

    This letter proposes a highly accurate algorithm to estimate the signal-to-noise ratio (SNR) for a linear system from a single realization of the received signal. We assume that the linear system has a Gaussian matrix with one sided left correlation. The unknown entries of the signal and the noise are assumed to be independent and identically distributed with zero mean and can be drawn from any distribution. We use the ridge regression function of this linear model in company with tools and techniques adapted from random matrix theory to achieve, in closed form, accurate estimation of the SNR without prior statistical knowledge on the signal or the noise. Simulation results show that the proposed method is very accurate.

  12. Future development LMFBR-steam generators SNR2

    International Nuclear Information System (INIS)

    Essebaggers, J.; Pors, J.G.

    1975-01-01

    The development work for steam generators for large LMFBR plants by Neratoom will be reviewed consisting of: 1. Development engineering information. 2. Concept select studies followed by conceptual designs of selected models. 3. Development manufacturing techniques. 4. Detail design of a prototype unit. 5. Testing of sub-constructions for prototype steam generators. In this presentation item 1 and 2 above will be high lighted, identifying the development work for the SNR-2 steam generators on short term basis. (author)

  13. IVA2 verification: Expansion phase experiment in SNR geometry

    International Nuclear Information System (INIS)

    Kolev, N.I.

    1987-09-01

    Using the IVA2/005 computer code the SNR model explosion experiment SGI-09-1 was numerically simulated. The experiment consists of high pressure gas injection into a low pressure liquid pool with a free surface in a cylindrical geometry with internals. Bubble formation and pressure history as a function of time was predicted and compared with the experimental observation. A good agreement between theory and experiment was obtained. Numerical diffusion and its influence on the results are discussed. (orig.) [de

  14. Safety and risk assessments for the SNR 300

    International Nuclear Information System (INIS)

    Maschek, W.; Froehlich, R.; Jacobs, H.; Schikorr, M.; Heusener, G.; Caldarola, L.; Royl, P.; Struwe, D.

    1983-01-01

    Under the official inquiry ''Future Nuclear Energy Policies'', KfK have carried out a number of studies concerning the hazards arising from core-destructive accidents at the SNR-300 reactor. Among these, there was the so-called ''Upper Limit Study'' providing a critical evaluation of literature on all research done on core-destructive accidents (Bethe-Tait excursion) with a high mechanic energy release potential; the other one was the so-called ''SAI Study'' (a cooperation of KfK, Science Applications, Inc. (SAI) and Interatom (IA)) which investigated the hazards of an uncontrolled coolant flow rate disturbance occurring in the SNR-300 reactor. KfK also took part in the analysis of hazards comparing the SNR-300 reactor with an LWR-type reactor like the one at Biblis B, ordered by the Federal Ministry of Research and Technology (BMFT). These studies have already been dealt with KfK-Nachrichten, 14th annual set issue 4/1982. The article on hand summarizes and evaluates once more the most important results. (orig./RW) [de

  15. COMPARISON OF DIVERSITY OF TYPE IIB SUPERNOVAE WITH ASYMMETRY IN CASSIOPEIA A USING LIGHT ECHOES

    Energy Technology Data Exchange (ETDEWEB)

    Finn, Kieran; Bianco, Federica B.; Modjaz, Maryam; Liu, Yu-Qian [Center for Cosmology and Particle Physics, New York University, New York, NY 10003 (United States); Rest, Armin [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States)

    2016-10-20

    We compare the diversity of spectral line velocities in a large sample of type IIb supernovae (SNe IIb) with the expected asphericity in the explosion, as measured from the light echoes (LEs) of Cassiopeia A (Cas A), which was a historical galactic SN IIb. We revisit the results of Rest et al., who used LEs to observe Cas A from multiple lines of sight and hence determine its asphericity, as seen in the velocity of three spectral lines (He i λ 5876, H α , and the Ca ii near-infrared (NIR) triplet). We confirm and improve on this measurement by reproducing the effect of the LEs in the spectra of several extragalactic SNe IIb found in the literature as well as mean SN IIb spectra recently created by Liu et al. and comparing these to the observed light echo spectra of Cas A, including their associated uncertainties. In order to quantify the accuracy of this comparison, we smooth the light echo spectra of Cas A using Gaussian processes and use a Monte Carlo method to measure the absorption velocities of these three features in the spectra. We then test the hypothesis that the diversity of ejecta velocities seen in SNe IIb can be explained by asphericity. We do this by comparing the range of velocities seen in the different LEs, and hence different lines of sight, of Cas A to that seen in the population of SNe IIb. We conclude that these two ranges are of the same order and thus asphericity could be enough to explain the diversity in the expansion velocity alone.

  16. Multifrequency radio observations of a SNR in the LMC: The case of SNR J0527-6549 (DEM l204

    Directory of Open Access Journals (Sweden)

    Bozzetto L.M.

    2010-01-01

    Full Text Available We present a detailed study and results of new Australia Telescope Compact Array (ATCA observations of supernova remnant SNR J0527-6549. This Large Magellanic Cloud (LMC object follows a typical supernova remnant (SNR horseshoe morphology with a diameter of D=(66×58±1 pc which is among the largest SNRs in the LMC. Its relatively large size indicates older age while a steeper than expected radio spectral index of α=-0.92±0.11 is more typical of younger and energetic SNRs. Also, we report detections of regions with a high order of polarization at a peak value of ~54%±17% at 6 cm.

  17. Stimulated Respiration and Net Photosynthesis in Cassiopeia sp. during Glucose Enrichment Suggests in hospite CO2 Limitation of Algal Endosymbionts

    KAUST Repository

    Radecker, Nils

    2017-08-15

    The endosymbiosis between cnidarians and dinoflagellates of the genus Symbiodinium is key to the high productivity of tropical coral reefs. In this endosymbiosis, Symbiodinium translocate most of their photosynthates to their animal host in exchange for inorganic nutrients. Among these, carbon dioxide (CO ) derived fromhost respiration helps to meet the carbon requirements to sustain photosynthesis of the dinoflagellates. Nonetheless, recent studies suggest that productivity in symbiotic cnidarians such as corals is CO -limited. Here we show that glucose enrichment stimulates respiration and gross photosynthesis rates by 80 and 140%, respectively, in the symbiotic upside-down jellyfish Cassiopeia sp. from the Central Red Sea. Our findings show that glucose was rapidly consumed and respired within the Cassiopeia sp. holobiont. The resulting increase of CO availability in hospite in turn likely stimulated photosynthesis in Symbiodinium. Hence, the increase of photosynthesis under these conditions suggests that CO limitation of Symbiodinium is a common feature of stable cnidarian holobionts and that the stimulation of holobiont metabolism may attenuate this CO limitation.

  18. Radio-continuum study of the supernova remnants in the large Magellanic Cloud: An SNR with a highly polarized breakout region: SNR J0455-6838

    Directory of Open Access Journals (Sweden)

    Crawford E.J.

    2008-01-01

    Full Text Available We present the results of new moderate resolution ATCA observations of SNR J0455-6838. We found that this SNR exhibits a mostly typical appearance with rather steep and curved α=-0.81±0.18 and D=43×31±1 pc. Regions of high polarization were detected, including unusually strong (~70% region corresponding to the northern breakout. Such a strong polarization in breakout regions has not been observed in any other SNR.

  19. Review on Dutch-German steam generator safety activities in the field of SNR-development

    International Nuclear Information System (INIS)

    Dumm, K.; Westenbrugge, J.K. van

    1984-01-01

    This paper reviews the results of the experimental and theoretical safety related work for SNR steam generators in brief. A review of the operating experience with SNR-300 sodium-water heat-exchangers and protection philosophy used in SNR-2 is also given

  20. Analysis of simulation results of damaged nuclear fuel accidents at NPPs with shell-type nuclear reactors

    Directory of Open Access Journals (Sweden)

    Igor L. Kozlov

    2015-03-01

    Full Text Available Lessons from the accident at the Fukushima Daiichi NPP made it necessary to reevaluate and intensificate the work on modeling and analyzing various scenarios of severe accidents with damage to the nuclear fuel in the reactor, containment and spent nuclear fuel storage pool with the expansion of the primary initiating event causes group listing. Further development of computational tools for modeling the explosion prevention criteria as to steam and gas mixtures, considering the specific thermal-hydrodynamic conditions and mechanisms of explosive situations arrival at different stages of a severe accident development, is substantiated. Based on the analysis of the known shell-type nuclear reactors accidents results the explosion safety thermodynamic criteria are presented, the parameters defining the steam and gas explosions conditions are found, the need to perform the further verification and validation of deterministic codes serving to simulate general accident processes behavior as well as phase-to-phase interaction calculated dependencies is established. The main parameters controlling and defining the criteria explosion safety effective regulation areas and their optimization conditions are found.

  1. Cavitation problems in mixing devices of SNR-300 fuel elements

    International Nuclear Information System (INIS)

    Benemann, A.

    1976-01-01

    Because of a complex flow path within the mixing device developed for the fuel elements of the SNR-300, in order to determine the minimum allowable interval to the beginning of cavitation, experimental tests with the original geometry are necessary. These conclusions show that for cavitation values CV>=1,3 - in the model and prototype - no cavitation zones can form. For reactor conditions a maximum velocity of Vsub(max)=4,7m/sec is therefore allowable in the free annular space of the compensator unit which corresponds to a massflow of M=22,5kg/sec. A cavitation value of CV=1,5 can be figured for the 120% load factor (M=20,4kg/sec,T=560 0 C). The mixing device developed is free of cavitation under the present conditions in the SNR-300. The condition of the fully developed cavitation is evidenced by a white noise with frequencies of at least 2.000 - 300.000cps and a signal/noise ratio S/R>40dB. The pressure amplitudes dependent on frequency are propagated in the streaming fluid and are severely damped by the locally existing two-phase flow. The unstable range at the beginning of cavitation is characterized by frequencies of about f=15.000cps

  2. On the secular decrease of radio emission flux densities of the supernova remnants of Cassiopeia A and Taurus A at frequency 927 MHz

    International Nuclear Information System (INIS)

    Vinyajkin, E.N.; Razin, V.A.

    1979-01-01

    Relative measurements of the radio emission flux densities of the supernova remnants of Cassiopeia A and Taurus A were made at the frequency 927 MHz to investigate the secular decrease of their intensity. Experiments were fulfilled in October-December 1977 at the 10-meter radio telescope of the radioastronomical station Staraya Pustyn' (NIRFI). The radio galaxied of Cygnus A, Virgo A and Orion Nebula were taken as the comparison sources. The comparison of the data obtained with the results of absolute measurements carried out in October 1962 permits to state that during 15 years the radio emission flux density of Cassiopeia A decreased by (14.2+-0.6)% (the average annual decrease amounts to (0.95+-O.04)%) and the radio emission flux density of Taurus A decreased by (2.7+-0.1)% (the annual decrease is (0.18+-0.01)%)

  3. Concepts on high temperature design analysis for SNR 300

    International Nuclear Information System (INIS)

    Bieniussa, K.; Zolti, E.

    1976-01-01

    The paper briefly describes the evolution, the present situation and the next activities on the design of high temperature components of the DEBENELUX prototype fast breeder reactor SNR-300 with particular regard to the design criteria. Elastic structural analyses are performed for the basic design of the components and are supplied by the manufacturer. In agreement with the Safety Experts simplified and/or detailed inelastic analyses of the critical areas are supplied by the prime contractor of the plant. The elastic computations are evaluated on the basis of a set of design rules derived from ASME Code Case Interpretation 1331-4 but with more conservative limits, and the inelastic ones on the basis of the ASME Code Case Interpretation 1592

  4. MIMO channel capacity with full CSI at Low SNR

    KAUST Repository

    Tall, Abdoulaye

    2012-10-01

    In this paper, we characterize the ergodic capacity of Multiple Input Multiple Output (MIMO) Rayleigh fading channels with full channel state information (CSI) at both the transmitter (CSI-T) and the receiver (CSI-R) at asymptotically low signal-to-noise ratio (SNR). A simple analytical expression of the capacity is derived for any number of transmit and receive antennas. This characterization clearly shows the substantial gain in terms of capacity over the no CSI-T case and gives a good insight on the effect of the number of antennas used. In addition, an On-Off transmission scheme is proposed and is shown to be asymptotically capacity-achieving. © 2012 IEEE.

  5. Carrier tracking by smoothing filter improves symbol SNR

    Science.gov (United States)

    Pomalaza-Raez, Carlos A.; Hurd, William J.

    1986-01-01

    The potential benefit of using a smoothing filter to estimate carrier phase over use of phase locked loops (PLL) is determined. Numerical results are presented for the performance of three possible configurations of the deep space network advanced receiver. These are residual carrier PLL, sideband aided residual carrier PLL, and finally sideband aiding with a Kalman smoother. The average symbol signal to noise ratio (SNR) after losses due to carrier phase estimation error is computed for different total power SNRs, symbol rates and symbol SNRs. It is found that smoothing is most beneficial for low symbol SNRs and low symbol rates. Smoothing gains up to 0.4 dB over a sideband aided residual carrier PLL, and the combined benefit of smoothing and sideband aiding relative to a residual carrier loop is often in excess of 1 dB.

  6. Steam generators under construction for the SNR-300 power plant

    Energy Technology Data Exchange (ETDEWEB)

    Essebaggers, J

    1975-07-01

    The prototype straight tube and the helical coil-steam generator has been designed and fabricated of which the straight tube steam generator has been successfully tested for over 3000 hours at prototypical conditions and is presently being dismantled for detailed examination of critical designed features. The prototype helical coil steam generator is presently under testing in the 50 MWt test facility at TNO-Hengelo with approximately 500 hours of operation at full load conditions. In an earlier presentation the design and fabrication of the prototype steam generators have been presented, while for this presentation the production units for SNR-300 will be discussed. Some preliminary information will be presented at this meeting of the dismantling operations of the prototype straight tube steam generator. (author)

  7. Steam generators under construction for the SNR-300 power plant

    International Nuclear Information System (INIS)

    Essebaggers, J.

    1975-01-01

    The prototype straight tube and the helical coil-steam generator has been designed and fabricated of which the straight tube steam generator has been successfully tested for over 3000 hours at prototypical conditions and is presently being dismantled for detailed examination of critical designed features. The prototype helical coil steam generator is presently under testing in the 50 MWt test facility at TNO-Hengelo with approximately 500 hours of operation at full load conditions. In an earlier presentation the design and fabrication of the prototype steam generators have been presented, while for this presentation the production units for SNR-300 will be discussed. Some preliminary information will be presented at this meeting of the dismantling operations of the prototype straight tube steam generator. (author)

  8. Comparison of ANL containment codes with SNR-300 simulation experiments

    International Nuclear Information System (INIS)

    Marchertas, A.H.; Wang, C.Y.; Fistedis, S.H.

    1976-01-01

    A comparison of REXCO and ICECO code predictions is made with data obtained from experiments of LMFBR excursion models. The comparisons are based on published results of tests conducted for the safety analysis of the SNR-300 fast breeder. The test configurations consist of a centrally located spherical source immersed in a pool of water which is encased in a cylindrical container. The cylinical walls of the container are prestressed by holddown bolts which span the two rigid ends. The space above the surface of the water within the container is occupied by air. Although certain aspects of the tests could not be simulated by the analytical models exactly, the comparison of results shows quite close agreement. The fact that the REXCO and ICECO codes involve different analytical formulations, their own close correspondence of results lends added credence to the value of analytical predictions

  9. Absolute measurements of fluxes from Cassiopeia A, Cygnus A, Taurus A, Virgo A at seven wavelengths in the 1.8-4.2 cm band

    International Nuclear Information System (INIS)

    Dmitrenko, L.V.; Snegireva, V.V.; Turchin, V.I.; Tsejtlin, N.M.; Voronkov, L.A.; Dmitrenko, D.A.; Kuznetsova, N.A.; Kholodilov, N.N.

    1981-01-01

    Results of absolute measurements of fluxes from Cassiopeia A, Cygnus A, Taurus A, Virgo A at 1.8-4.17 cm wavelengths are presented. Spectra are built in the wave range of 1.8-100 cm with the use of results obtained earlier. Variability has been detected in radiation of Taurus A as well as ''steps'' in the spectrum of Taurus A with the spectral index α=0 in the region of 2 cm and 3-4 cm [ru

  10. Selective Route Based on SNR with Cross-Layer Scheme in Wireless Ad Hoc Network

    Directory of Open Access Journals (Sweden)

    Istikmal

    2017-01-01

    Full Text Available In this study, we developed network and throughput formulation models and proposed new method of the routing protocol algorithm with a cross-layer scheme based on signal-to-noise ratio (SNR. This method is an enhancement of routing protocol ad hoc on-demand distance vector (AODV. This proposed scheme uses selective route based on the SNR threshold in the reverse route mechanism. We developed AODV SNR-selective route (AODV SNR-SR for a mechanism better than AODV SNR, that is, the routing protocol that used average or sum of path SNR, and also better than AODV which is hop-count-based. We also used selective reverse route based on SNR mechanism, replacing the earlier method to avoid routing overhead. The simulation results show that AODV SNR-SR outperforms AODV SNR and AODV in terms of throughput, end-to-end delay, and routing overhead. This proposed method is expected to support Device-to-Device (D2D communications that are concerned with the quality of the channel awareness in the development of the future Fifth Generation (5G.

  11. Improved SNR of phased-array PERES coils via simulation study

    International Nuclear Information System (INIS)

    RodrIguez, Alfredo O; Medina, LucIa

    2005-01-01

    A computational comparison of signal-to-noise ratio (SNR) was performed between a conventional phased array of two circular-shaped coils and a petal resonator surface array. The quasi-static model and phased-array optimum SNR were combined to derive an SNR formula for each array. Analysis of mutual inductance between coil petals was carried out to compute the optimal coil separation and optimum number of petal coils. Mutual interaction between coil arrays was not included in the model because this does not drastically affect coil performance. Phased arrays of PERES coils show a 114% improvement in SNR over that of the simplest circular configuration. (note)

  12. Detection of local sodium boiling in the nuclear boiling generator in KNK II and in the cores of SNR 300 and SNR 2

    International Nuclear Information System (INIS)

    Erhardt, J.; Hoppe, P.

    1977-03-01

    As a basis of a global detection system, the detection of local boiling in sodium cooled reactors via surveillance of the neutron flux background noise is of special importance. With the help of parameter studies it is investigated in the present report, which parts of the core of SNR 300 and SNR 2 could be monitored with such a detection system. As a comparison the detection sensibility of the planned boiling generator in KNK II is determined

  13. SNR in ultrasonic pluse compression using Golay codes

    International Nuclear Information System (INIS)

    Kim, Young Hwan; Kim, Young Gil; Jeong, Peter

    1994-01-01

    The conventional ultrasonic flaw detection system uses a large amplitude narrow pulse to excite a transducer, however, these systems are limited in average transmit power. An excessively large amplitude causes a dielectric breakage of the transducer, and an excessively long pulse cuases decrease of the resolution. Using the pulse compression, a long pulse of psudorandom signal can be used without sacrificing resolution by signal correlation. In the present work, the pulse compression technique was utilized to the ultrasonic system. Golay code was used as a psudorandom signal in this system, since pair sum of auto-correlations has not sidelobe. The equivalent input pulse of the Golay code was proposed to analyze the pulse compression system. In experiment, the material type, material thickness and code length were considered. As results, pulse compression system considerably reduced system's white noise, and approximately 30 dB improvement in SNR was obtained over the conventional ultrasonic system. The technique seems to perform particularly well with highly energy-absorbent materials such as polymers, plastics and rubbers.

  14. Off-gas filter system of the SNR-300

    International Nuclear Information System (INIS)

    Boehm, L.; Jordan, S.; Schikarski, W.

    1975-01-01

    The Reventing-Exventing-System of the German Liquid Metal Fast Breeder Prototype SNR-300 is described. After an accident with major damage to the core the ventilation valves are quickly closed. At the same time the blower of the reventing system evacuates the reventing gap up to a pressure difference of 2 mbar between the containment and the outer atmosphere. This pressure difference prevents a leakage from the containment to the outside. The revented gas is recirculated into the outer-containment. Leaks from the atmosphere and possibly from the inner containment into the reventing gap increase the pressure in the outer-containment. Therefore depending on the pressure build-up which is determined by the course of the accident, it is necessary to exvent the containment after several days. The exvented gas is filtered by a filter combination consisting of pre-filters, charcoal-filters and HEPA-filters. Because accidental sodium fires produce high concentrations of sodium oxide-aerosols this filter system must resist chemical aggressive aerosols. (U.S.)

  15. Secure diversity-multiplexing tradeoff of zero-forcing transmit scheme at finite-SNR

    KAUST Repository

    Rezki, Zouheir; Alouini, Mohamed-Slim

    2012-01-01

    information in the orthogonal space of the eavesdropper channel, is used. First, we introduce the secrecy multiplexing gain at finite-SNR that generalizes the definition at high-SNR. Then, we provide upper and lower bounds on the outage probability under

  16. Free-space optical communications with peak and average constraints: High SNR capacity approximation

    KAUST Repository

    Chaaban, Anas; Morvan, Jean-Marie; Alouini, Mohamed-Slim

    2015-01-01

    . Numerical evaluation shows that this capacity lower bound is nearly tight at high signal-to-noise ratio (SNR), while it is shown analytically that the gap to capacity upper bounds is a small constant at high SNR. In particular, the gap to the high

  17. Core/shell-type nanorods of Tb{sup 3+}-doped LaPO{sub 4}, modified with amine groups, revealing reduced cytotoxicity

    Energy Technology Data Exchange (ETDEWEB)

    Runowski, Marcin [Adam Mickiewicz University, Department of Rare Earths, Faculty of Chemistry (Poland); Dąbrowska, Krystyna [Polish Academy of Sciences, Bacteriophage Laboratory, Institute of Immunology and Experimental Therapy (Poland); Grzyb, Tomasz [Adam Mickiewicz University, Department of Rare Earths, Faculty of Chemistry (Poland); Miernikiewicz, Paulina [Polish Academy of Sciences, Bacteriophage Laboratory, Institute of Immunology and Experimental Therapy (Poland); Lis, Stefan, E-mail: blis@amu.edu.pl [Adam Mickiewicz University, Department of Rare Earths, Faculty of Chemistry (Poland)

    2013-11-15

    A simple co-precipitation reaction between Ln{sup 3+} cations (Ln = lanthanide) and phosphate ions in the presence of polyethylene glycol (PEG), including post-treatment under hydrothermal conditions, leads to the formation of Tb{sup 3+}-doped LaPO{sub 4} crystalline nanorods. The nanoparticles obtained can be successfully coated with amorphous and porous silica, forming core/shell-type nanorods. Both products reveal intensive green luminescence under UV lamp irradiation. The surface of the core/shell-type product can also be modified with –NH{sub 2} groups via silylation procedure, using 3-aminopropyltriethoxysilane as a modifier. Powder X-ray diffraction, transmission electron microscopy, and scanning electron microscopy confirm the desired structure and needle-like shape of the products synthesized. Fourier transform infrared spectroscopy and specific surface area measurements by Brunauer–Emmett–Teller method reveal a successful surface modification with amine groups of the core/shell-type nanoparticles prepared. The nanomaterials synthesized exhibit green luminescence characteristic of Tb{sup 3+} ions, as solid powders and aqueous colloids, examined by spectrofluorometry. The in vitro cytotoxicity studies reveal different degree toxicity of the products. LaPO{sub 4}:Tb{sup 3+}@SiO{sub 2}@NH{sub 2} exhibits the smallest toxicity against B16F0 mouse melanoma cancer cells and human skin microvascular endothelial cell lines, in contrast to the most toxic LaPO{sub 4}:Tb{sup 3+}@SiO{sub 2}.Graphical Abstract.

  18. Low-SNR Capacity of Parallel IM-DD Optical Wireless Channels

    KAUST Repository

    Chaaban, Anas

    2016-11-29

    The capacity of parallel intensity-modulation and direct-detection (IM-DD) optical wireless channels with total average intensity and per-channel peak intensity constraints is studied. The optimal intensity allocation at low signal-to-noise ratio (SNR) is derived, leading to the capacity-achieving onoff keying (OOK) distribution. Interestingly, while activating the strongest channel is optimal if (i) the peak intensity is fixed, this is not the case if (ii) the peak intensity is proportional to the average intensity. The minimum average optical intensity per bit is also studied, and is characterized for case (i) where it is achievable at low SNR. However, in case (ii), the average optical intensity per bit grows indefinitely as SNR decreases, indicating that lower optical intensity per bit can be achieved at moderate SNR than at low SNR.

  19. On the capacity of Rician fading channels with full channel state information at low SNR

    KAUST Repository

    Rezki, Zouheir

    2012-06-01

    The capacity of flat Rayleigh fading channels with full channel state information (CSI) at the transmitter and at the receiver at asymptotically low SNR has been recently shown to scale essentially as SNR log (1/SNR). In this paper, we investigate the Rician fading channel capacity with full CSI, and show that the capacity of this channel scales essentially as 1/1+K SNR log (1 /SNR), where K is the Rician factor. This characterization includes perfect CSI at both the transmitter and the receiver or noisy CSI at the transmitter and perfect CSI at the receiver. We also show that one-bit CSI at the transmitter is enough to achieve this asymptotic capacity using an On-Off power control scheme. Our framework may be seen as a generalization of previous works as it captures the Rayleigh fading channel as a special case by letting K goes to zero. © 2012 IEEE.

  20. Free-space optical communications with peak and average constraints: High SNR capacity approximation

    KAUST Repository

    Chaaban, Anas

    2015-09-07

    The capacity of the intensity-modulation direct-detection (IM-DD) free-space optical channel with both average and peak intensity constraints is studied. A new capacity lower bound is derived by using a truncated-Gaussian input distribution. Numerical evaluation shows that this capacity lower bound is nearly tight at high signal-to-noise ratio (SNR), while it is shown analytically that the gap to capacity upper bounds is a small constant at high SNR. In particular, the gap to the high-SNR asymptotic capacity of the channel under either a peak or an average constraint is small. This leads to a simple approximation of the high SNR capacity. Additionally, a new capacity upper bound is derived using sphere-packing arguments. This bound is tight at high SNR for a channel with a dominant peak constraint.

  1. Astrometric analysis of the unresolved binary MU Cassiopeiae from photographs taken with the Sproul 61 centimeter refractor

    International Nuclear Information System (INIS)

    Lippincott, S.L.

    1981-01-01

    Mu Cassiopeiae, a high-velocity Population II subdwarf, is an astrometric binary which has been on the Sproul Observatory astrometric program since 1937. The data yield P = 21.43 yr, with a photocentric semiaxis major, α = 0''.186 +- 0''.001 (p.e) and a relative parallax, π = +0''.130 +- 0''.001. Rigorous masses for the components from the Sproul results will follow in the future only in conjunction with reliable values for Δm and separation derived from other techniques. The best tentative values of Δm and separation so far found suggest M/sub A/ = 0.7 M/sub sun/, and M/sub B/roughly-equal0.2Msun with Δmapprox.4.5, which indicate higher. He content for μ Cas A than for the Sun. The masses are of particular interest because they hold a clue to the chemical composition of the system which is likely to be similar to that in the interstellar medium during the early stages of our Galaxy at the time μ Cas is thought to have originated

  2. On the low SNR capacity of MIMO fading channels with imperfect channel state information

    KAUST Repository

    Benkhelifa, Fatma

    2014-06-01

    The capacity of multiple-input multiple-output (MIMO) Rayleigh fading channels with full knowledge of channel state information (CSI) at both the transmitter and the receiver (CSI-TR) has been shown recently to scale at low signal-to-noise ratio (SNR) essentially as SNR log(1/SNR), independently of the number of transmit and receive antennas. In this paper, we investigate the ergodic capacity of MIMO Rayleigh fading channel with estimated channel state information at the transmitter (CSI-T) and possibly imperfect channel state information at the receiver (CSI-R). Our framework can be seen as a generalization of previous works as it can capture the perfect CSI-TR as a special case when the estimation error variance goes to zero. In this paper, we mainly focus on the low SNR regime, and we show that the capacity scales as (1-α) SNR log(1/SNR), where α is the estimation error variance. This characterization shows the loss of performance due to error estimation over the perfect channel state information at both the transmitter and the receiver. As a by-product of our new analysis, we show that our framework can be also extended to characterize the capacity of MIMO Rician fading channels at low SNR with possibly imperfect CSI-T and CSI-R. © 1972-2012 IEEE.

  3. On the low SNR capacity of MIMO fading channels with imperfect channel state information

    KAUST Repository

    Benkhelifa, Fatma

    2014-05-01

    The capacity of Multiple Input Multiple Output (MIMO) Rayleigh fading channels with full knowledge of channel state information (CSI) at both the transmitter and the receiver (CSI-TR) has been shown recently to scale at low Signal-to-Noise Ratio (SNR) essentially as SNR log(1=SNR), independently of the number of transmit and receive antennas. In this paper, we investigate the ergodic capacity of MIMO Rayleigh fading channel with estimated channel state information at the transmitter (CSI-T) and possibly imperfect channel state information at the receiver (CSI-R). Our framework can be seen as a generalization of previous works as it can capture the perfect CSI-TR as a special case when the estimation error variance goes to zero. In our work, we mainly focus on the low SNR regime and we show that the capacity scales as (1-α) SNR log(1=SNR), where α is the estimation error variance. This characterization shows the loss of performance due to error estimation over the perfect channel state information at both the transmitter and the receiver. As a by-product of our new analysis, we show that our framework can also be extended to characterize the capacity of MIMO Rician fading channels at low SNR with possibly imperfect CSI-T and CSI-R. © 2014 IFIP.

  4. On the low SNR capacity of log-normal turbulence channels with full CSI

    KAUST Repository

    Benkhelifa, Fatma; Tall, Abdoulaye; Rezki, Zouheir; Alouini, Mohamed-Slim

    2014-01-01

    In this paper, we characterize the low signal-To-noise ratio (SNR) capacity of wireless links undergoing the log-normal turbulence when the channel state information (CSI) is perfectly known at both the transmitter and the receiver. We derive a closed form asymptotic expression of the capacity and we show that it scales essentially as λ SNR where λ is the water-filling level satisfying the power constraint. An asymptotically closed-form expression of λ is also provided. Using this framework, we also propose an on-off power control scheme which is capacity-achieving in the low SNR regime.

  5. A model of SNR evolution for an O-star in a cloudy ISM

    International Nuclear Information System (INIS)

    Shull, P. Jr.

    1988-01-01

    The authors present an analytical model of SNR evolution in a cloudy interstellar medium for a single progenitor star of spectral type 05 V. The model begins with the progenitor on the zero-age main sequence, includes the effects of the star's wind and ionizing photons, and ends with the SNR's assimilation by the ISM. The authors assume that the ISM consists of atomic clouds, molecular clouds, and a hot intercloud phase. The type of SNR that results bears a strong resemblance to N63A in the Large Magellanic Cloud

  6. The southern molecular environment of SNR G18.8+0.3

    OpenAIRE

    Paron, S.; Peña, M. Celis; Ortega, M. E.; Petriela, A.; Dubner, G.; Giacina, E.; Rubio, M.

    2015-01-01

    In a previous paper we have investigated the molecular environment towardsthe eastern border of the SNR G18.8+0.3. Continuing with the study of thesurroundings of this SNR, in this work we focus on its southern border, whichin the radio continuum emission shows a very peculiar morphology with acorrugated corner and a very flattened southern flank. We observed two regionstowards the south of SNR G18.8+0.3 using the Atacama Submillimeter TelescopeExperiment (ASTE) in the 12CO J=3-2. One of thes...

  7. On the low SNR capacity of log-normal turbulence channels with full CSI

    KAUST Repository

    Benkhelifa, Fatma

    2014-09-01

    In this paper, we characterize the low signal-To-noise ratio (SNR) capacity of wireless links undergoing the log-normal turbulence when the channel state information (CSI) is perfectly known at both the transmitter and the receiver. We derive a closed form asymptotic expression of the capacity and we show that it scales essentially as λ SNR where λ is the water-filling level satisfying the power constraint. An asymptotically closed-form expression of λ is also provided. Using this framework, we also propose an on-off power control scheme which is capacity-achieving in the low SNR regime.

  8. Effect of exposure time reduction towards sensitivity and SNR for computed radiography (CR) application in NDT

    International Nuclear Information System (INIS)

    Sapizah Rahim; Khairul Anuar Mohd Salleh; Noorhazleena Azaman; Shaharudin Sayuti; Siti Madiha Muhammad Amir; Arshad Yassin; Abdul Razak Hamzah

    2010-01-01

    Signal-to-noise ratio (SNR) and sensitivity study of Computed Radiography (CR) system with reduction of exposure time is presented. The purposes of this research are to determine the behavior of SNR toward three different thicknesses (step wedge; 5, 10 and 15 mm) and the ability of CR system to recognize hole type penetrameter when the exposure time decreased up to 80 % according to the exposure chart (D7; ISOVOLT Titan E). It is shown that the SNR is decreased with decreasing of exposure time percentage but the high quality image is achieved until 80 % reduction of exposure time. (author)

  9. The effect of SNR structure on non-equilibrium X-ray spectra

    International Nuclear Information System (INIS)

    Hamilton, A.J.S.; Sarazin, C.L.

    1983-01-01

    A technique is presented for characterizing the ionization structure and consequent thermal X-ray emission of a SNR when non-equilibrium ionization effects are important. The technique allows different theoretical SNR models to be compared and contrasted rapidly in advance of detailed numerical computations. In particular it is shown that the spectrum of a Sedov remnant can probably be applied satisfactorily in a variety of SNR structures, including the reverse shock model advocated by Chevalier (1982) for Type I SN, the isothermal similarity solution of Solinger, Rappaport and Buff (1975), and various inhomogenous or 'messy' structures. (Auth.)

  10. Secure diversity-multiplexing tradeoff of zero-forcing transmit scheme at finite-SNR

    KAUST Repository

    Rezki, Zouheir

    2012-04-01

    In this paper, we address the finite Signal-to-Noise Ratio (SNR) Diversity-Multiplexing Tradeoff (DMT) of the Multiple Input Multiple Output (MIMO) wiretap channel, where a Zero-Forcing (ZF) transmit scheme, that intends to send the secret information in the orthogonal space of the eavesdropper channel, is used. First, we introduce the secrecy multiplexing gain at finite-SNR that generalizes the definition at high-SNR. Then, we provide upper and lower bounds on the outage probability under secrecy constraint, from which secrecy diversity gain estimates of ZF are derived. Through asymptotic analysis, we show that the upper bound underestimates the secrecy diversity gain, whereas the lower bound is tight at high-SNR, and thus its related diversity gain estimate is equal to the actual asymptotic secrecy diversity gain of the MIMO wiretap channel. © 2012 IEEE.

  11. Risk-oriented analysis on the German prototype fast breeder reactor SNR-300

    International Nuclear Information System (INIS)

    Bayer, A.; Koeberlein, K.; Gesellschaft fuer Reaktorsicherheit, Garching, Germany)

    1984-01-01

    On request of a fact-finding committee of the German Federal Parliament, a risk-oriented analysis on the SNR-300, the German prototype fast breeder reactor, has been performed to allow a pragmatic safety comparison of the SNR-300 and a modern light-water reactor. Results of the technical plant analysis have been summarized in seven release categories. Accident consequences have been calculated for the actual site at Kalkar/Rhine. The results indicate that for the SNR-300 both the frequency of major accidents and the consequences of accidents are smaller than for the pressurized-water reactor analyzed in the German Risk Study. This article summarizes the methods and main results of the analysis of the SNR-300

  12. Low SNR Capacity of FSO Links over Gamma-Gamma Atmospheric Turbulence Channels

    KAUST Repository

    Benkhelifa, Fatma; Alouini, Mohamed-Slim; Rezki, Zouheir

    2013-01-01

    free space optical communication systems over Gamma-Gamma atmospheric turbulence fading channels with perfect channel state information at both the transmitter and the receiver. In our framework, we mainly focus on the low signal-to-noise ratio range and show that the ergodic capacity scales proportionally to SNR log^4(1/SNR). We show also that one-bit CSI feedback at the transmitter is enough to achieve this capacity using an on-o ff power control scheme.

  13. The upper limits of the SNR in radiography and CT with polyenergetic x-rays

    International Nuclear Information System (INIS)

    Shikhaliev, Polad M

    2010-01-01

    The aim of the study is to determine the upper limits of the signal-to-noise ratio (SNR) in radiography and computed tomography (CT) with polyenergetic x-ray sources. In x-ray imaging, monoenergetic x-rays provide a higher SNR compared to polyenergetic x-rays. However, the SNR in polyenergetic x-ray imaging can be increased when a photon-counting detector is used and x-rays are optimally weighted according to their energies. For a particular contrast/background combination and at a fixed x-ray entrance skin exposure, the SNR in energy-weighting x-ray imaging depends on tube voltage and can be maximized by selecting the optimal tube voltage. The SNR in energy-weighted x-ray images acquired at this optimal tube voltage is the highest SNR that can be achieved with polyenergetic x-ray sources. The optimal tube voltages and the highest SNR were calculated and compared to the SNR of monoenergetic x-ray imaging. Monoenergetic, energy-weighting polyenergetic and energy-integrating polyenergetic x-ray imagings were simulated at a fixed entrance skin exposure of 20 mR. The tube voltages varied in the range of 30-140 kVp with 10 kV steps. Contrast elements of CaCO 3 , iodine, adipose and tumor with thicknesses of 280 mg cm -2 , 15 mg cm -2 , 1 g cm -2 and 1 g cm -2 , respectively, inserted in a soft tissue background with 10 cm and 20 cm thicknesses, were used. The energy weighting also improves the contrast-to-noise ratio (CNR) in CT when monoenergetic CT projections are optimally weighted prior to CT reconstruction (projection-based weighting). Alternatively, monoenergetic CT images are reconstructed, optimally weighted and composed to yield a final CT image (image-based weighting). Both projection-based and image-based weighting methods improve the CNR in CT. An analytical approach was used to determine which of these two weighting methods provides the upper limit of the CNR in CT. The energy-weighting method was generalized and expanded as a weighting method applicable in

  14. Evaluation of special safety features of the SNR-300 in view of the Chernobyl accident

    International Nuclear Information System (INIS)

    Vossebrecker, H.

    1987-03-01

    A comparison of those characteristics, which decisively influenced the accident in the RMBK-1000 reactor, with the safety features of SNR-300 has been performed. The conclusions of this comparison are presented in the present report. The SNR-300 is characterized by a stable reactivity behaviour and good controllability, whereas RBMK-1000 has an instable behaviour and complex spatial dependencies in the core. Among other points, design deficiencies in the protection and emergency shutdown systems were responsible for the Chernobyl accident. The protection and scram systems of the SNR-300 are unquestionably superior to those of the RBMK-1000 with regard to redundancy, diversity, degree of automation, separation of operational and safety-relevant tasks, protection against inadmissible interventions, effectiveness and safety reserves. Therefore, excursion accidents can be classified as hypothetical for SNR-300. Due to elementary physical properties, possible energy releases during hypothetical excursions are substantially lower for SNR-300 and would be controlled by the design of the primary system and containment systems. No damage limiting measures are provided in the RBMK-100 for excursion accidents. Finally, exothermal processes augmented the consequences of the accident in the RBMK-1000 and the long-lasting graphite fire intensified the release of radioactivity. In the SNR-300, however, inertisation of the containment, the steel plate lining and the floor troughs ensure that activity enclosure inside the containment after leakage or hypothetical excursion accident is not endangered by exothermal reactions. Further safety aspects are presented in the report, which can be linked with the accident in Chernobyl. In summary, it is obvious that the disadvantageous physical and technical features of the RBMK-1000 do either not exist in the SNR-300 or are covered by the safety design

  15. Influence of range-gated intensifiers on underwater imaging system SNR

    Science.gov (United States)

    Wang, Xia; Hu, Ling; Zhi, Qiang; Chen, Zhen-yue; Jin, Wei-qi

    2013-08-01

    Range-gated technology has been a hot research field in recent years due to its high effective back scattering eliminating. As a result, it can enhance the contrast between a target and its background and extent the working distance of the imaging system. The underwater imaging system is required to have the ability to image in low light level conditions, as well as the ability to eliminate the back scattering effect, which means that the receiver has to be high-speed external trigger function, high resolution, high sensitivity, low noise, higher gain dynamic range. When it comes to an intensifier, the noise characteristics directly restrict the observation effect and range of the imaging system. The background noise may decrease the image contrast and sharpness, even covering the signal making it impossible to recognize the target. So it is quite important to investigate the noise characteristics of intensifiers. SNR is an important parameter reflecting the noise features of a system. Through the use of underwater laser range-gated imaging prediction model, and according to the linear SNR system theory, the gated imaging noise performance of the present market adopted super second generation and generation Ⅲ intensifiers were theoretically analyzed. Based on the active laser underwater range-gated imaging model, the effect to the system by gated intensifiers and the relationship between the system SNR and MTF were studied. Through theoretical and simulation analysis to the image intensifier background noise and SNR, the different influence on system SNR by super second generation and generation Ⅲ ICCD was obtained. Range-gated system SNR formula was put forward, and compared the different effect influence on the system by using two kind of ICCDs was compared. According to the matlab simulation, a detailed analysis was carried out theoretically. All the work in this paper lays a theoretical foundation to further eliminating back scattering effect, improving

  16. MIMO Intensity-Modulation Channels: Capacity Bounds and High SNR Characterization

    KAUST Repository

    Chaaban, Anas

    2016-10-01

    The capacity of MIMO intensity modulation channels is studied. The nonnegativity of the transmit signal (intensity) poses a challenge on the precoding of the transmit signal, which limits the applicability of classical schemes in this type of channels. To resolve this issue, capacity lower bounds are developed by using precoding-free schemes. This is achieved by channel inversion or QR decomposition to convert the MIMO channel to a set of parallel channels. The achievable rate of a DC-offset SVD based scheme is also derived as a benchmark. Then, a capacity upper bound is derived and is shown to coincide with the achievable rate of the QR decomposition based scheme at high SNR, consequently characterizing the high-SNR capacity of the channel. The high-SNR gap between capacity and the achievable rates of the channel inversion and the DC-offset SVD based schemes is also characterized. Finally, the ergodic capacity of the channel is also briefly discussed.

  17. Optical intensity modulation direct detection versus heterodyne detection: A high-SNR capacity comparison

    KAUST Repository

    Chaaban, Anas

    2016-09-15

    An optical wireless communications system which employs either intensity-modulation and direct-detection (IM-DD) or heterodyne detection (HD) is considered. IM-DD has lower complexity and cost than HD, but on the other hand, has lower capacity. It is therefore interesting to investigate the capacity gap between the two systems. The main focus of this paper is to investigate this gap at high SNR. Bounds on this gap are established for two cases: between IM-DD and HD, and between IM-DD and an HD-PAM which is an HD system employing pulse-amplitude modulation (PAM). While the gap between IM-DD and HD increases as the signal-to-noise ratio (SNR) increases, the gap between IM-DD and an HD-PAM is upper bounded by a constant at high SNR. © 2015 IEEE.

  18. SNR characteristics of 850-nm OEIC receiver with a silicon avalanche photodetector.

    Science.gov (United States)

    Youn, Jin-Sung; Lee, Myung-Jae; Park, Kang-Yeob; Rücker, Holger; Choi, Woo-Young

    2014-01-13

    We investigate signal-to-noise ratio (SNR) characteristics of an 850-nm optoelectronic integrated circuit (OEIC) receiver fabricated with standard 0.25-µm SiGe bipolar complementary metal-oxide-semiconductor (BiCMOS) technology. The OEIC receiver is composed of a Si avalanche photodetector (APD) and BiCMOS analog circuits including a transimpedance amplifier with DC-balanced buffer, a tunable equalizer, a limiting amplifier, and an output buffer with 50-Ω loads. We measure APD SNR characteristics dependence on the reverse bias voltage as well as BiCMOS circuit noise characteristics. From these, we determine the SNR characteristics of the entire OEIC receiver, and finally, the results are verified with bit-error rate measurement.

  19. SNR-steam generator design with respect to large sodium water reactions

    International Nuclear Information System (INIS)

    Jong, J.J. de; Kellner, A.; Florie, C.J.L.

    1984-01-01

    This paper deals with the experiences gained during the licensing procedure for the steam generators for the SNR 300 LMFBR regarding large sodium-water reactions. A description is given of the different calculations executed to investigate the effects of large leaks on the 85 MW helical coiled and straight tube steam generators. The investigations on the helical coiled steam generators are divided in the formulations of fluid behaviour, dynamic force calculations, dynamic response calculation and finally stress analyses. Several results are shown. The investigations on the straight tube steam generators are performed using models describing fluid-structure interaction, coupled with stress analyses. Several results are presented. A description is given of the problems and necessary construction changes during the licensing process. Advises are given for future analyses and design concepts for second generation commercial size LMFBR steam generators with respect to large leaks; based on the experience, gained with SNR 300, and using some new calculations for SNR 2. (author)

  20. Optical intensity modulation direct detection versus heterodyne detection: A high-SNR capacity comparison

    KAUST Repository

    Chaaban, Anas; Alouini, Mohamed-Slim

    2016-01-01

    An optical wireless communications system which employs either intensity-modulation and direct-detection (IM-DD) or heterodyne detection (HD) is considered. IM-DD has lower complexity and cost than HD, but on the other hand, has lower capacity. It is therefore interesting to investigate the capacity gap between the two systems. The main focus of this paper is to investigate this gap at high SNR. Bounds on this gap are established for two cases: between IM-DD and HD, and between IM-DD and an HD-PAM which is an HD system employing pulse-amplitude modulation (PAM). While the gap between IM-DD and HD increases as the signal-to-noise ratio (SNR) increases, the gap between IM-DD and an HD-PAM is upper bounded by a constant at high SNR. © 2015 IEEE.

  1. A novel method for enhancing the lateral resolution and image SNR in confocal microscopy

    Science.gov (United States)

    Chen, Youhua; Zhu, Dazhao; Fang, Yue; Kuang, Cuifang; Liu, Xu

    2017-12-01

    There is always a tradeoff between the resolution and the signal-to-noise ratio (SNR) in confocal microscopy. In particular, the pinhole size is very important for maintaining a balance between them. In this paper, we propose a method for improving the lateral resolution and image SNR in confocal microscopy without making any changes to the hardware. By using the fluorescence emission difference (FED) approach, we divide the images acquired by different pinhole sizes into one image acquired by the central pinhole and several images acquired by ring-shaped pinholes. Then, they are added together with the deconvolution method. Simulation and experimental results for fluorescent particles and cells show that our method can achieve a far better resolution than a large pinhole and a higher SNR than a small pinhole. Moreover, our method can improve the performance of classic confocal laser scanning microscopy (CLSM) to a certain extent, especially CLSM with a continuously variable pinhole.

  2. dDYRK2 and Minibrain interact with the chromatin remodelling factors SNR1 and TRX.

    Science.gov (United States)

    Kinstrie, Ross; Lochhead, Pamela A; Sibbet, Gary; Morrice, Nick; Cleghon, Vaughn

    2006-08-15

    The DYRKs (dual specificity tyrosine phosphorylation-regulated kinases) are a conserved family of protein kinases that autophosphorylate a tyrosine residue in their activation loop by an intra-molecular mechanism and phosphorylate exogenous substrates on serine/threonine residues. Little is known about the identity of true substrates for DYRK family members and their binding partners. To address this question, we used full-length dDYRK2 (Drosophila DYRK2) as bait in a yeast two-hybrid screen of a Drosophila embryo cDNA library. Of 14 independent dDYRK2 interacting clones identified, three were derived from the chromatin remodelling factor, SNR1 (Snf5-related 1), and three from the essential chromatin component, TRX (trithorax). The association of dDYRK2 with SNR1 and TRX was confirmed by co-immunoprecipitation studies. Deletion analysis showed that the C-terminus of dDYRK2 modulated the interaction with SNR1 and TRX. DYRK family member MNB (Minibrain) was also found to co-precipitate with SNR1 and TRX, associations that did not require the C-terminus of the molecule. dDYRK2 and MNB were also found to phosphorylate SNR1 at Thr102 in vitro and in vivo. This phosphorylation required the highly conserved DH-box (DYRK homology box) of dDYRK2, whereas the DH-box was not essential for phosphorylation by MNB. This is the first instance of phosphorylation of SNR1 or any of its homologues and implicates the DYRK family of kinases with a role in chromatin remodelling.

  3. The possibilities of application of experimental Kfk results from BR2 on SNR designs

    International Nuclear Information System (INIS)

    Karsten, G.; Elbel, K.; Dienst, W.; Schaefer, L.

    1978-01-01

    A review is given of the relevant results of the technological application for the SNR300 reactor, since the BR2 reactor has been used as a test facility for the material development. Special emphasis has been laid on the fuel pin behavior under the aspect of chemical and mechanical fuel-clad interaction and on the specification of the cladding in terms of high temperature mechanical behavior in the SNR 300 reactor. A systematic analysis of urgent research topics in BR2 test facility reactor is presented. (A.F.)

  4. Description of the global fuel element failure detection for SNR 300

    International Nuclear Information System (INIS)

    Dauk, J.

    1985-07-01

    For the detection of fission products in the cover gas of SNR 300 a high-resolution gamma-spectrometer with connected mini-computer is applied. The mechanical structure of the two Ge-detectors, which are positioned at two redundant gas lines, the analogous electronic and the structure of the computer with its periphery are described in this report. The concept of the software is presented, which had been developed especially for SNR 300. The start-up of the system and the calibration of the auxiliary measuring points and of the Ge-detectors are described [de

  5. Low SNR Capacity of FSO Links over Gamma-Gamma Atmospheric Turbulence Channels

    KAUST Repository

    Benkhelifa, Fatma

    2013-01-27

    In this paper, we study the ergodic capacity of free space optical communication systems over Gamma-Gamma atmospheric turbulence fading channels with perfect channel state information at both the transmitter and the receiver. In our framework, we mainly focus on the low signal-to-noise ratio range and show that the ergodic capacity scales proportionally to SNR log^4(1/SNR). We show also that one-bit CSI feedback at the transmitter is enough to achieve this capacity using an on-o ff power control scheme.

  6. Low SNR Capacity of FSO Links over Gamma-Gamma Atmospheric Turbulence Channels

    KAUST Repository

    Benkhelifa, Fatma

    2013-02-23

    In this paper, we study the ergodic capacity of free space optical communication systems over Gamma-Gamma atmospheric turbulence fading channels with perfect channel state information at both the transmitter and the receiver. In our framework, we mainly focus on the low signal-to-noise ratio range and show that the ergodic capacity scales proportionally to SNR log^4(1/SNR). We show also that one-bit CSI feedback at the transmitter is enough to achieve this capacity using an on-off power control scheme.

  7. Low SNR Capacity of FSO Links over Gamma-Gamma Atmospheric Turbulence Channels

    KAUST Repository

    Benkhelifa, Fatma; Alouini, Mohamed-Slim; Rezki, Zouheir

    2013-01-01

    In this paper, we study the ergodic capacity of free space optical communication systems over Gamma-Gamma atmospheric turbulence fading channels with perfect channel state information at both the transmitter and the receiver. In our framework, we mainly focus on the low signal-to-noise ratio range and show that the ergodic capacity scales proportionally to SNR log^4(1/SNR). We show also that one-bit CSI feedback at the transmitter is enough to achieve this capacity using an on-off power control scheme.

  8. The SNR 300 fast breeder in the ups and downs of its history

    International Nuclear Information System (INIS)

    Marth, W.

    1994-12-01

    The Fast Breeder Project was founded in Karlsruhe in 1960. After an initial period of fundamental research, industry assumed responsibility for designing the SNR 300. Construction of the Kalkar Nuclear Power Station was hampered by a variety of political influences, but finally completed in 1985. As a consequence of the North Rhine-Westphalian party-in-government's opting out of nuclear power, no startup permit was issued for the SNR 300. Consequently, the Kalkar Nuclear Power Station project was discontinued for political reasons in March 1991. The report is the English translation of KFK--4466. (orig./HP) [de

  9. A method to design high SNR nanoscale magnetic sensors using an array of tunnelling magneto-resistance (TMR) devices

    International Nuclear Information System (INIS)

    Gomez, P; Litvinov, D; Khizroev, S

    2007-01-01

    This paper presents a systematic method to design and calculate tunnelling magneto-resistance (TMR) sensors with high signal-to-noise ratio (SNR). The sensing module consists of four TMR devices arranged in a Wheatstone-bridge configuration. Closed-form equations were obtained to calculate TMR sensor current, array output voltage, magneto-resistance ratio, overall noise (thermal and shot) and SNR for a given bandwidth. Using this technique we were able to maximize the SNR by tuning the many parameters of the TMR devices. Typical SNR values are in excess of 45 dB

  10. BVRcIc OBSERVATIONS AND ANALYSES OF THE DWARF DETACHED BINARY V1043 CASSIOPEIA AND A COMMENT ON PRECONTACT W UMa'S

    International Nuclear Information System (INIS)

    Samec, R. G.; Smith, P. M.; Chamberlain, H.; Faulkner, D. R.; Van Hamme, W.

    2013-01-01

    Complete Bessel BVR c I c light curves of V1043 Cassiopeia [2MASS J00371195+5301324, Mis V1292, USNO–A2.0 1425–00875743, α(2000) = 00 h 37 m 11. s 95, δ(2000) = +53°01'32.''5] are analyzed. The system is a member of the small group of pre-contact W UMa binaries (PCWBs). Its light curve has the appearance of an Algol (EA) light curve, however it is made up of dwarf solar type components in a detached mode with a period of only 0.6616 days. The analysis includes a period study, an improved ephemeris, a mass ratio search, and a simultaneous BVR c I c Wilson-Devinney solution. We document about 20 other PCWBs given in the literature. Several have RS CVn-like properties.

  11. Multi-year X-Ray Variations of Iron-K and Continuum Emissions in the Young Supernova Remnant Cassiopeia A

    Energy Technology Data Exchange (ETDEWEB)

    Sato, Toshiki; Masai, Kuniaki [Department of Physics, Tokyo Metropolitan University, 1-1 Minami-Osawa, Hachioji, Tokyo 192-0397 (Japan); Maeda, Yoshitomo; Ishida, Manabu [Department of High Energy Astrophysics, Institute of Space and Astronautical Science (ISAS), Japan Aerospace Exploration Agency (JAXA), 3-1-1 Yoshinodai, Sagamihara, 229-8510 (Japan); Bamba, Aya [Department of Physics, The University of Tokyo, 7-3-1 Hongo, Bunkyo-ku, Tokyo 113-0033 (Japan); Katsuda, Satoru [Department of Physics, Faculty of Science and Engineering, Chuo University, 1-13-27 Kasuga, Bunkyo, Tokyo 112-8551 (Japan); Ohira, Yutaka; Yamazaki, Ryo; Sawada, Makoto [Department of Physics and Mathematics, Aoyama Gakuin University, 5-10-1 Fuchinobe, Chuo-ku, Sagamihara, Kanagawa 252-5258 (Japan); Matsumoto, Hironori [Kobayashi-Maskawa Institute for the Origin of Particles and the Universe, Nagoya University, Furo-cho, Chikusa-ku, Nagoya 464-8602 (Japan); Terada, Yukikatsu [Graduate School of Science and Engineering, Saitama University, 255 Shimo-Ohkubo, Sakura, Saitama 338-8570 (Japan); Hughes, John P., E-mail: toshiki@astro.isas.jaxa.jp [Department of Physics and Astronomy, Rutgers University, 136 Frelinghuysen Road, Piscataway, NJ 08854-8019 (United States)

    2017-02-20

    We found a simultaneous decrease of the Fe–K line and 4.2–6 keV continuum of Cassiopeia A with the monitoring data taken by the Chandra X-ray Observatory in 2000–2013. The flux change rates in the whole remnant are −0.65 ± 0.02% yr{sup −1} in the 4.2–6.0 keV continuum and −0.6 ± 0.1% yr{sup −1} in the Fe–K line. In the eastern region where the thermal emission is considered to dominate, the variations show the largest values: −1.03 ± 0.05% yr{sup −1} (4.2–6 keV band) and −0.6 ± 0.1% yr{sup −1} (Fe–K line). In this region, the time evolution of the emission measure and the temperature have a decreasing trend. This could be interpreted as adiabatic cooling with the expansion of m = 0.66. On the other hand, in the non-thermal emission dominated regions, variations of the 4.2–6 keV continuum show smaller rates: −0.60 ± 0.04% yr{sup −1} in the southwestern region, −0.46 ± 0.05% yr{sup −1} in the inner region, and +0.00 ± 0.07% yr{sup −1} in the forward shock region. In particular, flux does not show significant change in the forward shock region. These results imply that strong braking in shock velocity has not been occurring in Cassiopeia A (<5 km s{sup −1} yr{sup −1}). All of our results support the idea that X-ray flux decay in the remnant is mainly caused by thermal components.

  12. Improved method for SNR prediction in machine-learning-based test

    NARCIS (Netherlands)

    Sheng, Xiaoqin; Kerkhoff, Hans G.

    2010-01-01

    This paper applies an improved method for testing the signal-to-noise ratio (SNR) of Analogue-to-Digital Converters (ADC). In previous work, a noisy and nonlinear pulse signal is exploited as the input stimulus to obtain the signature results of ADC. By applying a machine-learning-based approach,

  13. Multipath detection with the combination of SNR measurements - Example from urban environment

    Science.gov (United States)

    Špánik, Peter; Hefty, Ján

    2017-12-01

    Multipath is one of the most severe station-dependent error sources in both static and kinematic positioning. Relatively new and simple detection technique using the Signal-to-Noise (SNR) measurements on three frequencies will be presented based on idea of Strode and Groves. Exploitation of SNR measurements is benefi cial especially for their unambiguous character. Method is based on the fact that SNR values are closely linked with estimation of pseudo-ranges and phase measurements during signal correlation processing. Due to this connection, combination of SNR values can be used to detect anomalous behavior in received signal, however some kind of calibration in low multipath environment has to be done previously. In case of multipath, phase measurements on different frequencies will not be affected in the same manner. Specular multipath, e.g. from building wall introduces additional path delay which is interpreted differently on each of the used carrier, due to different wavelengths. Experimental results of multipath detection in urban environment will be presented. Originally proposed method is designed to work with three different frequencies in each epoch, thus only utilization of GPS Block II-F and Galileo satellites is possible. Simplification of detection statistics to use only two frequencies is made and results using GPS and GLONASS systems are presented along with results obtained using original formula.

  14. Multipath detection with the combination of SNR measurements – Example from urban environment

    Directory of Open Access Journals (Sweden)

    Špánik Peter

    2017-12-01

    Full Text Available Multipath is one of the most severe station-dependent error sources in both static and kinematic positioning. Relatively new and simple detection technique using the Signal-to-Noise (SNR measurements on three frequencies will be presented based on idea of Strode and Groves. Exploitation of SNR measurements is benefi cial especially for their unambiguous character. Method is based on the fact that SNR values are closely linked with estimation of pseudo-ranges and phase measurements during signal correlation processing. Due to this connection, combination of SNR values can be used to detect anomalous behavior in received signal, however some kind of calibration in low multipath environment has to be done previously. In case of multipath, phase measurements on different frequencies will not be affected in the same manner. Specular multipath, e.g. from building wall introduces additional path delay which is interpreted differently on each of the used carrier, due to different wavelengths. Experimental results of multipath detection in urban environment will be presented. Originally proposed method is designed to work with three different frequencies in each epoch, thus only utilization of GPS Block II-F and Galileo satellites is possible. Simplification of detection statistics to use only two frequencies is made and results using GPS and GLONASS systems are presented along with results obtained using original formula.

  15. Detection of plumes at Redoubt and Etna volcanoes using the GPS SNR method

    Science.gov (United States)

    Larson, Kristine M.; Palo, Scott; Roesler, Carolyn; Mattia, Mario; Bruno, Valentina; Coltelli, Mauro; Fee, David

    2017-09-01

    Detection and characterization of volcanic eruptions is important both for public health and aircraft safety. A variety of ground sensors are used to monitor volcanic eruptions. Data from these ground sensors are subsequently incorporated into models that predict the movement of ash. Here a method to detect volcanic plumes using GPS signals is described. Rather than carrier phase data used by geodesists, the method takes advantage of attenuations in signal to noise ratio (SNR) data. Two datasets are evaluated: the 2009 Redoubt Volcano eruptions and the 2013/2015 eruptions at Mt. Etna. SNR-based eruption durations are compared with previously published seismic, infrasonic, and radar studies at Redoubt Volcano. SNR-based plume detections from Mt. Etna are compared with L-band radar and tremor observations. To place these SNR observations from Redoubt and Etna in context, a model of the propagation of GPS signals through both water/water vapor and tephra is developed. Neither water nor fine ash particles will produce the observed attenuation of GPS signals, while scattering caused by particles > 1 cm in diameter potentially could.

  16. Study of the accidental risk of the German fast breeder prototype reactor SNR-300

    International Nuclear Information System (INIS)

    Koeberlein, K.

    1983-01-01

    A fact-finding committee of the German Federal Parliament in July 1980 recommended to perform a 'risk-oriented study' of the SNR-300, the German 300 MWe fast breeder prototype reactor being under construction at Kalkar. The main aim of this study was to allow a comparative safety evaluation between the SNR-300 and a modern PWR, thus to prepare a basis for a political decision on the SNR-300. Methods and main results of the study are presented in this paper. In the first step of the study six groups of accidents have been identified which may initiate core destruction. By reliability analyses, expected frequency of each group has been estimated. Conditional probabilities for conceivable reactor tank failure modes have been analysed. Tank failure after core destruction leads to release of energy and radioactive material into the containment system. Such accident sequences have been pursued further. Based on a number of core destruction initiators and tank failure modes and various combinations of success and failure states of the containment systems, detailed calculations of different containment scenarious were carried out. From the results of the plant systems analysis, five release categories have been defined. Possible effects of external events and releases of radioactivity from the spent fuel storage pool have also been analysed. In order to quantify the degree of uncertainty of the calculated frequencies, subjective probability distributions of fixed, but inaccurately known quantities have been propagated through the calculations. Using the release categories as input, accident consequences were calculated for the site Kalkar. Though the uncertainty bandwidths for the accident frequencies estimated in the SNR-300 analysis are much wider than for the PWR, the analysis indicates that frequencies of severe accidents, and consequences, are smaller for the SNR-300 than for the PWR as analysed in the 'German Risk Study'. (orig.)

  17. Experimental and theoretical investigations on safety of the SNR - straight-tube design steam generator with sodium-water reactions

    International Nuclear Information System (INIS)

    Dumm, K.; Sauermann, F.; Schnitker, W.; Welter, A.

    A number of large sodium-water reaction tests has been performed in a steam generator model in order to verify the layout criteria of the SNR straight-tube design steam generators under accident conditions. The experimental setup is described. The test results and their applicability to the SNR steam generators are given and discussed. (U.S.)

  18. On the capacity of nakagami-m fading Channels with full channel state information at low SNR

    KAUST Repository

    Rezki, Zouheir

    2012-06-01

    The capacity of flat Rayleigh fading channels with full channel state information (CSI) at the transmitter and at the receiver at asymptotically low SNR has been recently shown to scale essentially as SNR log(1/SNR)}. In this paper, we investigate the Nakagami-m fading channel capacity with full CSI, and show that the capacity of this channel scales essentially as m/ Omega SNR log(1/SNR), where m is the Nakagami-m fading parameter and where Ω is the channel mean-square. We also show that one-bit CSI at the transmitter is enough to achieve this asymptotic capacity using an On-Off power control scheme. Our framework may be seen as a generalization of previous works as it captures the Rayleigh fading channel as a special case by taking m=1. © 2012 IEEE.

  19. New method to extract radial acceleration of target from short-duration signal at low SNR

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    In order to extract target radial acceleration from radar echo signal at low SNR (signal-to-noise), this paper employed FRFT (fractional Fourier transformation) to analyze short-duration radar echo and studied the relations between signal convergence peaks in matched transformation domain and signal duration and modu- lated frequency of signal. When signal duration is specified, the method of multi- plying sampled signal by the known frequency modulated signal to alter modulated frequency was presented, which generated the new signal with larger convergence peaks than the initial signal in matched transformation domain. Thus, it could successfully estimate the radial acceleration of radar target at low SNR. Simulations were conducted to show the feasibility and effectiveness of the method.

  20. Quasi Cyclic Low Density Parity Check Code for High SNR Data Transfer

    Directory of Open Access Journals (Sweden)

    M. R. Islam

    2010-06-01

    Full Text Available An improved Quasi Cyclic Low Density Parity Check code (QC-LDPC is proposed to reduce the complexity of the Low Density Parity Check code (LDPC while obtaining the similar performance. The proposed QC-LDPC presents an improved construction at high SNR with circulant sub-matrices. The proposed construction yields a performance gain of about 1 dB at a 0.0003 bit error rate (BER and it is tested on 4 different decoding algorithms. Proposed QC-LDPC is compared with the existing QC-LDPC and the simulation results show that the proposed approach outperforms the existing one at high SNR. Simulations are also performed varying the number of horizontal sub matrices and the results show that the parity check matrix with smaller horizontal concatenation shows better performance.

  1. Licensing aspects in the verification of the SNR 300 design concept against hypothetical accidents

    International Nuclear Information System (INIS)

    Kugler, E.; Wiesner, S.

    1976-01-01

    The German prototype of a fast breeder reactor, the SNR 300, is being built near Kalkar on the Lower Rhine. It is a loop-type fast sodium-cooled reactor, designed and constructed by Interatom, Bensberg. Experiences gained from the first phase of construction are described. The report is restricted to the aspects of the SNR 300 design against a core disruptive accident (CDA) and its consequences and to the difficulties having arisen in the verification of the design concept so far. Some examples of the detailed design are described and discussed from the licensing authority's point of view showing that the difficulties have been typical for a prototype reactor subjected to a regular licensing procedure

  2. Comparison study on CNR and SNR of thoracic spine lateral radiography

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Ki Won [Dept. of Radiology, Samsung Medical Center, Seoul (Korea, Republic of); Min, Jung Whan; Lyu, Kwang Yeul [Dept. of Radiology, Shingu University, Sungnam (Korea, Republic of); Kim, Jung Min [Dept. of Radiological Science, College of Health Science, Korea University, Seoul (Korea, Republic of); Jeong, Hei Woun [Dept. of Radiological Science, Beakseok Culture University, Cheonan (Korea, Republic of); Lee, Joo Ah [Dept. of Oncology, Catholic University of Korea Incheon St.Mary,s Hospital, Incheon (Korea, Republic of); Jung, Jae Hong [Dept. of Oncology, Soonchunhyang University Bucheon Hospital, Bucheon (Korea, Republic of); Sung, Dong Chan [Dept. of Radiology, Dong Guk University Medical Center, Seoul (Korea, Republic of); Park, Soon Cheol [Dept. of Radiology, Kang Dong Kyung Hee University Medical Center, Seoul (Korea, Republic of)

    2013-12-15

    This study was proven for the T-spine breathing technique in lateral projection, using computer radiography (CR), charge coupled device (CCD), indirect digital radiography (IDR) and direct digital radiography (DDR). All images were evaluated and compared with CNR and SNR measured with the mean pixels and the standard deviation as setting ROI of spinous process, pedicle, vertebral body, intervertebral foramen and intervertebral disk using Image J. In experiment results of 4 type detectors, T-spine breathing technique was indicated as excellent in ROI of spinous process, pedicle, vertebral body, intervertebral foramen and intervertebral disk. As T-spine breathing technique indicated excellent images compared to the existing T-spine lateral radiography, this method would be useful for elderly patients who have difficulty in deep exhalation. This study was indicated the application possibility of T-spine breathing technique by presenting contrast to noise ratio (CNR) and signal to noise ratio (SNR) with quantitative value in 4 type detectors.

  3. Use of compensation assemblies in the first core of SNR-300

    International Nuclear Information System (INIS)

    Billaux, M.; De Wouters, R.; Pilate, S.; Vandenberg, C.

    1975-01-01

    For the SNR-300 reactor, the use of thin fuel pins was limited to the first core. A direct consequence of changing from the cycle reloading scheme to a complete irradiation without refueling operation is an increase of the initial excess reactivity and plutonium investment. The new system of special assemblies conceived to compensate for the too high reactivity of the first core is described: fixed absorbers, made of B 4 C pins, and sodium diluents, consisting simply of hollow wrapper tubes [fr

  4. The split symbol moments SNR estimator in narrow-band channels

    Science.gov (United States)

    Shah, Biren; Hinedi, Sami

    1990-01-01

    The split symbol moments estimator is an algorithm that is designed to estimate symbol SNR in the presence of additive white Gaussian noise. The performance of the algorithm in band-limited channels is examined, and the effects of the resulting intersymbol interference are quantified. All results obtained are in closed form and can be easily evaluated numerically for performance-prediction purposes. The results are also validated through digital simulations.

  5. Design of planar microcoil-based NMR probe ensuring high SNR

    Science.gov (United States)

    Ali, Zishan; Poenar, D. P.; Aditya, Sheel

    2017-09-01

    A microNMR probe for ex vivo applications may consist of at least one microcoil, which can be used as the oscillating magnetic field (MF) generator as well as receiver coil, and a sample holder, with a volume in the range of nanoliters to micro-liters, placed near the microcoil. The Signal-to-Noise ratio (SNR) of such a probe is, however, dependent not only on its design but also on the measurement setup, and the measured sample. This paper introduces a performance factor P independent of both the proton spin density in the sample and the external DC magnetic field, and which can thus assess the performance of the probe alone. First, two of the components of the P factor (inhomogeneity factor K and filling factor η ) are defined and an approach to calculate their values for different probe variants from electromagnetic simulations is devised. A criterion based on dominant component of the magnetic field is then formulated to help designers optimize the sample volume which also affects the performance of the probe, in order to obtain the best SNR for a given planar microcoil. Finally, the P factor values are compared between different planar microcoils with different number of turns and conductor aspect ratios, and planar microcoils are also compared with conventional solenoids. These comparisons highlight which microcoil geometry-sample volume combination will ensure a high SNR under any external setup.

  6. Design of planar microcoil-based NMR probe ensuring high SNR

    Directory of Open Access Journals (Sweden)

    Zishan Ali

    2017-09-01

    Full Text Available A microNMR probe for ex vivo applications may consist of at least one microcoil, which can be used as the oscillating magnetic field (MF generator as well as receiver coil, and a sample holder, with a volume in the range of nanoliters to micro-liters, placed near the microcoil. The Signal-to-Noise ratio (SNR of such a probe is, however, dependent not only on its design but also on the measurement setup, and the measured sample. This paper introduces a performance factor P independent of both the proton spin density in the sample and the external DC magnetic field, and which can thus assess the performance of the probe alone. First, two of the components of the P factor (inhomogeneity factor K and filling factor η are defined and an approach to calculate their values for different probe variants from electromagnetic simulations is devised. A criterion based on dominant component of the magnetic field is then formulated to help designers optimize the sample volume which also affects the performance of the probe, in order to obtain the best SNR for a given planar microcoil. Finally, the P factor values are compared between different planar microcoils with different number of turns and conductor aspect ratios, and planar microcoils are also compared with conventional solenoids. These comparisons highlight which microcoil geometry-sample volume combination will ensure a high SNR under any external setup.

  7. Optimizing the night time with dome vents and SNR-QSO at CFHT

    Science.gov (United States)

    Devost, Daniel; Mahoney, Billy; Moutou, Claire; CFHT QSO Team, CFHT software Group

    2017-06-01

    Night time is a precious and costly commodity and it is important to get everything we can out of every second of every night of observing. In 2012 the Canada-France-Hawaii Telescope started operating 12 new vent doors installed on the dome over the course of the previous two years. The project was highly successful and seeing measurements show that venting the dome greatly enhances image quality at the focal plane. In order to capitalize on the gains brought by the new vents, the observatory started exploring a new mode of observation called SNR-QSO. This mode consist of a new implementation inside our Queued Service Observation (QSO) system. Exposure times are adjusted for each frame depending on the weather conditions in order to reach a specific depth, Signal to Noise Ratio (SNR) at a certain magnitude. The goal of this new mode is to capitalize on the exquisite seeing provided by Maunakea, complemented by the minimized dome turbulence, to use the least amount of time to reach the depth required by the science programs. Specific implementations were successfully tested on two different instruments, our wide field camera MegaCam and our high resolution spectrograph ESPaDOnS. I will present the methods used for each instrument to achieve SNR observing and the gains produced by these new observing modes in order to reach the scientific goals of accepted programs in a shorter amount of time.

  8. Skalabilitas Signal to Noise Ratio (SNR pada Pengkodean Video dengan Derau Gaussian

    Directory of Open Access Journals (Sweden)

    Agus Purwadi

    2015-04-01

    Full Text Available In video transmission, there is a possibility of packet lost an d a large load variation on the bandwidth. These are the source of network congestion, which can interfere the communication data rate. This study discusses a system to overcome the congestion with Signal-to-noise ratio (SNR scalability-based approach, for the video sequence encoding method into two layers, which is a solution to decrease encoding mode for each packet and channel coding rate. The goal is to minimize any distortion from the source to the destination. The coding system used is a video coding standards that is MPEG-2 or H.263 with SNR scalability. The algorithm used for motion compensation, temporal redundancy and spatial redundancy is the Discrete Cosine Transform (DCT and quantization. The transmission error is simulated by adding Gaussian noise (error on motion vectors. From the simulation results, the SNR and Peak Signal to Noise Ratio (PSNR in the noisy video frames decline with averages of 3dB and 4dB respectively.

  9. Best relay selection using SNR and interference quotient for underlay cognitive networks

    KAUST Repository

    Hussain, Syed Imtiaz

    2012-06-01

    Cognitive networks in underlay settings operate simultaneously with the primary networks satisfying stringent interference limits. This condition forces them to operate with low transmission powers and confines their area of coverage. In an effort to reach remote destinations, underlay cognitive sources make use of relaying techniques. Selecting the best relay among those who are ready to cooperate is different in underlay settings than traditional non-cognitive networks. In this paper, we present a relay selection scheme which uses the quotient of the relay link signal to noise ratio (SNR) and the interference generated from the relay to the primary user to choose the best relay. The proposed scheme optimizes this quotient in a way to maximize the relay link SNR above a certain value whereas the interference is kept below a defined threshold. We derive closed expressions for the outage probability and bit error probability of the system incorporating this scheme. Simulation results confirm the validity of the analytical results and reveal that the relay selection in cognitive environment is feasible in low SNR regions. © 2012 IEEE.

  10. Empirical investigation on the dependence of TCP downstream throughput on SNR in an IEEE802.11b WLAN system

    Directory of Open Access Journals (Sweden)

    Ikponmwosa Oghogho

    2017-04-01

    Full Text Available The dependence of TCP downstream throughput (TCPdownT on signal to noise ratio (SNR in an IEEE802.11b WLAN system was investigated in various environments and varieties of QoS traffic. TCPdownT was measured for various SNR observed. An Infrastructure based IEEE802.11b WLAN system having networked computers on which measurement software were installed, was set up consecutively in various environments (open corridor, small offices with block walls and plaster boards and free space. Empirical models describing TCPdownT against SNR for different signal ranges (all ranges of signals, strong signals only, grey signals only and weak signals only were statistically generated and validated. As the SNR values changed from high (strong signals through low (grey signals to very low (weak signals, our results show a strong dependence of TCPdownT on the received SNR. Our models showed lower RMS errors when compared with other similar models. We observed RMS errors of 0.6734791 Mbps, 0.472209 Mbps, 0.9111563 Mbps and 0.5764460 Mbps for general (all SNR model, strong signals model, grey signals model and Weak signals model respectively. Our models will provide researchers and WLAN systems users with a tool to estimate the TCP downstream throughput in a real network in various environments by monitoring the received SNR.

  11. High SNR Acquisitions Improve the Repeatability of Liver Fat Quantification Using Confounder-corrected Chemical Shift-encoded MR Imaging

    Science.gov (United States)

    Motosugi, Utaroh; Hernando, Diego; Wiens, Curtis; Bannas, Peter; Reeder, Scott. B

    2017-01-01

    Purpose: To determine whether high signal-to-noise ratio (SNR) acquisitions improve the repeatability of liver proton density fat fraction (PDFF) measurements using confounder-corrected chemical shift-encoded magnetic resonance (MR) imaging (CSE-MRI). Materials and Methods: Eleven fat-water phantoms were scanned with 8 different protocols with varying SNR. After repositioning the phantoms, the same scans were repeated to evaluate the test-retest repeatability. Next, an in vivo study was performed with 20 volunteers and 28 patients scheduled for liver magnetic resonance imaging (MRI). Two CSE-MRI protocols with standard- and high-SNR were repeated to assess test-retest repeatability. MR spectroscopy (MRS)-based PDFF was acquired as a standard of reference. The standard deviation (SD) of the difference (Δ) of PDFF measured in the two repeated scans was defined to ascertain repeatability. The correlation between PDFF of CSE-MRI and MRS was calculated to assess accuracy. The SD of Δ and correlation coefficients of the two protocols (standard- and high-SNR) were compared using F-test and t-test, respectively. Two reconstruction algorithms (complex-based and magnitude-based) were used for both the phantom and in vivo experiments. Results: The phantom study demonstrated that higher SNR improved the repeatability for both complex- and magnitude-based reconstruction. Similarly, the in vivo study demonstrated that the repeatability of the high-SNR protocol (SD of Δ = 0.53 for complex- and = 0.85 for magnitude-based fit) was significantly higher than using the standard-SNR protocol (0.77 for complex, P magnitude-based fit, P = 0.003). No significant difference was observed in the accuracy between standard- and high-SNR protocols. Conclusion: Higher SNR improves the repeatability of fat quantification using confounder-corrected CSE-MRI. PMID:28190853

  12. On the finite-SNR diversity-multiplexing tradeoff of zero-forcing transmit scheme under secrecy constraint

    KAUST Repository

    Rezki, Zouheir

    2011-06-01

    In this paper, we address the finite Signal-to-Noise Ratio (SNR) Diversity-Multiplexing Tradeoff (DMT) of the Multiple Input Multiple Output (MIMO) wiretap channel, where a Zero-Forcing (ZF) transmit scheme, that intends to send the secret information in the orthogonal space of the eavesdropper channel, is used. First, we introduce the secret multiplexing gain at finite-SNR that generalizes the definition at high-SNR. Then, we provide upper and lower bounds on the outage probability under secrecy constraint, from which secret diversity gain estimates of ZF are derived. Through asymptotic analysis, we show that the upper bound underestimates the secret diversity gain, whereas the lower bound is tight at high-SNR, and thus its related diversity gain estimate is equal to the actual asymptotic secret diversity gain of the Multiple-Input Multiple-Output (MIMO) wiretap channel. © 2011 IEEE.

  13. LACERTA I AND CASSIOPEIA III. TWO LUMINOUS AND DISTANT ANDROMEDA SATELLITE DWARF GALAXIES FOUND IN THE 3π PAN-STARRS1 SURVEY

    International Nuclear Information System (INIS)

    Martin, Nicolas F.; Laevens, Benjamin P. M.; Slater, Colin T.; Bell, Eric F.; Schlafly, Edward F.; Morganson, Eric; Rix, Hans-Walter; Bernard, Edouard J.; Ferguson, Annette M. N.; Finkbeiner, Douglas P.; Burgett, William S.; Chambers, Kenneth C.; Hodapp, Klaus W.; Kaiser, Nicholas; Kudritzki, Rolf-Peter; Magnier, Eugene A.; Morgan, Jeffrey S.; Tonry, John L.; Wainscoat, Richard J.; Price, Paul A.

    2013-01-01

    We report the discovery of two new dwarf galaxies, Lacerta I/Andromeda XXXI (Lac I/And XXXI) and Cassiopeia III/Andromeda XXXII (Cas III/And XXXII), in stacked Pan-STARRS1 r P1 - and i P1 -band imaging data. Both are luminous systems (M V ∼ –12) located at projected distances of 20.°3 and 10.°5 from M31. Lac I and Cas III are likely satellites of the Andromeda galaxy with heliocentric distances of 756 +44 -28 kpc and 772 +61 -56 kpc, respectively, and corresponding M31-centric distances of 275 ± 7 kpc and 144 +6 -4 kpc. The brightest of recent Local Group member discoveries, these two new dwarf galaxies owe their late discovery to their large sizes (r h = 4.2 +0.4 -0.5 arcmin or 912 +124 -93 pc for Lac I; r h = 6.5 +1.2 -1.0 arcmin or 1456 ± 267 pc for Cas III) and consequently low surface brightness (μ 0 ∼ 26.0 mag arcsec –2 ), as well as to the lack of a systematic survey of regions at large radii from M31, close to the Galactic plane. This latter limitation is now alleviated by the 3π Pan-STARRS1 survey, which could lead to the discovery of other distant Andromeda satellite dwarf galaxies.

  14. Intelligibility for Binaural Speech with Discarded Low-SNR Speech Components.

    Science.gov (United States)

    Schoenmaker, Esther; van de Par, Steven

    2016-01-01

    Speech intelligibility in multitalker settings improves when the target speaker is spatially separated from the interfering speakers. A factor that may contribute to this improvement is the improved detectability of target-speech components due to binaural interaction in analogy to the Binaural Masking Level Difference (BMLD). This would allow listeners to hear target speech components within specific time-frequency intervals that have a negative SNR, similar to the improvement in the detectability of a tone in noise when these contain disparate interaural difference cues. To investigate whether these negative-SNR target-speech components indeed contribute to speech intelligibility, a stimulus manipulation was performed where all target components were removed when local SNRs were smaller than a certain criterion value. It can be expected that for sufficiently high criterion values target speech components will be removed that do contribute to speech intelligibility. For spatially separated speakers, assuming that a BMLD-like detection advantage contributes to intelligibility, degradation in intelligibility is expected already at criterion values below 0 dB SNR. However, for collocated speakers it is expected that higher criterion values can be applied without impairing speech intelligibility. Results show that degradation of intelligibility for separated speakers is only seen for criterion values of 0 dB and above, indicating a negligible contribution of a BMLD-like detection advantage in multitalker settings. These results show that the spatial benefit is related to a spatial separation of speech components at positive local SNRs rather than to a BMLD-like detection improvement for speech components at negative local SNRs.

  15. Measurement and analysis of vibrational behaviour of an SNR-fuel element in sodium flow

    International Nuclear Information System (INIS)

    Hess, B.F.H.; Ruppert, E.; Schmidt, H.; Vinzens, K.

    1975-01-01

    Within the framework of SNR-300 fuel element development programme a complete full size fuel element dummy has been tested thoroughly for nearly 3000 hours at 650 0 C system temperature in the AKB sodium loop at Interatom, Bensberg. Investigations of the hydraulic characteristics by measurements of specific pressure losses, flow velocities, leakage flow through the piston rings and investigations of its vibrational behaviour were part of this endurance test at elevated temperatures. The pressure drop versus flow and the leakage measurement are mentioned briefly to confirm the correctness of the test hydraulics. The vibrational behaviour of the element and the approach to analysis is the main object of this report. (Auth.)

  16. Status of sodium removal and component decontamination technology in the SNR programme

    Energy Technology Data Exchange (ETDEWEB)

    Haubold, W [INTERATOM GmbH, Bergisch Gladbach (Germany); Smit, C Ch [MT-TNO Dept. 50-MW Sodium Component Test Facility, Hengelo (Netherlands); Stade, K Ch [Kernkraftwerk-Betriebsgesellschaft mbH, Eggenstein-Leopoldshafen (Germany)

    1978-08-01

    This paper summarizes the experience with sodium removal and component decontamination processes within the framework of the SNR project since the IAEA Specialists Meeting on 'Decontamination of Plant Components from Sodium and Radioactivity' at Dounreay, April 9-12, 1973. The moist nitrogen process has been successfully applied to remove sodium from all 66 fuel elements of the KNK I core. Progress has been obtained in removing sodium from fuel elements and large components by vacuum distillation. Areas where future development is required are identified. (author)

  17. Study of the containment system of the planned SNR-2 Fast Breeder Reactor

    International Nuclear Information System (INIS)

    Bunz, H.; Scholle, U.

    1979-01-01

    Research is presented concerning the behaviour of four possible containment concepts for the planned Fast Breeder Reactor SNR-2 under the conditions of a HCDA. Detailed descriptions and calculations are given dealing with the acceptable leakages and the filter loads reached. The transport of the aerosol-type as well as the gaseous activity through the different compartments into the environment is calculated and from this the resulting accident doses. To cover the uncertainties of the accident course a wide range of accident parameters is examined

  18. Fabrication of fuel elements interplay between typical SNR Mark Ia specifications and the fuel element fabrication

    International Nuclear Information System (INIS)

    Biermann, W.K.; Heuvel, H.J.; Pilate, S.; Vanderborck, Y.; Pelckmans, E.; Vanhellemont, G.; Roepenack, H.; Stoll, W.

    1987-01-01

    The core and fuel were designed for the SNR-300 first core by Interatom GmbH and Belgonucleaire. The fuel was fabricated by Alkem/RBU and Belgonucleaire. Based on the preparation of drawings and specifications and on the results of the prerun fabrication, an extensive interplay took place between design requirements, specifications, and fabrication processes at both fuel plants. During start-up of pellet and pin fabrication, this solved such technical questions as /sup 239/Pu equivalent linear weight, pellet density, stoichiometry of the pellets, and impurity content. Close cooperation of designers and manufacturers has allowed manufacture of 205 fuel assemblies without major problems

  19. Status of sodium removal and component decontamination technology in the SNR programme

    International Nuclear Information System (INIS)

    Haubold, W.; Smit, C.Ch.; Stade, K.Ch.

    1978-01-01

    This paper summarizes the experience with sodium removal and component decontamination processes within the framework of the SNR project since the IAEA Specialists Meeting on 'Decontamination of Plant Components from Sodium and Radioactivity' at Dounreay, April 9-12, 1973. The moist nitrogen process has been successfully applied to remove sodium from all 66 fuel elements of the KNK I core. Progress has been obtained in removing sodium from fuel elements and large components by vacuum distillation. Areas where future development is required are identified. (author)

  20. The Fast Breeder SNR 300 in the ups and downs of its history

    International Nuclear Information System (INIS)

    Marth, W.

    1992-03-01

    The Fast Breeder Project was founded in 1960 at Karlsruhe. After an initial period of basic research, the industry took over the design of SRN 300. Affected by various political influences, the construction of the nuclear power plant Kalkar was disturbed and delayed, but was finally completed in 1985. However, since the governing party of Nordrhein-Westfalen decided to drop out of nuclear energy, the authorisation for starting up the SNR 300 could not be obtained. Therefore, the Kalkar project was cancelled for political reasons in March 1991. (orig.) [de

  1. A Ramp Cosine Cepstrum Model for the Parameter Estimation of Autoregressive Systems at Low SNR

    Directory of Open Access Journals (Sweden)

    Zhu Wei-Ping

    2010-01-01

    Full Text Available A new cosine cepstrum model-based scheme is presented for the parameter estimation of a minimum-phase autoregressive (AR system under low levels of signal-to-noise ratio (SNR. A ramp cosine cepstrum (RCC model for the one-sided autocorrelation function (OSACF of an AR signal is first proposed by considering both white noise and periodic impulse-train excitations. Using the RCC model, a residue-based least-squares optimization technique that guarantees the stability of the system is then presented in order to estimate the AR parameters from noisy output observations. For the purpose of implementation, the discrete cosine transform, which can efficiently handle the phase unwrapping problem and offer computational advantages as compared to the discrete Fourier transform, is employed. From extensive experimentations on AR systems of different orders, it is shown that the proposed method is capable of estimating parameters accurately and consistently in comparison to some of the existing methods for the SNR levels as low as −5 dB. As a practical application of the proposed technique, simulation results are also provided for the identification of a human vocal tract system using noise-corrupted natural speech signals demonstrating a superior estimation performance in terms of the power spectral density of the synthesized speech signals.

  2. Capacity Bounds and High-SNR Capacity of MIMO Intensity-Modulation Optical Channels

    KAUST Repository

    Chaaban, Anas

    2018-02-19

    The capacity of the intensity modulation direct detection multiple-input multiple-output channel is studied. Therein, the nonnegativity constraint of the transmit signal limits the applicability of classical schemes, including precoding. Thus, new ways are required for deriving capacity bounds for this channel. To this end, capacity lower bounds are developed in this paper by deriving the achievable rates of two precodingfree schemes: Channel inversion and QR decomposition. The achievable rate of a DC-offset SVD-based scheme is also derived as a benchmark. Then, capacity upper bounds are derived and compared against the lower bounds. As a result, the capacity at high signal-to-noise ratio (SNR) is characterized for the case where the number of transmit apertures is not larger than the number of receive apertures, and is shown to be achievable by the QR decomposition scheme. This is shown for a channel with average intensity or peak intensity constraints. Under both constraints, the high-SNR capacity is approximated within a small gap. Extensions to a channel with more transmit apertures than receive apertures are discussed, and capacity bounds for this case are derived.

  3. Capacity Bounds and High-SNR Capacity of MIMO Intensity-Modulation Optical Channels

    KAUST Repository

    Chaaban, Anas; Rezki, Zouheir; Alouini, Mohamed-Slim

    2018-01-01

    The capacity of the intensity modulation direct detection multiple-input multiple-output channel is studied. Therein, the nonnegativity constraint of the transmit signal limits the applicability of classical schemes, including precoding. Thus, new ways are required for deriving capacity bounds for this channel. To this end, capacity lower bounds are developed in this paper by deriving the achievable rates of two precodingfree schemes: Channel inversion and QR decomposition. The achievable rate of a DC-offset SVD-based scheme is also derived as a benchmark. Then, capacity upper bounds are derived and compared against the lower bounds. As a result, the capacity at high signal-to-noise ratio (SNR) is characterized for the case where the number of transmit apertures is not larger than the number of receive apertures, and is shown to be achievable by the QR decomposition scheme. This is shown for a channel with average intensity or peak intensity constraints. Under both constraints, the high-SNR capacity is approximated within a small gap. Extensions to a channel with more transmit apertures than receive apertures are discussed, and capacity bounds for this case are derived.

  4. Joint volumetric extraction and enhancement of vasculature from low-SNR 3-D fluorescence microscopy images.

    Science.gov (United States)

    Almasi, Sepideh; Ben-Zvi, Ayal; Lacoste, Baptiste; Gu, Chenghua; Miller, Eric L; Xu, Xiaoyin

    2017-03-01

    To simultaneously overcome the challenges imposed by the nature of optical imaging characterized by a range of artifacts including space-varying signal to noise ratio (SNR), scattered light, and non-uniform illumination, we developed a novel method that segments the 3-D vasculature directly from original fluorescence microscopy images eliminating the need for employing pre- and post-processing steps such as noise removal and segmentation refinement as used with the majority of segmentation techniques. Our method comprises two initialization and constrained recovery and enhancement stages. The initialization approach is fully automated using features derived from bi-scale statistical measures and produces seed points robust to non-uniform illumination, low SNR, and local structural variations. This algorithm achieves the goal of segmentation via design of an iterative approach that extracts the structure through voting of feature vectors formed by distance, local intensity gradient, and median measures. Qualitative and quantitative analysis of the experimental results obtained from synthetic and real data prove the effcacy of this method in comparison to the state-of-the-art enhancing-segmenting methods. The algorithmic simplicity, freedom from having a priori probabilistic information about the noise, and structural definition gives this algorithm a wide potential range of applications where i.e. structural complexity significantly complicates the segmentation problem.

  5. A Study on the Optimal Receiver Impedance for SNR Maximization in Broadband PLC

    Directory of Open Access Journals (Sweden)

    Massimo Antoniali

    2013-01-01

    Full Text Available We consider the design of the front-end receiver for broadband power line communications. We focus on the design of the input impedance that maximizes the signal-to-noise ratio (SNR at the receiver. We show that the amplitude, rather than the power, of the received signal is important for communication purposes. Furthermore, we show that the receiver impedance impacts the amplitude of the noise term. We focus on the background noise, and we propose a novel description of the noise experienced at the receiver port of a PLC network. We model the noise as the sum of four uncorrelated contributions, that is, the active, resistive, receiver, and coupled noise components. We study the optimal impedance design problem for real in-home grids that we assessed with experimental measurements. We describe the results of the measurement campaign, and we report the statistics of the optimal impedance. Hence, we study the best attainable performance when the optimal receiver impedance is deployed. We focus on the SNR and the maximum achievable rate, and we show that power matching is suboptimal with respect to the proposed impedance design approach.

  6. Multifrequency radio observations of SNR J0536-6735 (N 59B with associated pulsar

    Directory of Open Access Journals (Sweden)

    Bozzetto L.M.

    2012-01-01

    Full Text Available We present a study of new Australian Telescope Compact Array (ATCA observations of supernova remnant, SNR J0536-6735. This remnant appears to follow a shell morphology with a diameter of D=36x29 pc (with 1 pc uncertainty in each direction. There is an embedded HII region on the northern limb of the remnant which made various analysis and measurements (such as flux density, spectral index and polarisation difficult. The radio-continuum emission followed the same structure as the optical emission, allowing for extent and flux density estimates at 20 cm. We estimate the surface brightness at 1 GHz of 2.55x10−21 Wm−2 Hz−1 sr−1 for the SNR. Also, we detect a distinctive radio-continuum point source which confirms the previous suggestion of this remnant being associated with pulsar wind nebula (PWN. The tail of this remnant is not seen in the radio-continuum images and is only seen in the optical and X-ray images.

  7. Multi-reception strategy with improved SNR for multichannel MR imaging.

    Directory of Open Access Journals (Sweden)

    Bing Wu

    Full Text Available A multi-reception strategy with extended GRAPPA is proposed in this work to improve MR imaging performance at ultra-high field MR systems with limited receiver channels. In this method, coil elements are separated to two or more groups under appropriate grouping criteria. Those groups are enabled in sequence for imaging first, and then parallel acquisition is performed to compensate for the redundant scan time caused by the multiple receptions. To efficiently reconstruct the data acquired from elements of each group, a specific extended GRAPPA was developed. This approach was evaluated by using a 16-element head array on a 7 Tesla whole-body MRI scanner with 8 receive channels. The in-vivo experiments demonstrate that with the same scan time, the 16-element array with twice receptions and acceleration rate of 2 can achieve significant SNR gain in the periphery area of the brain and keep nearly the same SNR in the center area over an eight-element array, which indicates the proposed multi-reception strategy and extended GRAPPA are feasible to improve image quality for MRI systems with limited receive channels. This study also suggests that it is advantageous for a MR system with N receiver channels to utilize a coil array with more than N elements if an appropriate acquisition strategy is applied.

  8. The effect of energy weighting on the SNR under the influence of non-ideal detectors in mammographic applications

    International Nuclear Information System (INIS)

    Patatoukas, G.; Gaitanis, A.; Kalivas, N.; Liaparinos, P.; Nikolopoulos, D.; Konstantinidis, A.; Kandarakis, I.; Cavouras, D.; Panayiotakis, G.

    2006-01-01

    This work investigates the effect of the energy-weighting technique on the signal to noise ratio (SNR) response of X-ray imaging detectors. So far in the literature all scintillation-detector characteristics (detection efficiency, conversion efficiency, light-attenuation effects, etc) that degrade image quality have been ignored. A theoretical evaluation of the scintillator's SNR output was carried out. An algorithm was produced to describe the variation of the weighting factor, and SNR, with respect to the anode material (Mo or W), in a particular energy range (25-40 keV), typical for mammography, using two different phantoms. Results show that under non-ideal conditions the ratio of the weighted SNR to the original SNR appears to be increasing from values that are close to unity, and under specific conditions, can reach values up to 30. For the further investigation of this method, a more complex, simulated computed tomography breast imaging system was modeled and studied for various parameters such as breast software phantoms, scintillation materials and reconstruction filters

  9. Production and Distribution of {sup 44}Ti and {sup 56}Ni in a Three-dimensional Supernova Model Resembling Cassiopeia A

    Energy Technology Data Exchange (ETDEWEB)

    Wongwathanarat, Annop [RIKEN, Astrophysical Big Bang Laboratory, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Janka, Hans-Thomas; Müller, Ewald; Pllumbi, Else [Max-Planck-Institut für Astrophysik, Karl-Schwarzschild-Str. 1, D-85748 Garching (Germany); Wanajo, Shinya, E-mail: annop.wongwathanarat@riken.jp [Department of Engineering and Applied Sciences, Sophia University, Chiyoda-ku, Tokyo 102-8554 (Japan)

    2017-06-10

    The spatial and velocity distributions of nuclear species synthesized in the innermost regions of core-collapse supernovae can yield important clues about explosion asymmetries and the operation of the still disputed explosion mechanism. Recent observations of radioactive {sup 44}Ti with high-energy satellite telescopes ( Nuclear Spectroscopic Telescope Array [ NuSTAR ], INTEGRAL ) have measured gamma-ray line details, which provide direct evidence of large-scale explosion asymmetries in SN 1987A and in Cassiopeia A (Cas A) even by mapping of the spatial brightness distribution ( NuSTAR ). Here we discuss a 3D simulation of a neutrino-driven explosion, using a parameterized neutrino engine, whose {sup 44}Ti distribution is mostly concentrated in one hemisphere pointing opposite to the neutron star (NS) kick velocity. Both exhibit intriguing resemblance to the observed morphology of the Cas A remnant, although neither the progenitor nor the explosion was fine-tuned for a perfect match. Our results demonstrate that the asymmetries observed in this remnant can, in principle, be accounted for by a neutrino-driven explosion, and that the high {sup 44}Ti abundance in Cas A may be explained without invoking rapid rotation or a jet-driven explosion, because neutrino-driven explosions generically eject large amounts of high-entropy matter. The recoil acceleration of the NS is connected to mass ejection asymmetries and is opposite to the direction of the stronger explosion, fully compatible with the gravitational tugboat mechanism. Our results also imply that Cas A and SN 1987A could possess similarly “one-sided” Ti and Fe asymmetries, with the difference that Cas A is viewed from a direction with large inclination angle to the NS motion, whereas the NS in SN 1987A should have a dominant velocity component pointing toward us.

  10. Design and operational behaviour of the SNR-reactor fuel element structure

    International Nuclear Information System (INIS)

    Dietz, W.; Toebbe, H.

    1985-01-01

    The fuel element and core concept of a fast breeder reactor is described by the example of the SNR 300 (1st core), and the requirements made on the fuel elements with respect to burnup and neutron dose are listed for existing and projected plants. Irradiation experiments carried out and operational experience gained with fuel elements show that the residence time of the fuel elements is influenced mainly by the stability of shape of the fuel element components. The requirements made with reference to neutron loading for future advanced high-performance fuel elements can not be anticipated from the present state of experience. Besides optimization of fuel element design and checking-out of the limits of operation by PFADFINDERELEMENTE elements, R and D work for the improvement of fuel element materials is also necessary. (orig.) [de

  11. Optimized optical wireless channel for indoor and intra-vehicle communications: power distribution and SNR analysis

    Science.gov (United States)

    Shaaban, Rana; Faruque, Saleh

    2018-01-01

    Light emitting diodes - LEDs are modernizing the indoor illumination and replacing current incandescent and fluorescent lamps rapidly. LEDs have multiple advantages such as extremely high energy efficient, longer lifespan, and lower heat generation. Due to the ability to switch to different light intensity at a very fast rate, LED has given rise to a unique communication technology (visible light communication - VLC) used for high speed data transmission. By studying various kinds of commonly used VLC channel analysis: diffuse and line of sight channels, we presented a simply improved indoor and intra-vehicle visible light communication transmission model. Employing optical wireless communications within the vehicle, not only enhance user mobility, but also alleviate radio frequency interference, and increase efficiency by lowering the complexity of copper cabling. Moreover, a solution to eliminate ambient noise caused by environmental conditions is examined by using optical differential receiver. The simulation results show the improved received power distribution and signal to noise ratio - SNR.

  12. Experimental investigations on scaled models for the SNR-2 decay heat removal by natural convection

    International Nuclear Information System (INIS)

    Hoffmann, H.; Weinberg, D.; Tschoeke, H.; Frey, H.H.; Pertmer, G.

    1986-01-01

    Scaled water models are used to prove the mode of function of the decay heat removal by natural convection for the SNR-2. The 2D and 3D models were designed to reach the characteristic numbers (Richardson, Peclet) of the reactor. In the experiments on 2D models the position of the immersed cooler (IC) and the power were varied. Temperature fields and velocities were measured. The IC installed as a separate component in the hot plenum resulted in a very complex flow behavior and low temperatures. Integrating the IC in the IHX showed a very simple circulating flow and high temperatures within the hot plenum. With increasing power only slightly rising temperature differences within the core and IC were detected. Recalculations using the COMMIX 1B code gave qualitatively satisfying results. (author)

  13. Decay heat removal plan of the SNR-300: a licensed concept

    International Nuclear Information System (INIS)

    Morgenstern, F.H.; Gyr, W.; Stoetzel, H.; Vossebrecker, H.

    1976-01-01

    The report describes how the decay heat removal plan of the SNR-300 has been established in 3 essential licensing steps, thus giving a very significant example for the slow but steady progress in the overall licensing process of the plant. (1) Introduction of an ECCS in addition to the 3 main heat transfer chains as a back-up for rather unlikely and undefined occurrences, 1970; (2) Experimental and computational demonstration of a reliable functioning of the in-vessel natural convection of the fluid flow, 1974; and (3) Proof of fulfilling the general safety and specific reliability criteria for the overall decay heat removal plan; i.e., the 3 main heat transfer chains with specific installations on the steam/water system side and the ECCS, 1976. Some special problem areas, for instance the cavity concept provided for the pipe fracture accident, have still to be licensed, but they do not contribute considerably to the overall risk

  14. On the low SNR capacity of maximum ratio combining over rician fading channels with full channel state information

    KAUST Repository

    Benkhelifa, Fatma

    2013-04-01

    In this letter, we study the ergodic capacity of a maximum ratio combining (MRC) Rician fading channel with full channel state information (CSI) at the transmitter and at the receiver. We focus on the low Signal-to-Noise Ratio (SNR) regime and we show that the capacity scales as L ΩK+L SNRx log(1SNR), where Ω is the expected channel gain per branch, K is the Rician fading factor, and L is the number of diversity branches. We show that one-bit CSI feedback at the transmitter is enough to achieve this capacity using an on-off power control scheme. Our framework can be seen as a generalization of recently established results regarding the fading-channels capacity characterization in the low-SNR regime. © 2012 IEEE.

  15. On the low SNR capacity of maximum ratio combining over rician fading channels with full channel state information

    KAUST Repository

    Benkhelifa, Fatma; Rezki, Zouheir; Alouini, Mohamed-Slim

    2013-01-01

    In this letter, we study the ergodic capacity of a maximum ratio combining (MRC) Rician fading channel with full channel state information (CSI) at the transmitter and at the receiver. We focus on the low Signal-to-Noise Ratio (SNR) regime and we show that the capacity scales as L ΩK+L SNRx log(1SNR), where Ω is the expected channel gain per branch, K is the Rician fading factor, and L is the number of diversity branches. We show that one-bit CSI feedback at the transmitter is enough to achieve this capacity using an on-off power control scheme. Our framework can be seen as a generalization of recently established results regarding the fading-channels capacity characterization in the low-SNR regime. © 2012 IEEE.

  16. On the origin of the system PSR B 1757-24/SNR G 5.4-1.2

    Science.gov (United States)

    Gvaramadze, V. V.

    2004-03-01

    A scenario for the origin of the system PSR B 1757-24/supernova remnant (SNR) G 5.4-1.2 is proposed. It is suggested that both objects are the remnants of a supernova (SN) that exploded within a pre-existing bubble blown-up by a runaway massive star (the SN progenitor) during the final (Wolf-Rayet) phase of its evolution. This suggestion implies that (a) the SN blast centre was significantly offset from the geometric centre of the wind-blown bubble (i.e. from the centre of the future SNR), (b) the bubble was surrounded by a massive wind-driven shell, and (c) the SN blast wave was drastically decelerated by the interaction with the shell. Therefore, one can understand how the relatively young and low-velocity pulsar PSR B 1757-24 was able to escape from the associated SNR G 5.4-1.2 and why the inferred vector of pulsar transverse velocity does not point away from the geometric centre of the SNR. A possible origin of the radio source G 5.27-0.9 (located between PSR B 1757-24 and the SNR G 5.4-1.2) is proposed. It is suggested that G 5.27-0.9 is a lobe of a low Mach number (≃1.7) jet of gas outflowing from the interior of G 5.4-1.2 through the hole bored in the SNR's shell by the escaping pulsar. It is also suggested that the non-thermal emission of the comet-shaped pulsar wind nebula originates in the vicinity of the termination shock and in the cylindric region of subsonically moving shocked pulsar wind. The role of magnetized wind-driven shells (swept-up during the Wolf-Rayet phase from the ambient interstellar medium with the regular magnetic field) in formation of elongated axisymmetric SNRs is discussed.

  17. SNR-300 steam generator accident philosophy - Assessment due to new understandings in Na/H20-reactions

    International Nuclear Information System (INIS)

    Ruloff, G.; Huebner, R.

    1990-01-01

    Recent R+D results in the intermediate leak range (finally confirmed by the PFR steam generator accident) lead to a new assessment for the SNR-300 steam generator accident. This paper discusses the course of such accident which has to be expected under the SNR-300 conditions, starting with an unblocked micro leak and ending with the pressure loads on the secondary system due to overheating failure. Also, enclosed are the possibilities for a leak detection before serious damage has occurred and the discussion of the definition of the DBA. (author). 2 refs, 9 figs

  18. On the origin of the system PSR B1757-24/SNR G5.4-1.2

    OpenAIRE

    Gvaramadze, V. V.

    2003-01-01

    A scenario for the origin of the system PSR B1757-24/supernova remnant (SNR) G5.4-1.2 is proposed. It is suggested that both objects are the remnants of a supernova (SN) that exploded within a pre-existing bubble blown-up by a runaway massive star (the SN progenitor) during the final (Wolf-Rayet) phase of its evolution. This suggestion implies that (a) the SN blast centre was significantly offset from the geometric centre of the wind-blown bubble (i.e. from the centre of the future SNR), (b) ...

  19. Recovery of a broken inspection lance from the reactor vessel of the German sodium cooled fast breeder reactor SNR 300

    International Nuclear Information System (INIS)

    Menck, J.W.; Hoeft, E.; Kirchner, G.

    1988-01-01

    An inspection lance for flow and vibration measurements was installed into the SNR-300 rotating plug. Centering and guiding of the lower end of the lance was effected in the central grid plate insert. The lance was torn off due to handling problems. The task consisted in recovering all defective parts from the reactor vessel and re-establishing the intact initial state. (author)

  20. Design Report for the core design of the first core Mark-Ia of the SNR-300

    International Nuclear Information System (INIS)

    Stanculescu, A.

    1984-05-01

    The report describes the first core Mark-Ia of the SNR-300 reactor and its different assembly types with their operational strategy. Methods, criteria and results of the neutron physical, thermal hydraulic and core mechanical design of the whole core and its assemblies are presented

  1. Activities with regard to research and development of technics for SNR 300 reactor vessel in-service inspection procedures

    International Nuclear Information System (INIS)

    Hoeller, K.; Kirchner, G.; Menck, J.

    1980-01-01

    During the development of SNR 300 in-service inspection equipment, several branches were tested by experiment. In this report special steps for testing of manipulation systems and additional engineering equipment for control systems, such as coupling fluid circuit or camera cooling system are considered more in detail

  2. Gain and offset calibration reduces variation in exposure-dependent SNR among systems with identical digital flat-panel detectors.

    Science.gov (United States)

    Willis, Charles E; Vinogradskiy, Yevgeniy Y; Lofton, Brad K; White, R Allen

    2011-07-01

    The conditions under which vendor performance criteria for digital radiography systems are obtained do not adequately simulate the conditions of actual clinical imaging with respect to radiographic technique factors, scatter production, and scatter control. Therefore, the relationship between performance under ideal conditions and performance in clinical practice remains unclear. Using data from a large complement of systems in clinical use, the authors sought to develop a method to establish expected performance criteria for digital flat-panel radiography systems with respect to signal-to-noise ratio (SNR) versus detector exposure under clinical conditions for thoracic imaging. The authors made radiographic exposures of a patient-equivalent chest phantom at 125 kVp and 180 cm source-to-image distance. The mAs value was modified to produce exposures above and below the mAs delivered by automatic exposure control. Exposures measured free-in-air were corrected to the imaging plane by the inverse square law, by the attenuation factor of the phantom, and by the Bucky factor of the grid for the phantom, geometry, and kilovolt peak. SNR was evaluated as the ratio of the mean to the standard deviation (SD) of a region of interest automatically selected in the center of each unprocessed image. Data were acquired from 18 systems, 14 of which were tested both before and after gain and offset calibration. SNR as a function of detector exposure was interpolated using a double logarithmic function to stratify the data into groups of 0.2, 0.5, 1.0, 2.0, and 5.0 mR exposure (1.8, 4.5, 9.0, 18, and 45 microGy air KERMA) to the detector. The mean SNR at each exposure interval after calibration exhibited linear dependence on the mean SNR before calibration (r2=0.9999). The dependence was greater than unity (m = 1.101 +/- 0.006), and the difference from unity was statistically significant (p grid replacement. The nonconformant behavior of the other system was corrected by replacing

  3. Use of reflected GNSS SNR data to retrieve either soil moisture or vegetation height from a wheat crop

    Directory of Open Access Journals (Sweden)

    S. Zhang

    2017-09-01

    Full Text Available This work aims to estimate soil moisture and vegetation height from Global Navigation Satellite System (GNSS Signal to Noise Ratio (SNR data using direct and reflected signals by the land surface surrounding a ground-based antenna. Observations are collected from a rainfed wheat field in southwestern France. Surface soil moisture is retrieved based on SNR phases estimated by the Least Square Estimation method, assuming the relative antenna height is constant. It is found that vegetation growth breaks up the constant relative antenna height assumption. A vegetation-height retrieval algorithm is proposed using the SNR-dominant period (the peak period in the average power spectrum derived from a wavelet analysis of SNR. Soil moisture and vegetation height are retrieved at different time periods (before and after vegetation's significant growth in March. The retrievals are compared with two independent reference data sets: in situ observations of soil moisture and vegetation height, and numerical simulations of soil moisture, vegetation height and above-ground dry biomass from the ISBA (interactions between soil, biosphere and atmosphere land surface model. Results show that changes in soil moisture mainly affect the multipath phase of the SNR data (assuming the relative antenna height is constant with little change in the dominant period of the SNR data, whereas changes in vegetation height are more likely to modulate the SNR-dominant period. Surface volumetric soil moisture can be estimated (R2  =  0.74, RMSE  =  0.009 m3 m−3 when the wheat is smaller than one wavelength (∼ 19 cm. The quality of the estimates markedly decreases when the vegetation height increases. This is because the reflected GNSS signal is less affected by the soil. When vegetation replaces soil as the dominant reflecting surface, a wavelet analysis provides an accurate estimation of the wheat crop height (R2  =  0.98, RMSE  =  6

  4. Explaining the morphology of supernova remnant (SNR) 1987A with the jittering jets explosion mechanism

    Science.gov (United States)

    Bear, Ealeal; Soker, Noam

    2018-04-01

    We find that the remnant of supernova (SN) 1987A shares some morphological features with four supernova remnants (SNRs) that have signatures of shaping by jets, and from that we strengthen the claim that jets played a crucial role in the explosion of SN 1987A. Some of the morphological features appear also in planetary nebulae (PNe) where jets are observed. The clumpy ejecta bring us to support the claim that the jittering jets explosion mechanism can account for the structure of the remnant of SN 1987A, i.e., SNR 1987A. We conduct a preliminary attempt to quantify the fluctuations in the angular momentum of the mass that is accreted on to the newly born neutron star via an accretion disk or belt. The accretion disk/belt launches the jets that explode core collapse supernovae (CCSNe). The relaxation time of the accretion disk/belt is comparable to the duration of a typical jet-launching episode in the jittering jets explosion mechanism, and hence the disk/belt has no time to relax. We suggest that this might explain two unequal opposite jets that later lead to unequal sides of the elongated structures in some SNRs of CCSNe. We reiterate our earlier call for a paradigm shift from neutrino-driven explosion to a jet-driven explosion of CCSNe.

  5. Measurement and analysis of vibrational behavior of an SNR-fuel element in sodium flow

    International Nuclear Information System (INIS)

    Hess, B.F.H.; Ruppert, E.; Schmidt, H.; Vinzens, K.

    1975-01-01

    Within the framework of SNR-300 fuel element development programme a complete full size fuel element dummy has been tested thoroughly for nearly 3000 hours at 650 deg C system temperature in the AKB sodium loop at Interatom, Bensberg. It is known that the coolant flow through a subassembly can induce flutter or vibrations of structural parts such as single pins, the wrapper and the total pin bundle all of which have been of interest during this test. To detect these vibrations of different structural parts simultaneously with a minimum of instrumentation only 3 weldable high temperature strain gauges were employed. These strain gauges were especially prepared and bent in such a way as to form a bridge between the inner wrapper and a fuel pin top and spot-welded to both the wrapper and the fuel pin. Although this arrangement seems to be a rather unusual one, the simultaneous-measurement of bundle, wrapper and pin vibrations was possible and periodic flow fluctuations were also detected. The presented results are only relative due to calibration difficulties with these deformed strain gauges which were first used during this test. It is, however, believed that this arrangement, in connection with the proposed anlytical approach, leads to a simple and technical representation of the vibrational behavior of core elements during sodium tests. Detailed information needed for check and calibration of computer codes are however displayed by the respective power spectral density functions

  6. SNR and Standard Deviation of cGNSS-R and iGNSS-R Scatterometric Measurements.

    Science.gov (United States)

    Alonso-Arroyo, Alberto; Querol, Jorge; Lopez-Martinez, Carlos; Zavorotny, Valery U; Park, Hyuk; Pascual, Daniel; Onrubia, Raul; Camps, Adriano

    2017-01-19

    This work addresses the accuracy of the Global Navigation Satellite Systems (GNSS)-Reflectometry (GNSS-R) scatterometric measurements considering the presence of both coherent and incoherent scattered components, for both conventional GNSS-R (cGNSS-R) and interferometric GNSS-R (iGNSS-R) techniques. The coherent component is present for some type of surfaces, and it has been neglected until now because it vanishes for the sea surface scattering case. Taking into account the presence of both scattering components, the estimated Signal-to-Noise Ratio (SNR) for both techniques is computed based on the detectability criterion, as it is done in conventional GNSS applications. The non-coherent averaging operation is considered from a general point of view, taking into account that thermal noise contributions can be reduced by an extra factor of 0.88 dB when using partially overlapped or partially correlated samples. After the SNRs are derived, the received waveform's peak variability is computed, which determines the system's capability to measure geophysical parameters. This theoretical derivations are applied to the United Kingdom (UK) TechDemoSat-1 (UK TDS-1) and to the future GNSS REflectometry, Radio Occultation and Scatterometry on board the International Space Station (ISS) (GEROS-ISS) scenarios, in order to estimate the expected scatterometric performance of both missions.

  7. SNR and Standard Deviation of cGNSS-R and iGNSS-R Scatterometric Measurements

    Directory of Open Access Journals (Sweden)

    Alberto Alonso-Arroyo

    2017-01-01

    Full Text Available This work addresses the accuracy of the Global Navigation Satellite Systems (GNSS-Reflectometry (GNSS-R scatterometric measurements considering the presence of both coherent and incoherent scattered components, for both conventional GNSS-R (cGNSS-R and interferometric GNSS-R (iGNSS-R techniques. The coherent component is present for some type of surfaces, and it has been neglected until now because it vanishes for the sea surface scattering case. Taking into account the presence of both scattering components, the estimated Signal-to-Noise Ratio (SNR for both techniques is computed based on the detectability criterion, as it is done in conventional GNSS applications. The non-coherent averaging operation is considered from a general point of view, taking into account that thermal noise contributions can be reduced by an extra factor of 0.88 dB when using partially overlapped or partially correlated samples. After the SNRs are derived, the received waveform’s peak variability is computed, which determines the system’s capability to measure geophysical parameters. This theoretical derivations are applied to the United Kingdom (UK TechDemoSat-1 (UK TDS-1 and to the future GNSS REflectometry, Radio Occultation and Scatterometry on board the International Space Station (ISS (GEROS-ISS scenarios, in order to estimate the expected scatterometric performance of both missions.

  8. Suzaku observation of TeV SNR RX J1713.7-3946

    International Nuclear Information System (INIS)

    Takahashi, Tadayuki; Tanaka, Takaaki; Uchiyama, Yasunobu

    2007-01-01

    We report on results from Suzaku broadband X-ray observations of the Galactic supernova remnant (SNR) RX J1713.7-3946 with an energy coverage of 0.4-40 keV. With a sensitive hard X-ray measurement from the HXD PIN on board Suzaku, we determine the hard X-ray spectrum in the 12-40 keV range to be described by a power law with photon index Γ=3.2±0.2, significantly steeper than the soft X-ray index of Γ=2.4±0.05 measured previously with ASCA and other missions. We find that a simple power law fails to describe the full spectral range of 0.4-40 keV and instead a cutoff power law with hard index Γ=1.96±0.05 and high energy cutoff ε c =9±1 keV provides an excellent fit over the full bandpass. (author)

  9. Development of a smartphone-based pulse oximeter with adaptive SNR/power balancing.

    Science.gov (United States)

    Phelps, Tom; Haowei Jiang; Hall, Drew A

    2017-07-01

    Millions worldwide suffer from diseases that exhibit early warnings signs that can be detected by standard clinical-grade diagnostic tools. Unfortunately, such tools are often prohibitively expensive to the developing world leading to inadequate healthcare and high mortality rates. To address this problem, a smartphone-based pulse oximeter is presented that interfaces with the phone through the audio jack, enabling point-of-care measurements of heart rate (HR) and oxygen saturation (SpO 2 ). The device is designed to utilize existing phone resources (e.g., the processor, battery, and memory) resulting in a more portable and inexpensive diagnostic tool than standalone equivalents. By adaptively tuning the LED driving signal, the device is less dependent on phone-specific audio jack properties than prior audio jack-based work making it universally compatible with all smartphones. We demonstrate that the pulse oximeter can adaptively optimize the signal-to-noise ratio (SNR) within the power constraints of a mobile phone (<; 10mW) while maintaining high accuracy (HR error <; 3.4% and SpO 2 error <; 3.7%) against a clinical grade instrument.

  10. Fluctuations of the SNR at the output of the MVDR with Regularized Tyler Estimators

    KAUST Repository

    Elkhalil, Khalil

    2016-12-27

    This paper analyzes the statistical properties of the signal-to-noise ratio (SNR) at the output of the Capon\\'s minimum variance distortionless response (MVDR) beamformers when operating over impulsive noises. Particularly, we consider the supervised case in which the receiver employs the regularized Tyler estimator in order to estimate the covariance matrix of the interference-plus-noise process using n observations of size N×1N×1. The choice for the regularized Tylor estimator (RTE) is motivated by its resilience to the presence of outliers and its regularization parameter that guarantees a good conditioning of the covariance estimate. Of particular interest in this paper is the derivation of the second order statistics of the SINR. To achieve this goal, we consider two different approaches. The first one is based on considering the classical regime, referred to as the n-large regime, in which N is assumed to be fixed while n grows to infinity. The second approach is built upon recent results developped within the framework of random matrix theory and assumes that N and n grow large together. Numerical results are provided in order to compare between the accuracies of each regime under different settings.

  11. Seismic risk analysis for the fast breeder prototype SNR-300 in Kalkar (FRG)

    International Nuclear Information System (INIS)

    Hosser, D.

    1983-01-01

    This paper summarizes the seismic part of the SNR-300 Risk Oriented Analysis. Two different approaches were used for the seismic hazard description. In the first one, similar to the German Risk Study for PWR, the seismic input was given by a site-independent mean acceleration response spectrum and duration of strong motion prescribed for the design of the plant; the spectrum was scaled with the peak ground acceleration the probability of exceedance of which at the site Kalkar had been calculated in a former seismic hazard tudy. For the second approach, site- and intensity- dependent mean acceleration response spectra and duration of strong motion were derived and the probability of exceedance of the site intensity was evaluated in a probabilistic seismic hazard analysis. The seismic responses of safety related and other important buildings were calculated by time-history analyses using artificial acceleration time-histories with the given frequency content and duration of strong motion. The influence of uncertainties in dynamic soil parameters and structural modelling was assessed in parametric studies. Some important structural elements within the buildings were investigated in more detail. Their seismic performance was evaluated using ultimate limit state definitions according to the respective design codes or rotation limits for nonlinear dynamic calculations. (orig./RW)

  12. Optimized filtering of regional and teleseismic seismograms: results of maximizing SNR measurements from the wavelet transform and filter banks

    Energy Technology Data Exchange (ETDEWEB)

    Leach, R.R.; Schultz, C.; Dowla, F.

    1997-07-15

    Development of a worldwide network to monitor seismic activity requires deployment of seismic sensors in areas which have not been well studied or may have from available recordings. Development and testing of detection and discrimination algorithms requires a robust representative set of calibrated seismic events for a given region. Utilizing events with poor signal-to-noise (SNR) can add significant numbers to usable data sets, but these events must first be adequately filtered. Source and path effects can make this a difficult task as filtering demands are highly varied as a function of distance, event magnitude, bearing, depth etc. For a given region, conventional methods of filter selection can be quite subjective and may require intensive analysis of many events. In addition, filter parameters are often overly generalized or contain complicated switching. We have developed a method to provide an optimized filter for any regional or teleseismically recorded event. Recorded seismic signals contain arrival energy which is localized in frequency and time. Localized temporal signals whose frequency content is different from the frequency content of the pre-arrival record are identified using rms power measurements. The method is based on the decomposition of a time series into a set of time series signals or scales. Each scale represents a time-frequency band with a constant Q. SNR is calculated for a pre-event noise window and for a window estimated to contain the arrival. Scales with high SNR are used to indicate the band pass limits for the optimized filter.The results offer a significant improvement in SNR particularly for low SNR events. Our method provides a straightforward, optimized filter which can be immediately applied to unknown regions as knowledge of the geophysical characteristics is not required. The filtered signals can be used to map the seismic frequency response of a region and may provide improvements in travel-time picking, bearing estimation

  13. BVR{sub c}I{sub c} OBSERVATIONS AND ANALYSES OF THE DWARF DETACHED BINARY V1043 CASSIOPEIA AND A COMMENT ON PRECONTACT W UMa'S

    Energy Technology Data Exchange (ETDEWEB)

    Samec, R. G.; Smith, P. M.; Chamberlain, H. [Astronomy Group, Physics and Engineering Department, Bob Jones University, 1700 Wade Hampton Boulevard, Greenville, SC 29614 (United States); Faulkner, D. R. [Division of Math, Science, Nursing and Public Health, University of South Carolina, Lancaster, 476 Hubbard Drive, Lancaster, SC 29720 (United States); Van Hamme, W. [Physics Department, Florida International University, 11200 SW 8th Street, Miami, FL 33199 (United States)

    2013-01-01

    Complete Bessel BVR{sub c}I{sub c} light curves of V1043 Cassiopeia [2MASS J00371195+5301324, Mis V1292, USNO-A2.0 1425-00875743, {alpha}(2000) = 00{sup h}37{sup m}11.{sup s}95, {delta}(2000) = +53 Degree-Sign 01'32.''5] are analyzed. The system is a member of the small group of pre-contact W UMa binaries (PCWBs). Its light curve has the appearance of an Algol (EA) light curve, however it is made up of dwarf solar type components in a detached mode with a period of only 0.6616 days. The analysis includes a period study, an improved ephemeris, a mass ratio search, and a simultaneous BVR{sub c}I{sub c} Wilson-Devinney solution. We document about 20 other PCWBs given in the literature. Several have RS CVn-like properties.

  14. A study of Tycho's SNR at TeV energies with the HEGRA CT-System

    Science.gov (United States)

    Aharonian, F. A.; Akhperjanian, A. G.; Barrio, J. A.; Bernlöhr, K.; Börst, H.; Bojahr, H.; Bolz, O.; Contreras, J. L.; Cortina, J.; Denninghoff, S.; Fonseca, V.; Gonzalez, J. C.; Götting, N.; Heinzelmann, G.; Hermann, G.; Heusler, A.; Hofmann, W.; Horns, D.; Ibarra, A.; Jung, I.; Kankanyan, R.; Kestel, M.; Kettler, J.; Kohnle, A.; Konopelko, A.; Kornmeyer, H.; Kranich, D.; Krawczynski, H.; Lampeitl, H.; Lorenz, E.; Lucarelli, F.; Magnussen, N.; Mang, O.; Meyer, H.; Mirzoyan, R.; Moralejo, A.; Padilla, L.; Panter, M.; Plaga, R.; Plyasheshnikov, A.; Prahl, J.; Pühlhofer, G.; Rauterberg, G.; Röhring, A.; Rhode, W.; Rowell, G. P.; Sahakian, V.; Samorski, M.; Schilling, M.; Schröder, F.; Stamm, W.; Tluczykont, M.; Völk, H. J.; Wiedner, C.; Wittek, W.

    2001-07-01

    Tycho's supernova remnant (SNR) was observed during 1997 and 1998 with the HEGRA Čerenkov Telescope System in a search for gamma-ray emission at energies above ~ 1 TeV. An analysis of these data, ~ 65 hours in total, resulted in no evidence for TeV gamma-ray emission. The 3sigma upper limit to the gamma-ray flux (>1 TeV) from Tycho is estimated at 5.78x 10-13 photons cm-2 s-1, or 33 milli-Crab. We interpret our upper limit within the framework of the following scenarios: (1) that the observed hard X-ray tail is due to synchrotron emission. A lower limit on the magnetic field within Tycho may be estimated B>=22 mu G, assuming that the RXTE-detected X-rays were due to synchrotron emission. However, using results from a detailed model of the ASCA emission, a more conservative lower limit B>=6 mu G is derived. (2) The hadronic model of Drury and (3) the more recent time-dependent kinetic theory of Berezhko & Völk. Our upper limit lies within the range of predicted values of both hadronic models, according to uncertainties in physical parameters of Tycho, and shock acceleration details. In the latter case, the model was scaled to suit the parameters of Tycho and re-normalised to account for a simplification of the original model. We find that we cannot rule out Tycho as a potential contributor at an average level to the Galactic cosmic-ray flux.

  15. Fevers and Chills: Separating thermal and synchrotron components in SNR spectra

    Science.gov (United States)

    Fedor, Emily Elizabeth; Martina-Hood, Hyourin; Stage, Michael D.

    2018-06-01

    Spatially-resolved spectroscopy is an extremely powerful tool in X-ray analysis of extended sources, but can be computationally difficult if a source exhibits complex morphology. For example, high-resolution Chandra data of bright Galactic supernova remnants (Cas A, Tycho, etc.) allow extractions of high-quality spectra from tens to hundreds of thousands of regions, providing a rich laboratory for localizing emission from processes such as thermal line emission, bremsstrahlung, and synchrotron. This soft-band analysis informs our understanding of the typically nonthermal hard X-ray emission observed with other lower-resolution instruments. The analysis is complicated by both projection effects and the presence of multiple emission mechanisms in some regions. In particular, identifying regions with significant nonthermal emission is critical to understanding acceleration processes in remnants. Fitting tens of thousands of regions with complex, multi-component models can be time-consuming and involve so many free parameters that little constraint can be placed on the values. Previous work by Stage & Allen ('06, '07, '11) on Cas A used a technique to identify regions dominated by the highest-cutoff synchrotron emission by fitting with a simple thermal emission model and identifying regions with anomalously high apparent temperatures (caused by presence of the high-energy tail of the synchrotron emission component). Here, we present a similar technique. We verify the previous approach and, more importantly, expand it to include a method to identify regions containing strong lower-cutoff synchrotron radiation. Such regions might be associated with the reverse-shock of a supernova. Identification of a nonthermal electron population in the interior of an SNR would have significant implications for the energy balance and emission mechanisms producing the high-energy (> 10 keV) spectrum.

  16. Signal to noise ratio (SNR) and image uniformity: an estimate of performance of magnetic resonance imaging (MRI) system

    International Nuclear Information System (INIS)

    Narayan, P.; Suri, S.; Choudhary, S.R.

    2001-01-01

    In most general definition, noise in an image, is any variation that represents a deviation from truth. Noise sources in MRI can be systematic or random and statistical in nature. Data processing algorithms that smooth and enhance the edges by non-linear intensity assignments among other factors can affect the distribution of statistical noise. The SNR and image uniformity depends on the various parameters of NMR imaging system (viz. General system calibration, Gain coil tuning, AF shielding, coil loading, image processing and scan parameters like TE, TR, interslice distance, slice thickness, pixel size and matrix size). A study on SNR and image uniformity have been performed using standard head AF coil with different TR and the estimates of their variation are presented. A comparison between different techniques has also been evaluated using standard protocol of the Siemens Magnetom Vision Plus MRI system

  17. A relationship between SNR G109.1-1.0 and the molecular cloud of Sh2-152

    International Nuclear Information System (INIS)

    Heydari-Malayeri, M.; Kahane, C.; Lucas, R.

    1981-01-01

    The possible association of the supernova remnant SNR G109.1 - 1.0 and the x-ray source GF2259 + 586 with the molecular cloud of Sh2 - 152 has been investigated by observing the molecular line 13 CO (J = 1 → 0) of the complex Sh2 - 147/Sh2 - 153. The present results are compared with those of previous workers. It is shown that although the various estimates of distance for the SNR, the x-ray source, the H II region Sh2 - 152 and the molecular cloud are in relatively good agreement, because of the uncertainties of distance evaluation in the Perseus arm this cannot be regarded as conclusive proof of the association of these objects. (U.K.)

  18. Corrosion and deposition behaviour of 60Co and 54Mn in the SNR mockup loop for the primary sodium system

    International Nuclear Information System (INIS)

    Menken, G.; Reichel, H.

    1976-01-01

    The SNR corrosion mockup loop, simulating the SNR primary system is described. The influence of hydraulic conditions and temperature on the deposition behaviour is studied. γ-spectroscopy measurements at the pipe-work and removable samples allowed to determine the distribution of radioactive corrosion products in the loop and by-pass system. The release rate of Mn 54 could be reduced by a factor of 3 by decreasing the cold trap temperature from 165 0 C to 105 0 C while the Co 60 release rate could be reduced by a factor of 14, respectively. High temperature loop sections (873K) representing 13% of the loop surface absorbed 50-60% of the released Co 60 and only 8 - 18% of the Mn 54. The cold trap absorbed not more than 1% of the Co 60 and 10% of the Mn 54 inventory. (author)

  19. A Method to Optimize Geometric Errors of Machine Tool based on SNR Quality Loss Function and Correlation Analysis

    Directory of Open Access Journals (Sweden)

    Cai Ligang

    2017-01-01

    Full Text Available Instead improving the accuracy of machine tool by increasing the precision of key components level blindly in the production process, the method of combination of SNR quality loss function and machine tool geometric error correlation analysis to optimize five-axis machine tool geometric errors will be adopted. Firstly, the homogeneous transformation matrix method will be used to build five-axis machine tool geometric error modeling. Secondly, the SNR quality loss function will be used for cost modeling. And then, machine tool accuracy optimal objective function will be established based on the correlation analysis. Finally, ISIGHT combined with MATLAB will be applied to optimize each error. The results show that this method is reasonable and appropriate to relax the range of tolerance values, so as to reduce the manufacturing cost of machine tools.

  20. Performance of the split-symbol moments SNR estimator in the presence of inter-symbol interference

    Science.gov (United States)

    Shah, B.; Hinedi, S.

    1989-01-01

    The Split-Symbol Moments Estimator (SSME) is an algorithm that is designed to estimate symbol signal-to-noise ratio (SNR) in the presence of additive white Gaussian noise (AWGN). The performance of the SSME algorithm in band-limited channels is examined. The effects of the resulting inter-symbol interference (ISI) are quantified. All results obtained are in closed form and can be easily evaluated numerically for performance prediction purposes. Furthermore, they are validated through digital simulations.

  1. Star Forming Dense Cloud Cores in the TeV -ray SNR RX J1713.7-3946

    Energy Technology Data Exchange (ETDEWEB)

    Sano, H.; Sato, J.; Yamamoto, H.; Hayakawa, T.; Torii, K.; Moribe, N.; Kawamura, A.; Okuda, T.; Mizuno, N.; Onishi, T.; Maezawa, H.; Inoue, T.; Inutsuka, S.; Tanaka, T.; Mizuno, A.; Ogawa, H.; Stutzki, J.; Bertoldi, F.; Anderl, S.; Bronfman, L.; Koo, B.C.

    2010-10-27

    RX J1713.7-3946 is one of the TeV {gamma}-ray supernova remnants (SNRs) emitting synchrotron X rays. The SNR is associated with molecular gas located at {approx}1 kpc. We made new molecular observations toward the dense cloud cores, peaks A, C and D, in the SNR in the {sup 12}CO(J=2-1) and {sup 13}CO(J=2-1) transitions at angular resolution of 90 degrees. The most intense core in {sup 13}CO, peak C, was also mapped in the {sup 12}CO(J=4-3) transition at angular resolution of 38 degrees. Peak C shows strong signs of active star formation including bipolar outflow and a far-infrared protostellar source and has a steep gradient with a r{sup -2.2 {+-} 0.4} variation in the average density within radius r. Peak C and the other dense cloud cores are rim-brightened in synchrotron X rays, suggesting that the dense cloud cores are embedded within or on the outer boundary of the SNR shell. This confirms the earlier suggestion that the X rays are physically associated with the molecular gas (Fukui et al. 2003). We present a scenario where the densest molecular core, peak C, survived against the blast wave and is now embedded within the SNR. Numerical simulations of the shock-cloud interaction indicate that a dense clump can indeed survive shock erosion, since shock propagation speed is stalled in the dense clump. Additionally, the shock-cloud interaction induces turbulence and magnetic field amplification around the dense clump that may facilitate particle acceleration in the lower-density inter-clump space leading to the enhanced synchrotron X rays around dense cores.

  2. The Association of PSR B1757-24 and the SNR G5.4-1.2

    Science.gov (United States)

    Gvaramadze, V. V.

    The association of PSR B1757-24 and the supernova remnant (SNR) G5.4-1.2 was recently questioned by Thorsett et al. (2002) on the basis of proper motion measurements of the pulsar and the "incorrect" orientation of the vector of pulsar transverse velocity (inferred from the orientation of the cometary-shaped pulsar wind nebula). We show, however, that the association could be real if both objects are the remnants of an off-centered cavity supernova explosion.

  3. Nature of the Diffuse Source and Its Central Point-like Source in SNR 0509–67.5

    Energy Technology Data Exchange (ETDEWEB)

    Litke, Katrina C.; Chu, You-Hua; Holmes, Abigail; Santucci, Robert; Blindauer, Terrence; Gruendl, Robert A.; Ricker, Paul M. [Astronomy Department, University of Illinois, 1002 W. Green Street, Urbana, IL 61801 (United States); Li, Chuan-Jui [Academia Sinica Institute of Astronomy and Astrophysics, P.O. Box 23-141, Taipei 10617, Taiwan, R.O.C. (China); Pan, Kuo-Chuan [Departement Physik, Universität Basel, Klingelbergstrasse 82, CH-4056 Basel (Switzerland); Weisz, Daniel R., E-mail: kclitke@email.arizona.edu [Department of Astronomy, University of California, 501 Cambell Hall #3411, Berkeley, CA 94720-3411 (United States)

    2017-03-10

    We examine a diffuse emission region near the center of SNR 0509−67.5 to determine its nature. Within this diffuse region we observe a point-like source that is bright in the near-IR, but is not visible in the B and V bands. We consider an emission line observed at 6766 Å and the possibilities that it is Ly α , H α , and [O ii] λ 3727. We examine the spectral energy distribution (SED) of the source, comprised of Hubble Space Telescope B , V , I , J , and H bands in addition to Spitzer /IRAC 3.6, 4.5, 5.8, and 8 μ m bands. The peak of the SED is consistent with a background galaxy at z ≈ 0.8 ± 0.2 and a possible Balmer jump places the galaxy at z ≈ 0.9 ± 0.3. These SED considerations support the emission line’s identification as [O ii] λ 3727. We conclude that the diffuse source in SNR 0509−67.5 is a background galaxy at z ≈ 0.82. Furthermore, we identify the point-like source superposed near the center of the galaxy as its central bulge. Finally, we find no evidence for a surviving companion star, indicating a double-degenerate origin for SNR 0509−67.5.

  4. Nature of the Diffuse Source and Its Central Point-like Source in SNR 0509–67.5

    International Nuclear Information System (INIS)

    Litke, Katrina C.; Chu, You-Hua; Holmes, Abigail; Santucci, Robert; Blindauer, Terrence; Gruendl, Robert A.; Ricker, Paul M.; Li, Chuan-Jui; Pan, Kuo-Chuan; Weisz, Daniel R.

    2017-01-01

    We examine a diffuse emission region near the center of SNR 0509−67.5 to determine its nature. Within this diffuse region we observe a point-like source that is bright in the near-IR, but is not visible in the B and V bands. We consider an emission line observed at 6766 Å and the possibilities that it is Ly α , H α , and [O ii] λ 3727. We examine the spectral energy distribution (SED) of the source, comprised of Hubble Space Telescope B , V , I , J , and H bands in addition to Spitzer /IRAC 3.6, 4.5, 5.8, and 8 μ m bands. The peak of the SED is consistent with a background galaxy at z ≈ 0.8 ± 0.2 and a possible Balmer jump places the galaxy at z ≈ 0.9 ± 0.3. These SED considerations support the emission line’s identification as [O ii] λ 3727. We conclude that the diffuse source in SNR 0509−67.5 is a background galaxy at z ≈ 0.82. Furthermore, we identify the point-like source superposed near the center of the galaxy as its central bulge. Finally, we find no evidence for a surviving companion star, indicating a double-degenerate origin for SNR 0509−67.5.

  5. Secret-key agreement over spatially correlated multiple-antenna channels in the low-SNR regime

    KAUST Repository

    Zorgui, Marwen; Rezki, Zouheir; Alomair, Basel; Jorswieck, Eduard A.; Alouini, Mohamed-Slim

    2015-01-01

    We consider secret-key agreement with public discussion over Rayleigh fast-fading channels with transmit, receive and eavesdropper correlation. The legitimate receiver along with the eavesdropper are assumed to have perfect channel knowledge while the transmitter has only knowledge of the correlation matrices. We analyze the secret-key capacity in the low signal-to-noise ratio (SNR) regime. We derive closed-form expressions for the first and the second derivatives of the secret-key capacity with respect to SNR at SNR= 0, for arbitrary correlation matrices and number of transmit, receive and eavesdropper antennas. Moreover, we identify optimal transmission strategies achieving these derivatives. For instance, we prove that achieving the first and the second derivatives requires a uniform power distribution between the eigenvectors spanning the maximal-eigenvalue eigenspace of the transmit correlation matrix. We also compare the optimal transmission scheme to a simple uniform power allocation. Finally, we express the minimum energy required for sharing a secret-key bit as well as the wideband slope in terms of the system parameters.

  6. Reactivity feedback evaluation of material relocations in the CABRI-1 experiments with fuel worth distributions from SNR-300

    International Nuclear Information System (INIS)

    Royl, P.; Pfrang, W.; Struwe, D.

    1991-01-01

    The fuel relocations from the CABRI-1 experiments with irradiated fuel that had been evaluated from the hodoscope measurements were used together with fuel reactivity worth distributions from the SNR-300 to estimate the reactivity effect which these motions would have if they occurred in SNR-300 at the same relative distance to the peak power as in CABRI. The procedure for the reactivity evaluation is outlined including the assumptions made for fuel mass conservation. The results show that the initial fuel motion yields always negative reactivities. They also document the mechanism for a temporary reactivity increase by in-pin fuel flow in some transient overpower tests. This mechanism, however, never dominates, because material accumulates always sufficiently above the peak power point. Thus, the late autocatalytic amplifications of voiding induced power excursions by compactive in-pin fuel flow, that had been simulated in bounding loss of flow analyses for SNR-300, have no basis at all when considering the results from the CABRI-1 experiments

  7. Secret-key agreement over spatially correlated multiple-antenna channels in the low-SNR regime

    KAUST Repository

    Zorgui, Marwen

    2015-09-28

    We consider secret-key agreement with public discussion over Rayleigh fast-fading channels with transmit, receive and eavesdropper correlation. The legitimate receiver along with the eavesdropper are assumed to have perfect channel knowledge while the transmitter has only knowledge of the correlation matrices. We analyze the secret-key capacity in the low signal-to-noise ratio (SNR) regime. We derive closed-form expressions for the first and the second derivatives of the secret-key capacity with respect to SNR at SNR= 0, for arbitrary correlation matrices and number of transmit, receive and eavesdropper antennas. Moreover, we identify optimal transmission strategies achieving these derivatives. For instance, we prove that achieving the first and the second derivatives requires a uniform power distribution between the eigenvectors spanning the maximal-eigenvalue eigenspace of the transmit correlation matrix. We also compare the optimal transmission scheme to a simple uniform power allocation. Finally, we express the minimum energy required for sharing a secret-key bit as well as the wideband slope in terms of the system parameters.

  8. PSR B 1706-44 and the SNR G 343.1-2.3 as the remnants of a cavity supernova explosion

    Science.gov (United States)

    Bock, D. C.-J.; Gvaramadze, V. V.

    2002-11-01

    The possible association of the supernova remnant (SNR) G 343.1-2.3 with the pulsar PSR B 1706-44 (superposed on the arclike ``shell" of the SNR) has been questioned by some authors on the basis of an inconsistency between the implied and measured (scintillation) transverse velocities of the pulsar, the absence of any apparent interaction between the pulsar and the SNR's ``shell'', and some other indirect arguments. We suggest, however, that this association could be real if both objects are the remnants of a supernova (SN) which exploded within a mushroom-like cavity (created by the SN progenitor wind breaking out of the parent molecular cloud). This suggestion implies that the actual shape of the SNR's shell is similar to that of the well-known SNR VRO 42.05.01 and that the observed bright arc corresponds to the ``half'' of the SNR located inside the cloud. We report the discovery in archival radio data of an extended ragged radio arc to the southeast of the bright arc which we interpret as the ``half'' of the SN blast wave expanding in the intercloud medium.

  9. Influence of detector collimation on SNR in four different MDCT scanners using a reconstructed slice thickness of 5 mm

    International Nuclear Information System (INIS)

    Verdun, F.R.; Pachoud, M.; Monnin, P.; Valley, J.-F.; Noel, A.; Meuli, R.; Schnyder, P.; Denys, A.

    2004-01-01

    The purpose of this paper is to compare the influence of detector collimation on the signal-to-noise ratio (SNR) for a 5.0 mm reconstructed slice thickness for four multi-detector row CT (MDCT) units. SNRs were measured on Catphan test phantom images from four MDCT units: a GE LightSpeed QX/I, a Marconi MX 8000, a Toshiba Aquilion and a Siemens Volume Zoom. Five-millimetre-thick reconstructed slices were obtained from acquisitions performed using detector collimations of 2.0-2.5 mm and 5.0 mm, 120 kV, a 360 tube rotation time of 0.5 s, a wide range of mA and pitch values in the range of 0.75-0.85 and 1.25-1.5. For each set of acquisition parameters, a Wiener spectrum was also calculated. Statistical differences in SNR for the different acquisition parameters were evaluated using a Student's t-test (P<0.05). The influence of detector collimation on the SNR for a 5.0-mm reconstructed slice thickness is different for different MDCT scanners. At pitch values lower than unity, the use of a small detector collimation to produce 5.0-mm thick slices is beneficial for one unit and detrimental for another. At pitch values higher than unity, using a small detector collimation is beneficial for two units. One manufacturer uses different reconstruction filters when switching from a 2.5- to a 5.0-mm detector collimation. For a comparable reconstructed slice thickness, using a smaller detector collimation does not always reduce image noise. Thus, the impact of the detector collimation on image noise should be determined by standard deviation calculations, and also by assessing the power spectra of the noise. (orig.)

  10. Combining parallel detection of proton echo planar spectroscopic imaging (PEPSI) measurements with a data-consistency constraint improves SNR.

    Science.gov (United States)

    Tsai, Shang-Yueh; Hsu, Yi-Cheng; Chu, Ying-Hua; Kuo, Wen-Jui; Lin, Fa-Hsuan

    2015-12-01

    One major challenge of MRSI is the poor signal-to-noise ratio (SNR), which can be improved by using a surface coil array. Here we propose to exploit the spatial sensitivity of different channels of a coil array to enforce the k-space data consistency (DC) in order to suppress noise and consequently to improve MRSI SNR. MRSI data were collected using a proton echo planar spectroscopic imaging (PEPSI) sequence at 3 T using a 32-channel coil array and were averaged with one, two and eight measurements (avg-1, avg-2 and avg-8). The DC constraint was applied using a regularization parameter λ of 1, 2, 3, 5 or 10. Metabolite concentrations were quantified using LCModel. Our results show that the suppression of noise by applying the DC constraint to PEPSI reconstruction yields up to 32% and 27% SNR gain for avg-1 and avg-2 data with λ = 5, respectively. According to the reported Cramer-Rao lower bounds, the improvement in metabolic fitting was significant (p < 0.01) when the DC constraint was applied with λ ≥ 2. Using the DC constraint with λ = 3 or 5 can minimize both root-mean-square errors and spatial variation for all subjects using the avg-8 data set as reference values. Our results suggest that MRSI reconstructed with a DC constraint can save around 70% of scanning time to obtain images and spectra with similar SNRs using λ = 5. Copyright © 2015 John Wiley & Sons, Ltd.

  11. FERMI LARGE AREA TELESCOPE DISCOVERY OF GeV GAMMA-RAY EMISSION FROM THE VICINITY OF SNR W44

    Energy Technology Data Exchange (ETDEWEB)

    Uchiyama, Yasunobu; Funk, Stefan; Katsuta, Junichiro [SLAC National Accelerator Laboratory, 2575 Sand Hill Road M/S 29, Menlo Park, CA 94025 (United States); Katagiri, Hideaki [College of Science, Ibaraki University, 2-1-1, Bunkyo, Mito 310-8512 (Japan); Lemoine-Goumard, Marianne [Centre d' Etudes Nucleaires de Bordeaux Gradignan, Universite Bordeaux 1, CNRS/IN2p3, 33175 Gradignan (France); Tajima, Hiroyasu; Tanaka, Takaaki [Kavli Institute for Particle Astrophysics and Cosmology, Stanford University, Stanford, CA 94305 (United States); Torres, Diego F., E-mail: uchiyama@slac.stanford.edu [Institut de Ciencies de l' Espai (IEEE-CSIC), Campus UAB, 08193 Barcelona (Spain)

    2012-04-20

    We report the detection of GeV {gamma}-ray emission from the molecular cloud complex that surrounds the supernova remnant (SNR) W44 using the Large Area Telescope on board Fermi. While the previously reported {gamma}-ray emission from SNR W44 is likely to arise from the dense radio-emitting filaments within the remnant, the {gamma}-ray emission that appears to come from the surrounding molecular cloud complex can be ascribed to the cosmic rays (CRs) that have escaped from W44. The non-detection of synchrotron radio emission associated with the molecular cloud complex suggests the decay of {pi}{sup 0} mesons produced in hadronic collisions as the {gamma}-ray emission mechanism. The total kinetic energy channeled into the escaping CRs is estimated to be W{sub esc} {approx} (0.3-3) Multiplication-Sign 10{sup 50} erg, in broad agreement with the conjecture that SNRs are the main sources of Galactic CRs.

  12. YOUNG REMNANTS OF TYPE Ia SUPERNOVAE AND THEIR PROGENITORS: A STUDY OF SNR G1.9+0.3

    International Nuclear Information System (INIS)

    Chakraborti, Sayan; Childs, Francesca; Soderberg, Alicia

    2016-01-01

    SNe Ia, with their remarkably homogeneous light curves and spectra, have been used as standardizable candles to measure the accelerating expansion of the universe. Yet, their progenitors remain elusive. Common explanations invoke a degenerate star (white dwarf) that explodes upon almost reaching the Chandrasekhar limit, by either steadily accreting mass from a companion star or violently merging with another degenerate star. We show that circumstellar interaction in young Galactic supernova remnants can be used to distinguish between these single and double degenerate (DD) progenitor scenarios. Here we propose a new diagnostic, the surface brightness index, which can be computed from theory and compared with Chandra and Very Large Array (VLA) observations. We use this method to demonstrate that a DD progenitor can explain the decades-long flux rise and size increase of the youngest known galactic supernova remnant (SNR), G1.9+0.3. We disfavor a single degenerate scenario for SNR G1.9+0.3. We attribute the observed properties to the interaction between a steep ejecta profile and a constant density environment. We suggest using the upgraded VLA, ASKAP, and MeerKAT to detect circumstellar interaction in the remnants of historical SNe Ia in the Local Group of galaxies. This may settle the long-standing debate over their progenitors

  13. YOUNG REMNANTS OF TYPE Ia SUPERNOVAE AND THEIR PROGENITORS: A STUDY OF SNR G1.9+0.3

    Energy Technology Data Exchange (ETDEWEB)

    Chakraborti, Sayan; Childs, Francesca; Soderberg, Alicia, E-mail: schakraborti@post.harvard.edu [Institute for Theory and Computation, Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States)

    2016-03-01

    SNe Ia, with their remarkably homogeneous light curves and spectra, have been used as standardizable candles to measure the accelerating expansion of the universe. Yet, their progenitors remain elusive. Common explanations invoke a degenerate star (white dwarf) that explodes upon almost reaching the Chandrasekhar limit, by either steadily accreting mass from a companion star or violently merging with another degenerate star. We show that circumstellar interaction in young Galactic supernova remnants can be used to distinguish between these single and double degenerate (DD) progenitor scenarios. Here we propose a new diagnostic, the surface brightness index, which can be computed from theory and compared with Chandra and Very Large Array (VLA) observations. We use this method to demonstrate that a DD progenitor can explain the decades-long flux rise and size increase of the youngest known galactic supernova remnant (SNR), G1.9+0.3. We disfavor a single degenerate scenario for SNR G1.9+0.3. We attribute the observed properties to the interaction between a steep ejecta profile and a constant density environment. We suggest using the upgraded VLA, ASKAP, and MeerKAT to detect circumstellar interaction in the remnants of historical SNe Ia in the Local Group of galaxies. This may settle the long-standing debate over their progenitors.

  14. LATE-TIME EVOLUTION OF COMPOSITE SUPERNOVA REMNANTS: DEEP CHANDRA OBSERVATIONS AND HYDRODYNAMICAL MODELING OF A CRUSHED PULSAR WIND NEBULA IN SNR G327.1-1.1

    Energy Technology Data Exchange (ETDEWEB)

    Temim, Tea [Observational Cosmology Lab, Code 665, NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Slane, Patrick [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Kolb, Christopher; Blondin, John [North Carolina State University, 421 Riddick Hall, Raleigh, NC 27695 (United States); Hughes, John P. [Rutgers University, 57 US Highway 1, New Brunswick, NJ 08901 (United States); Bucciantini, Niccoló [INAF Osservatorio Astrofisico di Arcetri, Largo Enrico Fermi, 5, 50125, Firenze Italy (Italy)

    2015-07-20

    In an effort to better understand the evolution of composite supernova remnants (SNRs) and the eventual fate of relativistic particles injected by their pulsars, we present a multifaceted investigation of the interaction between a pulsar wind nebula (PWN) and its host SNR G327.1-1.1. Our 350 Chandra X-ray observations of SNR G327.1-1.1 reveal a highly complex morphology: a cometary structure resembling a bow shock, prong-like features extending into large arcs in the SNR interior, and thermal emission from the SNR shell. Spectral analysis of the non-thermal emission offers clues about the origin of the PWN structures, while enhanced abundances in the PWN region provide evidence for a mixing of supernova ejecta with PWN material. The overall morphology and spectral properties of the SNR suggest that the PWN has undergone an asymmetric interaction with the SNR reverse shock (RS), whichcan occur as a result of a density gradient in the ambient medium and/or a moving pulsar that displaces the PWN from the center of the remnant. We present hydrodynamical simulations of G327.1-1.1 that show that its morphology and evolution can be described by a ∼17,000-year-old composite SNR that expanded into a density gradient with an orientation perpendicular to the pulsar’s motion. We also show that the RS/PWN interaction scenario can reproduce the broadband spectrum of the PWN from radio to γ-ray wavelengths. The analysis and modeling presented in this work have important implications for our general understanding of the structure and evolution of composite SNRs.

  15. Late-Time Evolution of Composite Supernova Remnants: Deep Chandra Observations and Hydrodynamical Modeling of a Crushed Pulsar Wind Nebula in SNR G327.1-1.1

    Science.gov (United States)

    Temim, Tea; Slane, Patrick; Kolb, Christopher; Blondin, John; Hughes, John P.; Bucciantini, Niccolo

    2015-01-01

    In an effort to better understand the evolution of composite supernova remnants (SNRs) and the eventual fate of relativistic particles injected by their pulsars, we present a multifaceted investigation of the interaction between a pulsar wind nebula (PWN) and its host SNR G327.1-1.1. Our 350 ks Chandra X-ray observations of SNR G327.1-1.1 reveal a highly complex morphology; a cometary structure resembling a bow shock, prong-like features extending into large arcs in the SNR interior, and thermal emission from the SNR shell. Spectral analysis of the non-thermal emission offers clues about the origin of the PWN structures, while enhanced abundances in the PWN region provide evidence for mixing of supernova ejecta with PWN material. The overall morphology and spectral properties of the SNR suggest that the PWN has undergone an asymmetric interaction with the SNR reverse shock(RS) that can occur as a result of a density gradient in the ambient medium and or a moving pulsar that displaces the PWN from the center of the remnant. We present hydrodynamical simulations of G327.1-1.1 that show that its morphology and evolution can be described by a approx. 17,000 yr old composite SNR that expanded into a density gradient with an orientation perpendicular to the pulsar's motion. We also show that the RSPWN interaction scenario can reproduce the broadband spectrum of the PWN from radio to gamma-ray wavelengths. The analysis and modeling presented in this work have important implications for our general understanding of the structure and evolution of composite SNRs.

  16. A HOS-based blind deconvolution algorithm for the improvement of time resolution of mixed phase low SNR seismic data

    International Nuclear Information System (INIS)

    Hani, Ahmad Fadzil M; Younis, M Shahzad; Halim, M Firdaus M

    2009-01-01

    A blind deconvolution technique using a modified higher order statistics (HOS)-based eigenvector algorithm (EVA) is presented in this paper. The main purpose of the technique is to enable the processing of low SNR short length seismograms. In our study, the seismogram is assumed to be the output of a mixed phase source wavelet (system) driven by a non-Gaussian input signal (due to earth) with additive Gaussian noise. Techniques based on second-order statistics are shown to fail when processing non-minimum phase seismic signals because they only rely on the autocorrelation function of the observed signal. In contrast, existing HOS-based blind deconvolution techniques are suitable in the processing of a non-minimum (mixed) phase system; however, most of them are unable to converge and show poor performance whenever noise dominates the actual signal, especially in the cases where the observed data are limited (few samples). The developed blind equalization technique is primarily based on the EVA for blind equalization, initially to deal with mixed phase non-Gaussian seismic signals. In order to deal with the dominant noise issue and small number of available samples, certain modifications are incorporated into the EVA. For determining the deconvolution filter, one of the modifications is to use more than one higher order cumulant slice in the EVA. This overcomes the possibility of non-convergence due to a low signal-to-noise ratio (SNR) of the observed signal. The other modification conditions the cumulant slice by increasing the power of eigenvalues of the cumulant slice, related to actual signal, and rejects the eigenvalues below the threshold representing the noise. This modification reduces the effect of the availability of a small number of samples and strong additive noise on the cumulant slices. These modifications are found to improve the overall deconvolution performance, with approximately a five-fold reduction in a mean square error (MSE) and a six

  17. Discovery of dominant and dormant genes from expression data using a novel generalization of SNR for multi-class problems

    Directory of Open Access Journals (Sweden)

    Chung I-Fang

    2008-10-01

    Full Text Available Abstract Background The Signal-to-Noise-Ratio (SNR is often used for identification of biomarkers for two-class problems and no formal and useful generalization of SNR is available for multiclass problems. We propose innovative generalizations of SNR for multiclass cancer discrimination through introduction of two indices, Gene Dominant Index and Gene Dormant Index (GDIs. These two indices lead to the concepts of dominant and dormant genes with biological significance. We use these indices to develop methodologies for discovery of dominant and dormant biomarkers with interesting biological significance. The dominancy and dormancy of the identified biomarkers and their excellent discriminating power are also demonstrated pictorially using the scatterplot of individual gene and 2-D Sammon's projection of the selected set of genes. Using information from the literature we have shown that the GDI based method can identify dominant and dormant genes that play significant roles in cancer biology. These biomarkers are also used to design diagnostic prediction systems. Results and discussion To evaluate the effectiveness of the GDIs, we have used four multiclass cancer data sets (Small Round Blue Cell Tumors, Leukemia, Central Nervous System Tumors, and Lung Cancer. For each data set we demonstrate that the new indices can find biologically meaningful genes that can act as biomarkers. We then use six machine learning tools, Nearest Neighbor Classifier (NNC, Nearest Mean Classifier (NMC, Support Vector Machine (SVM classifier with linear kernel, and SVM classifier with Gaussian kernel, where both SVMs are used in conjunction with one-vs-all (OVA and one-vs-one (OVO strategies. We found GDIs to be very effective in identifying biomarkers with strong class specific signatures. With all six tools and for all data sets we could achieve better or comparable prediction accuracies usually with fewer marker genes than results reported in the literature using the

  18. DISCOVERY OF TeV GAMMA-RAY EMISSION TOWARD SUPERNOVA REMNANT SNR G78.2+2.1

    Energy Technology Data Exchange (ETDEWEB)

    Aliu, E. [Department of Physics and Astronomy, Barnard College, Columbia University, NY 10027 (United States); Archambault, S. [Physics Department, McGill University, Montreal, QC H3A 2T8 (Canada); Arlen, T.; Aune, T. [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095 (United States); Beilicke, M.; Buckley, J. H.; Bugaev, V.; Dickherber, R. [Department of Physics, Washington University, St. Louis, MO 63130 (United States); Benbow, W. [Fred Lawrence Whipple Observatory, Harvard-Smithsonian Center for Astrophysics, Amado, AZ 85645 (United States); Bird, R.; Cannon, A.; Collins-Hughes, E. [School of Physics, University College Dublin, Belfield, Dublin 4 (Ireland); Bouvier, A. [Santa Cruz Institute for Particle Physics and Department of Physics, University of California, Santa Cruz, CA 95064 (United States); Bradbury, S. M. [School of Physics and Astronomy, University of Leeds, Leeds, LS2 9JT (United Kingdom); Byrum, K. [Argonne National Laboratory, 9700 S. Cass Avenue, Argonne, IL 60439 (United States); Cesarini, A.; Connolly, M. P. [School of Physics, National University of Ireland Galway, University Road, Galway (Ireland); Ciupik, L. [Astronomy Department, Adler Planetarium and Astronomy Museum, Chicago, IL 60605 (United States); Cui, W. [Department of Physics, Purdue University, West Lafayette, IN 47907 (United States); Duke, C., E-mail: amandajw@iastate.edu [Department of Physics, Grinnell College, Grinnell, IA 50112-1690 (United States); and others

    2013-06-20

    We report the discovery of an unidentified, extended source of very-high-energy gamma-ray emission, VER J2019+407, within the radio shell of the supernova remnant SNR G78.2+2.1, using 21.4 hr of data taken by the VERITAS gamma-ray observatory in 2009. These data confirm the preliminary indications of gamma-ray emission previously seen in a two-year (2007-2009) blind survey of the Cygnus region by VERITAS. VER J2019+407, which is detected at a post-trials significance of 7.5 standard deviations in the 2009 data, is localized to the northwestern rim of the remnant in a region of enhanced radio and X-ray emission. It has an intrinsic extent of 0.23 Degree-Sign .23 {+-} 0. Degree-Sign 03{sub stat-0 Degree-Sign .02sys}{sup +0 Degree-Sign .04} and its spectrum is well-characterized by a differential power law (dN/dE = N{sub 0} Multiplication-Sign (E/TeV){sup -{Gamma}}) with a photon index of {Gamma} = 2.37 {+-} 0.14{sub stat} {+-} 0.20{sub sys} and a flux normalization of N{sub 0} = 1.5 {+-} 0.2{sub stat} {+-} 0.4{sub sys} Multiplication-Sign 10{sup -12} photon TeV{sup -1} cm{sup -2} s{sup -1}. This yields an integral flux of 5.2 {+-} 0.8{sub stat} {+-} 1.4{sub sys} Multiplication-Sign 10{sup -12} photon cm{sup -2} s{sup -1} above 320 GeV, corresponding to 3.7% of the Crab Nebula flux. We consider the relationship of the TeV gamma-ray emission with the GeV gamma-ray emission seen from SNR G78.2+2.1 as well as that seen from a nearby cocoon of freshly accelerated cosmic rays. Multiple scenarios are considered as possible origins for the TeV gamma-ray emission, including hadronic particle acceleration at the SNR shock.

  19. Two-dimensional geometrical corner singularities in neutron diffusion. Part 2: Application to the SNR-300 benchmark

    International Nuclear Information System (INIS)

    Cacuci, D.G.; Univ. of Karlsruhe; Kiefhaber, E.; Stehle, B.

    1998-01-01

    The explicit solution developed by Cacuci for the multigroup neutron diffusion equation at interior corners in two-dimensional two-region domains has been applied to the SNR-300 fast reactor prototype design to obtain the exact behavior of the multigroup fluxes at and around typical corners arising between absorber/fuel and follower/fuel assemblies. The calculations have been performed in hexagonal geometry using four energy groups, and the results clearly show that the multigroup fluxes are finite but not analytical at interior corners. In particular, already the first-order spatial derivatives of the multigroup fluxes become unbounded at the corners between follower and fuel assemblies. These results highlight the need to treat properly the influence of corners, both for the direct calculation and for the reconstruction of pointwise neutron flux and power distributions in heterogeneous reactor cores

  20. Use of zero power plutonium reactor measurements as a support of criticality prediction for the SNR-300

    International Nuclear Information System (INIS)

    Pilate, S.; de Wouters, R.; Wehmann, U.; Helm, F.; Scholtyssek, W.

    1978-01-01

    Evaluations of criticality measurements performed in various SNEAK and Zero Power Plutonium Reactor (ZPPR) cores are compared. The best available methods of calculations (including transport theory) are used. The ZPPR results support well the trend indicated by the SNEAK evaluations for clean cores and for cores with followers; for cores with absorbers partially inserted, the agreement is only rough. Evaluations of control rod worth measurements are therefore also compared, using the routine method of calculation for SNR-300 (diffusion theory). The control rod worths are largely underestimated in SNEAK (C/E = 0.89), but only slightly underestimated in the ZPPR (C/E = 0.97). The difference in the nature of core fuel (uranium in SNEAK, plutonium in the ZPPR) could be at the origin of this discrepancy

  1. Nuclear Power Station Kalkar, 300 MWe Prototype Nuclear Power Plant with Fast Sodium Cooled Reactor (SNR-300), Plant description

    International Nuclear Information System (INIS)

    1984-06-01

    The nuclear power station Kalkar (SNR-300) is a prototype with a sodium cooled fast reactor and a thermal power of 762 MW. The present plant description has been made available in parallel to the licensing procedure for the reactor plant and its core Mark-Ia as supplementary information for the public. The report gives a detailed description of the whole plant including the prevention measures against the impact of external and plant internal events. The radioactive materials within the reactor cooling system and the irradiation protection and surveillance measures are outlined. Finally, the operation of the plant is described with the start-up procedures, power operation, shutdown phases with decay heat removal and handling procedures

  2. Low SNR capacity for MIMO Rician and Rayleigh-product fading channels with single co-channel interferer and noise

    KAUST Repository

    Zhong, Caijun

    2010-09-01

    This paper studies the ergodic capacity of multiple-input multiple-output (MIMO) systems with a single co-channel interferer in the low signal-to-noise-ratio (SNR) regime. Two MIMO models namely Rician and Rayleigh-product channels are investigated. Exact analytical expressions for the minimum energy per information bit, {Eb/N0min, and wideband slope, S0, are derived for both channels. Our results show that the minimum energy per information bit is the same for both channels while their wideband slopes differ significantly. Further, the impact of the numbers of transmit and receive antennas, the Rician K factor, the channel mean matrix and the interference-to-noise-ratio (INR) on the capacity, is addressed. Results indicate that interference degrades the capacity by increasing the required minimum energy per information bit and reducing the wideband slope. Simulation results validate our analytical results. © 2010 IEEE.

  3. Background- and simulated leak-noise measurements on ASB-loop, KNK II- and SNR 300-steam generators

    International Nuclear Information System (INIS)

    Voss, J.; Arnaoutis, N.; Foerster, K.; Moellerfeld, H.

    1990-01-01

    During several leak propagation experiments in the ASB sodium loop noise measurements were performed showing the acoustic behaviour of evoluting leaks in a tube bundle section under sodium. Effects like self evolution, secondary leaks and tube ruptures by overheating occurred during these tests and were reflected in the course of acoustic signals. In one of the KNK II steam generators simulated leak noise was detected against background noise throughout the operating power range. Experimental arrangements and results are described. In SNR 300 all of the SGUs are equipped with waveguides and some with accelerometers for background noise measurements. First measurement under isothermal conditions were performed in the past. A gas injection device for acoustic leak simulation is under construction. The design of the experimental acoustic system and first results are presented. (author). 1 ref., 21 figs, 2 tabs

  4. Measurement of moisture motion under a temperature gradient in a concrete for SNR-300 using thermal neutrons

    International Nuclear Information System (INIS)

    Zelinger, A.

    1975-01-01

    For describing the behavior of the moisture in the concrete of the containment of SNR-300 in a hypothetical accident parameters were determined experimentally. The method is based on transmission of thermal neutrons through a plate of concrete. When a temperature of 170 deg C was applied at one end of the plate migration of moisture and evaporation took place. This could be observed by neutron radiography giving a gross picture of moisture migration. Furthermore the intensity of the transmitted neutron beam was measured with a neutron counter. From these values profiles of the change of moisture concentration could be obtained with a spatial resolution of few millimeters. The method used is entirely different from the conventional moisture meters which use fast neutrons. From the experimental data the mass transfer coefficient of vapour, the diffusion coefficient of vapour in concrete and the porosity of the concrete could be determined

  5. Detailed investigation of the gamma-ray emission in the vicinity of SNR W28 with Fermi-LAT

    Energy Technology Data Exchange (ETDEWEB)

    Hanabata, Y. [Institute for Cosmic-Ray Research, University of Tokyo, 5-1-5 Kashiwanoha, Kashiwa, Chiba 277-8582 (Japan); Katagiri, H. [College of Science, Ibaraki University, 2-1-1, Bunkyo, Mito 310-8512 (Japan); Hewitt, J.W. [CRESST, University of Maryland, Baltimore County, Baltimore, MD 21250 (United States); Ballet, J. [Laboratoire AIM, CEA-IRFU/CNRS/Université Paris Diderot, Service d' Astrophysique, CEA Saclay, F-91191 Gif sur Yvette (France); Fukazawa, Y. [Department of Physical Sciences, Hiroshima University, Higashi-Hiroshima, Hiroshima 739-8526 (Japan); Fukui, Y.; Hayakawa, T. [Department of Physics and Astrophysics, Nagoya University, Chikusa-ku Nagoya 464-8602 (Japan); Lemoine-Goumard, M. [Centre d' Études Nucléaires de Bordeaux Gradignan, IN2P3/CNRS, Université Bordeaux 1, BP120, F-33175 Gradignan Cedex (France); Pedaletti, G.; Torres, D. F. [Institut de Ciències de l' Espai (IEEE-CSIC), Campus UAB, 08193 Barcelona (Spain); Strong, A. W. [Max-Planck Institut für extraterrestrische Physik, D-85748 Garching (Germany); Yamazaki, R., E-mail: hanabata@icrr.u-tokyo.ac.jp, E-mail: katagiri@mx.ibaraki.ac.jp [Department of Physics and Mathematics, Aoyama Gakuin University, Sagamihara, Kanagawa 252-5258 (Japan)

    2014-05-10

    We present a detailed investigation of the γ-ray emission in the vicinity of the supernova remnant (SNR) W28 (G6.4–0.1) observed by the Large Area Telescope (LAT) on board the Fermi Gamma-ray Space Telescope. We detected significant γ-ray emission spatially coincident with TeV sources HESS J1800–240A, B, and C, located outside the radio boundary of the SNR. Their spectra in the 2-100 GeV band are consistent with the extrapolation of the power-law spectra of the TeV sources. We also identified a new source of GeV emission, dubbed Source W, which lies outside the boundary of TeV sources and coincides with radio emission from the western part of W28. All of the GeV γ-ray sources overlap with molecular clouds in the velocity range from 0 to 20 km s{sup –1}. Under the assumption that the γ-ray emission toward HESS J1800–240A, B, and C comes from π{sup 0} decay due to the interaction between the molecular clouds and cosmic rays (CRs) escaping from W28, they can be naturally explained by a single model in which the CR diffusion coefficient is smaller than the theoretical expectation in the interstellar space. The total energy of the CRs escaping from W28 is constrained through the same modeling to be larger than ∼2 × 10{sup 49} erg. The emission from Source W can also be explained with the same CR escape scenario.

  6. Detailed investigation of the gamma-ray emission in the vicinity of SNR W28 with Fermi-LAT

    International Nuclear Information System (INIS)

    Hanabata, Y.; Katagiri, H.; Hewitt, J.W.; Ballet, J.; Fukazawa, Y.; Fukui, Y.; Hayakawa, T.; Lemoine-Goumard, M.; Pedaletti, G.; Torres, D. F.; Strong, A. W.; Yamazaki, R.

    2014-01-01

    We present a detailed investigation of the γ-ray emission in the vicinity of the supernova remnant (SNR) W28 (G6.4–0.1) observed by the Large Area Telescope (LAT) on board the Fermi Gamma-ray Space Telescope. We detected significant γ-ray emission spatially coincident with TeV sources HESS J1800–240A, B, and C, located outside the radio boundary of the SNR. Their spectra in the 2-100 GeV band are consistent with the extrapolation of the power-law spectra of the TeV sources. We also identified a new source of GeV emission, dubbed Source W, which lies outside the boundary of TeV sources and coincides with radio emission from the western part of W28. All of the GeV γ-ray sources overlap with molecular clouds in the velocity range from 0 to 20 km s –1 . Under the assumption that the γ-ray emission toward HESS J1800–240A, B, and C comes from π 0 decay due to the interaction between the molecular clouds and cosmic rays (CRs) escaping from W28, they can be naturally explained by a single model in which the CR diffusion coefficient is smaller than the theoretical expectation in the interstellar space. The total energy of the CRs escaping from W28 is constrained through the same modeling to be larger than ∼2 × 10 49 erg. The emission from Source W can also be explained with the same CR escape scenario.

  7. THE NEUTRAL INTERSTELLAR GAS TOWARD SNR W44: CANDIDATES FOR TARGET PROTONS IN HADRONIC {gamma}-RAY PRODUCTION IN A MIDDLE-AGED SUPERNOVA REMNANT

    Energy Technology Data Exchange (ETDEWEB)

    Yoshiike, S.; Fukuda, T.; Sano, H.; Ohama, A.; Moribe, N.; Torii, K.; Hayakawa, T.; Okuda, T.; Yamamoto, H.; Mizuno, N.; Onishi, T.; Fukui, Y. [Department of Physics and Astrophysics, Nagoya University, Nagoya, Aichi 464-8602 (Japan); Tajima, H.; Maezawa, H.; Mizuno, A. [Solar-Terrestrial Environment Laboratory, Nagoya University, Nagoya, Aichi 464-8601 (Japan); Nishimura, A.; Kimura, K.; Ogawa, H. [Department of Astrophysics, Graduate School of Science, Osaka Prefecture University, 1-1 Gakuen-cho, Naka-ku, Sakai, Osaka 599-8531 (Japan); Giuliani, A. [INAF-IASF Milano, via E. Bassini 15, I-20133 Milano (Italy); Koo, B.-C., E-mail: yoshiike@a.phys.nagoya-u.ac.jp [Seoul National University, Seoul 151-742 (Korea, Republic of)

    2013-05-10

    We present an analysis of the interstellar medium (ISM) toward the {gamma}-ray supernova remnant (SNR) W44. We used NANTEN2 {sup 12}CO(J = 2-1) and {sup 12}CO(J = 1-0) data and Arecibo H I data in order to identify the molecular and atomic gas in the SNR. We confirmed that the molecular gas is located in the SNR shell with a primary peak toward the eastern edge of the shell. We newly identified high-excitation molecular gas along the eastern shell of the SNR in addition to the high-excitation broad gas previously observed inside the shell; the line intensity ratio between the {sup 12}CO(J = 2-1) and {sup 12}CO(J = 1-0) transitions in these regions is greater than {approx}1.0, suggesting a kinetic temperature of 30 K or higher, which is most likely due to heating by shock interaction. By comparing the ISM with {gamma}-rays, we find that target protons of hadronic origin are dominated by molecular protons of average density around 200 cm{sup -3}, where the possible contribution of atomic protons is 10% or less. This average density is consistent with the recent discovery of the low-energy {gamma}-rays suppressed in 50 MeV-10 GeV as observed with AGILE and Fermi. The {gamma}-ray spectrum differs from place to place in the SNR, suggesting that the cosmic-ray (CR) proton spectrum significantly changes within the middle-aged SNR perhaps due to the energy-dependent escape of CR protons from the acceleration site. We finally derive a total CR proton energy of {approx}10{sup 49} erg, consistent with the SN origin of the majority of the CRs in the Galaxy.

  8. Development, design, construction and testing of pumps, intermediate heat exchangers and manipulator systems for in-service inspection of SNR 300

    International Nuclear Information System (INIS)

    Vroom, J.P.; Heslenfeld, M.W.; Westerweele, W.J.; Willigen, A. van

    1978-01-01

    The first part of this paper reviews the development, design, construction and testing of sodium pumps and intermediate heat exchangers as carried out by NERATOOM in the Netherlands. Testing of full-size components under operational conditions yielded important information for the design of the components for SNR 300. Information is also given in brief on the manufacture of the components. The second part reviews the work done on manipulator systems for in-service inspection as carried out by INTERATOM in Germany. In this field again experience gained from tests had important consequences for the design of the apparatus for SNR 300. (author)

  9. Optimize the Power Consumption and SNR of the 3D Photonic High-Radix Switch Architecture Based on Extra Channels and Redundant Rings

    Directory of Open Access Journals (Sweden)

    Jie Jian

    2018-01-01

    Full Text Available The demand from exascale computing has made the design of high-radix switch chips an attractive and challenging research field in EHPC (exascale high-performance computing. The static power, due to the thermal sensitivity and process variation of the microresonator rings, and the cross talk noise of the optical network become the main bottlenecks of the network’s scalability. This paper proposes the analyze model of the trimming power, process variation power, and signal-to-noise ratio (SNR for the Graphein-based high-radix optical switch networks and uses the extra channels and the redundant rings to decrease the trimming power and the process variation power. The paper also explores the SNR under different configurations. The simulation result shows that when using 8 extra channels in the 64×64 crossbar optical network, the trimming power reduces almost 80% and the process variation power decreases 65% by adding 16 redundant rings in the 64×64 crossbar optical network. All of these schemes have little influence on the SNR. Meanwhile, the greater channel spacing has great advantages to decrease the static power and increase the SNR of the optical network.

  10. Improvement of stress tolerance and leavening ability under multiple baking-associated stress conditions by overexpression of the SNR84 gene in baker's yeast.

    Science.gov (United States)

    Lin, Xue; Zhang, Cui-Ying; Bai, Xiao-Wen; Feng, Bing; Xiao, Dong-Guang

    2015-03-16

    During the bread-making process, industrial baker's yeast cells are exposed to multiple baking-associated stresses, such as elevated high-temperature, high-sucrose and freeze-thaw stresses. There is a high demand for baker's yeast strains that could withstand these stresses with high leavening ability. The SNR84 gene encodes H/ACA snoRNA (small nucleolar RNA), which is known to be involved in pseudouridylation of the large subunit rRNA. However, the function of the SNR84 gene in baker's yeast coping with baking-associated stresses remains unclear. In this study, we explored the effect of SNR84 overexpression on baker's yeast which was exposed to high-temperature, high-sucrose and freeze-thaw stresses. These results suggest that overexpression of the SNR84 gene conferred tolerance of baker's yeast cells to high-temperature, high-sucrose and freeze-thaw stresses and enhanced their leavening ability in high-sucrose and freeze-thaw dough. These findings could provide a valuable insight for breeding of novel stress-resistant baker's yeast strains that are useful for baking. Copyright © 2015 Elsevier B.V. All rights reserved.

  11. Risk-oriented analysis of the German prototype fast breeder reactor SNR-300: off-site accident consequence model and results of the study

    International Nuclear Information System (INIS)

    Bayer, A.; Ehrhardt, J.

    1984-01-01

    Accident off-site consequence calculations and risk assessments performed for the ''risk oriented analysis'' of the German prototype fast breeder reactor SNR-300 were performed with a modified version of the off-site accident consequence model UFOMOD. The modifications mainly relate to the deposition and resuspension processes, the ingestion model, and the dose factors. Consequence calculations at the site of Kalkar on the Rhine River were performed for 115 weather sequences in 36 wind directions. They were based on seven release categories evaluated for the SNR-300 with two different fueling strategies: plutonium from Magnox reactors only and plutonium from light water reactors and Magnox reactors. In parallel, the corresponding frequencies of occurrence are determined. The following results are generated: 1. complementary cumulative frequency distribution functions for collective fatalities and collective doses 2. expected values of the collective fatalities and collective doses as well as distance-dependent expected values of individual fatality 3. contributions of the different exposure pathways to fatalities with respect to the various organs. For comparison with the risk of a PWR-1300, calculations for the PWR-1300 of the ''German Risk Study'' were repeated with the same modified consequence model. Comparison shows that smaller risks result for the SNR-300. However, the confidence interval bandwidths obtained for the frequencies of the release categories for the SNR-300 are larger than those of the PWR-1300

  12. The TEX-I real-time expert system, applied to situation assessment for the SNR-300 reactor

    International Nuclear Information System (INIS)

    Schmal, N.; Leder, H.J.; Schade, H.J.

    1988-01-01

    Interatom, a subsidiary company of Siemens, is developing expert systems for the technical domain. These systems are operating in various industrial applications like flexible manufacturing or plant configuration, based on a domain-specific expert system shell, developed by Interatom. Additional projects are focusing on real-time diagnostics, e.g., for nuclear power plants. The authors report in this paper about a diagnosis expert system for the liquid-metal fast breeder reactor SNR-300, which uses new real-time tools, developed within the German TEX-I project (technical expert systems for data interpretation, diagnosis, and process control). The purpose of the system is to support the reactor operators in assessing plant status in real time, based on readings from many sensors. By on-line connection to the process control computer, it can monitor all incoming signal values, check the consistency of data, continuously diagnose the current plant status, detect unusual trends prior to accidents, localize faulty components, and recommended operator response in abnormal conditions. In the present knowledge acquisition and test phase, the expert system is connected to a real-time simulation of the reactor. The simulator is based on a thermohydraulic code for simulation of the transient behavior of temperatures and flow rates in the reactor core, plena, pipes, pumps, valves, intermediate heat exchangers, and cooling components. Additionally, the system's response to an asynchronous operator interaction can be simulated

  13. SNR and BER Models and the Simulation for BER Performance of Selected Spectral Amplitude Codes for OCDMA

    Directory of Open Access Journals (Sweden)

    Abdul Latif Memon

    2014-01-01

    Full Text Available Many encoding schemes are used in OCDMA (Optical Code Division Multiple Access Network but SAC (Spectral Amplitude Codes is widely used. It is considered an effective arrangement to eliminate dominant noise called MAI (Multi Access Interference. Various codes are studied for evaluation with respect to their performance against three noises namely shot noise, thermal noise and PIIN (Phase Induced Intensity Noise. Various Mathematical models for SNR (Signal to Noise Ratios and BER (Bit Error Rates are discussed where the SNRs are calculated and BERs are computed using Gaussian distribution assumption. After analyzing the results mathematically, it is concluded that ZCC (Zero Cross Correlation Code performs better than the other selected SAC codes and can serve larger number of active users than the other codes do. At various receiver power levels, analysis points out that RDC (Random Diagonal Code also performs better than the other codes. For the power interval between -10 and -20 dBm performance of RDC is better ZCC. Their lowest BER values suggest that these codes should be part of an efficient and cost effective OCDM access network in the future.

  14. Boosting the SNR by adding a receive-only endorectal monopole to an external antenna array for high-resolution, T2 -weighted imaging of early-stage cervical cancer with 7-T MRI

    NARCIS (Netherlands)

    van Kalleveen, I.M.L.; Hoogendam, J.P.; Raaijmakers, A.J.E.; Visser, F.; Arteaga de Castro, C.S.; Verheijen, R.H.M.; Luijten, P.R.; Zweemer, R.P.; Veldhuis, W.B.; Klomp, D.W.J.

    The aim of this study was to investigate the signal-to-noise ratio (SNR) gain in early-stage cervical cancer at ultrahigh-field MRI (e.g. 7 T) using a combination of multiple external antennas and a single endorectal antenna. In particular, we used an endorectal monopole antenna to increase the SNR

  15. Contrast Invariant SNR

    DEFF Research Database (Denmark)

    Weiss, Pierre; Escande, Paul; Dong, Yiqiu

    We design an image quality measure independent of local contrast changes, which constitute simple models of illumination changes. Given two images, the algorithm provides the image closest to the first one with the component tree of the second. This problem can be cast as a specific convex progra...... algorithms based on interior point methods. The algorithm has potential applications in change detection, color image processing or image fusion. A Matlab implementation is available at http://www.math.univ-toulouse.fr/_weiss/PageCodes.html....

  16. The TEX-I real-time expert system applied to situation assessment for the SNR-300 reactor

    International Nuclear Information System (INIS)

    Schmal, N.; Doerbecker, K.; Leder, H.J.; Rueckert, M.; Schade, H.J.

    1990-01-01

    Within the German TEX-I Project, which was sponsored by the Federal Ministry for Research and Technology, several companies developed industrial applications of technical expert systems for data interpretation, diagnosis and process control. The purpose of the diagnosis expert system reported here is to support the operators of the LMFBR SNR-300 in assessing plant status in real-time, based on readings from a large number of sensors. By online connection to the process control computer, it can monitor all incoming signal values, check the consistency of data, continuously diagnose the current plant status, detect unusual trends prior to accidents, localize faulty components and recommend operators response in abnormal conditions. The systems architecture consists of two basic subsystems, an inference engine and an intelligent process interface, implemented in Lisp on a Symbolics-Workstation. The inference engine has been derived from BABYLON, a hybrid shell developed by the German computer research institute GMD. This shell includes rules, prologue, constraints and an object oriented frame processor. The extended version has a component description language and a top-down diagnosis scheme including a mechanism of attention focusing. Inference run as independent, quasi-parallel processes. These so-called inference tasks can interrupt or abort each other, if higher priority events must be processed. The complete system is modelled in an object oriented matter and is divided into several subsystems and each subsystem into its physical components. At present the expert system is connected to a real-time simulation of the reactor. The simulation is based on a thermohydraulic code for simulation of the transient behaviour of temperatures and flow rates in the reactor core, plena, pipes, pumps, valves, intermediate heat exchangers and cooling components. Additionally, the systems response to an asynchronous operator interaction can be simulated. Several types of anomalies

  17. Design of an adaptive CubeSat transmitter for achieving optimum signal-to-noise ratio (SNR)

    Science.gov (United States)

    Jaswar, F. D.; Rahman, T. A.; Hindia, M. N.; Ahmad, Y. A.

    2017-12-01

    CubeSat technology has opened the opportunity to conduct space-related researches at a relatively low cost. Typical approach to maintain an affordable cubeSat mission is to use a simple communication system, which is based on UHF link with fixed-transmit power and data rate. However, CubeSat in the Low Earth Orbit (LEO) does not have relative motion with the earth rotation, resulting in variable propagation path length that affects the transmission signal. A transmitter with adaptive capability to select multiple sets of data rate and radio frequency (RF) transmit power is proposed to improve and optimise the link. This paper presents the adaptive UHF transmitter design as a solution to overcome the variability of the propagation path. The transmitter output power is adjustable from 0.5W to 2W according to the mode of operations and satellite power limitations. The transmitter is designed to have four selectable modes to achieve the optimum signal-to-noise ratio (SNR) and efficient power consumption based on the link budget analysis and satellite requirement. Three prototypes are developed and tested for space-environment conditions such as the radiation test. The Total Ionizing Dose measurements are conducted in the radiation test done at Malaysia Nuclear Agency Laboratory. The results from this test have proven that the adaptive transmitter can perform its operation with estimated more than seven months in orbit. This radiation test using gamma source with 1.5krad exposure is the first one conducted for a satellite program in Malaysia.

  18. Post-irradiation creep properties of four plates and two forgings DIN 1.4948 steel from the SNR-300 permanent primary structures

    International Nuclear Information System (INIS)

    Schaaf, B. van der.

    1987-01-01

    The safety authorities, involved in the licensing procedure of the SNR-300, have required the determination of the irradiation effect on the heat-to-heat variation of tensile and creep properties of Werkst. No. DIN 1.4948 austenitic stainless steel. These data are lacking in the present codes and they are necessary for the design and safety considerations of the permanent structures. Results are presented of about 200 tests on irradiated and unirradiated material of 6 heats used in the production of the SNR-300 permanent structures. After irradiation in the HFR-Petten to neutron fluences relevant for the SNR-300 service conditions post-irradiation tensile and creep tests (up to 10,000 hrs rupture time) were performed in the temperature range 723 K to 923 K. All heats are embrittled by irradiation resulting in reduction of rupture times, creep strength and ultimate tensile strength. The considerable reduction is attributed to helium enhanced intergranular creep crack growth, which reduces the ductility and strength, but does not affect the creep rate. The variation of tensile and creep properties is large and independent of irradiation. The minimum derived creep strength in irradiated condition drops below the values expected in the ASME Code and VdTuV Blatt. In design and safety analyses the irradiation effect on creep properties must be accounted for with an appropriate reduction factor. The predictions given, have to be verified with long-term creep tests and parts of the SNR surveillance programme. 172 figs.; 17 refs.; 58 tables

  19. Sodium magnetic resonance imaging. Development of a 3D radial acquisition technique with optimized k-space sampling density and high SNR-efficiency

    International Nuclear Information System (INIS)

    Nagel, Armin Michael

    2009-01-01

    A 3D radial k-space acquisition technique with homogenous distribution of the sampling density (DA-3D-RAD) is presented. This technique enables short echo times (TE 23 Na-MRI, and provides a high SNR-efficiency. The gradients of the DA-3D-RAD-sequence are designed such that the average sampling density in each spherical shell of k-space is constant. The DA-3D-RAD-sequence provides 34% more SNR than a conventional 3D radial sequence (3D-RAD) if T 2 * -decay is neglected. This SNR-gain is enhanced if T 2 * -decay is present, so a 1.5 to 1.8 fold higher SNR is measured in brain tissue with the DA-3D-RAD-sequence. Simulations and experimental measurements show that the DA-3D-RAD sequence yields a better resolution in the presence of T 2 * -decay and less image artefacts when B 0 -inhomogeneities exist. Using the developed sequence, T 1 -, T 2 * - and Inversion-Recovery- 23 Na-image contrasts were acquired for several organs and 23 Na-relaxation times were measured (brain tissue: T 1 =29.0±0.3 ms; T 2s * ∼4 ms; T 2l * ∼31 ms; cerebrospinal fluid: T 1 =58.1±0.6 ms; T 2 * =55±3 ms (B 0 =3 T)). T 1 - und T 2 * -relaxation times of cerebrospinal fluid are independent of the selected magnetic field strength (B0 = 3T/7 T), whereas the relaxation times of brain tissue increase with field strength. Furthermore, 23 Na-signals of oedemata were suppressed in patients and thus signals from different tissue compartments were selectively measured. (orig.)

  20. How to improve a critical performance for an ExoMars 2020 Scientific Instrument (RLS). Raman Laser Spectrometer Signal to Noise Ratio (SNR) Optimization

    Science.gov (United States)

    Canora, C. P.; Moral, A. G.; Rull, F.; Maurice, S.; Hutchinson, I.; Ramos, G.; López-Reyes, G.; Belenguer, T.; Canchal, R.; Prieto, J. A. R.; Rodriguez, P.; Santamaria, P.; Berrocal, A.; Colombo, M.; Gallago, P.; Seoane, L.; Quintana, C.; Ibarmia, S.; Zafra, J.; Saiz, J.; Santiago, A.; Marin, A.; Gordillo, C.; Escribano, D.; Sanz-Palominoa, M.

    2017-09-01

    The Raman Laser Spectrometer (RLS) is one of the Pasteur Payload instruments, within the ESA's Aurora Exploration Programme, ExoMars mission. Raman spectroscopy is based on the analysis of spectral fingerprints due to the inelastic scattering of light when interacting with matter. RLS is composed by Units: SPU (Spectrometer Unit), iOH (Internal Optical Head), and ICEU (Instrument Control and Excitation Unit) and the harnesses (EH and OH). The iOH focuses the excitation laser on the samples and collects the Raman emission from the sample via SPU (CCD) and the video data (analog) is received, digitalizing it and transmiting it to the processor module (ICEU). The main sources of noise arise from the sample, the background, and the instrument (Laser, CCD, focuss, acquisition parameters, operation control). In this last case the sources are mainly perturbations from the optics, dark signal and readout noise. Also flicker noise arising from laser emission fluctuations can be considered as instrument noise. In order to evaluate the SNR of a Raman instrument in a practical manner it is useful to perform end-to-end measurements on given standards samples. These measurements have to be compared with radiometric simulations using Raman efficiency values from literature and taking into account the different instrumental contributions to the SNR. The RLS EQM instrument performances results and its functionalities have been demonstrated in accordance with the science expectations. The Instrument obtained SNR performances in the RLS EQM will be compared experimentally and via analysis, with the Instrument Radiometric Model tool. The characterization process for SNR optimization is still on going. The operational parameters and RLS algorithms (fluorescence removal and acquisition parameters estimation) will be improved in future models (EQM-2) until FM Model delivery.

  1. Summary of results for the SNEAK-9 series of critical experiments and conclusions for the accuracy of predicted physics parameters of the SNR-300

    International Nuclear Information System (INIS)

    Helm, F.

    1978-08-01

    In a series of critical assembles in SNEAK physics parameters of interest for the prototype fast reactor SNR-300 were investigated and compared to the results of calculations. Since a complete mock-up of the SNR-300 was not possible with the material supply available the measurements were performed in three different assemblies, each being adapted to the investigation of a particular set of problems. Work was concentrated on the following quantities: criticality, breeding ratio, Na-void effect, control rod worths and power distribution. The calculation were performed using the diffusion and transport methods available at KFK and as a data basis the KFKINER cross section set. Detailed descriptions of the assemblies, the majority of the results and extensive discussions of the experimental and calculational methods used can be found in separate KFK reports about each assembly which were already published. This report contains a summary of the results for each quantity investigated including a basic account of the methods used, and an evaluation of the significance of these data for the prediction of parameters of the SNR-300. (orig.) 891 RW [de

  2. Evaluation of the signal-to-noise ratio (SNR) in a CR system and establishment of RQR-M and RQA-M IEC reference radiations in mammography

    International Nuclear Information System (INIS)

    Rosado, Paulo H.G.; Nogueira, Maria S.; Dantas, Marcelino V.A.; Santana, Priscila do C.

    2009-01-01

    In this work, the radiation condition RQR-M e RQA-M of IEC were established in the Siemens Mammomat 3000 mammography equipment. The standard radiation condition are described in terms of: emitting target of molybdenum, percentage ripple not more that 4%, total filtration of 0,032 ± 0,002 mm of molybdenum and specific values of first half-value layer. The results show that the values of parameters were in the range that the IEC recommends. Only the RQAM-3 the value of CSR was not in agreement of the value recommend, and was necessary a additions of 0,1 mm Al in the x-ray tube. After this, the signal noise ratio (SNR) of de Computer radiography (CR) system was evaluated in the reference qualities of RQR-M e RQA-M. For SNR the RQR-M mode of exposure was done with both the 20 mAs and automatic one. To RQA-M the exposure was done with 100 mAs. The variations of the values of SNR were approximated 4%. The tests were done with CR model CR850 made from Kodak and 40 mm of PMMA. (author)

  3. Interstellar protons in the TeV γ-ray SNR HESS J1731-347: Possible evidence for the coexistence of hadronic and leptonic γ-rays

    International Nuclear Information System (INIS)

    Fukuda, T.; Yoshiike, S.; Sano, H.; Torii, K.; Yamamoto, H.; Fukui, Y.; Acero, F.

    2014-01-01

    HESS J1731-347 (G353.6-0.7) is one of the TeV γ-ray supernova remnants (SNRs) that shows the shell-like morphology. We have made a new analysis of the interstellar protons toward the SNR by using both the 12 CO(J = 1-0) and H I data sets. The results indicate that the TeV γ-ray shell shows significant spatial correlation with the interstellar protons at a velocity range from –90 km s –1 to –75 km s –1 . The total mass of the interstellar medium (ISM) protons is estimated to be 6.4 × 10 4 M ☉ , 25% of which is atomic gas, and the distance corresponding to the velocity range is ∼5.2 kpc, a factor of 2 larger than the previous figure, 3 kpc. We have identified the cold H I gas observed as self-absorption which shows significant correspondence with the northeastern γ-ray peak. While the good correspondence between the ISM protons and TeV γ-rays in the north of the SNR lends support to the hadronic scenario for the TeV γ-rays, the southern part of the shell shows a break in the correspondence; in particular, the southwestern rim of the SNR shell shows a significant decrease of the interstellar protons by a factor of two. We argue that this discrepancy can be explained due to leptonic γ-rays because this region coincides well with the bright shell that emits non-thermal radio continuum emission and non-thermal X-rays, suggesting that the γ-rays of HESS J1713-347 consist of both the hadronic and leptonic components. The leptonic contribution corresponds to ∼20% of the total γ-rays.

  4. A study on evaluating validity of SNR calculation using a conventional two region method in MR images applied a multichannel coil and parallel imaging technique

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Kwan Woo; Son, Soon Yong [Dept. of Radiology, Asan Medical Center, Seoul (Korea, Republic of); Min, Jung Whan [Dept. of Radiological Technology, Shingu University, Sungnam (Korea, Republic of); Kwon, Kyung Tae [Dept. of Radiological Technology, Dongnam Health University, Suwon (Korea, Republic of); Yoo, Beong Gyu; Lee, Jong Seok [Dept. of Radiotechnology, Wonkwang Health Science University, Iksan (Korea, Republic of)

    2015-12-15

    The purpose of this study was to investigate the problems of a signal to noise ratio measurement using a two region measurement method that is conventionally used when using a multi-channel coil and a parallel imaging technique. As a research method, after calculating the standard SNR using a single channel head coil of which coil satisfies three preconditions when using a two region measurement method, we made comparisons and evaluations after calculating an SNR by using a two region measurement method of which method is problematic because it is used without considering the methods recommended by reputable organizations and the preconditions at the time of using a multi-channel coil and a parallel imaging technique. We found that a two region measurement method using a multi-channel coil and a parallel imaging technique shows the highest relative standard deviation, and thus shows a low degree of precision. In addition, we found out that the difference of SNR according to ROI location was very high, and thus a spatial noise distribution was not uniform. Also, 95% confidence interval through Blend-Altman plot is the widest, and thus the conformity degree with a two region measurement method using the standard single channel head coil is low. By directly comparing an AAPM method, which serves as a standard of a performance evaluation test of a magnetic resonance imaging device under the same image acquisition conditions, an NEMA method which can accurately determine the noise level in a signal region and the methods recommended by manufacturers of a magnetic resonance imaging device, there is a significance in that we quantitatively verified the inaccurate problems of a signal to noise ratio using a two region measurement method when using a multi-channel coil and a parallel imaging technique of which method does not satisfy the preconditions that researchers could overlook.

  5. Developments for the ultrasonic in-service inspection of the inner near surface zone of circular welds in the vessel of the fast breeder-reactor SNR 300

    International Nuclear Information System (INIS)

    Salzburger, H.J.; Huebschen, G.; Neuschwander, R.; Kleffner, G.; Wessels, J.

    1990-01-01

    For in-service, ultrasonic inspection of the inner near-surface zone of the welds 1 and 6 of the vessel of the SNR-300, an automated system has been developed for scanning, manipulation and evaluation tasks. The scanning system which currently is tested and qualified as a prototype system uses heat-resistant EMUS probes which do not require coupling agents, and which have been optimized for three different testing tasks. The required electronic equipment has also been developed to prototype stage, and both have been incorporated into the automated manipulation, data acquisition and evaluation system. (orig.) [de

  6. The influence of the reactivity ramp on the course of the power transient in the MARK 1A core of the SNR 300

    International Nuclear Information System (INIS)

    Froehlich, R.; Schmuck, P.

    1976-01-01

    The course of a hypothetic transient overpower accident caused by the onset of a not further specified reactivity ramp accompanied by the simultaneous failure of both shutdown systems must be analyzed in the SNR 300 Mark 1A core licensing procedure. The present study is limited to the discussion of the starting and shutdown phases of such accidents for the fresh core. Depending on the operational state of the reactor, the core geometry is still intact during the starting phase. In the following shutdown phase (core disassembly phase), large-scale mass transfer leads to the nuclear shutdown of the reactor. (orig./AK) [de

  7. Constraining the Single-degenerate Channel of Type Ia Supernovae with Stable Iron-group Elements in SNR 3C 397

    Energy Technology Data Exchange (ETDEWEB)

    Dave, Pranav; Kashyap, Rahul; Fisher, Robert [Department of Physics, University of Massachusetts Dartmouth, 285 Old Westport Road, North Dartmouth, MA 02740 (United States); Timmes, Frank [School of Earth and Space Exploration, Arizona State University, Tempe, AZ 85287 (United States); Townsley, Dean [Department of Physics and Astronomy, Box 870324, University of Alabama, Tuscaloosa, AL 35487 (United States); Byrohl, Chris [Institut für Astrophysik, Georg August Universität Göttingen, Friedrich-Hund-Platz 1, D-37077 Göttingen (Germany)

    2017-05-20

    Recent Suzaku X-ray spectra of supernova remnant (SNR) 3C 397 indicate enhanced stable iron group element abundances of Ni, Mn, Cr, and Fe. Seeking to address key questions about the progenitor and explosion mechanism of 3C 397, we compute nucleosynthetic yields from a suite of multidimensional hydrodynamics models in the near-Chandrasekhar-mass, single-degenerate paradigm for Type Ia supernovae (SNe Ia). Varying the progenitor white dwarf (WD) internal structure, composition, ignition, and explosion mechanism, we find that the best match to the observed iron peak elements of 3C 397 are dense (central density ≥6 × 10{sup 9} g cm{sup −3}), low-carbon WDs that undergo a weak, centrally ignited deflagration, followed by a subsequent detonation. The amount of {sup 56}Ni produced is consistent with a normal or bright normal SNe Ia. A pure deflagration of a centrally ignited, low central density (≃2 × 10{sup 9} g cm{sup −3}) progenitor WD, frequently considered in the literature, is also found to produce good agreement with 3C 397 nucleosynthetic yields, but leads to a subluminous SN Ia event, in conflict with X-ray line width data. Additionally, in contrast to prior work that suggested a large supersolar metallicity for the WD progenitor for SNR 3C 397, we find satisfactory agreement for solar- and subsolar-metallicity progenitors. We discuss a range of implications our results have for the single-degenerate channel.

  8. The diffuse source at the center of LMC SNR 0509–67.5 is a background galaxy at z = 0.031

    International Nuclear Information System (INIS)

    Pagnotta, Ashley; Walker, Emma S.; Schaefer, Bradley E.

    2014-01-01

    Type Ia supernovae (SNe Ia) are well-known for their use in the measurement of cosmological distances, but our continuing lack of concrete knowledge about their progenitor stars is both a matter of debate and a source of systematic error. In our attempts to answer this question, we presented unambiguous evidence that LMC SNR 0509–67.5, the remnant of an SN Ia that exploded in the Large Magellanic Cloud 400 ± 50 yr ago, did not have any point sources (stars) near the site of the original supernova explosion, from which we concluded that this particular supernova must have had a progenitor system consisting of two white dwarfs. There is, however, evidence of nebulosity near the center of the remnant, which could have been left over detritus from the less massive WD, or could have been a background galaxy unrelated to the supernova explosion. We obtained long-slit spectra of the central nebulous region using GMOS on Gemini South to determine which of these two possibilities is correct. The spectra show Hα emission at a redshift of z = 0.031, which implies that the nebulosity in the center of LMC SNR 0509–67.5 is a background galaxy, unrelated to the supernova.

  9. An 8-channel transceiver 7-channel receive RF coil setup for high SNR ultrahigh-field MRI of the shoulder at 7T.

    Science.gov (United States)

    Rietsch, Stefan H G; Pfaffenrot, Viktor; Bitz, Andreas K; Orzada, Stephan; Brunheim, Sascha; Lazik-Palm, Andrea; Theysohn, Jens M; Ladd, Mark E; Quick, Harald H; Kraff, Oliver

    2017-12-01

    In this work, we present an 8-channel transceiver (Tx/Rx) 7-channel receive (Rx) radiofrequency (RF) coil setup for 7 T ultrahigh-field MR imaging of the shoulder. A C-shaped 8-channel Tx/Rx coil was combined with an anatomically close-fitting 7-channel Rx-only coil. The safety and performance parameters of this coil setup were evaluated on the bench and in phantom experiments. The 7 T MR imaging performance of the shoulder RF coil setup was evaluated in in vivo measurements using a 3D DESS, a 2D PD-weighted TSE sequence, and safety supervision based on virtual observation points. Distinct SNR gain and acceleration capabilities provided by the additional 7-channel Rx-only coil were demonstrated in phantom and in vivo measurements. The power efficiency indicated good performance of each channel and a maximum B 1 + of 19 μT if the hardware RF power limits of the MR system were exploited. MR imaging of the shoulder was demonstrated with clinically excellent image quality and submillimeter spatial resolution. The presented 8-channel transceiver 7-channel receive RF coil setup was successfully applied for in vivo 7 T MRI of the shoulder providing a clear SNR gain vs the transceiver array without the additional receive array. Homogeneous images across the shoulder region were obtained using 8-channel subject-specific phase-only RF shimming. © 2017 American Association of Physicists in Medicine.

  10. Revised coordinates of variable stars in Cassiopeia

    Science.gov (United States)

    Nesci, R.

    2018-02-01

    The identification of the variable stars published on IBVS 3573 has ben revised on the basis of the original (unpublished) finding charts. Cross check with the 2MASS catalog has been made to get more accurate coordinates and to confirm their nature from their , colors. The Mira stars, given their known periods, could be used with the astrometric parallaxes of the forthcoming Gaia catalog to improve the Period-Luminosity relation.

  11. Material correlations and models for the irradiation behavior of fissile and fertile material in SNR-300, Mark-II and KNK II, third core

    International Nuclear Information System (INIS)

    Fenneker; Steinmetz; Toebbe

    1986-07-01

    The report contains the material correlations and models used in the fuel pin design code IAMBUS for the irradiation behavior of PuO 2 -UO 2 fissile materials and UO 2 fertile materials of the SNR-300 Mark-II reload and the KNK II third core. They are applicable for pellet densities of more than 90 % of the theoretical density. The presented models of the fuel behavior and the applied material correlations have been derived either from single experiments or from the comparison of theoretically predicted integral fuel behavior with the results of fuel pin irradiation experiments. The material correlations have been examined and extended in the frame of the collaborations INTERATOM/KWU and INTERATOM/KfK. French and British results were included, when available from the European fast reactor knowledge exchange [de

  12. Development of an application-oriented multi-frequency eddy current procedure for the outer reactor vessel- and store vessel wall of the SNR-300

    International Nuclear Information System (INIS)

    Hoeft, E.

    1991-08-01

    The following companies participated in the development of the application oriented multi-frequency eddy current procedure for the outer reactor vessel- and store vesselwall of the SNR-300: Interatom GmbH (coordinator), MAN-Energie GmbH (ME, subcontractor), Fraunhofer Institut IzfP, own promotion project). The precisely defined work packages of the participating companies Interatom and IzfP were supported by the Federal Minister for Research and Technology in separate promotion project. The present report comprises the work performed at Interatom and ME for developing the manipulator and the subsystems. The development aim was reached largely. Manufactoring of the manipulator with all necessary peripherical equipments was finished and accepted in partial function tests at the manufacturer. Tests at the Interatom teststand however with the fully mounted systems at ambient- and reactor temperature could not be done within the appropriated timeschedule and finance frame. (orig.) [de

  13. CORE-COLLAPSE MODEL OF BROADBAND EMISSION FROM SNR RX J1713.7–3946 WITH THERMAL X-RAYS AND GAMMA RAYS FROM ESCAPING COSMIC RAYS

    International Nuclear Information System (INIS)

    Ellison, Donald C.; Slane, Patrick; Patnaude, Daniel J.; Bykov, Andrei M.

    2012-01-01

    We present a spherically symmetric, core-collapse model of SNR RX J1713.7–3946 that includes a hydrodynamic simulation of the remnant evolution coupled to the efficient production of cosmic rays (CRs) by nonlinear diffusive shock acceleration. High-energy CRs that escape from the forward shock (FS) are propagated in surrounding dense material that simulates either a swept-up, pre-supernova shell or a nearby molecular cloud. The continuum emission from trapped and escaping CRs, along with the thermal X-ray emission from the shocked heated interstellar medium behind the FS, integrated over the remnant, is compared against broadband observations. Our results show conclusively that, overall, the GeV-TeV emission is dominated by inverse-Compton from CR electrons if the supernova is isolated regardless of its type, i.e., not interacting with a >>100 M ☉ shell or cloud. If the supernova remnant is interacting with a much larger mass ∼> 10 4 M ☉ , pion decay from the escaping CRs may dominate the TeV emission, although a precise fit at high energy will depend on the still uncertain details of how the highest energy CRs are accelerated by, and escape from, the FS. Based on morphological and other constraints, we consider the 10 4 M ☉ pion-decay scenario highly unlikely for SNR RX J1713.7–3946 regardless of the details of CR escape. Importantly, even though CR electrons dominate the GeV-TeV emission, the efficient production of CR ions is an essential part of our leptonic model.

  14. Sodium magnetic resonance imaging. Development of a 3D radial acquisition technique with optimized k-space sampling density and high SNR-efficiency; Natrium-Magnetresonanztomographie. Entwicklung einer 3D radialen Messtechnik mit optimierter k-Raum-Abtastdichte und hoher SNR-Effizienz

    Energy Technology Data Exchange (ETDEWEB)

    Nagel, Armin Michael

    2009-04-01

    A 3D radial k-space acquisition technique with homogenous distribution of the sampling density (DA-3D-RAD) is presented. This technique enables short echo times (TE<0.5 ms), that are necessary for {sup 23}Na-MRI, and provides a high SNR-efficiency. The gradients of the DA-3D-RAD-sequence are designed such that the average sampling density in each spherical shell of k-space is constant. The DA-3D-RAD-sequence provides 34% more SNR than a conventional 3D radial sequence (3D-RAD) if T{sub 2}{sup *}-decay is neglected. This SNR-gain is enhanced if T{sub 2}{sup *}-decay is present, so a 1.5 to 1.8 fold higher SNR is measured in brain tissue with the DA-3D-RAD-sequence. Simulations and experimental measurements show that the DA-3D-RAD sequence yields a better resolution in the presence of T{sub 2}{sup *}-decay and less image artefacts when B{sub 0}-inhomogeneities exist. Using the developed sequence, T{sub 1}-, T{sub 2}{sup *}- and Inversion-Recovery-{sup 23}Na-image contrasts were acquired for several organs and {sup 23}Na-relaxation times were measured (brain tissue: T{sub 1}=29.0{+-}0.3 ms; T{sub 2s}{sup *}{approx}4 ms; T{sub 2l}{sup *}{approx}31 ms; cerebrospinal fluid: T{sub 1}=58.1{+-}0.6 ms; T{sub 2}{sup *}=55{+-}3 ms (B{sub 0}=3 T)). T{sub 1}- und T{sub 2}{sup *}-relaxation times of cerebrospinal fluid are independent of the selected magnetic field strength (B0 = 3T/7 T), whereas the relaxation times of brain tissue increase with field strength. Furthermore, {sup 23}Na-signals of oedemata were suppressed in patients and thus signals from different tissue compartments were selectively measured. (orig.)

  15. Impact of SNR, masker type and noise reduction processing on sentence recognition performance and listening effort as indicated by the pupil dilation response

    DEFF Research Database (Denmark)

    Ohlenforst, Barbara; Wendt, Dorothea; Kramer, Sophia E

    2018-01-01

    Recent studies have shown that activating the noise reduction scheme in hearing aids results in a smaller peak pupil dilation (PPD), indicating reduced listening effort, at 50% and 95% correct sentence recognition with a 4-talker masker. The objective of this study was to measure the effect...... of the noise reduction scheme (on or off) on PPD and sentence recognition across a wide range of signal-to-noise ratios (SNRs) from +16 dB to -12 dB and two masker types (4-talker and stationary noise). Relatively low PPDs were observed at very low (-12 dB) and very high (+16 dB to +8 dB) SNRs presumably due...... to 'giving up' and 'easy listening', respectively. The maximum PPD was observed with SNRs at approximately 50% correct sentence recognition. Sentence recognition with both masker types was significantly improved by the noise reduction scheme, which corresponds to the shift in performance from SNR function...

  16. Comparison of cavitation tests on the SNR 300 prototype sodium pump, carried out using water at room temperature and liquid sodium at 5800C

    International Nuclear Information System (INIS)

    Fakkel, R.H.; Hoornweg, C.J.; Kamerling, B.; Ten Wolde, Tj.; Heslenfeld, M.W.; Mendte, W.K.; Bunjies, J.H.

    1976-01-01

    This paper gives results of tests carried out on a centrifugal pump in both a water and a sodium test facility. The pump tested is a prototype of the primary circulation pumps intended for a LMFBR 300 MWe nuclear power station (the SNR reactor) under construction at Kalkar, West Germany. The pump characteristics under various NPSH-conditions were investigated, and a comparison is made in the paper between the results of cavitation tests using water and liquid sodium. An attempt is made to account for differences in pump characteristics in both types of tests by referring to the physical properties of the liquids used (water and sodium). An attempt is also made to correlate the results obtained with the full-scale prototype to those obtained previously with a half-scale model of the impeller. The various test circuits used should be made identical, in order to avoid that differences in geometry should obscure essential features resulting from using different liquids. Yet, it showed that in this respect, the tests did not obey to this key-rule, reasons why the test results did not fully reveal the essential physical properties of either fluid under cavitating conditions. (author)

  17. Throughput Estimation Method in Burst ACK Scheme for Optimizing Frame Size and Burst Frame Number Appropriate to SNR-Related Error Rate

    Science.gov (United States)

    Ohteru, Shoko; Kishine, Keiji

    The Burst ACK scheme enhances effective throughput by reducing ACK overhead when a transmitter sends sequentially multiple data frames to a destination. IEEE 802.11e is one such example. The size of the data frame body and the number of burst data frames are important burst transmission parameters that affect throughput. The larger the burst transmission parameters are, the better the throughput under error-free conditions becomes. However, large data frame could reduce throughput under error-prone conditions caused by signal-to-noise ratio (SNR) deterioration. If the throughput can be calculated from the burst transmission parameters and error rate, the appropriate ranges of the burst transmission parameters could be narrowed down, and the necessary buffer size for storing transmit data or received data temporarily could be estimated. In this paper, we present a method that features a simple algorithm for estimating the effective throughput from the burst transmission parameters and error rate. The calculated throughput values agree well with the measured ones for actual wireless boards based on the IEEE 802.11-based original MAC protocol. We also calculate throughput values for larger values of the burst transmission parameters outside the assignable values of the wireless boards and find the appropriate values of the burst transmission parameters.

  18. SNR 300 - no perpetuum mobile

    International Nuclear Information System (INIS)

    Anon.

    1981-01-01

    It should breed more nuclear fuel than it needs for itself; it should produce cheap electricity - presumably it shall fulfill neither of these tasks, this 'Fast Breeder' at Kalkar. The State Secretary Mr. Stahl of the Bundesforschungsministerium had expressed it in the Bundestag: the breeding rate is 'not of the greatest importance' for the economic use of breeder reactors. (orig.) [de

  19. Experiments on the fluid dynamics and thermodynamics of rod bundles to verify and support the design of SNR-300 fuel elements - status and open problems

    International Nuclear Information System (INIS)

    Moeller, R.; Weinberg, D.; Trippe, G.; Tschoeke, H.

    1978-01-01

    The reliable design of reactor core elements calls for precise knowledge of the 3D-temperature fields of the different components; this primarily applies to the fuel element cladding tubes, these being the first safety barrier. This paper describes and discusses where and how the 3D-temperature fields so far determined exclusively with the help of global thermohydraulic computer codes (SUBCHANNEL-Codes) have to be determined more accurately by local investigations. The basis of these investigations is the measurement of local velocities and temperatures in 19-rod bundle models of the SNR-300 fuel element performed at the Kernforschungszentrum Karlsruhe (KfK). Some important results of the extensive experimental investigations are reported and compared with global and local recalculations. Open problems are pointed out. The influence of the uncertainties in the thermohydraulic design with respect to the strength analysis are discussed. The most significant results and conclusions are: (1) The peripheral bundle region is the critical zone, which has to be investigated with priority. Here the maximal azimuthal temperature differences of the claddings are ten times higher than those in the central bundle region. (2) The present deviations between thermal experiments and global as well as local calculations are much too high. Within the parameters investigated a careful code adaptation to the experiments is of high priority. (3) The knowledge gaps concerning liquid metal heat transfer in irregular geometries have to be closed. (4) The hot-channel analysis has to be checked with respect to the latest more detailed knowledge of thermohydraulics. (author)

  20. Two potential hookworm DAF-16 target genes, SNR-3 and LPP-1: gene structure, expression profile, and implications of a cis-regulatory element in the regulation of gene expression.

    Science.gov (United States)

    Gao, Xin; Goggin, Kevin; Dowling, Camille; Qian, Jason; Hawdon, John M

    2015-01-08

    Hookworms infect nearly 700 million people, causing anemia and developmental stunting in heavy infections. Little is known about the genomic structure or gene regulation in hookworms, although recent publication of draft genome assemblies has allowed the first investigations of these topics to be undertaken. The transcription factor DAF-16 mediates multiple developmental pathways in the free living nematode Caenorhabditis elegans, and is involved in the recovery from the developmentally arrested L3 in hookworms. Identification of downstream targets of DAF-16 will provide a better understanding of the molecular mechanism of hookworm infection. Genomic Fragment 2.23 containing a DAF-16 binding element (DBE) was used to identify overlapping complementary expressed sequence tags (ESTs). These sequences were used to search a draft assembly of the Ancylostoma caninum genome, and identified two neighboring genes, snr-3 and lpp-1, in a tail-to-tail orientation. Expression patterns of both genes during parasitic development were determined by qRT-PCR. DAF-16 dependent cis-regulatory activity of fragment 2.23 was investigated using an in vitro reporter system. The snr-3 gene spans approximately 5.6 kb in the genome and contains 3 exons and 2 introns, and contains the DBE in its 3' untranslated region. Downstream from snr-3 in a tail-to-tail arrangement is the gene lpp-1. The lpp-1 gene spans more than 6 kb and contains 10 exons and 9 introns. The A. caninum genome contains 2 apparent splice variants, but there are 7 splice variants in the A. ceylanicum genome. While the gene order is similar, the gene structures of the hookworm genes differ from their C. elegans orthologs. Both genes show peak expression in the late L4 stage. Using a cell culture based expression system, fragment 2.23 was found to have both DAF-16-dependent promoter and enhancer activity that required an intact DBE. Two putative DAF-16 targets were identified by genome wide screening for DAF-16 binding

  1. Signal to Noise Ratio (SNR Enhancement Comparison of Impulse-, Coding- and Novel Linear-Frequency-Chirp-Based Optical Time Domain Reflectometry (OTDR for Passive Optical Network (PON Monitoring Based on Unique Combinations of Wavelength Selective Mirrors

    Directory of Open Access Journals (Sweden)

    Christopher M. Bentz

    2014-03-01

    Full Text Available We compare optical time domain reflectometry (OTDR techniques based on conventional single impulse, coding and linear frequency chirps concerning their signal to noise ratio (SNR enhancements by measurements in a passive optical network (PON with a maximum one-way attenuation of 36.6 dB. A total of six subscribers, each represented by a unique mirror pair with narrow reflection bandwidths, are installed within a distance of 14 m. The spatial resolution of the OTDR set-up is 3.0 m.

  2. Analysis on frequency response of trans-impedance amplifier (TIA) for signal-to-noise ratio (SNR) enhancement in optical signal detection system using lock-in amplifier (LIA)

    Science.gov (United States)

    Kim, Ji-Hoon; Jeon, Su-Jin; Ji, Myung-Gi; Park, Jun-Hee; Choi, Young-Wan

    2017-02-01

    Lock-in amplifier (LIA) has been widely used in optical signal detection systems because it can measure small signal under high noise level. Generally, The LIA used in optical signal detection system is composed of transimpedance amplifier (TIA), phase sensitive detector (PSD) and low pass filter (LPF). But commercial LIA using LPF is affected by flicker noise. To avoid flicker noise, there is 2ω detection LIA using BPF. To improve the dynamic reserve (DR) of the 2ω LIA, the signal to noise ratio (SNR) of the TIA should be improved. According to the analysis of frequency response of the TIA, the noise gain can be minimized by proper choices of input capacitor (Ci) and feed-back network in the TIA in a specific frequency range. In this work, we have studied how the SNR of the TIA can be improved by a proper choice of frequency range. We have analyzed the way to control this frequency range through the change of passive component in the TIA. The result shows that the variance of the passive component in the TIA can change the specific frequency range where the noise gain is minimized in the uniform gain region of the TIA.

  3. UBV Photometry at the Outside Eclipse Phase of AZ Cassiopeiae

    Directory of Open Access Journals (Sweden)

    Il-Seong Nha

    1994-06-01

    Full Text Available VV Cep-type long period spectroscopic-eclipsing binary AZ Cas has been observed for five years, 1985 Oct ~ 1990 Feb, in UBV at the Ilsan Station of Yonsei University Observatory. A total of 431 observations (U=129, B=142 and V=160 are made for 86 nights. Instrumental differential UBV and B-V light curves made with these observations cover phases nearly a half of one period. There is no appreciable light variation in V but in other two passbands a gradual decrease of the brightness is clearly noticed. The loss of light in B resulted in a reddening in △(B-V by +0.06 at phases between 0.4~0.5 as compared with that of at phase ~0.1. This intrinsic reddening arouses a question why at the orbital phase of the transit of a hot star in front of a cool M supergiant the heating of the facing hemisphere of M supergiant by the strong radiation from the B star is absent. With regard to this unusual situation we propose a hypothesis that a large amount of gas stream of low temperature ejected from the surface of M supergiant component towards the B star dominates the brightness of B star and reflection effect.

  4. The Distribution of Radioactive 44ti In Cassiopeia A

    DEFF Research Database (Denmark)

    Grefenstette, Brian W.; Fryer, Chris L.; Harrison, Fiona A.

    2016-01-01

    the plane of the sky (measured clockwise from celestial north) and is tilted by 58° ± 20° into the plane of the sky away from the observer, roughly opposite to the inferred direction of motion of the central compact object. We find some 44Ti ejecta that are clearly interior to the reve0rse shock and some...

  5. Diffusion-weighted MRI of the prostate at 3.0 T: Comparison of endorectal coil (ERC) MRI and phased-array coil (PAC) MRI—The impact of SNR on ADC measurement

    International Nuclear Information System (INIS)

    Mazaheri, Yousef; Vargas, H. Alberto; Nyman, Gregory; Shukla-Dave, Amita; Akin, Oguz; Hricak, Hedvig

    2013-01-01

    Purpose: To compare ADC values measured from diffusion-weighted MR (DW-MR) images of the prostate obtained with both endorectal and phased-array coils (ERC + PAC) to those from DW-MRI images obtained with an eight-channel torso phased-array coil (PAC) at 3.0 T. Methods: The institutional review board issued a waiver of informed consent for this HIPAA-compliant study. Twenty-five patients with biopsy-proven prostate cancer underwent standard 3-T MRI using 2 different coil arrangements (ERC + PAC and PAC only) in the same session. DW-MRI at five b-values (0, 600, 1000, 1200, and 1500 s/mm 2 ) were acquired using both coil arrangements. On b = 0 images, signal-to-noise ratios (SNRs) were measured as the ratio of the mean signal from PZ and TZ ROIs to the standard deviation from the mean signal in an artifact-free ROI in the rectum. Matching regions-of-interest (ROIs) were identified in the peripheral zone and transition zone on ERC-MRI and PAC-MRI. For each ROI, mean ADC values for all zero and non-zero b-value combinations were computed. Results: Mean SNR with ERC-MRI at PZ (66.33 ± 27.07) and TZ (32.69 ± 12.52) was 9.27 and 5.52 times higher than with PAC-MRI ((7.32 ± 2.30) and (6.13 ± 1.56), respectively) (P < 0.0001 for both). ADCs from DW-MR images obtained with all b-values in the PZ and TZ were significantly lower with PAC-MRI than with ERC-MRI (P < 0.001 for all). Conclusion: Lower SNR of DW-MR images of the prostate obtained with a PAC can significantly decrease ADC values at higher b-values compared to similar measurements obtained using the ERC. To address these requirements, clinical MR systems should have image processing capabilities which incorporate the noise distribution

  6. dr. andries albertus odendaal snr., evangeliedraer in

    African Journals Online (AJOL)

    del oor “The translation of the name of God in Southern Sotho” (1973). Met sowel sy M.Th.verhandeling as die artikels en resensies van woordeboeke. 12 Die vreemde was dat geen kopie van die M. Th.tesis in die biblioteek van die Fakulteit. Teologie te Stellenbosch opgespoor kon word nie. 'n Kopie is uit A.A. se persoon.

  7. Risk-oriented analysis of SNR 300

    International Nuclear Information System (INIS)

    Franke, B.; Hoepfner, U.; Koch, T.

    1982-08-01

    This paper describes a failure of the outer containment and subsequent release of great quantities of radionuclides following a high-energy Bethe-Tait accidents. It describes two kinds of containment failure and how they arise. These are failure following projectile formation and failure owing to excess pressure. The study includes the consideration of mechanical energy release even over the value of 370 MJ as designed. (orig./DG) [de

  8. Diffusion-weighted MRI of the prostate at 3.0 T: comparison of endorectal coil (ERC) MRI and phased-array coil (PAC) MRI-The impact of SNR on ADC measurement.

    Science.gov (United States)

    Mazaheri, Yousef; Vargas, H Alberto; Nyman, Gregory; Shukla-Dave, Amita; Akin, Oguz; Hricak, Hedvig

    2013-10-01

    To compare ADC values measured from diffusion-weighted MR (DW-MR) images of the prostate obtained with both endorectal and phased-array coils (ERC+PAC) to those from DW-MRI images obtained with an eight-channel torso phased-array coil (PAC) at 3.0 T. The institutional review board issued a waiver of informed consent for this HIPAA-compliant study. Twenty-five patients with biopsy-proven prostate cancer underwent standard 3-T MRI using 2 different coil arrangements (ERC+PAC and PAC only) in the same session. DW-MRI at five b-values (0, 600, 1000, 1200, and 1500 s/mm(2)) were acquired using both coil arrangements. On b=0 images, signal-to-noise ratios (SNRs) were measured as the ratio of the mean signal from PZ and TZ ROIs to the standard deviation from the mean signal in an artifact-free ROI in the rectum. Matching regions-of-interest (ROIs) were identified in the peripheral zone and transition zone on ERC-MRI and PAC-MRI. For each ROI, mean ADC values for all zero and non-zero b-value combinations were computed. Mean SNR with ERC-MRI at PZ (66.33 ± 27.07) and TZ (32.69 ± 12.52) was 9.27 and 5.52 times higher than with PAC-MRI ((7.32 ± 2.30) and (6.13 ± 1.56), respectively) (PERC-MRI (PERC. To address these requirements, clinical MR systems should have image processing capabilities which incorporate the noise distribution. Copyright © 2013 Elsevier Ireland Ltd. All rights reserved.

  9. ZnO-nanocarbon core-shell type hybrid quantum dots

    CERN Document Server

    Choi, Won Kook

    2017-01-01

    This book offers a comprehensive overview of ZnO-nano carbon core shell hybrid issues. There is significant interest in metal oxide/nanocarbon hybrid functional materials in the field of energy conversion and storage as electrode materials for supercapacitors, Li ion secondary battery, electrocatalysts for water splitting, and optoelectronic devices such as light emitting diodes and solar photovoltaic cells. Despite efforts to manipulate more uniform metal oxide-nanocarbon nanocomposite structures, they have shown poor performance because they are randomly scattered and non-uniformly attached to the nanocarbon surface. For higher and more effective performance of the hybrid structure, 3D conformal coating on metal oxides are highly desirable. In the first part of the book, the physical and chemical properties of ZnO and nanocarbons and the state-of-the-art in related research are briefly summarized. In the next part, the 3D conformal coating synthetic processes of ZnO templated nanocarbon hybrid materials suc...

  10. Detailed spectral and morphological analysis of the shell type supernova remnant RCW 86

    Science.gov (United States)

    H.E.S.S. Collaboration; Abramowski, A.; Aharonian, F.; Ait Benkhali, F.; Akhperjanian, A. G.; Angüner, E. O.; Backes, M.; Balzer, A.; Becherini, Y.; Becker Tjus, J.; Berge, D.; Bernhard, S.; Bernlöhr, K.; Birsin, E.; Blackwell, R.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bordas, P.; Bregeon, J.; Brun, F.; Brun, P.; Bryan, M.; Bulik, T.; Carr, J.; Casanova, S.; Chakraborty, N.; Chalme-Calvet, R.; Chaves, R. C. G.; Chen, A.; Chevalier, J.; Chrétien, M.; Colafrancesco, S.; Cologna, G.; Condon, B.; Conrad, J.; Couturier, C.; Cui, Y.; Davids, I. D.; Degrange, B.; Deil, C.; deWilt, P.; Djannati-Ataï, A.; Domainko, W.; Donath, A.; Drury, L. O.'C.; Dubus, G.; Dutson, K.; Dyks, J.; Dyrda, M.; Edwards, T.; Egberts, K.; Eger, P.; Ernenwein, J.-P.; Espigat, P.; Farnier, C.; Fegan, S.; Feinstein, F.; Fernandes, M. V.; Fernandez, D.; Fiasson, A.; Fontaine, G.; Förster, A.; Füßling, M.; Gabici, S.; Gajdus, M.; Gallant, Y. A.; Garrigoux, T.; Giavitto, G.; Giebels, B.; Glicenstein, J. F.; Gottschall, D.; Goyal, A.; Grondin, M.-H.; Grudzińska, M.; Hadasch, D.; Häffner, S.; Hahn, J.; Hawkes, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hervet, O.; Hillert, A.; Hinton, J. A.; Hofmann, W.; Hofverberg, P.; Hoischen, C.; Holler, M.; Horns, D.; Ivascenko, A.; Jacholkowska, A.; Jamrozy, M.; Janiak, M.; Jankowsky, F.; Jung-Richardt, I.; Kastendieck, M. A.; Katarzyński, K.; Katz, U.; Kerszberg, D.; Khélifi, B.; Kieffer, M.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Kolitzus, D.; Komin, Nu.; Kosack, K.; Krakau, S.; Krayzel, F.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lau, J.; Lefaucheur, J.; Lefranc, V.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Lohse, T.; Lopatin, A.; Lorentz, M.; Lu, C.-C.; Lui, R.; Marandon, V.; Marcowith, A.; Mariaud, C.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; Meintjes, P. J.; Menzler, U.; Meyer, M.; Mitchell, A. M. W.; Moderski, R.; Mohamed, M.; Morå, K.; Moulin, E.; Murach, T.; de Naurois, M.; Niemiec, J.; Oakes, L.; Odaka, H.; Öttl, S.; Ohm, S.; Opitz, B.; Ostrowski, M.; Oya, I.; Panter, M.; Parsons, R. D.; Paz Arribas, M.; Pekeur, N. W.; Pelletier, G.; Petrucci, P.-O.; Peyaud, B.; Pita, S.; Poon, H.; Prokhorov, D.; Prokoph, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Reichardt, I.; Reimer, A.; Reimer, O.; Renaud, M.; de los Reyes, R.; Rieger, F.; Romoli, C.; Rosier-Lees, S.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Salek, D.; Sanchez, D. A.; Santangelo, A.; Sasaki, M.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwemmer, S.; Seyffert, A. S.; Simoni, R.; Sol, H.; Spanier, F.; Spengler, G.; Spies, F.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stinzing, F.; Stycz, K.; Sushch, I.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tluczykont, M.; Trichard, C.; Tuffs, R.; Valerius, K.; van der Walt, J.; van Eldik, C.; van Soelen, B.; Vasileiadis, G.; Veh, J.; Venter, C.; Viana, A.; Vincent, P.; Vink, J.; Voisin, F.; Völk, H. J.; Vuillaume, T.; Wagner, S. J.; Wagner, P.; Wagner, R. M.; Weidinger, M.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Yang, R.; Zabalza, V.; Zaborov, D.; Zacharias, M.; Zdziarski, A. A.; Zech, A.; Zefi, F.; Żywucka, N.

    2018-04-01

    Aim. We aim for an understanding of the morphological and spectral properties of the supernova remnant RCW 86 and for insights into the production mechanism leading to the RCW 86 very high-energy γ-ray emission. Methods: We analyzed High Energy Spectroscopic System (H.E.S.S.) data that had increased sensitivity compared to the observations presented in the RCW 86 H.E.S.S. discovery publication. Studies of the morphological correlation between the 0.5-1 keV X-ray band, the 2-5 keV X-ray band, radio, and γ-ray emissions have been performed as well as broadband modeling of the spectral energy distribution with two different emission models. Results: We present the first conclusive evidence that the TeV γ-ray emission region is shell-like based on our morphological studies. The comparison with 2-5 keV X-ray data reveals a correlation with the 0.4-50 TeV γ-ray emission. The spectrum of RCW 86 is best described by a power law with an exponential cutoff at Ecut = (3.5 ± 1.2stat) TeV and a spectral index of Γ ≈ 1.6 ± 0.2. A static leptonic one-zone model adequately describes the measured spectral energy distribution of RCW 86, with the resultant total kinetic energy of the electrons above 1 GeV being equivalent to 0.1% of the initial kinetic energy of a Type Ia supernova explosion (1051 erg). When using a hadronic model, a magnetic field of B ≈ 100 μG is needed to represent the measured data. Although this is comparable to formerly published estimates, a standard E-2 spectrum for the proton distribution cannot describe the γ-ray data. Instead, a spectral index of Γp ≈ 1.7 would be required, which implies that ˜7 × 1049/ncm-3 has been transferred into high-energy protons with the effective density ncm-3 = n/1 cm-3. This is about 10% of the kinetic energy of a typical Type Ia supernova under the assumption of a density of 1 cm-3.

  11. Microwave absorption properties of the core/shell-type iron and nickel nanoparticles

    International Nuclear Information System (INIS)

    Lu, B.; Dong, X.L.; Huang, H.; Zhang, X.F.; Zhu, X.G.; Lei, J.P.; Sun, J.P.

    2008-01-01

    Iron (Fe) and nickel (Ni) nanoparticles were prepared by the DC arc-discharge method in a mixture of hydrogen and argon gases, using bulk metals as the raw materials. The microstructure of core/shell (metal/metal oxide) in nanoparticle formed after in situ passivation process. The complex electromagnetic parameters (permittivity ε r =ε r ' +iε r '' and permeability μ r =μ r ' +iμ r '' ) of the paraffin-mixed nanocomposite samples (paraffin:nanoparticles=1:1 in mass ratio) were measured in the frequency range of 2-18 GHz. The polarization mechanisms of the space charge and dipole coexist in both the Fe and Ni nanoparticles. The orientational polarization is a particular polarization for Fe nanoparticles and brings a relatively higher dielectric loss. Natural resonance is the main reason for magnetic loss and the corresponding frequencies are 11.6 and 5.2 GHz for the Fe and Ni nanoparticles, respectively. The paraffin composite with Fe nanoparticles provided excellent microwave absorption properties (reflection loss <-20 dB) in the range 6.8-16.6 GHz over the absorber thickness of 1.1-2.3 mm

  12. Plasmonic Nanodiamonds – Targeted Core-shell Type Nanoparticles for Cancer Cell Thermoablation

    Science.gov (United States)

    Rehor, Ivan; Lee, Karin L.; Chen, Kevin; Hajek, Miroslav; Havlik, Jan; Lokajova, Jana; Masat, Milan; Slegerova, Jitka; Shukla, Sourabh; Heidari, Hamed; Bals, Sara

    2015-01-01

    Targeted biocompatible nanostructures with controlled plasmonic and morphological parameters are promising materials for cancer treatment based on selective thermal ablation of cells. Here, core-shell plasmonic nanodiamonds consisting of a silica-encapsulated diamond nanocrystal coated in a gold shell is designed and synthesized. The architecture of particles is analyzed and confirmed in detail using 3-dimensional transmission electron microscope tomography. The particles are biocompatibilized using a PEG polymer terminated with bioorthogonally reactive alkyne groups. Azide-modified transferrin is attached to these particles, and their high colloidal stability and successful targeting to cancer cells overexpressing the transferrin receptor is demonstrated. The particles are nontoxic to the cells and they are readily internalized upon binding to the transferrin receptor. The high plasmonic cross section of the particles in the near-infrared region is utilized to quantitatively ablate the cancer cells with a short, one-minute irradiation by a pulse 750-nm laser. PMID:25336437

  13. Plasmonic nanodiamonds: targeted core-shell type nanoparticles for cancer cell thermoablation.

    Science.gov (United States)

    Rehor, Ivan; Lee, Karin L; Chen, Kevin; Hajek, Miroslav; Havlik, Jan; Lokajova, Jana; Masat, Milan; Slegerova, Jitka; Shukla, Sourabh; Heidari, Hamed; Bals, Sara; Steinmetz, Nicole F; Cigler, Petr

    2015-02-18

    Targeted biocompatible nanostructures with controlled plasmonic and morphological parameters are promising materials for cancer treatment based on selective thermal ablation of cells. Here, core-shell plasmonic nanodiamonds consisting of a silica-encapsulated diamond nanocrystal coated in a gold shell are designed and synthesized. The architecture of particles is analyzed and confirmed in detail using electron tomography. The particles are biocompatibilized using a PEG polymer terminated with bioorthogonally reactive alkyne groups. Azide-modified transferrin is attached to these particles, and their high colloidal stability and successful targeting to cancer cells overexpressing the transferrin receptor are demonstrated. The particles are nontoxic to the cells and they are readily internalized upon binding to the transferrin receptor. The high plasmonic cross section of the particles in the near-infrared region is utilized to quantitatively ablate the cancer cells with a short, one-minute irradiation by a pulse 750-nm laser. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  14. Plasmonic Nanodiamonds: Targeted Core-Shell Type Nanoparticles for Cancer Cell Thermoablation

    Czech Academy of Sciences Publication Activity Database

    Řehoř, Ivan; Lee, K. L.; Chen, K.; Hájek, Miroslav; Havlík, Jan; Lokajová, Jana; Mašát, Milan; Šlegerová, Jitka; Shukla, S.; Heidari, H.; Bals, S.; Steinmetz, N. F.; Cígler, Petr

    2015-01-01

    Roč. 4, č. 3 (2015), s. 460-468 ISSN 2192-2640 R&D Projects: GA ČR GAP108/12/0640; GA MŠk(CZ) LH11027; GA MŠk LO1302 Grant - others:OPPC(CZ) CZ.2.16/3.1.00/24016 Institutional support: RVO:61388963 Keywords : nanodiamonds * plasmonics * gold * cancer * ablation Subject RIV: CC - Organic Chemistry Impact factor: 5.760, year: 2015

  15. Microwave absorption properties of the core/shell-type iron and nickel nanoparticles

    Science.gov (United States)

    Lu, B.; Dong, X. L.; Huang, H.; Zhang, X. F.; Zhu, X. G.; Lei, J. P.; Sun, J. P.

    Iron (Fe) and nickel (Ni) nanoparticles were prepared by the DC arc-discharge method in a mixture of hydrogen and argon gases, using bulk metals as the raw materials. The microstructure of core/shell (metal/metal oxide) in nanoparticle formed after in situ passivation process. The complex electromagnetic parameters (permittivity ɛ=ɛr'+iɛr″ and permeability μ=μr'+iμr″) of the paraffin-mixed nanocomposite samples (paraffin:nanoparticles=1:1 in mass ratio) were measured in the frequency range of 2-18 GHz. The polarization mechanisms of the space charge and dipole coexist in both the Fe and Ni nanoparticles. The orientational polarization is a particular polarization for Fe nanoparticles and brings a relatively higher dielectric loss. Natural resonance is the main reason for magnetic loss and the corresponding frequencies are 11.6 and 5.2 GHz for the Fe and Ni nanoparticles, respectively. The paraffin composite with Fe nanoparticles provided excellent microwave absorption properties (reflection loss <-20 dB) in the range 6.8-16.6 GHz over the absorber thickness of 1.1-2.3 mm.

  16. Preparation of Cotton-Wool-Like Poly(lactic acid-Based Composites Consisting of Core-Shell-Type Fibers

    Directory of Open Access Journals (Sweden)

    Jian Wang

    2015-11-01

    Full Text Available In previous works, we reported the fabrication of cotton-wool-like composites consisting of siloxane-doped vaterite and poly(l-lactic acid (SiVPCs. Various irregularly shaped bone voids can be filled with the composite, which effectively supplies calcium and silicate ions, enhancing the bone formation by stimulating the cells. The composites, however, were brittle and showed an initial burst release of ions. In the present work, to improve the mechanical flexibility and ion release, the composite fiber was coated with a soft, thin layer consisting of poly(d,l-lactic-co-glycolic acid (PLGA. A coaxial electrospinning technique was used to prepare a cotton-wool-like material comprising “core-shell”-type fibers with a diameter of ~12 µm. The fibers, which consisted of SiVPC coated with a ~2-µm-thick PLGA layer, were mechanically flexible; even under a uniaxial compressive load of 1.5 kPa, the cotton-wool-like material did not exhibit fracture of the fibers and, after removing the load, showed a ~60% recovery. In Tris buffer solution, the initial burst release of calcium and silicate ions from the “core-shell”-type fibers was effectively controlled, and the ions were slowly released after one day. Thus, the mechanical flexibility and ion-release behavior of the composites were drastically improved by the thin PLGA coating.

  17. Self-Assembled Core-Shell-Type Lipid-Polymer Hybrid Nanoparticles: Intracellular Trafficking and Relevance for Oral Absorption.

    Science.gov (United States)

    Li, Qiuxia; Xia, Dengning; Tao, Jinsong; Shen, Aijun; He, Yuan; Gan, Yong; Wang, Chi

    2017-10-01

    Lipid-polymer hybrid nanoparticles (NPs) are advantageous for drug delivery. However, their intracellular trafficking mechanism and relevance for oral drug absorption are poorly understood. In this study, self-assembled core-shell lipid-polymer hybrid NPs made of poly(lactic-co-glycolic acid) (PLGA) and various lipids were developed to study their differing intracellular trafficking in intestinal epithelial cells and their relevance for oral absorption of a model drug saquinavir (SQV). Our results demonstrated that the endocytosis and exocytosis of hybrid NPs could be changed by varying the kind of lipid. A glyceride mixture (hybrid NPs-1) decreased endocytosis but increased exocytosis in Caco-2 cells, whereas the phospholipid (E200) (hybrid NPs-2) decreased endocytosis but exocytosis was unaffected as compared with PLGA nanoparticles. The transport of hybrid NPs-1 in cells involved various pathways, including caveolae/lipid raft-dependent endocytosis, and clathrin-mediated endocytosis and macropinocytosis, which was different from the other groups of NPs that involved only caveolae/lipid raft-dependent endocytosis. Compared with that of the reference formulation (nanoemulsion), the oral absorption of SQV-loaded hybrid NPs in rats was poor, probably due to the limited drug release and transcytosis of NPs across the intestinal epithelium. In conclusion, the intracellular processing of hybrid NPs in intestinal epithelia can be altered by adding lipids to the NP. However, it appears unfavorable to use PLGA-based NPs to improve oral absorption of SQV compared with nanoemulsion. Our findings will be essential in the development of polymer-based NPs for the oral delivery of drugs with the purpose of improving their oral absorption. Copyright © 2017 American Pharmacists Association®. Published by Elsevier Inc. All rights reserved.

  18. Rare, threatened and relict species in flora of SNR Zasavica

    Directory of Open Access Journals (Sweden)

    Stanković, M.

    2011-09-01

    Full Text Available In group of biodiversity important plant species there are 23 taxa. 20 taxa are mentioned in „Preliminary Red List of flora of Serbia and Montenegro with IUCN 2001 Conservation Statuses“ in following categories: two as critically endangered (Aldrovanda vesiculosa L. and Hottonia palustris L., four as endangered (Hippuris vulgaris L., Lindernia palustris Hartm., Ranunculus lingua L. and Urtica kioviensis Rogow., five as vulnerable (Achillea aspleniifolia Vent., Dryopteris carthusiana (Vill. H. P. Fuchs, Leucojum aestivum L. subsp. aestivum, Stratiotes aloides L. and Thelypteris palustris (Schott subsp.palustris, while 9 are with indefinite categories (CR-VU, due to data deficient (DD. Special Nature Reserve „Zasavica“ is the only habitat in Serbia for Aldrovanda vesiculosa L., which was until 2005. considered as extinct from Serbia.

  19. SNR polarization and the direction of the magnetic field

    International Nuclear Information System (INIS)

    Milne, D.K.

    1988-01-01

    The authors are currently engaged in a program to map polarization in SNRs at 8.4 GHz. These results are compared with earlier Parkes 5 GHz maps to deduce the direction of magnetic field, Faraday rotation and depolarization

  20. Reactor transients tests for SNR fuel elements in HFR reactor

    International Nuclear Information System (INIS)

    Plitz, H.

    1989-01-01

    In HFR reactor, fuel pins of LMFBR reactors are putted in irradiation specimen capsules cooled with sodium for reactor transients tests. These irradiation capsules are instrumented and the experiences realized until this day give results on: - Fuel pins subjected at a continual variation of power - melting fuel - axial differential elongation of fuel pins

  1. A Correlating Receiver for OFDM at Low SNR

    NARCIS (Netherlands)

    Kokkeler, Andre B.J.; Smit, Gerardus Johannes Maria

    By extending OFDM symbols, acceptable BER performance can be achieved at low SNRs. Two alternative differential receiver architectures are presented, a receiver based on a FX correlator (Fourier transformation before correlation) and based on an XF correlator (correlation before Fourier

  2. Carrier tracking by smoothing filter can improve symbol SNR

    Science.gov (United States)

    Hurd, W. J.; Pomalaza-Raez, C. A.

    1985-01-01

    The potential benefit of using a smoothing filter to estimate carrier phase over use of phase locked loops (PLL) is determined. Numerical results are presented for the performance of three possible configurations of the deep space network advanced receiver. These are residual carrier PLL, sideband aided residual carrier PLL, and finally sideband aiding with a Kalman smoother. The average symbol signal to noise ratio (CNR) after losses due to carrier phase estimation error is computed for different total power SNRs, symbol rates and symbol SNRs. It is found that smoothing is most beneficial for low symbol SNRs and low symbol rates. Smoothing gains up to 0.4 dB over a sideband aided residual carrier PLL, and the combined benefit of smoothing and sideband aiding relative to a residual carrier loop is often in excess of 1 dB.

  3. Weighted-SNR-based fair scheduling for uplink OFDMA

    KAUST Repository

    Ma, Yao; Leith, Alex; Alouini, Mohamed-Slim; (Sherman) Shen X., Xuemin

    2009-01-01

    rates for different users. The offline optimization technique requires to know the channel distribution information (CDI) at the scheduler. The online method uses the weight adaption combined with individual user rate tracking, which avoids the need

  4. Acceleration of cosmic rays in SNR shock waves

    International Nuclear Information System (INIS)

    Drury, L.O'C.; Markiewicz, W.J.; Voelk, H.J.

    1988-01-01

    The time dependence of the energy density of cosmic rays accelerated in the outer shock of a supernova is studied in simple nonlinear models. The solutions are classified in their dependence on the parameters of the system. (orig.)

  5. Dr. Andries Albertus Odendaal snr., evangeliedraer in 'n multi ...

    African Journals Online (AJOL)

    The PDF file you selected should load here if your Web browser has a PDF reader plug-in installed (for example, a recent version of Adobe Acrobat Reader). If you would like more information about how to print, save, and work with PDFs, Highwire Press provides a helpful Frequently Asked Questions about PDFs.

  6. Light curve analysis of the late type binary V523 Cassiopeiae

    Directory of Open Access Journals (Sweden)

    Latković O.

    2009-01-01

    Full Text Available We present the analysis of V and R light curves of the late type contact binary V523 Cas for the season of 2006. These observations make part of the monitoring program aimed at studying the long-term light curve variability in this system. Our results confirm that the system is in an over contact configuration, and include a bright spot in the neck region of the cooler and larger primary. We compare these results with the previous solution, obtained for the season 2005 dataset and discuss the differences.

  7. X-ray observation of the shocked red supergiant wind of Cassiopeia A

    International Nuclear Information System (INIS)

    Lee, Jae-Joon; Park, Sangwook; Hughes, John P.; Slane, Patrick O.

    2014-01-01

    Cas A is a Galactic supernova remnant whose supernova explosion is observed to be of Type IIb from spectroscopy of its light echo. Having its SN type known, observational constraints on the mass-loss history of Cas A's progenitor can provide crucial information on the final fate of massive stars. In this paper, we study X-ray characteristics of the shocked ambient gas in Cas A using the 1 Ms observation carried out with the Chandra X-Ray Observatory and try to constrain the mass-loss history of the progenitor star. We identify thermal emission from the shocked ambient gas along the outer boundary of the remnant. Comparison of measured radial variations of spectroscopic parameters of the shocked ambient gas to the self-similar solutions of Chevalier show that Cas A is expanding into a circumstellar wind rather than into a uniform medium. We estimate a wind density n H ∼ 0.9 ± 0.3 cm –3 at the current outer radius of the remnant (∼3 pc), which we interpret as a dense slow wind from a red supergiant (RSG) star. Our results suggest that the progenitor star of Cas A had an initial mass around 16 M ☉ , and its mass before the explosion was about 5 M ☉ , with uncertainties of several tens of percent. Furthermore, the results suggest that, among the mass lost from the progenitor star (∼11 M ☉ ), a significant amount (more than 6 M ☉ ) could have been via its RSG wind.

  8. Preliminary study of light variations of the eclipsing binary AB Cassiopeiae

    International Nuclear Information System (INIS)

    Ando, H.; Manchester Univ.

    1980-01-01

    Preliminary study of the eclipsing binary AB Cas is presented here by using the photometric observational data. The primary component is one of the delta Sct variables with period of 0.sup(d)054, and whether the oscillation is of a radial mode or of a non-radial one is discussed. Two colour indices (B - V and U - B) data and the light curve analysis suggest that this binary system is a typical Algol type binary system, in which the primary component is near the ZAMS with about 2.3 Msub(sun) and the secondary one is a subgiant star with about 0.5 Msub(sun). (orig.)

  9. Cosmic-ray acceleration and the radio evolution of Cassiopeia A

    International Nuclear Information System (INIS)

    Chevalier, R.A.; Robertson, J.W.; Scott, J.S.

    1976-01-01

    A more detailed analysis of the Scott and Chevalier model for production of galactic cosmic rays in supernova remnants is presented. Particles are accelerated by second-order Fermi acceleration with turbulent vortices (produced by the motions of the supernova ejecta through the remnant) acting as moving scattering centers. The time-dependent equation of continuity in particle energy space is solved numerically. The results of the calculations are in substantial agreement with all time-dependent observations of the radio emission from Cas A. This mechanism implies an dependent solution yields a cosmic ray spectrum with the same slope as galactic cosmic rays. The results of our calculations and new work on γ-rays by, e.g., Stecker and by Lingenfelter and Higdon and cosmic ray composition by, e.g., Hainebach, Norman, and Schramm support our hypothesis that galactic cosmic rays are produced in supernova remnants by the mechanism proposed by Scott and Chevalier

  10. The collision of a strong shock with a gas cloud: a model for Cassiopeia A

    International Nuclear Information System (INIS)

    Sgro, A.G.

    1975-01-01

    The result of the collision of the shock with the cloud is a shock traveling around the cloud, a shock transmitted into the cloud, and a shock reflected from the cloud. By equating the cooling time of the posttransmitted shock gas to the time required for the transmitted shock to travel the length of the cloud, a critical cloud density n/subc/ /sup prime/ is defined. For clouds with density greater than n/subc/ /sup prime/, the posttransmitted shock gas cools rapidly and then emits the lines of the lower ionization stages of its constituent elements. The structure of such and its expected appearance to an observer are discussed and compared with the quasi-stationary condensations of Cas A. Conversely, clouds with density less than n/subc//sup prime/ remain hot for several thousand years, and are sources of X-radiation whose temperatures are much less than that of the intercloud gas. After the transmitted shock passes, the cloud pressure is greater than the pressure in the surrounding gas, causing the cloud to expand and the emission to decrease from its value just after the collision. A model in which the soft X-radiation of Cas A is due to a collection of such clouds is discussed. The faint emission patches to the north of Cas A are interpreted as preshocked clouds which will probably become quasi-stationary condensations after being hit by the shock

  11. 1980 outburst of 4U 0115+63 (V635 Cassiopeiae)

    International Nuclear Information System (INIS)

    Kriss, G.A.; Cominsky, L.R.; Remillard, R.A.; Williams, G.; Thorstensen, J.R.

    1983-01-01

    Optical observations of the proposed Be companion star (V635 Cas) to the hard transient X-ray pulsar 4U 0115+63 have been used to predict the 1980 December X-ray outburst, thus confirming the identification. V635 Cas increased in brightness by 1.7 magnitudes over the three months preceding the X-ray outburst, and strong, variable Hα emission was always present. These results demonstrate for the first time that increased optical activity in the Be companion star can lead directly to a ''hard'' transient X-ray outburst. There is a delay of approx.60 days between the onset of optical activity and the X-ray outburst. This delay and the absence of orbital modulation of the 1980 X-ray outburst (or any of the previous X-ray outburst) rule out direct accretion from a stellar wind. We suggest that the delay represents the time for material near the X-ray source to form an accretion disk and move inward toward the neutron star surface, and we discuss the observational implications of this interpretation. Future observations of similar transient events may provide a firm basis for the study of accretion disk dynamics

  12. Low-frequency excited-carbon radio lines toward Cassiopeia A

    International Nuclear Information System (INIS)

    Ershov, A.A.; Lekht, E.E.; Rudnitskii, G.M.; Sorochenko, R.L.

    1982-01-01

    A search for the C400α radio line in the direction of Cas A indicates that it is absent: in terms of antenna temperature the upper limit T/sub L//T/sub C/ -3 . Comparison of this negative result against successful measurements of the C630α, C63lα, C640α yields parameters for the C II region formed by a hypothetical B star. Nonthermal radio emission is the fundamental factor restricting galactic recombination radio lines to quantum numbers n< or approx. =900

  13. Radio and X-ray emission from supernova remnants

    International Nuclear Information System (INIS)

    Asvarova, A.I.; Novruzova, H.I.; Ahmedova, S.I.

    2010-01-01

    In this paper it was studied the statistical correlation between radio and X-ray emissions from shell-type supernova remnants (SNR). The primary aim of this study is to test the model of radio emission of shell-type SNRs presented by one of the authors. Based on this model of radio emission, by using the Monte Carlo techniques we have simulated statistical relations radio - X-ray luminosities (not surface brightnesses) which then were compared with the observations. X-ray emission is assumed to be thermal. To have a uniform statistical material it was used observational data on the SNRs in Magellanic Clouds

  14. The recovery of gold from the aqua regia leachate of electronic parts using a core–shell type anion exchange resin

    Directory of Open Access Journals (Sweden)

    P. Cyganowski

    2017-09-01

    The investigated resins revealed great selectivity towards gold. Despite the fact that the obtained solutions contained only 1.5% (CPU or 0.1% (PIN of Au, its removal reached 86% and the logarithms of partition coefficients indicate that affinity of the applied resins to gold is almost ten times greater than the very competitive nickel present in the obtained solutions. Finally, the gold-containing core–shell polymers were effectively eluted, recovering 100% of the taken from the solutions gold.

  15. THE COOLING OF THE CASSIOPEIA A NEUTRON STAR AS A PROBE OF THE NUCLEAR SYMMETRY ENERGY AND NUCLEAR PASTA

    Energy Technology Data Exchange (ETDEWEB)

    Newton, William G.; Hooker, Joshua; Li, Bao-An [Department of Physics and Astronomy, Texas A and M University-Commerce, Commerce, TX 75429-3011 (United States); Murphy, Kyleah [Umpqua Community College, Roseburg, OR 97470 (United States)

    2013-12-10

    X-ray observations of the neutron star (NS) in the Cas A supernova remnant over the past decade suggest the star is undergoing a rapid drop in surface temperature of ≈2%-5.5%. One explanation suggests the rapid cooling is triggered by the onset of neutron superfluidity in the core of the star, causing enhanced neutrino emission from neutron Cooper pair breaking and formation (PBF). Using consistent NS crust and core equations of state (EOSs) and compositions, we explore the sensitivity of this interpretation to the density dependence of the symmetry energy L of the EOS used, and to the presence of enhanced neutrino cooling in the bubble phases of crustal ''nuclear pasta''. Modeling cooling over a conservative range of NS masses and envelope compositions, we find L ≲ 70 MeV, competitive with terrestrial experimental constraints and other astrophysical observations. For masses near the most likely mass of M ≳ 1.65 M {sub ☉}, the constraint becomes more restrictive 35 ≲ L ≲ 55 MeV. The inclusion of the bubble cooling processes decreases the cooling rate of the star during the PBF phase, matching the observed rate only when L ≲ 45 MeV, taking all masses into consideration, corresponding to NS radii ≲ 11 km.

  16. Properties and nature of Be stars 29. Orbital and long-term spectral variations of gamma Cassiopeiae

    Czech Academy of Sciences Publication Activity Database

    Nemravová, J.; Harmanec, P.; Koubský, Pavel; Miroshnichenko, A. S.; Yang, S.; Šlechta, Miroslav; Buil, C.; Korčáková, D.; Votruba, Viktor

    2012-01-01

    Roč. 537, January (2012), A59/1-A59/11 ISSN 0004-6361 R&D Projects: GA ČR GD205/08/H005 Grant - others:ESA(XE) ESA- PECS project No. 98058 Institutional research plan: CEZ:AV0Z10030501 Keywords : spectroscopic * early-type stars * Be stars Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 5.084, year: 2012

  17. New selection effect of statistical investigations of supernova remnants

    International Nuclear Information System (INIS)

    Allakhverdiev, A.O.; Gusejnov, O.Kh.; Kasumov, F.K.

    1986-01-01

    The influence of H2 regions on the parameters of Supernova remnants (SNR) is investigated. It has been shown that the projection of such regions on the SNRs leads to local changes of morphological structure of young shell-type SNRs and considerable distortions of integral parameters of evolved shell-type SNRs (with D > 10 pc) and plerions, up to their complete undetectability on the background of classical and gigantic H2 regions. A new selection effect, in fact, arises from these factors connected with additional limitations made by the real structure of the interstellar medium on the statistical investigations of SNRs. The influence of this effect on the statistical completeness of objects has been estimated

  18. New selection effect in statistical investigations of supernova remnants

    Science.gov (United States)

    Allakhverdiev, A. O.; Guseinov, O. Kh.; Kasumov, F. K.

    1986-01-01

    The influence of H II regions on the parameters of supernova remnants (SNR) is investigated. It has been shown that the projection of such regions on the SNRs leads to: a) local changes of morphological structure of young shell-type SNRs and b) considerable distortions of integral parameters of evolved shell-type SNRs (with D > 10 pc) and plerions, up to their complete undetectability on the background of classical and gigantic H II regions. A new selection effect, in fact, arises from these factors connected with additional limitations made by the real structure of the interstellar medium on the statistical investigations of SNRs. The influence of this effect on the statistical completeness of objects has been estimated.

  19. High-SNR spectrum measurement based on Hadamard encoding and sparse reconstruction

    Science.gov (United States)

    Wang, Zhaoxin; Yue, Jiang; Han, Jing; Li, Long; Jin, Yong; Gao, Yuan; Li, Baoming

    2017-12-01

    The denoising capabilities of the H-matrix and cyclic S-matrix based on the sparse reconstruction, employed in the Pixel of Focal Plane Coded Visible Spectrometer for spectrum measurement are investigated, where the spectrum is sparse in a known basis. In the measurement process, the digital micromirror device plays an important role, which implements the Hadamard coding. In contrast with Hadamard transform spectrometry, based on the shift invariability, this spectrometer may have the advantage of a high efficiency. Simulations and experiments show that the nonlinear solution with a sparse reconstruction has a better signal-to-noise ratio than the linear solution and the H-matrix outperforms the cyclic S-matrix whether the reconstruction method is nonlinear or linear.

  20. High SNR BER comparison of coherent and differentially coherent modulation schemes in lognormal fading channels

    KAUST Repository

    Song, Xuegui; Cheng, Julian; Alouini, Mohamed-Slim

    2014-01-01

    Using an auxiliary random variable technique, we prove that binary differential phase-shift keying and binary phase-shift keying have the same asymptotic bit-error rate performance in lognormal fading channels. We also show that differential quaternary phase-shift keying is exactly 2.32 dB worse than quaternary phase-shift keying over the lognormal fading channels in high signal-to-noise ratio regimes.

  1. On the capacity of Rician fading channels with full channel state information at low SNR

    KAUST Repository

    Rezki, Zouheir; Alouini, Mohamed-Slim

    2012-01-01

    or noisy CSI at the transmitter and perfect CSI at the receiver. We also show that one-bit CSI at the transmitter is enough to achieve this asymptotic capacity using an On-Off power control scheme. Our framework may be seen as a generalization of previous

  2. Low-SNR Capacity of Parallel IM-DD Optical Wireless Channels

    KAUST Repository

    Chaaban, Anas; Rezki, Zouheir; Alouini, Mohamed-Slim

    2016-01-01

    The capacity of parallel intensity-modulation and direct-detection (IM-DD) optical wireless channels with total average intensity and per-channel peak intensity constraints is studied. The optimal intensity allocation at low signal-to-noise ratio

  3. Inherently safe SNR shutdown system with Curie point controlled sensor/switch unit

    International Nuclear Information System (INIS)

    Mueller, K.; Norajitra, P.; Reiser, H.

    1987-02-01

    Inherent shutdown due to increase in the sodium temperature at the core outlet is triggered by interruption of the current supply to the electromagnet coupling of absorber elements via curie point controlled sensor/switch units. These switches are arranged above suitable fuel element positions and spatially independent of the shutdown elements. Compared with other similar systems very short response times are achieved. A prototype switch unit has already undergone extensive testing. These tests have confirmed that switching takes place in a very narrow temperature range. (orig./HP) [de

  4. SNR enhancement for downhole microseismic data based on scale classification shearlet transform

    Science.gov (United States)

    Li, Juan; Ji, Shuo; Li, Yue; Qian, Zhihong; Lu, Weili

    2018-06-01

    Shearlet transform (ST) can be effective in 2D signal processing, due to its parabolic scaling, high directional sensitivity, and optimal sparsity. ST combined with thresholding has been successfully applied to suppress random noise. However, because of the low magnitude and high frequency of a downhole microseismic signal, the coefficient values of valid signals and noise are similar in the shearlet domain. As a result, it is difficult to use for denoising. In this paper, we present a scale classification ST to solve this problem. The ST is used to decompose noisy microseismic data into serval scales. By analyzing the spectrum and energy distribution of the shearlet coefficients of microseismic data, we divide the scales into two types: low-frequency scales which contain less useful signal and high-frequency scales which contain more useful signal. After classification, we use two different methods to deal with the coefficients on different scales. For the low-frequency scales, the noise is attenuated using a thresholding method. As for the high-frequency scales, we propose to use a generalized Gauss distribution model based a non-local means filter, which takes advantage of the temporal and spatial similarity of microseismic data. The experimental results on both synthetic records and field data illustrate that our proposed method preserves the useful components and attenuates the noise well.

  5. Tests of the SNR fuel pin behaviour in case of operational transients in the HFR Petten

    International Nuclear Information System (INIS)

    Plitz, H.

    1989-05-01

    The loadings on fast reactor fuel pins under operational transients (power and temperature increases in the design area) have been studied in the High-Flux-Reactor HFR in Petten with sodium cooled irradiation capsules. The results of the first campaign of transient experiments are described in the report. No cladding defects have been observed, and the fuel pins of the Mark-I and Mark-II type resisted to linear power levels of more than 800 W/cm, thus demonstrating the required design margins. The plans for further experiments are outlined

  6. Channel Estimation for Filter Bank Multicarrier Systems in Low SNR Environments

    Energy Technology Data Exchange (ETDEWEB)

    Driggs, Jonathan; Sibbett, Taylor; Moradiy, Hussein; Farhang-Boroujeny, Behrouz

    2017-05-01

    Channel estimation techniques are crucial for reliable communications. This paper is concerned with channel estimation in a filter bank multicarrier spread spectrum (FBMCSS) system. We explore two channel estimator options: (i) a method that makes use of a periodic preamble and mimics the channel estimation techniques that are widely used in OFDM-based systems; and (ii) a method that stays within the traditional realm of filter bank signal processing. For the case where the channel noise is white, both methods are analyzed in detail and their performance is compared against their respective Cramer-Rao Lower Bounds (CRLB). Advantages and disadvantages of the two methods under different channel conditions are given to provide insight to the reader as to when one will outperform the other.

  7. A Massive Shell of Supernova-formed Dust in SNR G54.1+0.3

    Energy Technology Data Exchange (ETDEWEB)

    Temim, Tea [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); Dwek, Eli; Arendt, Richard G. [Observational Cosmology Lab, Code 665, NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Borkowski, Kazimierz J.; Reynolds, Stephen P. [North Carolina State University, Raleigh, NC 27695 (United States); Slane, Patrick; Raymond, John C. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Gelfand, Joseph D. [New York University, Abu Dhabi (United Arab Emirates)

    2017-02-10

    While theoretical models of dust condensation predict that most refractory elements produced in core-collapse supernovae (SNe) efficiently condense into dust, a large quantity of dust has so far only been observed in SN 1987A. We present an analysis of observations from the Spitzer Space Telescope , Herschel Space Observatory , Stratospheric Observatory for Infrared Astronomy, and AKARI of the infrared shell surrounding the pulsar wind nebula in the supernova remnant G54.1+0.3. We attribute a distinctive spectral feature at 21 μ m to a magnesium silicate grain species that has been invoked in modeling the ejecta-condensed dust in Cas A, which exhibits the same spectral signature. If this species is responsible for producing the observed spectral feature and accounts for a significant fraction of the observed infrared continuum, we find that it would be the dominant constituent of the dust in G54.1+0.3, with possible secondary contributions from other compositions, such as carbon, silicate, or alumina grains. The total mass of SN-formed dust required by this model is at least 0.3 M {sub ⊙}. We discuss how these results may be affected by varying dust grain properties and self-consistent grain heating models. The spatial distribution of the dust mass and temperature in G54.1+0.3 confirms the scenario in which the SN-formed dust has not yet been processed by the SN reverse shock and is being heated by stars belonging to a cluster in which the SN progenitor exploded. The dust mass and composition suggest a progenitor mass of 16–27 M {sub ⊙} and imply a high dust condensation efficiency, similar to that found for Cas A and SN 1987A. The study provides another example of significant dust formation in a Type IIP SN explosion and sheds light on the properties of pristine SN-condensed dust.

  8. Blind sequence-length estimation of low-SNR cyclostationary sequences

    CSIR Research Space (South Africa)

    Vlok, JD

    2014-06-01

    Full Text Available Several existing direct-sequence spread spectrum (DSSS) detection and estimation algorithms assume prior knowledge of the symbol period or sequence length, although very few sequence-length estimation techniques are available in the literature...

  9. Revisiting SNR Puppis A with Seven Years of Fermi Large Area Telescope Observations

    Energy Technology Data Exchange (ETDEWEB)

    Xin, Yu-Liang; Guo, Xiao-Lei; Liao, Neng-Hui; Yuan, Qiang; Liu, Si-Ming; Wei, Da-Ming, E-mail: yuanq@pmo.ac.cn, E-mail: liusm@pmo.ac.cn, E-mail: dmwei@pmo.ac.cn [Key laboratory of Dark Matter and Space Astronomy, Purple Mountain Observatory, Chinese Academy of Sciences, Nanjing 210008 (China)

    2017-07-10

    Puppis A is a very famous and extensively studied supernova remnant that shows strong evidence of shock-cloud interaction. We reanalyze its GeV γ -ray emission using seven years of Pass 8 data recorded by the Fermi Large Area Telescope. The morphology of the γ -ray emission is more compatible with that of the thermal X-ray and IR emissions than the radio image, which suggests a possible correlation between the gamma-ray-emitting region and dense clouds. The γ -ray spectrum in the energy range of 1–500 GeV shows a break at 7.92 ± 1.91 GeV, with photon indices of 1.81 ± 0.08 below the break and 2.53 ± 0.12 above the break, which can naturally explain the lack of TeV γ -ray emission from Puppis A. The multi-wavelength observations favor a hadronic origin for the γ -ray emission.

  10. Survey on structural material investigations for the primary circuit of the SNR 300

    International Nuclear Information System (INIS)

    Grosser, E.D.; Lorenz, H.

    1977-01-01

    The material programs described so far cover major Important areas of structural material behavior in the primary system of a sodium cooled reactor. The results demonstrate that a good base is available for the design and safe operation of sodium systems. For complementation purposes some further work is needed in certain areas: creep-fatigue interaction mechanism and description of base material and weld metal behavior for design purposes, irradiation effects in the low-dose range on time-dependent material behavior, impact of heat-to-heat variation on materials properties data, establishment of a profound data base to evaluate sodium impact on mechanical properties, application of the leak-before-break concept in plant design, confirmation of laboratory test results by the operational experience of sodium cooled reactor systems. (author)

  11. Wideband spectrum sensing order for cognitive radios with sensing errors and channel SNR probing uncertainty

    KAUST Repository

    Hamza, Doha R.

    2013-04-01

    A secondary user (SU) seeks to transmit by sequentially sensing statistically independent primary user (PU) channels. If a channel is sensed free, it is probed to estimate the signal-to-noise ratio between the SU transmitter-receiver pair over the channel. We jointly optimize the channel sensing time, the sensing decision threshold, the channel probing time, together with the channel sensing order under imperfect synchronization between the PU and the SU. The sensing and probing times and the decision threshold are assumed to be the same for all channels. We maximize a utility function related to the SU throughput under the constraint that the collision probability with the PU is kept below a certain value and taking sensing errors into account. We illustrate the optimal policy and the variation of SU throughput with various system parameters. © 2012 IEEE.

  12. Ultrasonic attenuation measurements at very high SNR: Correlation, information theory and performance

    International Nuclear Information System (INIS)

    Challis, Richard; Ivchenko, Vladimir; Al-Lashi, Raied

    2013-01-01

    This paper describes a system for ultrasonic wave attenuation measurements which is based on pseudo-random binary codes as transmission signals combined with on-the-fly correlation for received signal detection. The apparatus can receive signals in the nanovolt range against a noise background in the order of hundreds of microvolts and an analogue to digital convertor (ADC) bit-step also in the order of hundreds of microvolts. Very high signal to noise ratios (SNRs) are achieved without recourse to coherent averaging with its associated requirement for high sampling times. The system works by a process of dithering – in which very low amplitude received signals enter the dynamic range of the ADC by 'riding' on electronic noise at the system input. The amplitude of this 'useful noise' has to be chosen with care for an optimised design. The process of optimisation is explained on the basis of classical information theory and is achieved through a simple noise model. The performance of the system is examined for different transmitted code lengths and gain settings in the receiver chain. Experimental results are shown to verify the expected operation when the system is applied to a very highly attenuating material – an aerated slurry

  13. Seismic design principles for the German fast breeder reactor SNR2

    International Nuclear Information System (INIS)

    Rangette, A.M.; Peters, K.A.

    1988-01-01

    The leading aim of a seismic design is, besides protection against seismic impacts, not to enhance the overall risk in the absence of seismic vibrations and, secondly, to avoid competition between operational needs and a seismic structural design. This approach is supported by avoiding overconservatism in the assumption of seismic loads and in the calculation of the structural response. Accordingly the seismic principles are stated as follows: restriction to German or equivalent low seismicity sites with intensities (SSE) lower VIII at frequency lower than 10 -4 /year; best estimate of seismic input-data without further conservatism; no consideration of OBE. The structural design principles are: 1. The secondary character of the seismic excitation is explicitly accounted for; 2. Energy absorption is allowed for by ductility of materials and construction. Accordingly strain criteria are used for failure predictions instead of stress criteria. (author). 1 fig

  14. A Comparison of BLISS and PLD on Low-SNR WASP-29b Spitzer Observations

    Science.gov (United States)

    Challener, Ryan; Harrington, Joseph; Cubillos, Patricio E.; Blecic, Jasmina; Deming, Drake; Hellier, Coel

    2018-01-01

    We present an analysis of Spitzer secondary eclipse observations of exoplanet WASP-29b. WASP-29b is a Saturn-sized, short-period exoplanet with mass 0.24 ± 0.02 Jupiter masses and radius 0.84 ± 0.06 Jupiter radii (Hellier et al., 2010). We measure eclipse depths and midpoints using our Photometry for Orbits, Eclipses, and Transits (POET) code, which does photometry and light-curve modeling with a BiLinearly Interpolated Subpixel Sensitivity (BLISS) map, and our Zen Eliminates Noise (ZEN) code, which takes POET photometry and applies Pixel-Level Decorrelation (PLD). BLISS creates a physical map of pixel gain variations, and is thereby independent of any astrophysical effects. PLD takes a mathematical approach, using relative variations in pixel values near the target to eliminate position-correlated noise. The results are consistent between the methods, except in one outlier observation where neither model could effectively remove correlated noise in the light curve. Using the eclipse timings, along with previous transit observations and radial velocity data, we further refine the orbit of WASP-29b, and, when excluding the outlier, determine an eccentricity between 0.037 and 0.056. We performed atmospheric retrieval with our Bayesian Atmospheric Radiative Transfer (BART) code but find that, when the outlier is discarded, the planet is consistent with a blackbody, and molecular abundances cannot be constrained. This work is based on observations made with the Spitzer Space Telescope, which is operated by the Jet Propulsion Laboratory, California Institute of Technology under a contract with NASA. This work was supported by NASA Planetary Atmospheres grant NNX12AI69G and NASA Astrophysics Data Analysis Program grant NNX13AF38G.

  15. Experimental investigation of flow dynamics in the SNR-upper-core structure

    International Nuclear Information System (INIS)

    Meyer, L.

    1985-03-01

    This report describes the results of a simulant-material experimental investigation of flow dynamics in the upper-core (UCS) during a HCDA of a LMFBR. The experiments were designed to verify some of the thermal-hydraulic models in SIMMER-II. Four different liquids were used to simulate the flashing U0 2 ; and numerous parameter variations were made regarding initial pressure, temperature, and configurations of the test apparatus. The experiments showed the large effect of the heat transfer in the UCS and the relatively small effect of friction. The reduction in final kinetic energy by the presence of the UCS is shown as a function of the initial pressure and the temperature difference between core and UCS. Calculations with SIMMER-II for the wide range of experiments produced results for the kinetic energy within a factor of 2 of the experimental results without changing the crucial input parameters. The minimum droplet size during the flashing process and the structure-side heat transfer coefficient were determined to be the crucial and most sensitive parameters. This reflects deficiencies in modeling of both the flashing process and the transient heat conduction in the structure. (orig./HP) [de

  16. Interaction between the SNR Sagittarius A East and the 50-km s-1 Molecular Cloud

    International Nuclear Information System (INIS)

    Tsuboi, Masato; Okumura, Sachiko K; Miyazaki, Atsushi

    2006-01-01

    We performed high-resolution observations of the Galactic Center 50-km s -1 molecular cloud in the CS J = 1 - 0 line using the Nobeyama Millimeter Array. The 50-km s -1 molecular cloud corresponds to a break in the Sagittarius (Sgr) A east shell. A very broad and negative velocity wing feature is detected at an apparent contact spot between the molecular cloud and the Sgr A east shell. The velocity width of the wing feature is over 50-km s -1 . The width is three times wider than those of typical Galactic Center clouds. This strongly suggests that the shell is interacting physically with the molecular cloud. The asymmetric velocity profile of the wing feature indicates that the Sgr A east shell expands and crashes into the far side of the molecular cloud. About 50 clumps are identified in the cloud using CLUMPFIND. The velocity width-size relation and the mass spectrum of clumps in the cloud are similar to those in Central Molecular Zone (CMZ)

  17. Analysis of the SNR and sensing ability of different sensor types in a LIDAR system

    Science.gov (United States)

    Choi, Gyudong; Han, Munhyun; Seo, Hongseok; Mheen, Bongki

    2017-10-01

    LIDAR (light distance and ranging) systems use sensors to detect reflected signals. The performance of the sensors significantly affects the specification of the LIDAR system. Especially, the number and size of the sensors determine the FOV (field of view) and resolution of the system, regardless of which sensors are used. The resolution of an array-type sensor normally depends on the number of pixels in the array. In this type of sensor, there are several limitations to increase the number of pixels in an array for higher resolution, specifically complexity, cost, and size limitations. Another type of sensors uses multiple pairs of transmitter and receiver channels. Each channel detects different points with the corresponding directions indicated by the laser points of each channel. In this case, in order to increase the resolution, it is required to increase the number of channels, resulting in bigger sensor head size and deteriorated reliability due to heavy rotating head module containing all the pairs. In this paper, we present a method to overcome these limitations and improve the performance of the LIDAR system. ETRI developed a type of scanning LIDAR system called a STUD (static unitary detector) LIDAR system. It was developed to solve the problems associated with the aforementioned sensors. The STUD LIDAR system can use a variety of sensors without any limitations on the size or number of sensors, unlike other LIDAR systems. Since it provides optimal performance in terms of range and resolution, the detailed analysis was conducted in the STUD LIDAR system by applying different sensor type to have improved sensing performance.

  18. Derivation of time dependent design-values for SNR 300 structural material

    International Nuclear Information System (INIS)

    Lorenz, H.; Breitling, H.; de Heesen, E.

    1976-01-01

    Time-dependent design values were derived from long-term creep rupture data for steel X 6 CrNi 1811 in the unwelded and welded condition. The design values had to satisfy the ASME CC 1592 criterea with respect to creep rupture strength, time to reach 1% strain and transition to tertiary creep as well as the requirement of German regulatory rules to properly account for weld bahaviour. For the evaluation and extrapolation 2 proven computer programmes were used. The design data derived under consideration of weld joints show relative good agreement with the values of ASME CC 1592. Consideration of welds leads to lower design values above 550 0 C and 5x10 3 h with the difference between rolled and weld material becoming larger with increasing time and temperature. (author)

  19. High-SNR Capacity of AWGN Channels with Generic Alphabet Constraints

    Science.gov (United States)

    2017-01-01

    coordinate-independent manner and prove several novel entropy convergence theorems. A particular focus is entropy of random variables on smooth...work with differential entropy in a coordinate-independent manner , as manifolds generally cannot be parameterized entirely by any single coordinate

  20. Seismic design principles for the German fast breeder reactor SNR 2

    International Nuclear Information System (INIS)

    Busch, K.A.; Peters, K.A.; Rosenhauer, W.

    1987-01-01

    The safety issue of an adequate and optimized external event protection is of course that unnecessary hardware precautions might promote internal disturbances or hamper their control. It has up to now not satisfactorily been realized that the only serious context for seismic impacts on a fast reactor is their attributed potential of overriding core disruptive accident prevention, see e.g. GRS 1982. General and exaggerated antiseismic design features not focussed upon this point may as well turn out to be non-negligible initators in the absence of seismic vibrations. Unexpected snubber difficulties requiring additional reactor scrams and decay heat removal phases may be named as a simple example. The presented seismic design principles reflect the progress made in the concerned fields of analysis and do serve on the other hand as guidelines for research and development efforts under work. (orig./GL)

  1. Fluctuations of the SNR at the output of the MVDR with Regularized Tyler Estimators

    KAUST Repository

    Elkhalil, Khalil; Kammoun, Abla; Al-Naffouri, Tareq Y.; Alouini, Mohamed-Slim

    2016-01-01

    case in which the receiver employs the regularized Tyler estimator in order to estimate the covariance matrix of the interference-plus-noise process using n observations of size N×1N×1. The choice for the regularized Tylor estimator (RTE) is motivated

  2. Experimental investigations on the compatibility of a SNR-type corium with graphite

    International Nuclear Information System (INIS)

    Peehs, M.; Friedrich, H.J.; Heuvel, H.J.

    1976-01-01

    Tests on the compatibility between UO 2 -pellets, UO 2 /stainless steel mixtures (70 w/o UO 2 , 30 w/o SS) and graphite were carried out at 1600, 2000, and 2400 0 C. The test duration was 0.5 h. UO 2 -pellets are only completely converted to carbides at 2400 0 C, when liquid U-carbide phases occur. In the presence of SS the liquefaction temperature was lowered to 2000 0 C. The conversion rates in the case of UO 2 -liquefaction as indicated by the corresponding CO-generation are high. The interactions are completed within a quarter of an hour. Apart from the release of O in the form of CO, the pick-up of C and the evaporation losses at the highest temperatures no significant changes in the chemical composition could be found. Post melting analyses by microsections, microprobe and X-ray investigations detected UFeC 2 -phases and carbides from the M 7 C 3 -type together with austenite. A thermodynamic evaluation revealed that the C-activity of the melts after UO 2 -liquefaction is nearly 1

  3. Wideband spectrum sensing order for cognitive radios with sensing errors and channel SNR probing uncertainty

    KAUST Repository

    Hamza, Doha R.; Aï ssa, Sonia

    2013-01-01

    A secondary user (SU) seeks to transmit by sequentially sensing statistically independent primary user (PU) channels. If a channel is sensed free, it is probed to estimate the signal-to-noise ratio between the SU transmitter-receiver pair over the channel. We jointly optimize the channel sensing time, the sensing decision threshold, the channel probing time, together with the channel sensing order under imperfect synchronization between the PU and the SU. The sensing and probing times and the decision threshold are assumed to be the same for all channels. We maximize a utility function related to the SU throughput under the constraint that the collision probability with the PU is kept below a certain value and taking sensing errors into account. We illustrate the optimal policy and the variation of SU throughput with various system parameters. © 2012 IEEE.

  4. Noncolocated Time-Reversal MUSIC: High-SNR Distribution of Null Spectrum

    Science.gov (United States)

    Ciuonzo, Domenico; Rossi, Pierluigi Salvo

    2017-04-01

    We derive the asymptotic distribution of the null spectrum of the well-known Multiple Signal Classification (MUSIC) in its computational Time-Reversal (TR) form. The result pertains to a single-frequency non-colocated multistatic scenario and several TR-MUSIC variants are here investigated. The analysis builds upon the 1st-order perturbation of the singular value decomposition and allows a simple characterization of null-spectrum moments (up to the 2nd order). This enables a comparison in terms of spectrums stability. Finally, a numerical analysis is provided to confirm the theoretical findings.

  5. Simultaneous Range-Velocity Processing and SNR Analysis of AFIT’s Random Noise Radar

    Science.gov (United States)

    2012-03-22

    reducing the overall processing time. Two computers, equipped with NVIDIA ® GPUs, were used to process the col- 45 lected data. The specifications for each...gather the results back to the CPU. Another company , AccelerEyes®, has developed a product called Jacket® that claims to be better than the parallel...Number of Processing Cores 4 8 Processor Speed 3.33 GHz 3.07 GHz Installed Memory 48 GB 48 GB GPU Make NVIDIA NVIDIA GPU Model Tesla 1060 Tesla C2070 GPU

  6. High SNR BER comparison of coherent and differentially coherent modulation schemes in lognormal fading channels

    KAUST Repository

    Song, Xuegui

    2014-09-01

    Using an auxiliary random variable technique, we prove that binary differential phase-shift keying and binary phase-shift keying have the same asymptotic bit-error rate performance in lognormal fading channels. We also show that differential quaternary phase-shift keying is exactly 2.32 dB worse than quaternary phase-shift keying over the lognormal fading channels in high signal-to-noise ratio regimes.

  7. MAGNETAR-LIKE ACTIVITY FROM THE CENTRAL COMPACT OBJECT IN THE SNR RCW103

    Energy Technology Data Exchange (ETDEWEB)

    Rea, N.; Borghese, A.; Esposito, P.; Zelati, F. Coti [Anton Pannekoek Institute for Astronomy, University of Amsterdam, Postbus 94249, NL-1090 GE Amsterdam (Netherlands); Bachetti, M. [INAF-Osservatorio Astronomico di Cagliari, via della Scienza 5, I-09047 Selargius (Italy); Israel, G. L. [INAF-Osservatorio Astronomico di Roma, via Frascati 33, I-00040, Monteporzio Catone (Italy); De Luca, A., E-mail: rea@ice.csic.es [INAF-Istituto di Astrofisica Spaziale e Fisica Cosmica Milano, Via E. Bassini 15, I-20133 Milano (Italy)

    2016-09-01

    The 6.67 hr periodicity and the variable X-ray flux of the central compact object (CCO) at the center of the supernova remnant RCW 103, named 1E 161348–5055, have been always difficult to interpret within the standard scenarios of an isolated neutron star (NS) or a binary system. On 2016 June 22, the Burst Alert Telescope (BAT) on board Swift detected a magnetar-like short X-ray burst from the direction of 1E 161348–5055, also coincident with a large long-term X-ray outburst. Here, we report on Chandra , Nuclear Spectroscopic Telescope Array , and Swift (BAT and XRT) observations of this peculiar source during its 2016 outburst peak. In particular, we study the properties of this magnetar-like burst, we discover a hard X-ray tail in the CCO spectrum during outburst, and we study its long-term outburst history (from 1999 to 2016 July). We find the emission properties of 1E 161348–5055 consistent with it being a magnetar. However, in this scenario, the 6.67 hr periodicity can only be interpreted as the rotation period of this strongly magnetized NS, which therefore represents the slowest pulsar ever detected, by orders of magnitude. We briefly discuss the viable slow-down scenarios, favoring a picture involving a period of fall-back accretion after the supernova explosion, similarly to what is invoked (although in a different regime) to explain the “anti-magnetar” scenario for other CCOs.

  8. Capacity of spectrum sharing Cognitive Radio systems over Nakagami fading channels at low SNR

    KAUST Repository

    Sboui, Lokman

    2013-06-01

    In this paper, we study the ergodic capacity of Cognitive Radio (CR) spectrum sharing systems at low power regime. We focus on Nakagami fading channels. We formally define the low power regime and present closed form expressions of the capacity in the low power regime under various types of interference and/or power constraints, depending on the available channel state information (CSI) of the cross link (CL) between the secondary user transmitter and the primary user receiver. We explicitly characterize two regimes where either the interference constraint or the power constraint dictates the optimal power profile. Our framework also highlights the effects of different fading parameters on the secondary link ergodic capacity. Interestingly, we show that the low power regime analysis provides a specific insight on the capacity behavior of CR that has not been reported by previous studies. © 2013 IEEE.

  9. Discovery of an Energetic Pulsar Associated with SNR G76.9+1.0

    Science.gov (United States)

    Arzoumanian, Zaven; Gotthelf, E. V.; Ransom, S. M.; Safi-Harb, S.; Kothes, R.; Landecker, T. L.

    2012-01-01

    We report the discovery of PSR J2022-pulsar in the supernova remnant G76.9+i.0, in observations with the Chandra X-ray telescope, the Robert C. Byrd Green Bank Radio Telescope, and the Rossi X-ray Timing Explorer (RXTE). The pulsar's spin-down rate implies a rotation-powered luminosity E = 1.2 X 10(exp 38) erg/s, a surface dipole magnetic field strength B(sub S), = 1.0 X 10(exp 12) G, and a characteristic age of 8.9 kyr. PSR J2022+3842 is thus the second-most energetic Galactic pulsar known, after the Crab, as well as the most rapidly-rotating young, radio-bright pulsar known. The radio pulsations are highly dispersed and broadened by interstellar scattering, and we find that a large (delta f/f approximates 1.9 x 10(exp -6)) spin glitch must have occurred between our discovery and confirmation observations. The X-ray pulses are narrow (0.06 cycles FWHM) and visible up to 20 keV, consistent with magnetospheric emission from a rotation-powered pulsar. The Chandra X-ray image identifies the pulsar with a hard, unresolved source at the midpoint of the double-lobed radio morphology of G76.9+ 1.0 and embedded within faint, compact X-ray nebulosity. The spatial relationship of the X-ray and radio emissions is remarkably similar to extended structure seen around the Vela pulsar. The combined Chandra and RXTE pulsar spectrum is well-fitted by an absorbed power-law model with column density N(sub H) = (1.7 +/- 0.3) x 10(exp 22) / sq cm and photon index Gamma = 1.0 +/- 0.2; it implies that the Chandra point-source flux is virtually 100% pulsed. For a distance of 10 kpc, the X-ray luminosity of PSR J2022+3842 is L(sub x){2-1O keV) = 7.0 x 10(exp 33) erg/s. Despite being extraordinarily energetic, PSR J2022+3842 lacks a bright X-ray wind nebula and has an unusually low conversion efficiency of spin-down power to X-ray luminosity, Lx/E = 5.9 X 10(exp-5).

  10. Channel Capacity Calculation at Large SNR and Small Dispersion within Path-Integral Approach

    Science.gov (United States)

    Reznichenko, A. V.; Terekhov, I. S.

    2018-04-01

    We consider the optical fiber channel modelled by the nonlinear Shrödinger equation with additive white Gaussian noise. Using Feynman path-integral approach for the model with small dispersion we find the first nonzero corrections to the conditional probability density function and the channel capacity estimations at large signal-to-noise ratio. We demonstrate that the correction to the channel capacity in small dimensionless dispersion parameter is quadratic and positive therefore increasing the earlier calculated capacity for a nondispersive nonlinear optical fiber channel in the intermediate power region. Also for small dispersion case we find the analytical expressions for simple correlators of the output signals in our noisy channel.

  11. Prediction of topographic and bathymetric measurement performance of airborne low-SNR lidar systems

    Science.gov (United States)

    Cossio, Tristan

    Low signal-to-noise ratio (LSNR) lidar (light detection and ranging) is an alternative paradigm to traditional lidar based on the detection of return signals at the single photoelectron level. The objective of this work was to predict low altitude (600 m) LSNR lidar system performance with regards to elevation measurement and target detection capability in topographic (dry land) and bathymetric (shallow water) scenarios. A modular numerical sensor model has been developed to provide data for further analysis due to the dearth of operational low altitude LSNR lidar systems. This simulator tool is described in detail, with consideration given to atmospheric effects, surface conditions, and the effects of laser phenomenology. Measurement performance analysis of the simulated topographic data showed results comparable to commercially available lidar systems, with a standard deviation of less than 12 cm for calculated elevation values. Bathymetric results, although dependent largely on water turbidity, were indicative of meter-scale horizontal data spacing for sea depths less than 5 m. The high prevalence of noise in LSNR lidar data introduces significant difficulties in data analysis. Novel algorithms to reduce noise are described, with particular focus on their integration into an end-to-end target detection classifier for both dry and submerged targets (cube blocks, 0.5 m to 1.0 m on a side). The key characteristic exploited to discriminate signal and noise is the temporal coherence of signal events versus the random distribution of noise events. Target detection performance over dry earth was observed to be robust, reliably detecting over 90% of targets with a minimal false alarm rate. Comparable results were observed in waters of high clarity, where the investigated system was generally able to detect more than 70% of targets to a depth of 5 m. The results of the study show that CATS, the University of Florida's LSNR lidar prototype, is capable of high fidelity (decimeter-scale) coverage of the topographic zone with limited applicability to shallow waters less than 5 m deep. To increase the spatial-temporal contrast between signal and noise events, laser pulse rate is the optimal system characteristic to improve in future LSNR lidar units.

  12. MIMO Intensity-Modulation Channels: Capacity Bounds and High SNR Characterization

    KAUST Repository

    Chaaban, Anas; Rezki, Zouheir; Alouini, Mohamed-Slim

    2016-01-01

    The capacity of MIMO intensity modulation channels is studied. The nonnegativity of the transmit signal (intensity) poses a challenge on the precoding of the transmit signal, which limits the applicability of classical schemes in this type

  13. Non-thermal emission from young supernova remnants: Implications on cosmic ray acceleration

    Science.gov (United States)

    Araya-Arguedas, Miguel A.

    For a long time, supernova remnants have been thought to constitute the main source of galactic cosmic rays. Plausible mechanisms have been proposed through which these objects would be able to transfer some of their energy to charged particles. Detailed studies of SNRs, particularly allowed by the spectral and spatial resolution obtained with telescopes such as the Chandra X-Ray Observatory , have permitted us to understand some of the properties of high-energy particles within these objects and their interactions with their environment. In the first part of this work, the basic concepts of particle acceleration in SNRs are outlined, and the main observational tools available today for studying high-energy phenomena in astrophysics are mentioned briefly. In the second part, a study of non-thermal emission from the young SNR Cassiopeia A is presented. Through the use of a very deep one million-second Chandra observation of this remnant, the spectral evolution across non-thermal filaments near the forward shock was studied. A consistent hardening of the spectrum towards the exterior of the remnant was found and explained via a model developed that takes into account particle diffusion, plasma advection and radiation losses. The role of particle diffusion was studied and its effect on the photon spectral index quantified. In the model, the diffusion is included as a fraction of Bohm-type diffusion, which is consistent with the data. The model also allowed an estimation of the electron distribution, the magnetic field and its orientation, as well as the level of magnetic turbulence. In the third part, a multi-wavelength study of two young SNRs is presented. Multi-wavelength modeling of spectral energy distributions (SED) may hold the key to disentangle the nature and content of cosmic rays within these objects. The first model shown presents state of the art measurements gathered for Cassiopeia A, and the modeling is based partly on the results presented in the second

  14. Study of the interstellar medium towards RCW 103

    OpenAIRE

    Paron, Sergio Ariel; Reynoso, Estela Marta; Dubner, Gloria Mabel; Castelletti, Gabriela Marta

    2017-01-01

    RCW 103 is a shell type supernova remnant (SNR) that, according to near infrared observations, is interacting with a molecular cloud, specially to the south. In this paper we report on the study of the interstellar medium in an extended region towards RCW 103 based on HI 21 cm data acquired with the ATCA radiotelescope. Also, we report on the detection of HCO+ and CO emission in the rotational transition J=1-0 associated with the remnant. These observations were carried out with the millimete...

  15. A new characterization procedure for computed radiography performance levels based on EPS, SNR and basic spatial resolution measurements

    International Nuclear Information System (INIS)

    Ewert, Uwe; Zscherpel, Uwe; Baer, Sylke

    2016-01-01

    The standards EN 14784-1:2005 and ISO 16371-1:2011 describe the classification of Computed Radiography systems for industrial applications. After 10 years of classification experience, it can be concluded that all certified NDT CR systems achieve the best classification result: IP 1. The measured basic spatial resolution is different depending on the manufacturer's brand and the IP used. Therefore, a revision was recommended to obtain a better gradation for the different brands. Users in USA and Europe classify the CR systems based on different parameters. Consequently, a new revision of ASTM E 2446-15 was finalized in 2015, which describes the characterization of CR systems based on CR performance levels. The key parameters are the normalized Signal to Noise Ratio (SNRN), the interpolated basic spatial resolution (iSR b detector ) and the achieved equivalent penetrameter sensitivity (aEPS). A series of further tests is required for complete characterization by manufacturers or certifying laboratories. This includes e.g.: geometric distortion, laser jitter, PMT non-linearity, scanner slippage, shading or banding, erasure, burn-In, spatial linearity, artefacts, imaging plate response variation and imaging plate fading. ASTM E 2445-15 describes several tests, for users to perform periodic quality assurance. The measurement procedures are described and the resulting values as CR speed, achieved contrast sensitivity and efficiency are discussed. The results will be presented graphically in a spider net graph in the qualification/certification statement. A revision of the related CEN and ISO standards is discussed.

  16. SNR 2 core dynamics and shut-down signals in a protected loss-of-flow incident

    International Nuclear Information System (INIS)

    Kleefeldt, K.

    1982-01-01

    The dynamic behavior of a 1300 MWe Core during a loss-of-flow incident has been analyzed by use of the SAS3D code for a given pump coast down characteristic and constant core inlet temperature. Emphasis was placed on the questions: How fast and via which monitored parameters can the incident be recognized by the reactor protection system. What is the tolerable time span for the shut-down action without exceeding safety limits. Key prameters and limit values as well as conceivable reactivity feed-back effects are discussed. The result is, that three out of four choosen monitored parameters are capable of initiating a shut-down action in time. In addition, the amount of shut-down reactivity required for a successful scram was briefly investigated

  17. On the capacity of multiple access and broadcast fading channels with full channel state information at low SNR

    KAUST Repository

    Rezki, Zouheir; Alouini, Mohamed-Slim

    2014-01-01

    structure and thus is simply characterized by single user capacity points.More specifically, we show that at low power regime, the boundary surface of the capacity region shrinks to a single point corresponding to the sum rate maximizer

  18. A unified framework for the statistical characterization of the SNR of amplify-and-forward multihop channels

    KAUST Repository

    Yilmaz, Ferkan

    2010-01-01

    In this paper, we present a unified approach to analyze the exact statistical characteristics of the harmonic mean of N ≥ 2 statistically independent and non-identically distributed random variables (RVs), which we term the N-normalized harmonic distribution (i.e., NHD distribution), for the purpose of modeling the amplify-and-forward multihop relay channels. We present exact statistical metrics for the moments-generating function (MGF), moments (Mellin moments-generating function), probability density function (PDF) and cumulative distribution function (CDF) of the NHD distribution. Aside from unifying past results based on the geometric-mean approximation of the harmonic-mean, our approach relies on the algebraic combination of Mellin and Laplace transforms to obtain exact single integral expressions which can be easily computed using the Gauss-Laguerre quadrature rule or can be readily expressed in terms of the multivariable Meijer\\'s G of Fox\\'s H functions. Numerical and simulation results, performed to verify the correctness of the proposed formulation, are in perfect agreement. The proposed formulation can be used to analyze the performance measures of the amplify-and-forward multihop relay channels such as outage probability, outage capacity, average capacity and average bit error probabilities. © 2009 IEEE.

  19. SNR Improvement Employing Dynamics Beamforming Based on Angle of Arrival for Mobile WiMax IEEE 802.16e

    OpenAIRE

    Yuwono, T

    2014-01-01

    The development of telecommunicationtechnology and services is very rapid. One oftelecommunication technology that is beingdeveloped is WiMax (Worldwide Interoperabilityfor Microwave Access). The advantages of WiMaxis it possess much range and can operate in non -LOS conditions. So it fits implemented inIndonesia to accelerate the internet penetration.Some features of WiMax technology is higherbandwidth and further range/area. SNRImprovement is The effort to increase the rangeand improve the ...

  20. A unified framework for the statistical characterization of the SNR of amplify-and-forward multihop channels

    KAUST Repository

    Yilmaz, Ferkan; Kucur, Oǧuz; Alouini, Mohamed-Slim

    2010-01-01

    In this paper, we present a unified approach to analyze the exact statistical characteristics of the harmonic mean of N ≥ 2 statistically independent and non-identically distributed random variables (RVs), which we term the N-normalized harmonic

  1. A Multiple Model SNR/RCS Likelihood Ratio Score for Radar-Based Feature-Aided Tracking

    National Research Council Canada - National Science Library

    Slocumb, Benjamin J; Klusman, III, Michael E

    2005-01-01

    ...) and radar cross section (RCS) for use in narrowband radar tracking. The formulation requires an estimate of the target mean RCS, and a key challenge is the tracking of the mean RCS through significant jumps due to aspect dependencies...

  2. Hitomi observations of the LMC SNR N 132 D: Highly redshifted X-ray emission from iron ejecta

    Science.gov (United States)

    Hitomi Collaboration; Aharonian, Felix; Akamatsu, Hiroki; Akimoto, Fumie; Allen, Steven W.; Angelini, Lorella; Audard, Marc; Awaki, Hisamitsu; Axelsson, Magnus; Bamba, Aya; Bautz, Marshall W.; Blandford, Roger; Brenneman, Laura W.; Brown, Gregory V.; Bulbul, Esra; Cackett, Edward M.; Chernyakova, Maria; Chiao, Meng P.; Coppi, Paolo S.; Costantini, Elisa; de Plaa, Jelle; de Vries, Cor P.; den Herder, Jan-Willem; Done, Chris; Dotani, Tadayasu; Ebisawa, Ken; Eckart, Megan E.; Enoto, Teruaki; Ezoe, Yuichiro; Fabian, Andrew C.; Ferrigno, Carlo; Foster, Adam R.; Fujimoto, Ryuichi; Fukazawa, Yasushi; Furuzawa, Akihiro; Galeazzi, Massimiliano; Gallo, Luigi C.; Gandhi, Poshak; Giustini, Margherita; Goldwurm, Andrea; Gu, Liyi; Guainazzi, Matteo; Haba, Yoshito; Hagino, Kouichi; Hamaguchi, Kenji; Harrus, Ilana M.; Hatsukade, Isamu; Hayashi, Katsuhiro; Hayashi, Takayuki; Hayashida, Kiyoshi; Hiraga, Junko S.; Hornschemeier, Ann; Hoshino, Akio; Hughes, John P.; Ichinohe, Yuto; Iizuka, Ryo; Inoue, Hajime; Inoue, Yoshiyuki; Ishida, Manabu; Ishikawa, Kumi; Ishisaki, Yoshitaka; Iwai, Masachika; Kaastra, Jelle; Kallman, Tim; Kamae, Tsuneyoshi; Kataoka, Jun; Katsuda, Satoru; Kawai, Nobuyuki; Kelley, Richard L.; Kilbourne, Caroline A.; Kitaguchi, Takao; Kitamoto, Shunji; Kitayama, Tetsu; Kohmura, Takayoshi; Kokubun, Motohide; Koyama, Katsuji; Koyama, Shu; Kretschmar, Peter; Krimm, Hans A.; Kubota, Aya; Kunieda, Hideyo; Laurent, Philippe; Lee, Shiu-Hang; Leutenegger, Maurice A.; Limousin, Olivier; Loewenstein, Michael; Long, Knox S.; Lumb, David; Madejski, Greg; Maeda, Yoshitomo; Maier, Daniel; Makishima, Kazuo; Markevitch, Maxim; Matsumoto, Hironori; Matsushita, Kyoko; McCammon, Dan; McNamara, Brian R.; Mehdipour, Missagh; Miller, Eric D.; Miller, Jon M.; Mineshige, Shin; Mitsuda, Kazuhisa; Mitsuishi, Ikuyuki; Miyazawa, Takuya; Mizuno, Tsunefumi; Mori, Hideyuki; Mori, Koji; Mukai, Koji; Murakami, Hiroshi; Mushotzky, Richard F.; Nakagawa, Takao; Nakajima, Hiroshi; Nakamori, Takeshi; Nakashima, Shinya; Nakazawa, Kazuhiro; Nobukawa, Kumiko K.; Nobukawa, Masayoshi; Noda, Hirofumi; Odaka, Hirokazu; Ohashi, Takaya; Ohno, Masanori; Okajima, Takashi; Ota, Naomi; Ozaki, Masanobu; Paerels, Frits; Paltani, Stéphane; Petre, Robert; Pinto, Ciro; Porter, Frederick S.; Pottschmidt, Katja; Reynolds, Christopher S.; Safi-Harb, Samar; Saito, Shinya; Sakai, Kazuhiro; Sasaki, Toru; Sato, Goro; Sato, Kosuke; Sato, Rie; Sato, Toshiki; Sawada, Makoto; Schartel, Norbert; Serlemtsos, Peter J.; Seta, Hiromi; Shidatsu, Megumi; Simionescu, Aurora; Smith, Randall K.; Soong, Yang; Stawarz, Łukasz; Sugawara, Yasuharu; Sugita, Satoshi; Szymkowiak, Andrew; Tajima, Hiroyasu; Takahashi, Hiromitsu; Takahashi, Tadayuki; Takeda, Shin'ichiro; Takei, Yoh; Tamagawa, Toru; Tamura, Takayuki; Tanaka, Takaaki; Tanaka, Yasuo; Tanaka, Yasuyuki T.; Tashiro, Makoto S.; Tawara, Yuzuru; Terada, Yukikatsu; Terashima, Yuichi; Tombesi, Francesco; Tomida, Hiroshi; Tsuboi, Yohko; Tsujimoto, Masahiro; Tsunemi, Hiroshi; Tsuru, Takeshi Go; Uchida, Hiroyuki; Uchiyama, Hideki; Uchiyama, Yasunobu; Ueda, Shutaro; Ueda, Yoshihiro; Uno, Shin'ichiro; Urry, C. Megan; Ursino, Eugenio; Watanabe, Shin; Werner, Norbert; Wilkins, Dan R.; Williams, Brian J.; Yamada, Shinya; Yamaguchi, Hiroya; Yamaoka, Kazutaka; Yamasaki, Noriko Y.; Yamauchi, Makoto; Yamauchi, Shigeo; Yaqoob, Tahir; Yatsu, Yoichi; Yonetoku, Daisuke; Zhuravleva, Irina; Zoghbi, Abderahmen

    2018-03-01

    We present Hitomi observations of N 132 D, a young, X-ray bright, O-rich core-collapse supernova remnant in the Large Magellanic Cloud (LMC). Despite a very short observation of only 3.7 ks, the Soft X-ray Spectrometer (SXS) easily detects the line complexes of highly ionized S K and Fe K with 16-17 counts in each. The Fe feature is measured for the first time at high spectral resolution. Based on the plausible assumption that the Fe K emission is dominated by He-like ions, we find that the material responsible for this Fe emission is highly redshifted at ˜ 800 km s-1 compared to the local LMC interstellar medium (ISM), with a 90% credible interval of 50-1500 km s-1 if a weakly informative prior is placed on possible line broadening. This indicates (1) that the Fe emission arises from the supernova ejecta, and (2) that these ejecta are highly asymmetric, since no blueshifted component is found. The S K velocity is consistent with the local LMC ISM, and is likely from swept-up ISM material. These results are consistent with spatial mapping that shows the He-like Fe concentrated in the interior of the remnant and the S tracing the outer shell. The results also show that even with a very small number of counts, direct velocity measurements from Doppler-shifted lines detected in extended objects like supernova remnants are now possible. Thanks to the very low SXS background of ˜ 1 event per spectral resolution element per 100 ks, such results are obtainable during short pointed or slew observations with similar instruments. This highlights the power of high-spectral-resolution imaging observations, and demonstrates the new window that has been opened with Hitomi and will be greatly widened with future missions such as the X-ray Astronomy Recovery Mission (XARM) and Athena.

  3. Low SNR capacity for MIMO Rician and Rayleigh-product fading channels with single co-channel interferer and noise

    KAUST Repository

    Zhong, Caijun; Jin, Shi; Wong, Kaikit; Alouini, Mohamed-Slim; Ratnarajah, Tharm

    2010-01-01

    . Exact analytical expressions for the minimum energy per information bit, {Eb/N0min, and wideband slope, S0, are derived for both channels. Our results show that the minimum energy per information bit is the same for both channels while their wideband

  4. Simulation of high SNR photodetector with L-C coupling and transimpedance amplifier circuit and its verification

    Science.gov (United States)

    Wang, Shaofeng; Xiang, Xiao; Zhou, Conghua; Zhai, Yiwei; Quan, Runai; Wang, Mengmeng; Hou, Feiyan; Zhang, Shougang; Dong, Ruifang; Liu, Tao

    2017-01-01

    In this paper, a model for simulating the optical response and noise performances of photodetectors with L-C coupling and transimpedance amplification circuit is presented. To verify the simulation, two kinds of photodetectors, which are based on the same printed-circuit-board (PCB) designing and PIN photodiode but different operational amplifiers, are developed and experimentally investigated. Through the comparisons between the numerical simulation results and the experimentally obtained data, excellent agreements are achieved, which show that the model provides a highly efficient guide for the development of a high signal to noise ratio photodetector. Furthermore, the parasite capacitances on the developed PCB, which are always hardly measured but play a non-negligible influence on the photodetectors' performances, are estimated.

  5. On the capacity of multiple access and broadcast fading channels with full channel state information at low SNR

    KAUST Repository

    Rezki, Zouheir

    2014-01-01

    We study the throughput capacity region of the Gaussian multi-access (MAC) fading channel with perfect channel state information (CSI) at the receiver and at the transmitters, at low power regime. We show that it has a multidimensional rectangle structure and thus is simply characterized by single user capacity points.More specifically, we show that at low power regime, the boundary surface of the capacity region shrinks to a single point corresponding to the sum rate maximizer and that the coordinates of this point coincide with single user capacity bounds. Inspired from this result, we propose an on-off scheme, compute its achievable rate, and show that this scheme achieves single user capacity bounds of the MAC channel for a wide class of fading channels at asymptotically low power regime. We argue that this class of fading encompasses all known wireless channels for which the capacity region of the MAC channel has even a simpler expression in terms of users\\' average power constraints only. Using the duality of Gaussian MAC and broadcast channels (BC), we deduce a simple characterization of the BC capacity region at low power regime and show that for a class of fading channels (including Rayleigh fading), time-sharing is asymptotically optimal. © 2014 IEEE.

  6. Analysis of LOF/TOP excursions in the SNR-300 Zielkern core with a stress controlled rip extension after failure

    International Nuclear Information System (INIS)

    Royl, P.

    1987-07-01

    An unprotected loss of flow (ULOF) accident can result in energetic power excursions due to reactivity effects from in-pile fuel motion and compaction after a near midplane failure of fuel pins in unvoided regions of the core (loss of flow driven transient overpower or LOF/TOP excursions). These excursions are strongly mitigated by a propagation of the failure rip, which reduces the fuel compaction and enhances fuel sweep-out. A simple model has been introduced into the SAS3D code in which this propagation is restricted to the expansion of the void zone that is firmed in the coolant channel due to thermal interactions of fuel and sodium (FCI) after failure. The rip propagation is demonstrated in this report in all investigated cases to be a strong mitigator that will limit the fuel compaction effects in the region where they originate

  7. VizieR Online Data Catalog: GMOS spectroscopic obs. of SNR candidates in M83 (Winkler+, 2017)

    Science.gov (United States)

    Winkler, P. F.; Blair, W. P.; Long, K. S.

    2017-11-01

    We used the GMOS on the 8.2m Gemini-South telescope to obtain all the spectra reported here. Most were obtained in a classically scheduled observing run on 2011 April 7-9 (UT); masks 1-7. We later obtained spectra for two additional masks (which we refer to as masks 8 and 9 for simplicity) in a queue-scheduled program (GS-2015A-Q-90) during the 2015A semester. (6 data files).

  8. WE-DE-206-03: MRI Image Formation - Slice Selection, Phase Encoding, Frequency Encoding, K-Space, SNR

    International Nuclear Information System (INIS)

    Lin, C.

    2016-01-01

    Magnetic resonance imaging (MRI) has become an essential part of clinical imaging due to its ability to render high soft tissue contrast. Instead of ionizing radiation, MRI use strong magnetic field, radio frequency waves and field gradients to create diagnostic useful images. It can be used to image the anatomy and also functional and physiological activities within the human body. Knowledge of the basic physical principles underlying MRI acquisition is vitally important to successful image production and proper image interpretation. This lecture will give an overview of the spin physics, imaging principle of MRI, the hardware of the MRI scanner, and various pulse sequences and their applications. It aims to provide a conceptual foundation to understand the image formation process of a clinical MRI scanner. Learning Objectives: Understand the origin of the MR signal and contrast from the spin physics level. Understand the main hardware components of a MRI scanner and their purposes Understand steps for MR image formation including spatial encoding and image reconstruction Understand the main kinds of MR pulse sequences and their characteristics.

  9. Point X-ray sources in the SNR G 315.4-2.30 (MSH 14-63, RCW 86)

    Science.gov (United States)

    Gvaramadze, V. V.; Vikhlinin, A. A.

    2003-04-01

    We report the results of a search for a point X-ray source (stellar remnant) in the southwest protrusion of the supernova remnant G 315.4-2.30 (MSH 14-63, RCW 86) using the archival data of the Chandra X-ray Observatory. The search was motivated by a hypothesis that G 315.4-2.30 is the result of an off-centered cavity supernova explosion of a moving massive star, which ended its evolution just near the edge of the main-sequence wind-driven bubble. This hypothesis implies that the southwest protrusion in G 315.4-2.30 is the remainder of a pre-existing bow shock-like structure created by the interaction of the supernova progenitor's wind with the interstellar medium and that the actual location of the supernova blast center is near the center of this hemispherical structure. We have discovered two point X-ray sources in the ``proper" place. One of the sources has an optical counterpart with the photographic magnitude 13.38+/-0.40, while the spectrum of the source can be fitted with an optically thin plasma model. We interpret this source as a foreground active star of late spectral type. The second source has no optical counterpart to a limiting magnitude ~ 21. The spectrum of this source can be fitted almost equally well with several simple models (power law: photon index =1.87; two-temperature blackbody: kT1 =0.11 keV, R1 =2.34 km and kT2 =0.71 keV, R2 =0.06 km; blackbody plus power law: kT =0.07 keV, photon index =2.3). We interpret this source as a candidate stellar remnant (neutron star), while the photon index and non-thermal luminosity of the source (almost the same as those of the Vela pulsar and the recently discovered pulsar PSR J 0205+6449 in the supernova remnant 3C 58) suggest that it can be a young ``ordinary" pulsar.

  10. WE-DE-206-03: MRI Image Formation - Slice Selection, Phase Encoding, Frequency Encoding, K-Space, SNR

    Energy Technology Data Exchange (ETDEWEB)

    Lin, C. [Indiana University School of Medicine (United States)

    2016-06-15

    Magnetic resonance imaging (MRI) has become an essential part of clinical imaging due to its ability to render high soft tissue contrast. Instead of ionizing radiation, MRI use strong magnetic field, radio frequency waves and field gradients to create diagnostic useful images. It can be used to image the anatomy and also functional and physiological activities within the human body. Knowledge of the basic physical principles underlying MRI acquisition is vitally important to successful image production and proper image interpretation. This lecture will give an overview of the spin physics, imaging principle of MRI, the hardware of the MRI scanner, and various pulse sequences and their applications. It aims to provide a conceptual foundation to understand the image formation process of a clinical MRI scanner. Learning Objectives: Understand the origin of the MR signal and contrast from the spin physics level. Understand the main hardware components of a MRI scanner and their purposes Understand steps for MR image formation including spatial encoding and image reconstruction Understand the main kinds of MR pulse sequences and their characteristics.

  11. SNR-optimized phase-sensitive dual-acquisition turbo spin echo imaging: a fast alternative to FLAIR.

    Science.gov (United States)

    Lee, Hyunyeol; Park, Jaeseok

    2013-07-01

    Phase-sensitive dual-acquisition single-slab three-dimensional turbo spin echo imaging was recently introduced, producing high-resolution isotropic cerebrospinal fluid attenuated brain images without long inversion recovery preparation. Despite the advantages, the weighted-averaging-based technique suffers from noise amplification resulting from different levels of cerebrospinal fluid signal modulations over the two acquisitions. The purpose of this work is to develop a signal-to-noise ratio-optimized version of the phase-sensitive dual-acquisition single-slab three-dimensional turbo spin echo. Variable refocusing flip angles in the first acquisition are calculated using a three-step prescribed signal evolution while those in the second acquisition are calculated using a two-step pseudo-steady state signal transition with a high flip-angle pseudo-steady state at a later portion of the echo train, balancing the levels of cerebrospinal fluid signals in both the acquisitions. Low spatial frequency signals are sampled during the high flip-angle pseudo-steady state to further suppress noise. Numerical simulations of the Bloch equations were performed to evaluate signal evolutions of brain tissues along the echo train and optimize imaging parameters. In vivo studies demonstrate that compared with conventional phase-sensitive dual-acquisition single-slab three-dimensional turbo spin echo, the proposed optimization yields 74% increase in apparent signal-to-noise ratio for gray matter and 32% decrease in imaging time. The proposed method can be a potential alternative to conventional fluid-attenuated imaging. Copyright © 2012 Wiley Periodicals, Inc.

  12. Listening in on Baby - Monitoring the Youngest Known Pulsar (core Program)

    Science.gov (United States)

    We have discovered a most remarkable young pulsar, PSR J1846-0258, in the core of a Crab-like pulsar wind nebula at the center of the bright shell-type SNR Kes 75. Based on its spin-down rate and X-ray spectrum, PSR J1846-0258 is likely the youngest known rotation-powered pulsar. Compared to the Crab pulsar, however, its period, spin-down rate, and X-ray conversion efficiency are each an order of magnitude greater, likely the result of its extreme magnetic field, above the quantum critical threshold. We propose to continue our monitoring campaign of PSR~J1846-0258 to measure the braking index, characterize its timing noise, and search for evidence of timing glitches. Furthermore, an X- ray ephemeris contemporal with GLAST is critical to detecting the pulsar at higher energies.

  13. Monitoring Baby - Listening in on the Youngest Known Pulsar (XTEAO11)

    Science.gov (United States)

    Gotthelf, Eric

    We have discovered a most remarkable young pulsar, PSR~J1846-0258, in the core of a Crab-like pulsar wind nebula at the center of the bright shell-type supernova remnant Kes~75. Based on its spin-down rate and X- ray spectrum, PSR~J1846-0258 is likely the youngest known rotation- powered pulsar. Compared to the Crab pulsar, however, its period, spin- down rate, and spin-down to X-ray luminosity conversion efficiency are each an order of magnitude greater, likely the result of its extreme magnetic field, above the quantum critical threshold. We propose to continue our monitoring campaign to measure the pulsar's braking index, characterize its timing noise, and search for evidence of timing glitches. This pulsar provides important insight into the evolution of the youngest NS-SNR systems.

  14. Listening in on Baby - Monitoring the Youngest Known Pulsar

    Science.gov (United States)

    Gotthelf, Eric

    We have discovered a most remarkable young pulsar, PSR J1846-0258, in the core of a Crab-like pulsar wind nebula at the center of the bright shell-type SNR Kes 75. Based on its spin-down rate and X-ray spectrum, PSR J1846-0258 is likely the youngest known rotation-powered pulsar. Compared to the Crab pulsar, however, its period, spin-down rate, and X-ray conversion efficiency are each an order of magnitude greater, likely the result of its extreme magnetic field, above the quantum critical threshold. We propose to continue our monitoring campaign of PSR~J1846-0258 to measure the braking index, characterize its timing noise, and search for evidence of timing glitches. Furthermore, an X- ray ephemeris contemporal with GLAST is critical to detecting the pulsar at higher energies.

  15. Monitoring Baby - Listening in on the Youngest Known Pulsar

    Science.gov (United States)

    Gotthelf, Eric

    We have discovered a most remarkable young pulsar, PSR J1846-0258, in the core of a Crab-like pulsar wind nebula at the center of the bright shell-type supernova remnant Kes 75. Based on its spin-down rate and X- ray spectrum, PSR J1846-0258 is likely the youngest known rotation- powered pulsar. Compared to the Crab pulsar, however, its period, spin- down rate, and spin-down to X-ray luminosity conversion efficiency are each an order of magnitude greater, likely the result of its extreme magnetic field, above the quantum critical threshold. We propose to continue our monitoring campaign of PSR J1846-0258 to measure the braking index, characterize its timing noise, and search for evidence of glitches. This pulsar provides important insight into the evolution of the youngest NS-SNR systems.

  16. G141.2+5.0, A NEW PULSAR WIND NEBULA DISCOVERED IN THE CYGNUS ARM OF THE MILKY WAY

    Energy Technology Data Exchange (ETDEWEB)

    Kothes, R.; Foster, T. J. [National Research Council Herzberg, Dominion Radio Astrophysical Observatory, P.O. Box 248, Penticton, British Columbia, V2A 6J9 (Canada); Sun, X. H. [Sydney Institute for Astronomy, School of Physics, The University of Sydney, NSW 2006 (Australia); Reich, W., E-mail: roland.kothes@nrc-cnrc.gc.ca [Max-Planck-Institut für Radioastronomie, Auf dem Hügel 69, D-53121 Bonn (Germany)

    2014-04-01

    We report the discovery of the new pulsar wind nebula (PWN) G141.2+5.0 in data observed with the Dominion Radio Astrophysical Observatory's Synthesis Telescope at 1420 MHz. The new PWN has a diameter of about 3.'5, which translates to a spatial extent of about 4 pc at a distance of 4.0 kpc. It displays a radio spectral index of α ≈ –0.7, similar to the PWN G76.9+1.1. G141.2+5.0 is highly polarized up to 40% with an average of 15% in the 1420 MHz data. It is located in the center of a small spherical H I bubble, which is expanding at a velocity of 6 km s{sup –1} at a systemic velocity of v {sub LSR} = –53 km s{sup –1}. The bubble could be the result of the progenitor star's mass loss or the shell-type supernova remnant (SNR) created by the same supernova explosion in a highly advanced stage. The systemic LSR velocity of the bubble shares the velocity of H I associated with the Cygnus spiral arm, which is seen across the second and third quadrants and an active star-forming arm immediately beyond the Perseus arm. A kinematical distance of 4 ± 0.5 kpc is found for G141.2+5.0, similar to the optical distance of the Cygnus arm (3.8 ± 1.1 kpc). G141.2+5.0 represents the first radio PWN discovered in 17 years and the first SNR discovered in the Cygnus spiral arm, which is in stark contrast with the Perseus arm's overwhelming population of shell-type remnants.

  17. Cepheus

    Science.gov (United States)

    Murdin, P.

    2000-11-01

    (abbrev. Cep, gen. Cephei; area 588 sq. deg.) A northern constellation which lies between Draco and Cassiopeia, and culminates at midnight in late August. It is named after King Cepheus, husband of Queen Cassiopeia and father of Andromeda in Greek mythology. Its brightest stars were cataloged by Ptolemy (c. AD 100-175) in the Almagest....

  18. A DETAILED STUDY OF NON-THERMAL X-RAY PROPERTIES AND INTERSTELLAR GAS TOWARD THE γ-RAY SUPERNOVA REMNANT RX J1713.7–3946

    Energy Technology Data Exchange (ETDEWEB)

    Sano, H.; Fukuda, T.; Yoshiike, S.; Sato, J.; Horachi, H.; Kuwahara, T.; Torii, K.; Hayakawa, T.; Matsumoto, H.; Inutsuka, S.; Yamamoto, H.; Tachihara, K. [Department of Physics, Nagoya University, Furo-cho, Chikusa-ku, Nagoya 464-8601 (Japan); Tanaka, T. [Department of Physics, Kyoto University, Kitashirakawa-oiwake-cho, Sakyo-ku, Kyoto 606-8502 (Japan); Inoue, T.; Kawamura, A.; Okuda, T.; Mizuno, N. [National Astronomical Observatory of Japan, Mitaka 181-8588 (Japan); Yamazaki, R. [Department of Physics and Mathematics, Aoyama Gakuin University, Fuchinobe, Chuou-ku, Sagamihara 252-5258 (Japan); Onishi, T. [Department of Astrophysics, Graduate School of Science, Osaka Prefecture University, 1-1 Gakuen-cho, Naka-ku, Sakai 599-8531 (Japan); Mizuno, A., E-mail: sano@a.phys.nagoya-u.ac.jp [Solar-Terrestrial Environment Laboratory, Nagoya University, Furo-cho, Chikusa-ku, Nagoya 464-8601 (Japan); and others

    2015-02-01

    We have carried out a spectral analysis of the Suzaku X-ray data in the 0.4-12 keV range toward the shell-type very high-energy γ-ray supernova remnant (SNR) RX J1713.7–3946. The aims of this analysis are to estimate detailed X-rays spectral properties at a high angular resolution up to 2 arcmin and to compare them with the interstellar gas. The X-ray spectrum is non-thermal and used to calculate absorbing column density, photon index, and absorption-corrected X-ray flux. The photon index varies significantly from 2.1 to 2.9. It is shown that the X-ray intensity is well correlated with the photon index, especially in the west region, with a correlation coefficient of 0.81. The X-ray intensity tends to increase with the averaged interstellar gas density while the dispersion is relatively large. The hardest spectra, with photon indexes of less than 2.4, are found outside of the central 10 arcmin of the SNR, from the north to the southeast (∼430 arcmin{sup 2}) and from the southwest to the northwest (∼150 arcmin{sup 2}). The former region shows low interstellar gas density, while the latter shows high interstellar gas density. We present a discussion of possible scenarios that explain the distribution of the photon index and its relationship with the interstellar gas.

  19. 2D AMESING multi-echo (31)P-MRSI of the liver at 7T allows transverse relaxation assessment and T2-weighted averaging for improved SNR

    NARCIS (Netherlands)

    Runge, Jurgen Henk; van der Kemp, Wybe J M; Klomp, DWJ; Luijten, Peter R; Nederveen, Aart J; Stoker, Jaap

    PURPOSE: Liver diseases are a major global health concern often requiring invasive assessment by needle biopsy. (31)P magnetic resonance spectroscopic imaging (MRSI) allows non-invasive probing of important liver metabolites. Recently, the adiabatic multi-echo spectroscopic imaging sequence with

  20. Maximizing signal-to-noise ratio (SNR) in 3-D large bandgap semiconductor pixelated detectors in optimal and non-optimal filtering conditions

    International Nuclear Information System (INIS)

    Rodrigues, Miesher L.; Serra, Andre da S.; He, Zhong; Zhu, Yuefeng

    2009-01-01

    3-D pixelated semiconductor detectors are used in radiation detection applications requiring spectroscopic and imaging information from radiation sources. Reconstruction algorithms used to determine direction and energy of incoming gamma rays can be improved by reducing electronic noise and using optimum filtering techniques. Position information can be improved by achieving sub-pixel resolution. Electronic noise is the limiting factor. Achieving sub-pixel resolution - position of the interaction better than one pixel pitch - in 3-D pixelated semiconductor detectors is a challenging task due to the fast transient characteristics of these signals. This work addresses two fundamental questions: the first is to determine the optimum filter, while the second is to estimate the achievable sub-pixel resolution using this filter. It is shown that the matched filter is the optimum filter when applying the signal-to-noise ratio criteria. Also, non-optimum filters are studied. The framework of 3-D waveform simulation using the Shockley-Ramo Theorem and the Hecht Equation for electron and hole trapping is presented in this work. This waveform simulator can be used to analyze current detectors as well as explore new ideas and concepts in future work. Numerical simulations show that assuming an electronic noise of 3.3 keV it is possible to subdivide the pixel region into 5x5 sub-pixels. After analyzing these results, it is suggested that sub-pixel information can also improve energy resolution. Current noise levels present the major drawback to both achieve sub-pixel resolution as well as improve energy resolution below the current limits. (author)

  1. NEW [SnR2(C2O42]2- (R = Ph, Bu MOIETY CONTAINING ADDUCTS AND COMPLEXES: SYNTHESIS, INFRARED AND MOSSBAUER STUDIES

    Directory of Open Access Journals (Sweden)

    YAYA SOW

    2015-05-01

    Full Text Available New oxalato and hydrogenoxalato organotin (IV derivatives containing mono- and bichelating oxalates or a monochelating hydrogenoxalate, have been synthesized and characterized by elemental analyses, infrared and Mossbauer spectroscopy. The suggested structures are discrete, the environments around the tin (IV atoms being trans octahedral, seven coordinated or tetrahedral. The cations when present are involved in NH…O bonds. A 1 D supramolecular architecture is suggested for SnPh2 (HC2O42.1/2 C6H6. The C6H6 molecules obtained in situ molecules are lattice. SnPh3OH is involved in hydrogen bonding.

  2. Discovery of Pulsations from the Pulsar J0205 6449 in SNR 3C 58 with the Fermi Gamma-Ray Space Telescope

    Energy Technology Data Exchange (ETDEWEB)

    Abdo, Aous A.; /Naval Research Lab, Wash., D.C.; Ackermann, M.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Ajello, Marco; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Atwood, William B.; /UC, Santa Cruz; Axelsson, M.; /Stockholm U., OKC /Stockholm U.; Baldini, L.; /INFN, Pisa; Ballet, J.; /DAPNIA, Saclay; Barbiellini, Guido; /INFN, Trieste /Trieste U.; Bastieri, Denis; /INFN, Padua /Padua U.; Baughman, B.M.; /Ohio State U.; Bechtol, K.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bellazzini, Ronaldo; /INFN, Pisa; Berenji, Bijan; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Blandford, Roger D.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bloom, Elliott D.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bonamente, E.; /INFN, Perugia /Perugia U.; Borgland, Anders W.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bouvier, A.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bregeon, J.; /INFN, Pisa; Brez, A.; /INFN, Pisa; Brigida, M.; /Bari U. /INFN, Bari /Ecole Polytechnique /Washington U., Seattle /Bari U. /INFN, Bari /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Columbia U. /IASF, Milan /IASF, Milan /DAPNIA, Saclay /INFN, Perugia /Perugia U. /NASA, Goddard /George Mason U. /Naval Research Lab, Wash., D.C. /NASA, Goddard /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /INFN, Perugia /Perugia U. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /LPCE, Orleans /Montpellier U. /Stockholm U., OKC /Royal Inst. Tech., Stockholm /Stockholm U. /Naval Research Lab, Wash., D.C. /INFN, Trieste /Bari U. /INFN, Bari /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /UC, Santa Cruz /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /CENBG, Gradignan /CENBG, Gradignan /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Manchester U. /Montpellier U. /Bari U. /INFN, Bari /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; /more authors..

    2011-12-01

    We report the discovery of {gamma}-ray pulsations ({ge}0.1 GeV) from the young radio and X-ray pulsar PSR J0205 + 6449 located in the Galactic supernova remnant 3C 58. Data in the {gamma}-ray band were acquired by the Large Area Telescope aboard the Fermi Gamma-ray Space Telescope (formerly GLAST), while the radio rotational ephemeris used to fold {gamma}-rays was obtained using both the Green Bank Telescope and the Lovell telescope at Jodrell Bank. The light curve consists of two peaks separated by 0.49 {+-} 0.01 {+-} 0.01 cycles which are aligned with the X-ray peaks. The first {gamma}-ray peak trails the radio pulse by 0.08 {+-} 0.01 {+-} 0.01, while its amplitude decreases with increasing energy as for the other {gamma}-ray pulsars. Spectral analysis of the pulsed {gamma}-ray emission suggests a simple power law of index -2.1 {+-} 0.1 {+-} 0.2 with an exponential cutoff at 3.0{sub -0.7}{sup +1.1} {+-} 0.4 GeV. The first uncertainty is statistical and the second is systematic. The integral {gamma}-ray photon flux above 0.1 GeV is (13.7 {+-} 1.4 {+-} 3.0) x 10{sup -8} cm{sup -2} s{sup -1}, which implies for a distance of 3.2 kpc and assuming a broad fan-like beam a luminosity of 8.3 x 10{sup 34} erg s{sup -1} and an efficiency {eta} of 0.3%. Finally, we report a 95% upper limit on the flux of 1.7 x 10{sup -8} cm{sup -2} s{sup -1} for off-pulse emission from the object.

  3. Discovery of Pulsations from the Pulsar J0205 6449 in SNR 3C 58 with the Fermi Gamma-Ray Space Telescope

    International Nuclear Information System (INIS)

    Abdo, Aous A.; Ackermann, M.; Ajello, Marco; Atwood, William B.; Axelsson, M.; Baldini, L.; Ballet, J.; Barbiellini, Guido; Bastieri, Denis; Baughman, B.M.; Bechtol, K.; Bellazzini, Ronaldo; Berenji, Bijan; Blandford, Roger D.; Bloom, Elliott D.; Bonamente, E.; Borgland, Anders W.; Bouvier, A.; Bregeon, J.; Brez, A.; Brigida, M.

    2009-01-01

    We report the discovery of γ-ray pulsations ((ge)0.1 GeV) from the young radio and X-ray pulsar PSR J0205 + 6449 located in the Galactic supernova remnant 3C 58. Data in the γ-ray band were acquired by the Large Area Telescope aboard the Fermi Gamma-ray Space Telescope (formerly GLAST), while the radio rotational ephemeris used to fold γ-rays was obtained using both the Green Bank Telescope and the Lovell telescope at Jodrell Bank. The light curve consists of two peaks separated by 0.49 ± 0.01 ± 0.01 cycles which are aligned with the X-ray peaks. The first γ-ray peak trails the radio pulse by 0.08 ± 0.01 ± 0.01, while its amplitude decreases with increasing energy as for the other γ-ray pulsars. Spectral analysis of the pulsed γ-ray emission suggests a simple power law of index -2.1 ± 0.1 ± 0.2 with an exponential cutoff at 3.0 -0.7 +1.1 ± 0.4 GeV. The first uncertainty is statistical and the second is systematic. The integral γ-ray photon flux above 0.1 GeV is (13.7 ± 1.4 ± 3.0) x 10 -8 cm -2 s -1 , which implies for a distance of 3.2 kpc and assuming a broad fan-like beam a luminosity of 8.3 x 10 34 erg s -1 and an efficiency η of 0.3%. Finally, we report a 95% upper limit on the flux of 1.7 x 10 -8 cm -2 s -1 for off-pulse emission from the object.

  4. DISCOVERY OF PULSATIONS FROM THE PULSAR J0205+6449 IN SNR 3C 58 WITH THE FERMI GAMMA-RAY SPACE TELESCOPE

    International Nuclear Information System (INIS)

    Abdo, A. A.; Ackermann, M.; Ajello, M.; Bechtol, K.; Berenji, B.; Blandford, R. D.; Bloom, E. D.; Borgland, A. W.; Bouvier, A.; Atwood, W. B.; Axelsson, M.; Baldini, L.; Bellazzini, R.; Bregeon, J.; Brez, A.; Ballet, J.; Barbiellini, G.; Bastieri, D.; Baughman, B. M.; Bonamente, E.

    2009-01-01

    We report the discovery of γ-ray pulsations (≥0.1 GeV) from the young radio and X-ray pulsar PSR J0205 + 6449 located in the Galactic supernova remnant 3C 58. Data in the γ-ray band were acquired by the Large Area Telescope aboard the Fermi Gamma-ray Space Telescope (formerly GLAST), while the radio rotational ephemeris used to fold γ-rays was obtained using both the Green Bank Telescope and the Lovell telescope at Jodrell Bank. The light curve consists of two peaks separated by 0.49 ± 0.01 ± 0.01 cycles which are aligned with the X-ray peaks. The first γ-ray peak trails the radio pulse by 0.08 ± 0.01 ± 0.01, while its amplitude decreases with increasing energy as for the other γ-ray pulsars. Spectral analysis of the pulsed γ-ray emission suggests a simple power law of index -2.1 ± 0.1 ± 0.2 with an exponential cutoff at 3.0 +1.1 -0.7 ± 0.4 GeV. The first uncertainty is statistical and the second is systematic. The integral γ-ray photon flux above 0.1 GeV is (13.7 ± 1.4 ± 3.0) x 10 -8 cm -2 s -1 , which implies for a distance of 3.2 kpc and assuming a broad fan-like beam a luminosity of 8.3 x 10 34 erg s -1 and an efficiency η of 0.3%. Finally, we report a 95% upper limit on the flux of 1.7 x 10 -8 cm -2 s -1 for off-pulse emission from the object.

  5. Deeper H.E.S.S. observations of Vela Junior (RX J0852.0-4622): Morphology studies and resolved spectroscopy

    Science.gov (United States)

    H.E.S.S. Collaboration; Abdalla, H.; Abramowski, A.; Aharonian, F.; Ait Benkhali, F.; Akhperjanian, A. G.; Angüner, E. O.; Arakawa, M.; Arrieta, M.; Aubert, P.; Backes, M.; Balzer, A.; Barnard, M.; Becherini, Y.; Becker Tjus, J.; Berge, D.; Bernhard, S.; Bernlöhr, K.; Blackwell, R.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bordas, P.; Bregeon, J.; Brun, F.; Brun, P.; Bryan, M.; Büchele, M.; Bulik, T.; Capasso, M.; Carr, J.; Casanova, S.; Cerruti, M.; Chakraborty, N.; Chalme-Calvet, R.; Chaves, R. C. G.; Chen, A.; Chevalier, J.; Chrétien, M.; Coffaro, M.; Colafrancesco, S.; Cologna, G.; Condon, B.; Conrad, J.; Cui, Y.; Davids, I. D.; Decock, J.; Degrange, B.; Deil, C.; Devin, J.; deWilt, P.; Dirson, L.; Djannati-Ataï, A.; Domainko, W.; Donath, A.; Drury, L. O.'C.; Dutson, K.; Dyks, J.; Edwards, T.; Egberts, K.; Eger, P.; Ernenwein, J.-P.; Eschbach, S.; Farnier, C.; Fegan, S.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Förster, A.; Funk, S.; Füßling, M.; Gabici, S.; Gajdus, M.; Gallant, Y. A.; Garrigoux, T.; Giavitto, G.; Giebels, B.; Glicenstein, J. F.; Gottschall, D.; Goyal, A.; Grondin, M.-H.; Hahn, J.; Haupt, M.; Hawkes, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hervet, O.; Hinton, J. A.; Hofmann, W.; Hoischen, C.; Holler, M.; Horns, D.; Ivascenko, A.; Iwasaki, H.; Jacholkowska, A.; Jamrozy, M.; Janiak, M.; Jankowsky, D.; Jankowsky, F.; Jingo, M.; Jogler, T.; Jouvin, L.; Jung-Richardt, I.; Kastendieck, M. A.; Katarzyński, K.; Katsuragawa, M.; Katz, U.; Kerszberg, D.; Khangulyan, D.; Khélifi, B.; Kieffer, M.; King, J.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Kolitzus, D.; Komin, Nu.; Krakau, S.; Kraus, M.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lau, J.; Lees, J.-P.; Lefaucheur, J.; Lefranc, V.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Leser, E.; Lohse, T.; Lorentz, M.; Liu, R.; López-Coto, R.; Lypova, I.; Marandon, V.; Marcowith, A.; Mariaud, C.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; Meintjes, P. J.; Meyer, M.; Mitchell, A. M. W.; Moderski, R.; Mohamed, M.; Mohrmann, L.; Morå, K.; Moulin, E.; Murach, T.; Nakashima, S.; de Naurois, M.; Niederwanger, F.; Niemiec, J.; Oakes, L.; O'Brien, P.; Odaka, H.; Öttl, S.; Ohm, S.; Ostrowski, M.; Oya, I.; Padovani, M.; Panter, M.; Parsons, R. D.; Paz Arribas, M.; Pekeur, N. W.; Pelletier, G.; Perennes, C.; Petrucci, P.-O.; Peyaud, B.; Piel, Q.; Pita, S.; Poon, H.; Prokhorov, D.; Prokoph, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Reimer, A.; Reimer, O.; Renaud, M.; de los Reyes, R.; Richter, S.; Rieger, F.; Romoli, C.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Saito, S.; Salek, D.; Sanchez, D. A.; Santangelo, A.; Sasaki, M.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwemmer, S.; Seglar-Arroyo, M.; Settimo, M.; Seyffert, A. S.; Shafi, N.; Shilon, I.; Simoni, R.; Sol, H.; Spanier, F.; Spengler, G.; Spies, F.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stycz, K.; Sushch, I.; Takahashi, T.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tibaldo, L.; Tiziani, D.; Tluczykont, M.; Trichard, C.; Tsuji, N.; Tuffs, R.; Uchiyama, Y.; van der Walt, D. J.; van Eldik, C.; van Rensburg, C.; van Soelen, B.; Vasileiadis, G.; Veh, J.; Venter, C.; Viana, A.; Vincent, P.; Vink, J.; Voisin, F.; Völk, H. J.; Vuillaume, T.; Wadiasingh, Z.; Wagner, S. J.; Wagner, P.; Wagner, R. M.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Yang, R.; Zabalza, V.; Zaborov, D.; Zacharias, M.; Zanin, R.; Zdziarski, A. A.; Zech, A.; Zefi, F.; Ziegler, A.; Żywucka, N.

    2018-04-01

    Aims: We study γ-ray emission from the shell-type supernova remnant (SNR) RX J0852.0-4622 to better characterize its spectral properties and its distribution over the SNR. Methods: The analysis of an extended High Energy Spectroscopic System (H.E.S.S.) data set at very high energies (E > 100 GeV) permits detailed studies, as well as spatially resolved spectroscopy, of the morphology and spectrum of the whole RX J0852.0-4622 region. The H.E.S.S. data are combined with archival data from other wavebands and interpreted in the framework of leptonic and hadronic models. The joint Fermi-LAT-H.E.S.S. spectrum allows the direct determination of the spectral characteristics of the parent particle population in leptonic and hadronic scenarios using only GeV-TeV data. Results: An updated analysis of the H.E.S.S. data shows that the spectrum of the entire SNR connects smoothly to the high-energy spectrum measured by Fermi-LAT. The increased data set makes it possible to demonstrate that the H.E.S.S. spectrum deviates significantly from a power law and is well described by both a curved power law and a power law with an exponential cutoff at an energy of Ecut = (6.7 ± 1.2stat ± 1.2syst) TeV. The joint Fermi-LAT-H.E.S.S. spectrum allows the unambiguous identification of the spectral shape as a power law with an exponential cutoff. No significant evidence is found for a variation of the spectral parameters across the SNR, suggesting similar conditions of particle acceleration across the remnant. A simple modeling using one particle population to model the SNR emission demonstrates that both leptonic and hadronic emission scenarios remain plausible. It is also shown that at least a part of the shell emission is likely due to the presence of a pulsar wind nebula around PSR J0855-4644. A FITS image of the region of interest and two text files describing the H.E.S.S. spectrum of RX J0852.0-4622 are only available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (http

  6. DISCOVERY OF TeV GAMMA-RAY EMISSION FROM CTA 1 BY VERITAS

    Energy Technology Data Exchange (ETDEWEB)

    Aliu, E.; Errando, M. [Department of Physics and Astronomy, Barnard College, Columbia University, NY 10027 (United States); Archambault, S. [Physics Department, McGill University, Montreal, QC H3A 2T8 (Canada); Arlen, T. [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095 (United States); Aune, T.; Bouvier, A. [Santa Cruz Institute for Particle Physics and Department of Physics, University of California, Santa Cruz, CA 95064 (United States); Beilicke, M.; Buckley, J. H.; Bugaev, V.; Dickherber, R. [Department of Physics, Washington University, St. Louis, MO 63130 (United States); Benbow, W. [Fred Lawrence Whipple Observatory, Harvard-Smithsonian Center for Astrophysics, Amado, AZ 85645 (United States); Cesarini, A.; Connolly, M. P. [School of Physics, National University of Ireland Galway, University Road, Galway (Ireland); Ciupik, L. [Astronomy Department, Adler Planetarium and Astronomy Museum, Chicago, IL 60605 (United States); Collins-Hughes, E. [School of Physics, University College Dublin, Belfield, Dublin 4 (Ireland); Cui, W. [Department of Physics, Purdue University, West Lafayette, IN 47907 (United States); Duke, C. [Department of Physics, Grinnell College, Grinnell, IA 50112-1690 (United States); Dumm, J. [School of Physics and Astronomy, University of Minnesota, Minneapolis, MN 55455 (United States); Dwarkadas, V. V. [Department of Astronomy and Astrophysics, University of Chicago, Chicago, IL 60637 (United States); Falcone, A., E-mail: muk@astro.columbia.edu, E-mail: smcarthur@ulysses.uchicago.edu [Department of Astronomy and Astrophysics, 525 Davey Lab, Pennsylvania State University, University Park, PA 16802 (United States); and others

    2013-02-10

    We report the discovery of TeV gamma-ray emission coincident with the shell-type radio supernova remnant (SNR) CTA 1 using the VERITAS gamma-ray observatory. The source, VER J0006+729, was detected as a 6.5 standard deviation excess over background and shows an extended morphology, approximated by a two-dimensional Gaussian of semimajor (semiminor) axis 0. Degree-Sign 30 (0. Degree-Sign 24) and a centroid 5' from the Fermi gamma-ray pulsar PSR J0007+7303 and its X-ray pulsar wind nebula (PWN). The photon spectrum is well described by a power-law dN/dE = N {sub 0}(E/3 TeV){sup -{Gamma}}, with a differential spectral index of {Gamma} = 2.2 {+-} 0.2{sub stat} {+-} 0.3{sub sys}, and normalization N {sub 0} = (9.1 {+-} 1.3{sub stat} {+-} 1.7{sub sys}) Multiplication-Sign 10{sup -14} cm{sup -2} s{sup -1} TeV{sup -1}. The integral flux, F {sub {gamma}} = 4.0 Multiplication-Sign 10{sup -12} erg cm{sup -2} s{sup -1} above 1 TeV, corresponds to 0.2% of the pulsar spin-down power at 1.4 kpc. The energetics, colocation with the SNR, and the relatively small extent of the TeV emission strongly argue for the PWN origin of the TeV photons. We consider the origin of the TeV emission in CTA 1.

  7. NuSTAR discovery of a young, energetic pulsar associated with the luminous gamma-ray source Hess J1640-465

    DEFF Research Database (Denmark)

    Gotthelf, E. V.; Tomsick, J. A.; Halpern, J. P.

    2014-01-01

    We report the discovery of a 206 ms pulsar associated with the TeV γ-ray source HESS J1640-465 using the Nuclear Spectroscopic Telescope Array (NuSTAR) X-ray observatory. PSR J1640-4631 lies within the shell-type supernova remnant (SNR) G338.3-0.0, and coincides with an X-ray point source...... and putative pulsar wind nebula (PWN) previously identified in XMM-Newton and Chandra images. It is spinning down rapidly with period derivative 9.758(44) × 10-13, yielding a spin-down luminosity 4.4 × 1036 erg s-1, characteristic age 3350 yr, and surface dipole magnetic field strength Bs = 1.4 × 1013 G....... For the measured distance of 12 kpc to G338.3-0.0, the 0.2-10 TeV luminosity of HESS J1640-465 is 6% of the pulsar's present . The Fermi source 1FHL J1640.5-4634 is marginally coincident with PSR J1640-4631, but we find no γ-ray pulsations in a search using five years of Fermi Large Area Telescope (LAT) data...

  8. Screening a yeast promoter library leads to the isolation of the RP29/L32 and SNR17B/RPL37A divergent promoters and the discovery of a gene encoding ribosomal protein L37.

    Science.gov (United States)

    Santangelo, G M; Tornow, J; McLaughlin, C S; Moldave, K

    1991-08-30

    Two promoters (A7 and A23), isolated at random from the Saccharomyces cerevisiae genome by virtue of their capacity to activate transcription, are identical to known intergenic bidirectional promoters. Sequence analysis of the genomic DNA adjacent to the A7 promoter identified a split gene encoding ribosomal (r) protein L37, which is homologous to the tRNA-binding r-proteins, L35a (from human and rat) and L32 (from frogs).

  9. TeV γ-ray observations of the young synchrotron-dominated SNRs G1.9+0.3 and G330.2+1.0 with H.E.S.S.

    Science.gov (United States)

    H.E.S.S. Collaboration; Abramowski, A.; Aharonian, F.; Benkhali, F. Ait; Akhperjanian, A. G.; Angüner, E.; Anton, G.; Balenderan, S.; Balzer, A.; Barnacka, A.; Becherini, Y.; Becker Tjus, J.; Bernlöhr, K.; Birsin, E.; Bissaldi, E.; Biteau, J.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bordas, P.; Brucker, J.; Brun, F.; Brun, P.; Bulik, T.; Carrigan, S.; Casanova, S.; Cerruti, M.; Chadwick, P. M.; Chalme-Calvet, R.; Chaves, R. C. G.; Cheesebrough, A.; Chrétien, M.; Colafrancesco, S.; Cologna, G.; Conrad, J.; Couturier, C.; Cui, Y.; Dalton, M.; Daniel, M. K.; Davids, I. D.; Degrange, B.; Deil, C.; deWilt, P.; Dickinson, H. J.; Djannati-Ataï, A.; Domainko, W.; O'C. Drury, L.; Dubus, G.; Dutson, K.; Dyks, J.; Dyrda, M.; Edwards, T.; Egberts, K.; Eger, P.; Espigat, P.; Farnier, C.; Fegan, S.; Feinstein, F.; Fernandes, M. V.; Fernandez, D.; Fiasson, A.; Fontaine, G.; Förster, A.; Füßling, M.; Gajdus, M.; Gallant, Y. A.; Garrigoux, T.; Giavitto, G.; Giebels, B.; Glicenstein, J. F.; Grondin, M.-H.; Grudzińska, M.; Häffner, S.; Hahn, J.; Harris, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hervet, O.; Hillert, A.; Hinton, J. A.; Hofmann, W.; Hofverberg, P.; Holler, M.; Horns, D.; Jacholkowska, A.; Jahn, C.; Jamrozy, M.; Janiak, M.; Jankowsky, F.; Jung, I.; Kastendieck, M. A.; Katarzyński, K.; Katz, U.; Kaufmann, S.; Khélifi, B.; Kieffer, M.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Kneiske, T.; Kolitzus, D.; Komin, Nu.; Kosack, K.; Krakau, S.; Krayzel, F.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lefaucheur, J.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Lennarz, D.; Lohse, T.; Lopatin, A.; Lu, C.-C.; Marandon, V.; Marcowith, A.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; McComb, T. J. L.; Méhault, J.; Meintjes, P. J.; Menzler, U.; Meyer, M.; Moderski, R.; Mohamed, M.; Moulin, E.; Murach, T.; Naumann, C. L.; de Naurois, M.; Niemiec, J.; Nolan, S. J.; Oakes, L.; Ohm, S.; Wilhelmi, E. de Oña; Opitz, B.; Ostrowski, M.; Oya, I.; Panter, M.; Parsons, R. D.; Arribas, M. Paz; Pekeur, N. W.; Pelletier, G.; Perez, J.; Petrucci, P.-O.; Peyaud, B.; Pita, S.; Poon, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Raue, M.; Reimer, A.; Reimer, O.; Renaud, M.; Reyes, R. de los; Rieger, F.; Rob, L.; Romoli, C.; Rosier-Lees, S.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Sanchez, D. A.; Santangelo, A.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwarzburg, S.; Schwemmer, S.; Sol, H.; Spengler, G.; Spies, F.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stinzing, F.; Stycz, K.; Sushch, I.; Szostek, A.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tluczykont, M.; Trichard, C.; Valerius, K.; van Eldik, C.; van Soelen, B.; Vasileiadis, G.; Venter, C.; Viana, A.; Vincent, P.; Völk, H. J.; Volpe, F.; Vorster, M.; Vuillaume, T.; Wagner, S. J.; Wagner, P.; Ward, M.; Weidinger, M.; Weitzel, Q.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Zabalza, V.; Zacharias, M.; Zajczyk, A.; Zdziarski, A. A.; Zech, A.; Zechlin, H.-S.

    2014-06-01

    The non-thermal nature of the X-ray emission from the shell-type supernova remnants (SNRs) G1.9+0.3 and G330.2+1.0 is an indication of intense particle acceleration in the shock fronts of both objects. This suggests that the SNRs are prime candidates for very-high-energy (VHE; E > 0.1 TeV) γ-ray observations. G1.9+0.3, recently established as the youngest known SNR in the Galaxy, also offers a unique opportunity to study the earliest stages of SNR evolution in the VHE domain. The purpose of this work is to probe the level of VHE γ-ray emission from both SNRs and use this to constrain their physical properties. Observations were conducted with the H.E.S.S. (High Energy Stereoscopic System) Cherenkov Telescope Array over a more than six-year period spanning 2004-2010. The obtained data have effective livetimes of 67 h for G1.9+0.3 and 16 h for G330.2+1.0. The data are analysed in the context of the multiwavelength observations currently available and in the framework of both leptonic and hadronic particle acceleration scenarios. No significant γ-ray signal from G1.9+0.3 or G330.2+1.0 was detected. Upper limits (99 per cent confidence level) to the TeV flux from G1.9+0.3 and G330.2+1.0 for the assumed spectral index Γ = 2.5 were set at 5.6 × 10-13 cm-2 s-1 above 0.26 TeV and 3.2 × 10-12 cm-2 s-1 above 0.38 TeV, respectively. In a one-zone leptonic scenario, these upper limits imply lower limits on the interior magnetic field to BG1.9 ≳ 12 μG for G1.9+0.3 and to BG330 ≳ 8 μG for G330.2+1.0. In a hadronic scenario, the low ambient densities and the large distances to the SNRs result in very low predicted fluxes, for which the H.E.S.S. upper limits are not constraining.

  10. NuSTAR discovery of a young, energetic pulsar associated with the luminous gamma-ray source HESS J1640–465

    Energy Technology Data Exchange (ETDEWEB)

    Gotthelf, E. V.; Halpern, J. P.; Hailey, J. C. [Columbia Astrophysics Laboratory, Columbia University, 550 West 120th Street, New York, NY 10027-6601 (United States); Tomsick, J. A.; Boggs, S. E.; Craig, W. W. [Space Sciences Laboratory, University of California, Berkeley, CA 94720 (United States); Gelfand, J. D. [NYU Abu Dhabi, PO Box 129188, Abu Dhabi (United Arab Emirates); Harrison, F. A. [Cahill Center for Astronomy and Astrophysics, California Institute of Technology, Pasadena, CA 91125 (United States); Christensen, F. E. [DTU Space-National Space Institute, Technical University of Denmark, Elektrovej 327, 2800 Lyngby (Denmark); Kaspi, V. M. [Department of Physics, McGill University, Montreal, QC H3A 2T8 (Canada); Stern, D. K. [Jet Propulsion Laboratory, California Institute of Technology, 4800 Oak Grove Drive, Pasadena, CA 91109 (United States); Zhang, W. W., E-mail: eric@astro.columbia.edu [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States)

    2014-06-20

    We report the discovery of a 206 ms pulsar associated with the TeV γ-ray source HESS J1640–465 using the Nuclear Spectroscopic Telescope Array (NuSTAR) X-ray observatory. PSR J1640–4631 lies within the shell-type supernova remnant (SNR) G338.3–0.0, and coincides with an X-ray point source and putative pulsar wind nebula (PWN) previously identified in XMM-Newton and Chandra images. It is spinning down rapidly with period derivative P-dot = 9.758(44) × 10{sup –13}, yielding a spin-down luminosity E-dot = 4.4 × 10{sup 36} erg s{sup –1}, characteristic age τ{sub c}≡P/2 P-dot = 3350 yr, and surface dipole magnetic field strength B{sub s} = 1.4 × 10{sup 13} G. For the measured distance of 12 kpc to G338.3–0.0, the 0.2-10 TeV luminosity of HESS J1640–465 is 6% of the pulsar's present E-dot . The Fermi source 1FHL J1640.5–4634 is marginally coincident with PSR J1640–4631, but we find no γ-ray pulsations in a search using five years of Fermi Large Area Telescope (LAT) data. The pulsar energetics support an evolutionary PWN model for the broadband spectrum of HESS J1640–465, provided that the pulsar's braking index is n ≈ 2, and that its initial spin period was P {sub 0} ∼ 15 ms.

  11. First data from X-ray astronomy satellite

    International Nuclear Information System (INIS)

    Cox, J.

    1984-01-01

    EXOSAT, the European Space Agency's first x-ray astronomy satellite which was launched last year, has sent back information on x-ray sources. The article briefly discusses the observations made by the satellite concerning Cygnus x-1 and the galactic supernova remnant Cassiopeia A. EXOSAT is the first x-ray astronomy satellite to be operated in a deep space orbit

  12. A Spatial Study of X-ray Properties in Superbubble 30 Dor C with XMM-Newton

    Science.gov (United States)

    Babazaki, Yasunori; Mitsuishi, Ikuyuki; SANO, Hidetoshi; Yoshiike, Satoshi; Fukuda, Tatsuya; Maruyama, Shohei; Fujii, Kosuke; Fukui, Yasuo; Tawara, Yuzuru; Matsumoto, Hironori

    2015-08-01

    Supernova remnants (SNRs) in the Galaxy are believed to be most likely accelerators of cosmic-rays (CRs) in an energy range less than 3×10^15 eV. Thus SNRs emit synchrotron X-rays by high-energy electrons. Sano et al. (2014) investigated spatially-resolved X-ray spectral properties of a shell-type SNR RX1713.77-3946 which shows strong non-thermal X-ray emissions. A large variation in the photon index is found and the photon index tends to be hard with increasing an interstellar gas density, suggesting that CR electrons are efficiently accelerated in denser interstellar gas environments. Few studies have focused on a photon index variation in superbubbles which possess 100-1000 pc diameter shells of swept-up interstellar materials containing hot (~10^6 K) shock-heated gas. The superbubble 30 Dor C in the Large Magellanic Cloud is one of the best targets for examining the photon index variation, because 30 Dor C is by far strong non-thermal X-ray emissions, and thus provides an ideal laboratory for probing non-thermal emission mechanisms in the supperbubble. We investigated X-ray spectral properties of the superbubble with a high spatial resolution of on the order of 10 pc. Consequently, the spectra in the west region of 30 Dor C can be described with a combination of absorbed thermal and non-thermal models while the spectra in the east region can be fitted with an absorbed non-thermal model. The photon index and intensity in 2-10 keV show variations of 2.0-3.5 and (0.6-8.0) × 10^-7 erg/s/cm^2, respectively. The temperature of the thermal component ranges from ~0.1 to ~0.3 keV. We will discuss an interaction between the hot gas and an interstellar gas using mutiwavelength data.

  13. Andromeda

    Science.gov (United States)

    Murdin, P.

    2000-11-01

    (abbrev. And, gen. Andromedae; area 722 sq. deg.) A northern constellation that lies between Perseus and Pegasus, and culminates at midnight in early October. It is named after the daughter of King Cepheus and Queen Cassiopeia in Greek mythology, who was rescued by Perseus from being sacrificed to the sea monster Cetus, and is usually shown on early celestial charts as a chained maiden. Its brigh...

  14. Smoking supernovae

    OpenAIRE

    Gomez, Haley Louise; Eales, Stephen Anthony; Dunne, L.

    2007-01-01

    The question ‘Are supernovae important sources of dust?’ is a contentious one. Observations with the Infrared Astronomical Satellite (IRAS) and the Infrared Space Observatory (ISO) only detected very small amounts of hot dust in supernova remnants. Here, we review observations of two young Galactic remnants with the Submillimetre Common User Bolometer Array (SCUBA), which imply that large quantities of dust are produced by supernovae. The association of dust with the Cassiopeia A remnant is i...

  15. Supernova explosion in a very massive star

    International Nuclear Information System (INIS)

    El Eid, M.F.

    1986-07-01

    We describe the final evolution of a 100 solar mass following an evolutionary scenario during which the star evolves from a Wolf-Rayet stage through the electron- positron pair creation supernova. We find that the star is completely disrupted by explosive oxygen burning, and this type of explosion as a possible scenario for the Cassiopeia A remnant. This scenario seems to be also applicable to the supernova 1985f according to the recent observations of this object

  16. Active Optical Devices and Applications. Volume 228

    Science.gov (United States)

    1980-04-01

    Research Center, Minneapolis, Minnesota 55413 Abstract In this paper a control engineer’s point of view of the Large Space Structure (LSS) problem is...CASSIOPEIA SUPERNOVA REMNANT GALAXIES IN VIRGO CLUSTER QUASAR 3C273 CRAB PULSAR Figure 2. A collage of images of X-ray sources obtained with the HEAO...Telescope. Yet ST will not be able to study vari- able stars (primary distance indicators) to the Virgo cluster of galaxies and beyond. This cluster is

  17. Particle acceleration and nonthermal radiation in supernova remnants

    International Nuclear Information System (INIS)

    Zirakashvili, Vladimir

    2013-01-01

    Cosmic ray acceleration and magnetic amplification in shell-type supernova remnants is shortly reviewed. The results on the modeling of broadband electromagnetic emission from supernova remnants are presented and compared with observations.

  18. Outage analysis of opportunistic decode-and-forward relaying

    KAUST Repository

    Tourki, Kamel; Yang, Hongchuan; Alouini, Mohamed-Slim

    2010-01-01

    focused on high signal-to-noise ratio (SNR) regime, such results are important to enable the designers to take decisions regarding practical systems that operate at low SNR regime. We show that performance simulation results coincide with our analytical

  19. Observations of Non Typical Masers at the RT-22 Radio Telescope in 2004-2013

    Science.gov (United States)

    Shulga, V. M.; Antyufeyev, O. V.; Zubrin, S. Y.; Myshenko, V. V.; Piddyachiy, V. I.; Korolev, A. M.; Patoka, O. M.

    2017-06-01

    Purpose: Some peculiarities of emission of Class I methanol masers on the 80-71A+ transition at 95 GHz in sources closely associated with protostar-forming regions and in supernova remnants are studied. Here belongs the investigation of SiO (J=2-1) maser variability in R Cassiopeiae, too. Design/methodology/approach: Search for Class I methanol masers is based on the idea of coincidence of regions of their emission with sources of OH masing transition in the bottom level of energy at frequency of 1720 MHz (2Π3/2 J=3/2 F=2-1). Findings: Two methanol masers on transition 80-71A+ (95 GHz) in the supernova remnants IC 443 and Kes 79 are detected. Variabilities of SiO maser emission on transition J=2-1 in R Cassiopeiae are shown for the first time. Conclusions: Variability of methanol and SiO masers is their general feature. On the example of three objects, the possibility of using the 1720 MHz OH maser as an indicator in the search for Class I methanol masers is shown. Especially it is important in the study of methanol maser emission in supernova remnants that has been proved to be true by detection of methanol masers on transition 80-71A+ (95 GHz) in IC 443 and Kes 79. Features of spectra variability of emission in R Cassiopeiae testify to formation and disappearance of SiO (J=2-1) masers.

  20. 75 FR 34688 - Ball Bearings and Parts Thereof from France: Final Results of Changed-Circumstances Review

    Science.gov (United States)

    2010-06-18

    ...The Department of Commerce (the Department) has determined, pursuant to section 751(b) of the Tariff Act of 1930, as amended (the Act), that, after acquisition of SNR Roulements S.A. by NTN Corporation, post-acquisition SNR Roulements S.A. is the successor-in- interest to pre-acquisition SNR Roulements S.A.

  1. Efficient power allocation for fixed-gain amplify-and-forward relaying in rayleigh fading

    KAUST Repository

    Zafar, Ammar; Radaydeh, Redha Mahmoud; Chen, Yunfei; Alouini, Mohamed-Slim

    2013-01-01

    -to-end signal-to-noise ratio (SNR) and 2) minimizing the total consumed power while maintaining the end-to-end SNR over a threshold value. We assume that the relays have knowledge of only the channel statistics of all the links. We show that the SNR maximization

  2. Effect of Core-Shell Ag@TiO2 Volume Ratio on Characteristics of TiO2-Based DSSCs

    Directory of Open Access Journals (Sweden)

    Ho Chang

    2014-01-01

    Full Text Available This paper aims to develop photoanode material required by dye-sensitized solar cells. The material prepared is in the form of Ag@TiO2 core-shell-type nanocomposites. This material is used to replace the titanium oxide powder commonly used in general DSSCs. The prepared Ag@TiO2 core-shell-type nanocomposites are mixed with Degussa P25 TiO2 in different proportions. Triton X-100 is added and polyethylene glycol (PEG at 20 wt% is used as a polymer additive. This study tests the particle size and material properties of Ag@TiO2 core-shell-type nanocomposites and measures the photoelectric conversion efficiency and IPCE of DSSCs. Experimental results show that the DSSC prepared by Ag@TiO2 core-shell-type nanocomposites can achieve a photoelectric conversion efficiency of 3.67%. When Ag@TiO2 core-shell-type nanocomposites are mixed with P25 nanoparticles in specific proportions, and when the thickness of the photoelectrode thin film is 28 μm, the photoelectric conversion efficiency can reach 6.06%, with a fill factor of 0.52, open-circuit voltage of 0.64V, and short-circuit density of 18.22 mAcm−2. Compared to the DSSC prepared by P25 TiO2 only, the photoelectric conversion efficiency can be raised by 38% under the proposed approach.

  3. Signal-to-noise ratio of FT-IR CO gas spectra

    DEFF Research Database (Denmark)

    Bak, J.; Clausen, Sønnik

    1999-01-01

    in emission and transmission spectrometry, an investigation of the SNR in CO gas spectra as a function of spectral resolution has been carried out. We present a method to (1) determine experimentally the SNR at constant throughput, (2) determine the SNR on the basis of measured noise levels and Hitran......The minimum amount of a gaseous compound which can be detected and quantified with Fourier transform infrared (FT-IR) spectrometers depends on the signal-to-noise ratio (SNR) of the measured gas spectra. In order to use low-resolution FT-IR spectrometers to measure combustion gases like CO and CO2...... simulated signals, and (3) determine the SNR of CO from high to low spectral resolutions related to the molecular linewidth and vibrational-rotational lines spacing. In addition, SNR values representing different spectral resolutions but scaled to equal measurement times were compared. It was found...

  4. A Python Calculator for Supernova Remnant Evolution

    Science.gov (United States)

    Leahy, D. A.; Williams, J. E.

    2017-05-01

    A freely available Python code for modeling supernova remnant (SNR) evolution has been created. This software is intended for two purposes: to understand SNR evolution and to use in modeling observations of SNR for obtaining good estimates of SNR properties. It includes all phases for the standard path of evolution for spherically symmetric SNRs. In addition, alternate evolutionary models are available, including evolution in a cloudy ISM, the fractional energy-loss model, and evolution in a hot low-density ISM. The graphical interface takes in various parameters and produces outputs such as shock radius and velocity versus time, as well as SNR surface brightness profile and spectrum. Some interesting properties of SNR evolution are demonstrated using the program.

  5. Symbol signal-to-noise ratio loss in square-wave subcarrier downconversion

    Science.gov (United States)

    Feria, Y.; Statman, J.

    1993-01-01

    This article presents the simulated results of the signal-to-noise ratio (SNR) loss in the process of a square-wave subcarrier down conversion. In a previous article, the SNR degradation was evaluated at the output of the down converter based on the signal and noise power change. Unlike in the previous article, the SNR loss is defined here as the difference between the actual and theoretical symbol SNR's for the same symbol-error rate at the output of the symbol matched filter. The results show that an average SNR loss of 0.3 dB can be achieved with tenth-order infinite impulse response (IIR) filters. This loss is a 0.2-dB increase over the SNR degradation in the previous analysis where neither the signal distortion nor the symbol detector was considered.

  6. The position dependent influence that sensitivity correction processing gives the signal-to-noise ratio measurement in parallel imaging

    International Nuclear Information System (INIS)

    Murakami, Koichi; Yoshida, Koji; Yanagimoto, Shinichi

    2012-01-01

    We studied the position dependent influence that sensitivity correction processing gave the signal-to-noise ratio (SNR) measurement of parallel imaging (PI). Sensitivity correction processing that referred to the sensitivity distribution of the body coil improved regional uniformity more than the sensitivity uniformity correction filter with a fixed correction factor. In addition, the position dependent influence to give the SNR measurement in PI was different from the sensitivity correction processing. Therefore, if we divide SNR of the sensitivity correction processing image by SNR of the original image in each pixel and calculate SNR ratio, we can show the position dependent influence that sensitivity correction processing gives the SNR measurement in PI. It is with an index of the sensitivity correction processing precision. (author)

  7. The response of a linear monostable system and its application in parameters estimation for PSK signals

    Science.gov (United States)

    Duan, Chaowei; Zhan, Yafeng

    2016-03-01

    The output characteristics of a linear monostable system driven with a periodic signal and an additive white Gaussian noise are studied in this paper. Theoretical analysis shows that the output signal-to-noise ratio (SNR) decreases monotonously with the increasing noise intensity but the output SNR-gain is stable. Inspired by this high SNR-gain phenomenon, this paper applies the linear monostable system in the parameters estimation algorithm for phase shift keying (PSK) signals and improves the estimation performance.

  8. Subthalamic nucleus electrical stimulation modulates calcium activity of nigral astrocytes.

    Directory of Open Access Journals (Sweden)

    Elodie Barat

    Full Text Available The substantia nigra pars reticulata (SNr is a major output nucleus of the basal ganglia, delivering inhibitory efferents to the relay nuclei of the thalamus. Pathological hyperactivity of SNr neurons is known to be responsible for some motor disorders e.g. in Parkinson's disease. One way to restore this pathological activity is to electrically stimulate one of the SNr input, the excitatory subthalamic nucleus (STN, which has emerged as an effective treatment for parkinsonian patients. The neuronal network and signal processing of the basal ganglia are well known but, paradoxically, the role of astrocytes in the regulation of SNr activity has never been studied.In this work, we developed a rat brain slice model to study the influence of spontaneous and induced excitability of afferent nuclei on SNr astrocytes calcium activity. Astrocytes represent the main cellular population in the SNr and display spontaneous calcium activities in basal conditions. Half of this activity is autonomous (i.e. independent of synaptic activity while the other half is dependent on spontaneous glutamate and GABA release, probably controlled by the pace-maker activity of the pallido-nigral and subthalamo-nigral loops. Modification of the activity of the loops by STN electrical stimulation disrupted this astrocytic calcium excitability through an increase of glutamate and GABA releases. Astrocytic AMPA, mGlu and GABA(A receptors were involved in this effect.Astrocytes are now viewed as active components of neural networks but their role depends on the brain structure concerned. In the SNr, evoked activity prevails and autonomous calcium activity is lower than in the cortex or hippocampus. Our data therefore reflect a specific role of SNr astrocytes in sensing the STN-GPe-SNr loops activity and suggest that SNr astrocytes could potentially feedback on SNr neuronal activity. These findings have major implications given the position of SNr in the basal ganglia network.

  9. Subthalamic nucleus electrical stimulation modulates calcium activity of nigral astrocytes.

    Science.gov (United States)

    Barat, Elodie; Boisseau, Sylvie; Bouyssières, Céline; Appaix, Florence; Savasta, Marc; Albrieux, Mireille

    2012-01-01

    The substantia nigra pars reticulata (SNr) is a major output nucleus of the basal ganglia, delivering inhibitory efferents to the relay nuclei of the thalamus. Pathological hyperactivity of SNr neurons is known to be responsible for some motor disorders e.g. in Parkinson's disease. One way to restore this pathological activity is to electrically stimulate one of the SNr input, the excitatory subthalamic nucleus (STN), which has emerged as an effective treatment for parkinsonian patients. The neuronal network and signal processing of the basal ganglia are well known but, paradoxically, the role of astrocytes in the regulation of SNr activity has never been studied. In this work, we developed a rat brain slice model to study the influence of spontaneous and induced excitability of afferent nuclei on SNr astrocytes calcium activity. Astrocytes represent the main cellular population in the SNr and display spontaneous calcium activities in basal conditions. Half of this activity is autonomous (i.e. independent of synaptic activity) while the other half is dependent on spontaneous glutamate and GABA release, probably controlled by the pace-maker activity of the pallido-nigral and subthalamo-nigral loops. Modification of the activity of the loops by STN electrical stimulation disrupted this astrocytic calcium excitability through an increase of glutamate and GABA releases. Astrocytic AMPA, mGlu and GABA(A) receptors were involved in this effect. Astrocytes are now viewed as active components of neural networks but their role depends on the brain structure concerned. In the SNr, evoked activity prevails and autonomous calcium activity is lower than in the cortex or hippocampus. Our data therefore reflect a specific role of SNr astrocytes in sensing the STN-GPe-SNr loops activity and suggest that SNr astrocytes could potentially feedback on SNr neuronal activity. These findings have major implications given the position of SNr in the basal ganglia network.

  10. A first attempt at few coils and low-coverage resistive wall mode stabilization of EXTRAP T2R

    Science.gov (United States)

    Olofsson, K. Erik J.; Brunsell, Per R.; Drake, James R.; Frassinetti, Lorenzo

    2012-09-01

    The reversed-field pinch features resistive-shell-type instabilities at any (vanishing and finite) plasma pressure. An attempt to stabilize the full spectrum of these modes using both (i) incomplete coverage and (ii) few coils is presented. Two empirically derived model-based control algorithms are compared with a baseline guaranteed suboptimal intelligent-shell-type (IS) feedback. Experimental stabilization could not be achieved for the coil array subset sizes considered by this first study. But the model-based controllers appear to significantly outperform the decentralized IS method.

  11. Synthetic Aperture Focusing Applied to Imaging Using a Rotating Single Element Transducer

    DEFF Research Database (Denmark)

    Kortbek, Jacob; Jensen, Jørgen Arendt; Gammelmark, Kim Løkke

    2007-01-01

    This paper applies the concept of virtual sources and mono-static synthetic aperture focusing (SAF) to 2-dimensional imaging with a single rotating mechanically focused concave element with the objective of improving lateral resolution and signal-to-noise ratio (SNR). The geometrical focal point...... function of a single emission. The effect of SAF with focal depth at 20 mm is negligible, caused by the small number of LRL applied. The great profit of the SAF is the increase in SNR. For the setup with focal depth at 20 rum the SAF SNR gain is 11 dB. The SNR gain of a setup with a VS at radius 10 mm...

  12. A quantitative performance evaluation of the EM algorithm applied to radiographic images

    International Nuclear Information System (INIS)

    Brailean, J.C.; Sullivan, B.J.; Giger, M.L.; Chen, C.T.

    1991-01-01

    In this paper, the authors quantitatively evaluate the performance of the Expectation Maximization (EM) algorithm as a restoration technique for radiographic images. The perceived signal-to-noise ratio (SNR), of simple radiographic patterns processed by the EM algorithm are calculated on the basis of a statistical decision theory model that includes both the observer's visual response function and a noise component internal to the eye-brain system. The relative SNR (ratio of the processed SNR to the original SNR) is calculated and used as a metric to quantitatively compare the effects of the EM algorithm to two popular image enhancement techniques: contrast enhancement (windowing) and unsharp mask filtering

  13. G 2.4 + 1.4: a supernova remnant or ring nebula around a peculiar star

    International Nuclear Information System (INIS)

    Johnson, H.M.

    1975-01-01

    G2.4+1.4 is a probable nonthermal radio source and an optical nebula which appears to be a supernova remnant (SNR). It also contains an O vi sequence star of great excitation. We present new radiofrequency continuum and (nil) H 92α observations, optical spectroscopy, and Fabry-Perot scanner observations of the nebula. The object distance (5 kpc), origin of gas kinematics (SNR expansion), and mode of excitation of the gas (photoexcitation and/or shock wave) remain uncertain. We discuss the possible roles of the O vi star as ''runaway'' in a SNR, as a source of photoexcitation, and as an ejector of a ''counterfeit'' SNR

  14. Onion-shell model for cosmic ray electrons and radio synchrotron emission in supernova remnants

    International Nuclear Information System (INIS)

    Beck, R.; Drury, L.O.; Voelk, H.J.; Bogdan, T.J.

    1985-01-01

    The spectrum of cosmic ray electrons, accelerated in the shock front of a supernova remnant (SNR), is calculated in the test-particle approximation using an onion-shell model. Particle diffusion within the evolving remnant is explicity taken into account. The particle spectrum becomes steeper with increasing radius as well as SNR age. Simple models of the magnetic field distribution allow a prediction of the intensity and spectrum of radio synchrotron emission and their radial variation. The agreement with existing observations is satisfactory in several SNR's but fails in other cases. Radiative cooling may be an important effect, especially in SNR's exploding in a dense interstellar medium

  15. Signal-to-noise ratio measurement in parallel MRI with subtraction mapping and consecutive methods

    International Nuclear Information System (INIS)

    Imai, Hiroshi; Miyati, Tosiaki; Ogura, Akio; Doi, Tsukasa; Tsuchihashi, Toshio; Machida, Yoshio; Kobayashi, Masato; Shimizu, Kouzou; Kitou, Yoshihiro

    2008-01-01

    When measuring the signal-to-noise ratio (SNR) of an image the used parallel magnetic resonance imaging, it was confirmed that there was a problem in the application of past SNR measurement. With the method of measuring the noise from the background signal, SNR with parallel imaging was higher than that without parallel imaging. In the subtraction method (NEMA standard), which sets a wide region of interest, the white noise was not evaluated correctly although SNR was close to the theoretical value. We proposed two techniques because SNR in parallel imaging was not uniform according to inhomogeneity of the coil sensitivity distribution and geometry factor. Using the first method (subtraction mapping), two images were scanned with identical parameters. The SNR in each pixel divided the running mean (7 by 7 pixels in neighborhood) by standard deviation/√2 in the same region of interest. Using the second (consecutive) method, more than fifty consecutive scans of the uniform phantom were obtained with identical scan parameters. Then the SNR was calculated from the ratio of mean signal intensity to the standard deviation in each pixel on a series of images. Moreover, geometry factors were calculated from SNRs with and without parallel imaging. The SNR and geometry factor using parallel imaging in the subtraction mapping method agreed with those of the consecutive method. Both methods make it possible to obtain a more detailed determination of SNR in parallel imaging and to calculate the geometry factor. (author)

  16. Onion-shell model for cosmic ray electrons and radio synchrotron emission in supernova remnants

    Science.gov (United States)

    Beck, R.; Drury, L. O.; Voelk, H. J.; Bogdan, T. J.

    1985-01-01

    The spectrum of cosmic ray electrons, accelerated in the shock front of a supernova remnant (SNR), is calculated in the test-particle approximation using an onion-shell model. Particle diffusion within the evolving remnant is explicity taken into account. The particle spectrum becomes steeper with increasing radius as well as SNR age. Simple models of the magnetic field distribution allow a prediction of the intensity and spectrum of radio synchrotron emission and their radial variation. The agreement with existing observations is satisfactory in several SNR's but fails in other cases. Radiative cooling may be an important effect, especially in SNR's exploding in a dense interstellar medium.

  17. A Broad 22 Micron Emission Feature in the Carina Nebula H ii Region.

    Science.gov (United States)

    Chan; Onaka

    2000-04-10

    We report the detection of a broad 22 µm emission feature in the Carina Nebula H ii region by the Infrared Space Observatory (ISO) short-wavelength spectrometer. The feature shape is similar to that of the 22 µm emission feature of newly synthesized dust observed in the Cassiopeia A supernova remnant. This finding suggests that both of the features are arising from the same carrier and that supernovae are probably the dominant production sources of this new interstellar grain. A similar broad emission dust feature is also found in the spectra of two starburst galaxies from the ISO archival data. This new dust grain could be an abundant component of interstellar grains and can be used to trace the supernova rate or star formation rate in external galaxies. The existence of the broad 22 µm emission feature complicates the dust model for starburst galaxies and must be taken into account correctly in the derivation of dust color temperature. Mg protosilicate has been suggested as the carrier of the 22 µm emission dust feature observed in Cassiopeia A. The present results provide useful information in studies on the chemical composition and emission mechanism of the carrier.

  18. Turbulent amplification of magnetic fields in laboratory laser-produced shock waves

    International Nuclear Information System (INIS)

    Meinecke, J.; Doyle, H.W.; Bell, A.R.; Schekochihin, A.A.; Miniati, F.; Bingham, R.; Koenig, M.; Pelka, A.; Ravasio, A.; Yurchak, R.

    2014-01-01

    X-ray and radio observations of the supernova remnant Cassiopeia A reveal the presence of magnetic fields about 100 times stronger than those in the surrounding interstellar medium. Field coincident with the outer shock probably arises through a nonlinear feedback process involving cosmic rays. The origin of the large magnetic field in the interior of the remnant is less clear but it is presumably stretched and amplified by turbulent motions. Turbulence may be generated by hydrodynamic instability at the contact discontinuity between the supernova ejecta and the circumstellar gas. However, optical observations of Cassiopeia A indicate that the ejecta are interacting with a highly inhomogeneous, dense circumstellar cloud bank formed before the supernova explosion. Here we investigate the possibility that turbulent amplification is induced when the outer shock overtakes dense clumps in the ambient medium. We report laboratory experiments that indicate the magnetic field is amplified when the shock interacts with a plastic grid. We show that our experimental results can explain the observed synchrotron emission in the interior of the remnant. The experiment also provides a laboratory example of magnetic field amplification by turbulence in plasmas, a physical process thought to occur in many astrophysical phenomena. (authors)

  19. Radio evolution of young supernova remnants

    International Nuclear Information System (INIS)

    Shirkey, R.C. Jr.

    1976-01-01

    A one dimensional spherically symmetric magnetohydrodynamic code was developed to describe the evolution of the dynamical and radio properties of young supernova remnants. The code contains subroutines which treat the development of Rayleigh-Taylor instabilities wherever they arise in the remnant. Under the assumption of quasi-stationary equilibrium (dynamical changes considered slow in comparison to the time it takes the instability to achieve equilibrium) determined that the velocity of the instability is W approximately (a lambda)/sup 1 / 2 /, where a is the Rayleigh-Taylor acceleration and lambda is the wavelength of the instability. Subsequent processing of the kinetic energy of expansion, through turbulence, resulted in an increase in temperature and magnetic field strength. The model was used to analyze instability effects of density inhomogeneities in the interstellar medium on magnetic field amplification. A model was constructed for Cassiopeia A which gave good agreement with the measured dynamics, radio structure, and secular flux density decrease for the remnant. In order to compare observation with theory a computer routine was written that convolves the surface brightness at the source. The resultant convolved surface brightness graph is in good agreement with Rosenberg's observed ''model profile;'' differences between the graphs can be attributed to the asymmetric expansion of Cassiopeia A

  20. Boiling water reactor simulator. Workshop material

    International Nuclear Information System (INIS)

    2003-01-01

    The International Atomic Energy Agency (IAEA) has established an activity in nuclear reactor simulation computer programs to assist its Member States in education. The objective is to provide, for a variety of advanced reactor types, insight and practice in their operational characteristics and their response to perturbations and accident situations. To achieve this, the IAEA arranges for the development and distribution of simulation programs and workshop material and sponsors workshops. The workshops are in two parts: techniques and tools for reactor simulator development; and the use of reactor simulators in education. Workshop material for the first part is covered in the IAEA publication: Training Course Series No. 12, 'Reactor Simulator Development' (2001). Course material for workshops using a WWER- 1000 simulator from the Moscow Engineering and Physics Institute, Russian Federation is presented in the IAEA publication: Training Course Series No. 21 'WWER-1000 Reactor Simulator' (2002). Course material for workshops using a pressurized water reactor (PWR) simulator developed by Cassiopeia Technologies Incorporated, Canada, is presented in the IAEA publication: Training Course Series No. 22 'Pressurized Water Reactor Simulator' (2003). This report consists of course material for workshops using a boiling water reactor (BWR) simulator. Cassiopeia Technologies Incorporated, developed the simulator and prepared this report for the IAEA

  1. Approximate calculus of the auto transformers and power transformers capacitances; Calculo aproximado de las capacitancias de autotransformadores y transformadores de potencia

    Energy Technology Data Exchange (ETDEWEB)

    Carrasco, Gustavo [C.V.G. Electrificacion del Caroni, C.A. (EDELCA), Caracas (Venezuela)]. E-mail: gcarrasco@edelca.com.ve

    2001-07-01

    This paper develops a mathematical relation for the approximated calculus of the capacitances of the EDELCA power transformers and auto transformers. This mathematical relation is based on the type of transformers construction (Nucleus and shell type), the dielectric properties of the internal insulation material and the electric parameters (Voltage and power)

  2. Application of Hadamard transform in IMS

    International Nuclear Information System (INIS)

    Sha Miaomiao; Liu Weihao; Chen Yong; Jiang Dazhen

    2008-01-01

    Hadamard transform can improve the SNR by increasing the ion duty cycle in IMS. In this paper, the ion spectral signals were processed by Hadamard transform based on the IMS detector hardware platform. The results showed that Hadamard transform can greatly improve the SNR of the IMS detector in contrast with traditional method. (authors)

  3. The relation of sulcus nervi radialis with the fracture line of humerus fracture and radial nerve injury

    DEFF Research Database (Denmark)

    Ozden, Hilmi; Demir, Ahmet; Guven, Gul

    2008-01-01

    PURPOSE: Radial nerve is closely in contact with the bone in sulcus nervi radialis (SNR). Location of SNR shows ethnic differences. Radial nerve is a big problem in humerus fractures and its surgery. In this study, we aimed to examine if humerus fractures of this region increases the probability...

  4. Leak detection in LMFBR steam generators during operation

    Energy Technology Data Exchange (ETDEWEB)

    Dumm, K [INTERATOM, Bergisch Gladbach (Germany)

    1978-10-01

    This paper deals with the following four main aspects: requirement on the leak detection of the SNR-300 steam generators; the hydrogen detector of SNR-300; remarks on the disadvantage of impurity detectors; and the first approach to acoustic leak detection systems.

  5. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    2016-01-27

    Jan 27, 2016 ... We describe the serendipitous discovery of a very steep-spectrum radio point source in low-frequency Giant Metrewave Radio Telescope (GMRT) images of the supernova remnant (SNR) G76.9+1.0. The steep spectrum, as well as the location of the point source near the centre of this SNR confirm that this ...

  6. Leak detection in LMFBR steam generators during operation

    International Nuclear Information System (INIS)

    Dumm, K.

    1978-01-01

    This paper deals with the following four main aspects: requirement on the leak detection of the SNR-300 steam generators; the hydrogen detector of SNR-300; remarks on the disadvantage of impurity detectors; and the first approach to acoustic leak detection systems

  7. Enhancing Sensor Network Data Quality via Collaborated Circuit and Network Operations

    Directory of Open Access Journals (Sweden)

    Lucas Vespa

    2013-04-01

    Full Text Available In many applications, the quality of data gathered by sensor networks is directly related to the signal-to-noise ratio (SNR of the sensor data being transmitted in the networks. Different from the SNR that is often used in measuring the quality of communication links, the SNR used in this work measures how accurately the data in the network packets represent the physical parameters being sensed. Hence, the signal here refers to the physical parameters that are being monitored by sensor networks; the noise is due to environmental interference and circuit noises at sensor nodes, and packet loss during network transmission. While issues affecting SNR at sensor nodes have been intensively investigated, the impact of network packet loss on data SNR has not attracted significant attention in sensor network design. This paper investigates the impact of packet loss on sensor network data SNR and shows that data SNR is dramatically affected by network packet loss. A data quality metric, based on data SNR, is developed and a cross-layer adaptive scheme is presented to minimize data quality degradation in congested sensor networks. The proposed scheme consists of adaptive downsampling and bit truncation at sensor nodes and intelligent traffic management techniques at the network level. Simulation results are presented to demonstrate the validity and effectiveness of the proposed techniques.

  8. Project fast breeder (PSB)

    International Nuclear Information System (INIS)

    1978-01-01

    The annual report of the fast breeder project (PSB) contains contributions of the participating institutes on the four subjects: 1) Development of oxidic fuel rods and materials for the SNR line, 2) Physics and safety investigations for the SNR line, 3) Carbidic fuel elements, and 4) Back-up solution with gaseous coolant. (HK) [de

  9. 76 FR 127 - The Central Valley Project, the California-Oregon Transmission Project, the Pacific Alternating...

    Science.gov (United States)

    2011-01-03

    ... Calaveras Counties. A BR customer, under the 2004 Marketing Plan, is an entity that has executed a BR.... Available: Within the marketing area served by SNR. Applicable: To customers that contract with Western for..., 2016. Available: Within the marketing area served by SNR. Applicable: To customers receiving CVP firm...

  10. Relationship Between Capacity and Pathloss for Indoor MIMO Channels

    DEFF Research Database (Denmark)

    Nielsen, Jesper Ødum; Andersen, Jørgen Bach; Bauch, Gerhard

    2006-01-01

    MIMO transmission systems exploit scattering in the radio channel to achieve high capacity for a given SNR. A high pathloss is generally expected for channels with rich scattering, suggesting that a high SNR and rich multipath are competing goals. The current work investigates this issue based on...

  11. Terrain mapping camera for Chandrayaan-1

    Indian Academy of Sciences (India)

    The camera will have four gain settings to cover the varying illumination conditions of the Moon. Additionally, a provision of imaging with reduced resolution, for improving Signal-to-Noise Ratio (SNR) in polar regions, which have poor illumination conditions throughout, has been made. SNR of better than 100 is expected in ...

  12. Evaluation and comparison of contrast to noise ratio and signal to noise ratio according to change of reconstruction on breast PET/CT

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Young Jae [Dept. of Nuclear Medicine, Seoul National University Hospital, Seoul (Korea, Republic of); Lee, Eul Kyu [Dept. of Radiology, Inje Paik University Hospital Jeo-dong, Seoul (Korea, Republic of); Kim, Ki Won [Dept. of Radiology, Kyung Hee University Hospital at Gang-dong, Seoul (Korea, Republic of); Jeong, Hoi Woun [Dept. of Radiological Technology, The Baekseok Culture University, Cheonan (Korea, Republic of); Lyu, Kwang Yeul; Park, Hoon Hee; Son, Jin Hyun; Min, Jung Whan [Dept. of Radiological Technology, The Shingu University, Sungnam (Korea, Republic of)

    2017-03-15

    The purpose of this study was to measure contrast to noise ratio (CNR) and signal to noise ratio (SNR) according to change of reconstruction from region of interest (ROI) in breast positron emission tomography- computed tomography (PET-CT), and to analyze the CNR and SNR statically. We examined images of breast PET-CT of 100 patients in a University-affiliated hospital, Seoul, Korea. Each patient's image of breast PET-CT were calculated by using Image J. Differences of CNR and SNR among four reconstruction algorithms were tested by SPSS Statistics21 ANOVA test for there was statistical significance (p<0.05). We have analysis socio-demographical variables, CNR and SNR according to reconstruction images, 95% confidence according to CNR and SNR of reconstruction and difference in a mean of CNR and SNR. SNR results, with the quality of distributions in the order of PSF{sub T}OF, Iterative and Iterative-TOF, FBP-TOF. CNR, with the quality of distributions in the order of PSF{sub T}OF, Iterative and Iterative-TOF, FBP-TOF. CNR and SNR of PET-CT reconstruction methods of the breast would be useful to evaluate breast diseases.

  13. Design philosophy of LMFBR steam generator from the viewpoint of maintenance and repair in DeBeNe

    International Nuclear Information System (INIS)

    Westenbrugge, J.K. van; Dumm, K.

    2002-01-01

    In this paper we will describe the philosophy as applied in the design of the SNR-300 steam generators and make some remarks on the SNR-2 situation. Topics to be dealt with in design philosophy are: a. system lay-out and component accessibility b. component layout and accessibility to its internals

  14. Spasm of the near reflex: A case report.

    Science.gov (United States)

    Rhatigan, Maedbh; Byrne, Caroline; Logan, Patricia

    2017-06-01

    Spasm of the near reflex (SNR) is a triad of miosis, excess accommodation and excess convergence. Primary SNR is most often functional in origin We aim to highlight the clinical features which distinguish primary convergence from other conditions with a similar presentation but more sinister underlying aetiology, for example bilateral abducens nerve palsy. There is a paucity of published data on SNR, in particular diagnostic criteria and treatment. We report a case of SNR of functional origin in an otherwise healthy young female and discuss the clinical features that differentiate this condition from similar conditions with underlying neurological origin. SNR is predominantly a clinical diagnosis, and often leads to patients undergoing unnecessary investigations and sometimes treatment. Recognising the salient features that differentiate it could potentially avoid this.

  15. Radio-continuum observations of small, radially polarised Supernova Remnant J0519-6902 in the large Magellanic cloud

    Directory of Open Access Journals (Sweden)

    Bozzetto L.M.

    2012-01-01

    Full Text Available We report on new Australian Telescope Compact Array (ATCA observations of SNR J0519-6902. The Supernova Remnant (SNR is small in size (~8 pc and exhibits a typical SNR spectrum with α = -0.53±0.07, with steeper spectral indices towards the northern limb of the remnant. SNR J0519-6902 contains a low level of radially orientated polarisation at wavelengths of 3 and 6 cm, which is typical of younger SNRs. A fairly strong magnetic field was estimated to ~171µG. The remnant appears to be the result of a typical Type Ia supernova, sharing many properties with another small and young Type Ia LMC SNR, J0509-6731. [Projekat Ministarstva nauke Republike Srbije, br. 176005

  16. Localized surface plasmon resonance properties of Ag nanorod arrays on graphene-coated Au substrate

    Science.gov (United States)

    Mu, Haiwei; Lv, Jingwei; Liu, Chao; Sun, Tao; Chu, Paul K.; Zhang, Jingping

    2017-11-01

    Localized surface plasmon resonance (LSPR) on silver nanorod (SNR) arrays deposited on a graphene-coated Au substrate is investigated by the discrete dipole approximation (DDA) method. The resonance peaks in the extinction spectra of the SNR/graphene/Au structure show significantly different profiles as SNR height, and refractive index of the surrounding medium are varied gradually. Numerical simulation reveals that the shifts in the resonance peaks arise from hybridization of multiple plasmon modes as a result of coupling between the SNR arrays and graphene-coated Au substrate. Moreover, the LSPR modes blue-shifts from 800 nm to 700 nm when the thickness of the graphene layer in the metal nanoparticle (NP) - graphene hybrid nanostructure increases from 1 nm to 5 nm, which attribute to charge transfer between the graphene layer and SNR arrays. The results provide insights into metal NP-graphene hybrid nanostructures which have potential applications in plasmonics.

  17. The MISO wiretap channel with channel uncertainty: Asymptotic perspectives

    KAUST Repository

    Chaaban, Anas; Rezki, Zouheir; Alomair, Basel; Alouini, Mohamed-Slim

    2017-01-01

    The N-antenna MISO Gaussian wiretap channel with imperfect channel-state information at the transmitter (CSIT) is studied in terms of secrecy rate scaling versus the signal-to-noise ratio (SNR) and N. Two schemes are considered, beamforming (BF) and artificial noise injection (AN). It is shown that if the CSIT error is independent of SNR, then both schemes do not achieve scaling versus SNR. However, if this error vanishes as SNR increases, then AN achieves the optimal scaling versus SNR, contrary to BF. Scaling can be achieved in BF by increasing N. In fact, BF achieves the optimal scaling versus N. In the AN scheme however, injecting noise in multiple direction deteriorates its scaling versus N. Nevertheless, AN can achieve the optimal scaling if noise is sent in only one direction. This leads to better performance than BF if the CSIT error is smaller than a threshold which is also derived.

  18. A study of J-coupling spectroscopy using the Earth's field nuclear magnetic resonance inside a laboratory.

    Science.gov (United States)

    Liao, Shu-Hsien; Chen, Ming-Jye; Yang, Hong-Chang; Lee, Shin-Yi; Chen, Hsin-Hsien; Horng, Herng-Er; Yang, Shieh-Yueh

    2010-10-01

    In this paper, an instrumentation of the Earth's field nuclear magnetic resonance (EFNMR) inside a laboratory is presented. A lock-in analysis (LIA) technique was proposed to enhance the signal-to-noise ratio (SNR). A SNR of 137.8 was achieved in a single measurement for 9 ml tap water, and the LIA technique significantly enhanced the SNR to 188 after a 10-average in a noisy laboratory environment. The proton-phosphorus coupling in trimethyl phosphate ((CH(3)O)(3)PO) with J-coupling J[H,F]=(10.99±0.013) Hz has been demonstrated. The LIA technique improves the SNR, and a 2.6-fold improvement in SNR over that of the frequency-adjusted averaging is achieved. To reduce the noise in EFNMR, it was suggested that the LIA technique and the first order gradient shim be used to achieve a subhertz linewidth.

  19. Signal-to-noise analysis of a birefringent spectral zooming imaging spectrometer

    Science.gov (United States)

    Li, Jie; Zhang, Xiaotong; Wu, Haiying; Qi, Chun

    2018-05-01

    Study of signal-to-noise ratio (SNR) of a novel spectral zooming imaging spectrometer (SZIS) based on two identical Wollaston prisms is conducted. According to the theory of radiometry and Fourier transform spectroscopy, we deduce the theoretical equations of SNR of SZIS in spectral domain with consideration of the incident wavelength and the adjustable spectral resolution. An example calculation of SNR of SZIS is performed over 400-1000 nm. The calculation results indicate that SNR with different spectral resolutions of SZIS can be optionally selected by changing the spacing between the two identical Wollaston prisms. This will provide theoretical basis for the design, development and engineering of the developed imaging spectrometer for broad spectrum and SNR requirements.

  20. The MISO wiretap channel with channel uncertainty: Asymptotic perspectives

    KAUST Repository

    Chaaban, Anas

    2017-05-12

    The N-antenna MISO Gaussian wiretap channel with imperfect channel-state information at the transmitter (CSIT) is studied in terms of secrecy rate scaling versus the signal-to-noise ratio (SNR) and N. Two schemes are considered, beamforming (BF) and artificial noise injection (AN). It is shown that if the CSIT error is independent of SNR, then both schemes do not achieve scaling versus SNR. However, if this error vanishes as SNR increases, then AN achieves the optimal scaling versus SNR, contrary to BF. Scaling can be achieved in BF by increasing N. In fact, BF achieves the optimal scaling versus N. In the AN scheme however, injecting noise in multiple direction deteriorates its scaling versus N. Nevertheless, AN can achieve the optimal scaling if noise is sent in only one direction. This leads to better performance than BF if the CSIT error is smaller than a threshold which is also derived.

  1. Statistical approach of measurement of signal to noise ratio in according to change pulse sequence on brain MRI meningioma and cyst images

    International Nuclear Information System (INIS)

    Lee, Eul Kyu; Choi, Kwan Woo; Jeong, Hoi Woun; Jang, Seo Goo; Kim, Ki Won; Son, Soon Yong; Min, Jung Whan; Son, Jin Hyun

    2016-01-01

    The purpose of this study was to needed basis of measure MRI CAD development for signal to noise ratio (SNR) by pulse sequence analysis from region of interest (ROI) in brain magnetic resonance imaging (MRI) contrast. We examined images of brain MRI contrast enhancement of 117 patients, from January 2005 to December 2015 in a University-affiliated hospital, Seoul, Korea. Diagnosed as one of two brain diseases such as meningioma and cysts SNR for each patient's image of brain MRI were calculated by using Image J. Differences of SNR among two brain diseases were tested by SPSS Statistics21 ANOVA test for there was statistical significance (p < 0.05). We have analysis socio-demographical variables, SNR according to sequence disease, 95% confidence according to SNR of sequence and difference in a mean of SNR. Meningioma results, with the quality of distributions in the order of T1CE, T2 and T1, FLAIR. Cysts results, with the quality of distributions in the order of T2 and T1, T1CE and FLAIR. SNR of MRI sequences of the brain would be useful to classify disease. Therefore, this study will contribute to evaluate brain diseases, and be a fundamental to enhancing the accuracy of CAD development

  2. Signal-noise ratio of MR spectroscopy in the central gland of prostate

    International Nuclear Information System (INIS)

    Tong Yanjun; Wang Xiaoying; Li Feiyu; Jiang Xuexiang

    2007-01-01

    Objective: To analyze the signal to noise ratio (SNR) of the MRS of the prostate central gland, and study its relationship with the pathology of the lesions. Methods: Eighteen patients who underwent transurethral resection of prostate (TURP) for benign prostate hyperplasia (BPH) were enrolled in this study. They were divided into three groups according to the pathological findings: 7 cases of glandular-BPH (GBPH), 7 cases of stromal-BPH (SBPH) and 5 cases of incidentally detected prostate carcinoma (IDPC). The voxels in the central glands with SNR ≥5 and SNR < 5 were counted, and the relationship between the percentage of voxel with SNR < 5 and pathology was analyzed. Results: In the 18 cases, the total number of voxels measured in the regions of interest was 3632, and the voxels with SNR≥5 and SNR < 5 were 1579 (the percentage is 43%) and 1873, respectively. The percentage of voxels with SNR < 5 in SBPH group (67.6 ± 21.8)% was statistically higher than that in GBPH (37.1±14.5)% and IDPC (39.9±18.8)%. The difference between the group of GBPH and IDPC was not statistically significant. Conclusion: More than half of the voxels in the central gland could not be reliably analyzed in the prostate MRS examination because of its low SNR, especially in the case of SBPH. (authors)

  3. Weak-periodic stochastic resonance in a parallel array of static nonlinearities.

    Directory of Open Access Journals (Sweden)

    Yumei Ma

    Full Text Available This paper studies the output-input signal-to-noise ratio (SNR gain of an uncoupled parallel array of static, yet arbitrary, nonlinear elements for transmitting a weak periodic signal in additive white noise. In the small-signal limit, an explicit expression for the SNR gain is derived. It serves to prove that the SNR gain is always a monotonically increasing function of the array size for any given nonlinearity and noisy environment. It also determines the SNR gain maximized by the locally optimal nonlinearity as the upper bound of the SNR gain achieved by an array of static nonlinear elements. With locally optimal nonlinearity, it is demonstrated that stochastic resonance cannot occur, i.e. adding internal noise into the array never improves the SNR gain. However, in an array of suboptimal but easily implemented threshold nonlinearities, we show the feasibility of situations where stochastic resonance occurs, and also the possibility of the SNR gain exceeding unity for a wide range of input noise distributions.

  4. Noise-robust speech triage.

    Science.gov (United States)

    Bartos, Anthony L; Cipr, Tomas; Nelson, Douglas J; Schwarz, Petr; Banowetz, John; Jerabek, Ladislav

    2018-04-01

    A method is presented in which conventional speech algorithms are applied, with no modifications, to improve their performance in extremely noisy environments. It has been demonstrated that, for eigen-channel algorithms, pre-training multiple speaker identification (SID) models at a lattice of signal-to-noise-ratio (SNR) levels and then performing SID using the appropriate SNR dependent model was successful in mitigating noise at all SNR levels. In those tests, it was found that SID performance was optimized when the SNR of the testing and training data were close or identical. In this current effort multiple i-vector algorithms were used, greatly improving both processing throughput and equal error rate classification accuracy. Using identical approaches in the same noisy environment, performance of SID, language identification, gender identification, and diarization were significantly improved. A critical factor in this improvement is speech activity detection (SAD) that performs reliably in extremely noisy environments, where the speech itself is barely audible. To optimize SAD operation at all SNR levels, two algorithms were employed. The first maximized detection probability at low levels (-10 dB ≤ SNR < +10 dB) using just the voiced speech envelope, and the second exploited features extracted from the original speech to improve overall accuracy at higher quality levels (SNR ≥ +10 dB).

  5. Effects of Subthalamic and Nigral Stimulation on Gait Kinematics in Parkinson’s Disease

    Directory of Open Access Journals (Sweden)

    Marlieke Scholten

    2017-10-01

    Full Text Available Conventional subthalamic deep brain stimulation for Parkinson’s disease (PD presumably modulates the spatial component of gait. However, temporal dysregulation of gait is one of the factors that is tightly associated with freezing of gait (FOG. Temporal locomotor integration may be modulated differentially at distinct levels of the basal ganglia. Owing to its specific descending brainstem projections, stimulation of the substantia nigra pars reticulata (SNr area might modulate spatial and temporal parameters of gait differentially compared to standard subthalamic nucleus (STN stimulation. Here, we aimed to characterize the differential effect of STN or SNr stimulation on kinematic gait parameters. We analyzed biomechanical parameters during unconstrained over ground walking in 12 PD patients with subthalamic deep brain stimulation and FOG. Patients performed walking in three therapeutic conditions: (i Off stimulation, (ii STN stimulation (alone, and (iii SNr stimulation (alone. SNr stimulation was achieved by stimulating the most caudal contact of the electrode. We recorded gait using three sensors (each containing a tri-axial accelerometer, gyroscope, and magnetometer attached on both left and right ankle, and to the lumbar spine. STN stimulation improved both the spatial features (stride length, stride length variability and the temporal parameters of gait. SNr stimulation improved temporal parameters of gait (swing time asymmetry. Correlation analysis suggested that patients with more medial localization of the SNr contact associated with a stronger regularization of gait. These results suggest that SNr stimulation might support temporal regularization of gait integration.

  6. Statistical approach of measurement of signal to noise ratio in according to change pulse sequence on brain MRI meningioma and cyst images

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Eul Kyu [Inje Paik University Hospital Jeo-dong, Seoul (Korea, Republic of); Choi, Kwan Woo [Asan Medical Center, Seoul (Korea, Republic of); Jeong, Hoi Woun [The Baekseok Culture University, Cheonan (Korea, Republic of); Jang, Seo Goo [The Soonchunhyang University, Asan (Korea, Republic of); Kim, Ki Won [Kyung Hee University Hospital at Gang-dong, Seoul (Korea, Republic of); Son, Soon Yong [The Wonkwang Health Science University, Iksan (Korea, Republic of); Min, Jung Whan; Son, Jin Hyun [The Shingu University, Sungnam (Korea, Republic of)

    2016-09-15

    The purpose of this study was to needed basis of measure MRI CAD development for signal to noise ratio (SNR) by pulse sequence analysis from region of interest (ROI) in brain magnetic resonance imaging (MRI) contrast. We examined images of brain MRI contrast enhancement of 117 patients, from January 2005 to December 2015 in a University-affiliated hospital, Seoul, Korea. Diagnosed as one of two brain diseases such as meningioma and cysts SNR for each patient's image of brain MRI were calculated by using Image J. Differences of SNR among two brain diseases were tested by SPSS Statistics21 ANOVA test for there was statistical significance (p < 0.05). We have analysis socio-demographical variables, SNR according to sequence disease, 95% confidence according to SNR of sequence and difference in a mean of SNR. Meningioma results, with the quality of distributions in the order of T1CE, T2 and T1, FLAIR. Cysts results, with the quality of distributions in the order of T2 and T1, T1CE and FLAIR. SNR of MRI sequences of the brain would be useful to classify disease. Therefore, this study will contribute to evaluate brain diseases, and be a fundamental to enhancing the accuracy of CAD development.

  7. Effects of the physiological parameters on the signal-to-noise ratio of single myoelectric channel

    Directory of Open Access Journals (Sweden)

    Zhang YT

    2007-08-01

    Full Text Available Abstract Background An important measure of the performance of a myoelectric (ME control system for powered artificial limbs is the signal-to-noise ratio (SNR at the output of ME channel. However, few studies illustrated the neuron-muscular interactive effects on the SNR at ME control channel output. In order to obtain a comprehensive understanding on the relationship between the physiology of individual motor unit and the ME control performance, this study investigates the effects of physiological factors on the SNR of single ME channel by an analytical and simulation approach, where the SNR is defined as the ratio of the mean squared value estimation at the channel output and the variance of the estimation. Methods Mathematical models are formulated based on three fundamental elements: a motoneuron firing mechanism, motor unit action potential (MUAP module, and signal processor. Myoelectric signals of a motor unit are synthesized with different physiological parameters, and the corresponding SNR of single ME channel is numerically calculated. Effects of physiological multi factors on the SNR are investigated, including properties of the motoneuron, MUAP waveform, recruitment order, and firing pattern, etc. Results The results of the mathematical model, supported by simulation, indicate that the SNR of a single ME channel is associated with the voluntary contraction level. We showed that a model-based approach can provide insight into the key factors and bioprocess in ME control. The results of this modelling work can be potentially used in the improvement of ME control performance and for the training of amputees with powered prostheses. Conclusion The SNR of single ME channel is a force, neuronal and muscular property dependent parameter. The theoretical model provides possible guidance to enhance the SNR of ME channel by controlling physiological variables or conscious contraction level.

  8. Regulation of Substantia Nigra Pars Reticulata GABAergic Neuron Activity by H2O2 via Flufenamic Acid-Sensitive Channels and KATP Channels

    Science.gov (United States)

    Lee, Christian R.; Witkovsky, Paul; Rice, Margaret E.

    2011-01-01

    Substantia nigra pars reticulata (SNr) GABAergic neurons are key output neurons of the basal ganglia. Given the role of these neurons in motor control, it is important to understand factors that regulate their firing rate and pattern. One potential regulator is hydrogen peroxide (H2O2), a reactive oxygen species that is increasingly recognized as a neuromodulator. We used whole-cell current clamp recordings of SNr GABAergic neurons in guinea-pig midbrain slices to determine how H2O2 affects the activity of these neurons and to explore the classes of ion channels underlying those effects. Elevation of H2O2 levels caused an increase in the spontaneous firing rate of SNr GABAergic neurons, whether by application of exogenous H2O2 or amplification of endogenous H2O2 through inhibition of glutathione peroxidase with mercaptosuccinate. This effect was reversed by flufenamic acid (FFA), implicating transient receptor potential (TRP) channels. Conversely, depletion of endogenous H2O2 by catalase, a peroxidase enzyme, decreased spontaneous firing rate and firing precision of SNr neurons, demonstrating tonic control of firing rate by H2O2. Elevation of H2O2 in the presence of FFA revealed an inhibition of tonic firing that was prevented by blockade of ATP-sensitive K+ (KATP) channels with glibenclamide. In contrast to guinea-pig SNr neurons, the dominant effect of H2O2 elevation in mouse SNr GABAergic neurons was hyperpolarization, indicating a species difference in H2O2-dependent regulation. Thus, H2O2 is an endogenous modulator of SNr GABAergic neurons, acting primarily through presumed TRP channels in guinea-pig SNr, with additional modulation via KATP channels to regulate SNr output. PMID:21503158

  9. The Kalkar fast breeder: Decision of the Bundestag concerning start-up

    International Nuclear Information System (INIS)

    1983-01-01

    This survey informs on declarations and recommendations of the official inquiry commission ''Future Nuclear Energy Policies'' of the 9th Bundestag concerning the question whether or not commissioning of the fast breeder prototype plant SNR 300 in Kalkar is politically justifiable as well as on how the commission's recommendations were discussed in Parliament. The commission recommended by majority of votes to commission the SNR 300. The research and technology commission in charge accepted this recommendation by majority of votes. On December 3, 1982, the Bundestag voted in favour of the recommendation by majority of votes. Thus the political reservations of the Bundestag against commissioning the SNR-300 are revoked. (orig./HSCH) [de

  10. Large scale FCI experiments in subassembly geometry. Test facility and model experiments

    International Nuclear Information System (INIS)

    Beutel, H.; Gast, K.

    A program is outlined for the study of fuel/coolant interaction under SNR conditions. The program consists of a) under water explosion experiments with full size models of the SNR-core, in which the fuel/coolant system is simulated by a pyrotechnic mixture. b) large scale fuel/coolant interaction experiments with up to 5kg of molten UO 2 interacting with liquid sodium at 300 deg C to 600 deg C in a highly instrumented test facility simulating an SNR subassembly. The experimental results will be compared to theoretical models under development at Karlsruhe. Commencement of the experiments is expected for the beginning of 1975

  11. Stochastic resonance in a single-mode laser driven by frequency modulated signal and coloured noises

    Institute of Scientific and Technical Information of China (English)

    Jin Guo-Xiang; Zhang Liang-Ying; Cao Li

    2009-01-01

    By adding frequency modulated signals to the intensity equation of gain-noise model of the single-mode laser driven by two coloured noises which are correlated, this paper uses the linear approximation method to calculate the power spectrum and signal-to-noise ratio (SNR) of the laser intensity. The results show that the SNR appears typical stochastic resonance with the variation of intensity of the pump noise and quantum noise. As the amplitude of a modulated signal has effects on the SNR, it shows suppression, monotone increasing, stochastic resonance, and multiple stochastic resonance with the variation of the frequency of a carrier signal and modulated signal.

  12. Space-time encoding for high frame rate ultrasound imaging

    DEFF Research Database (Denmark)

    Misaridis, Thanssis; Jensen, Jørgen Arendt

    2002-01-01

    dynamically focused in both transmit and receive with only two firings. This reduces the problem of motion artifacts. The method has been tested with extensive simulations using Field II. Resolution and SNR are compared with uncoded STA imaging and conventional phased-array imaging. The range resolution...... remains the same for coded STA imaging with four emissions and is slightly degraded for STA imaging with two emissions due to the −55 dB cross-talk between the signals. The additional proposed temporal encoding adds more than 15 dB on the SNR gain, yielding a SNR at the same order as in phased-array...

  13. Contribution of infrared observations to the study of supernovae remnants

    International Nuclear Information System (INIS)

    Douvion, Thomas

    2000-01-01

    This research thesis addresses the study of dust in young supernovae remnants observed in middle infrared, mainly by means of the ISOCAM instrument installed on the ISO satellite. The author first presents the supernovae physics and the studied young remnants, describes dusts and the main sites of formation and destruction, and outlines the difficulties and benefits of observations performed in the middle infrared. Then, the author reports acquired evidences related to the formation of dusts in supernovae, and the search for a millimetre emission by cold dust contained in regions which are not yet excited by the shock, in order to better assess the overall quantities created by supernovae. He reports the use of observations of dust and neon in Cassiopeia A to perform a diagnosis on the mixture of elements during the supernovae explosion [fr

  14. Lifetime of {sup 44}Ti as probe for supernova models

    Energy Technology Data Exchange (ETDEWEB)

    Goerres, J; Meissner, J; Schatz, H; Stech, E; Tischhauser, P; Wiescher, M [Univ. of Notre Dame, Notre Dame, IN (United States); Bazin, D; Harkewicz, R; Hellstroem, M; Sherrill, B; Steiner, M [Michigan State Univ., East Lansing, MI (United States); Boyd, R N [Ohio State Univ., Columbus, OH (United States); Buchmann, L [TRIUMF, Vancouver, BC (Canada); Hartmann, D H [Clemson Univ., Clemson, SC (United States); Hinnefeld, J D [Indiana Univ. South Bend, South Bend, IN (United States)

    1998-06-01

    The recent observation of {sup 44}Ti radioactivity in the supernova remnant Cassiopeia A with the Compton Gamma Ray Observatory allows the determination of the absolute amount of {sup 44}Ti. This provides a test for current supernova models. The main uncertainty is the lifetime of {sup 44}Ti. We report a new measurement of the lifetime of {sup 44}Ti applying a novel technique. A mixed radioactive beam containing {sup 44}Ti as well as {sup 22}Na was implanted and the resulting {gamma}-activity was measured. This allowed the determination of the lifetime of {sup 44}Ti relative to the lifetime of {sup 22}Na, {tau} = (87.0 {+-} 1.9) y. With this lifetime, the {sup 44}Ti abundance agrees with theoretical predictions within the remaining observational uncertainties. (orig.)

  15. Revised description of the fine structure of in situ "zooxanthellae" genus Symbiodinium.

    Science.gov (United States)

    Wakefield, T S; Farmer, M A; Kempf, S C

    2000-08-01

    The fine structure of the symbiotic dinoflagellate genus Symbiodinium has been well described. All of the published descriptions are based on tissue that was fixed in standard aldehyde and osmium fixatives and dehydrated in an ethanol series before embedding. When the technique of freeze-substitution was used to fix tissue from Cassiopeia xamachana, Aiptasia pallida, and Phyllactis flosculifera and prepare it for embedding, thecal vesicles were revealed within the in situ symbionts of all three species. Although these structures have been identified in cultured symbionts, they have never been described in the in situ symbionts. A review of the literature has revealed several instances where thecal vesicles were either overlooked or identified incorrectly. Thus the formal description of the genus Symbiodinium, which describes the in situ symbionts, contains information that is based on artifact and should be revised. A revision of the genus is suggested, and the true nature of these structures and their significance in the symbiotic association are discussed.

  16. Diversity and abundance of epibiota on invasive and native estuarine gastropods depend on substratum and salinity

    DEFF Research Database (Denmark)

    Thyrring, Jakob; Thomsen, Mads Solgaard; Brunbjerg, Ane Kirstine

    2015-01-01

    ,226 shells representing the common gastropod species in the estuary; Nassarius pauperatus, Bedeva paiva and Batillaria australs from various sites and habitats. Generalized linear models were used to model variability of richness and abundances of common functional groups and species for the above listed...... factors. The five factors accounted for 3-34% of the total deviance explained of the models, with shell type and salinity levels being the only significant factors in nine of 14 models. These results highlight an overwhelming importance of shell type and salinity in explaining estuarine epibiota......Epibiosis is a common life form in estuarine ecosystems, where shell structures in particular, provide important attachment substrate for sessile species. Many studies have quantified variation in epibiota communities against a few environmental factors, but rarely studies have accounted...

  17. Toward a more comprehensive understanding of the impact of masker type and signal-to-noise ratio on the pupillary response while performing a speech-in-noise test

    DEFF Research Database (Denmark)

    Wendt, Dorothea; Koelewijn, Thomas; Książek, Patrycja

    2018-01-01

    intelligibility. In a second experiment, effects of SNR on listening effort were examined while presenting the HINT sentences across a broad range of fixed SNRs corresponding to intelligibility scores ranging from 100 % to 0 % correct performance. A peak pupil dilation (PPD) was calculated and a Growth Curve...... Analysis (GCA) was performed to examine listening effort involved in speech recognition as a function of SNR. The results of two experiments showed that the pupil dilation response is highly affected by both masker type and SNR when performing the HINT. The PPD was highest, suggesting the highest level...... strongly varied as a function of SNRs. Listening effort was highest for intermediate SNRs with performance accuracies ranging between 30 % -70 % correct. GCA revealed time-dependent effects of the SNR on the pupillary response that were not reflected in the PPD....

  18. Super-virtual refraction interferometry: an engineering field data example

    KAUST Repository

    Hanafy, Sherif M.

    2012-10-01

    The theory of super-virtual refraction interferometry (SVI) was recently developed to enhance the signal-to-noise ratio (SNR) of far-offset traces in refraction surveys. This enhancement of the SNR is proportional to √N and can be as high as N if an iterative procedure is used. Here N is the number of post-critical shot positions that coincides with the receiver locations. We now demonstrate the SNR enhancement of super-virtual refraction traces for one engineering-scale synthetic data and two field seismic data sets. The field data are collected over a normal fault in Saudi Arabia. Results show that both the SNR of the super-virtual data set and the number of reliable first-arrival traveltime picks are significantly increased. © 2012 European Association of Geoscientists & Engineers.

  19. The electrical properties of a planar coil electromagnetic acoustic transducer and their implications for noise performance

    International Nuclear Information System (INIS)

    Seher, Matthias; Challis, Richard

    2016-01-01

    This paper is concerned with the electrical properties of an electromagnetic acoustic transducer (EMAT) formed of a flat spiral coil coupled to steel sheet components and operating over a narrow band of frequencies around 50 kHz, well below significant resonances. The electromagnetic skin effect is a significant contributor to the terminal impedance of the EMAT and hence to signal sensitivity, Johnson noise generation and the achievable signal-to-noise ratios (SNR). A transformer model is developed to simulate these effects and to assist in the optimization of the SNR. In this analysis Johnson noise in the system is compared to the unknown emf generated in the eddy current path by an incident acoustic wave to yield a fundamental SNR. The attainable SNR of the whole system is normalized to this in the form of a noise figure. (paper)

  20. The response of a linear monostable system and its application in parameters estimation for PSK signals

    International Nuclear Information System (INIS)

    Duan, Chaowei; Zhan, Yafeng

    2016-01-01

    The output characteristics of a linear monostable system driven with a periodic signal and an additive white Gaussian noise are studied in this paper. Theoretical analysis shows that the output signal-to-noise ratio (SNR) decreases monotonously with the increasing noise intensity but the output SNR-gain is stable. Inspired by this high SNR-gain phenomenon, this paper applies the linear monostable system in the parameters estimation algorithm for phase shift keying (PSK) signals and improves the estimation performance. - Highlights: • The response of a linear monostable system driven with a periodic signal and an additive white Gaussian noise is analyzed. • The optimal parameter of this linear monostable system to maximum the output SNR-gain is obtained. • Application of this linear monostable system in parameters estimation algorithm for PSK signals obtains performance improvement.

  1. Dicty_cDB: AFO224 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ksck*ey snr*slrftrketllqsw*t*cscp*t*lcrpir*syrkrsfithllwyskw*fcnfthc wcsswyrn*thr*w*nyn*rccwssns*ilftnfrei...ki*ni Frame B: fkknhlgnlkifnikk*kksflttfvyaeekkrnekyiiirfwlcckast*lplkkrrlf cnnc*fi

  2. Super-virtual refraction interferometry: Field data example over a colluvial wedge

    KAUST Repository

    Hanafy, Sherif M.; Alhagan, Ola; Al-Tawash, Feras

    2011-01-01

    The theory of super-virtual refraction interferometry was recently developed to enhance the signal-to-noise ratio (SNR) of far-offset traces in refraction surveys. This enhancement of SNR is proportional to N, and can be as high as N if an iterative procedure is used. Here N is the number of post-critical shot positions that coincides with the receiver locations. We now demonstrate the enhancement of SNR of the super-virtual refraction traces for seismic data collected over a normal fault in Saudi Arabia. Results show that both the SNR of the super-virtual data set and the number of reliable first-arrival-traveltime picks are significantly increased. © 2011 Society of Exploration Geophysicists.

  3. Spasm of the near reflex: A case report

    Directory of Open Access Journals (Sweden)

    Maedbh Rhatigan

    2017-06-01

    Conclusion and importance: SNR is predominantly a clinical diagnosis, and often leads to patients undergoing unnecessary investigations and sometimes treatment. Recognising the salient features that differentiate it could potentially avoid this.

  4. Millimeter-wave Camera, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — Traditional SAR imaging at millimeter wave frequencies can provide excellent, high SNR, 3D images of features inside dielectric solids. However, imaging at these...

  5. Transmit selection for imperfect threshold-based receive MRC in Rayleigh fading channels

    KAUST Repository

    Radaydeh, Redha Mahmoud Mesleh; Alouini, Mohamed-Slim

    2010-01-01

    experience identically distributed and non-identically distributed Rayleigh fading conditions. New closed-form expressions for the combined SNR statistics and some performance measures are presented. The system models adopted herein and the presented

  6. A complex symbol signal-to-noise ratio estimator and its performance

    Science.gov (United States)

    Feria, Y.

    1994-01-01

    This article presents an algorithm for estimating the signal-to-noise ratio (SNR) of signals that contain data on a downconverted suppressed carrier or the first harmonic of a square-wave subcarrier. This algorithm can be used to determine the performance of the full-spectrum combiner for the Galileo S-band (2.2- to 2.3-GHz) mission by measuring the input and output symbol SNR. A performance analysis of the algorithm shows that the estimator can estimate the complex symbol SNR using 10,000 symbols at a true symbol SNR of -5 dB with a mean of -4.9985 dB and a standard deviation of 0.2454 dB, and these analytical results are checked by simulations of 100 runs with a mean of -5.06 dB and a standard deviation of 0.2506 dB.

  7. Interpixel crosstalk cancellation on holographic memory

    Science.gov (United States)

    Ishii, Toshiki; Fujimura, Ryushi

    2017-09-01

    In holographic memory systems, there have been no practical techniques to minimize interpixel crosstalk thus far. We developed an interpixel crosstalk cancellation technique using a checkerboard phase pattern with a phase difference of π/2, which can decrease the size of the spatial filter along the Fourier plane with the signal-to-noise ratio (SNR) kept high. This interpixel crosstalk cancellation technique is simple because it requires only one phase plate in the signal beam path. We verified the effect of such a cancellation technique by simulation. The improvement of SNR is maximized to 6.5 dB when the filter size specified in the Nyquist areal ratio is approximately 1.05 in ideal optical systems with no other fixed noise. The proposed technique can improve SNR by 0.85 in an assumed monocular architecture at an actual noise intensity. This improvement of SNR is very useful for realizing high-density recording or enhancing system robustness.

  8. Coherent Integrations, Fringe Modeling, and Bootstrapping With the NPOI

    National Research Council Canada - National Science Library

    Jorgensen, Anders M; Mozurkewich, Dave; Schmitt, Henrique; Armstrong, J. T; Gilbreath, G. C; Hindsley, Robert; Pauls, Thomas A; Peterson, Deane M

    2006-01-01

    .... It causes fringes to move on ms time-scales, forcing very short exposures. Because of the semi-random phase shifts, the traditional approach averages exposure power spectra to build signal-to-noise ratio (SNR...

  9. 2323-IJBCS-Article-Dr Emmanuel Ebudinya

    African Journals Online (AJOL)

    hp

    showed that the CDF manifested a reinforcing effect on the SNR10 vulcanizates but inferior to carbon black,. N330-filled ... The hardness results of the CDF-filled vulcanizates showed slight superiority over that of .... grinding machine.

  10. Spiral Waves and Multiple Spatial Coherence Resonances Induced by Colored Noise in Neuronal Network

    International Nuclear Information System (INIS)

    Tang Zhao; Li Yuye; Xi Lei; Jia Bing; Gu Huaguang

    2012-01-01

    Gaussian colored noise induced spatial patterns and spatial coherence resonances in a square lattice neuronal network composed of Morris-Lecar neurons are studied. Each neuron is at resting state near a saddle-node bifurcation on invariant circle, coupled to its nearest neighbors by electronic coupling. Spiral waves with different structures and disordered spatial structures can be alternately induced within a large range of noise intensity. By calculating spatial structure function and signal-to-noise ratio (SNR), it is found that SNR values are higher when the spiral structures are simple and are lower when the spatial patterns are complex or disordered, respectively. SNR manifest multiple local maximal peaks, indicating that the colored noise can induce multiple spatial coherence resonances. The maximal SNR values decrease as the correlation time of the noise increases. These results not only provide an example of multiple resonances, but also show that Gaussian colored noise play constructive roles in neuronal network. (general)

  11. Performance analysis of best relay selection scheme for amplify-and-forward cooperative networks in identical Nakagami-m channels

    KAUST Repository

    Hussain, Syed Imtiaz; Alouini, Mohamed-Slim; Hasna, Mazen Omar

    2010-01-01

    for a cooperative network with multiple relays operating in amplify-and-forward (AF) mode over identical Nakagami-m channels using exact source-relay-destination signal to noise ratio (SNR) expression. We derive accurate closed form expressions

  12. Involvement in Learning Revisited: Lessons We Have Learned.

    Science.gov (United States)

    Astin, Alexander W.

    1996-01-01

    Discusses interconnections between the following two national reports: (1) Involvement in Learning; and (2) The Student Learning Imperative. Reviews recent research on student development in order to demonstrate how student affairs professionals can use this information to enhance learning. (SNR)

  13. Ketogenic diet prevents neuronal firing increase within the substantia nigra during pentylenetetrazole-induced seizure in rats.

    Science.gov (United States)

    Viggiano, Andrea; Stoddard, Madison; Pisano, Simone; Operto, Francesca Felicia; Iovane, Valentina; Monda, Marcellino; Coppola, Giangennaro

    2016-07-01

    The mechanism responsible for the anti-seizure effect of ketogenic diets is poorly understood. Because the substantia nigra pars reticulata (SNr) is a "gate" center for seizures, the aim of the present experiment was to evaluate if a ketogenic diet modifies the neuronal response of this nucleus when a seizure-inducing drug is administered in rats. Two groups of rats were given a standard diet (group 1) or a ketogenic diet (group 2) for four weeks, then the threshold for seizure induction and the firing rate of putative GABAergic neurons within the SNr were evaluated with progressive infusion of pentylenetetrazole under general anesthesia. The results demonstrated that the ketogenic diet abolished the correlation between the firing rate response of SNr-neurons and the seizure-threshold. This result suggests that the anti-seizure effect of ketogenic diets can be due to a decrease in reactivity of GABAergic SNr-neurons. Copyright © 2016 Elsevier Inc. All rights reserved.

  14. Two-way cooperative AF relaying in spectrum-sharing systems: Enhancing cell-edge performance

    KAUST Repository

    Xia, Minghua; Aï ssa, Sonia

    2012-01-01

    signal-to-noise ratio (SNR). These important findings provide fresh perspectives for system designers to improve spectral efficiency of secondary users in next-generation broadband spectrum-sharing wireless systems. © 2012 IEEE.

  15. Assessment of the scatter correction procedures in single photon emission computed tomography imaging using simulation and clinical study

    Directory of Open Access Journals (Sweden)

    Mehravar Rafati

    2017-01-01

    Conclusion: The simulation and the clinical studies showed that the new approach could be better performance than DEW, TEW methods, according to values of the contrast, and the SNR for scatter correction.

  16. Signal-to-noise ratio application to seismic marker analysis and fracture detection

    Science.gov (United States)

    Xu, Hui-Qun; Gui, Zhi-Xian

    2014-03-01

    Seismic data with high signal-to-noise ratios (SNRs) are useful in reservoir exploration. To obtain high SNR seismic data, significant effort is required to achieve noise attenuation in seismic data processing, which is costly in materials, and human and financial resources. We introduce a method for improving the SNR of seismic data. The SNR is calculated by using the frequency domain method. Furthermore, we optimize and discuss the critical parameters and calculation procedure. We applied the proposed method on real data and found that the SNR is high in the seismic marker and low in the fracture zone. Consequently, this can be used to extract detailed information about fracture zones that are inferred by structural analysis but not observed in conventional seismic data.

  17. Quantum transport model for zigzag molybdenum disulfide nanoribbon structures : A full quantum framework

    International Nuclear Information System (INIS)

    Chen, Chun-Nan; Shyu, Feng-Lin; Chung, Hsien-Ching; Lin, Chiun-Yan; Wu, Jhao-Ying

    2016-01-01

    Mainly based on non-equilibrium Green’s function technique in combination with the three-band model, a full atomistic-scale and full quantum method for solving quantum transport problems of a zigzag-edge molybdenum disulfide nanoribbon (zMoSNR) structure is proposed here. For transport calculations, the relational expressions of a zMoSNR crystalline solid and its whole device structure are derived in detail and in its integrity. By adopting the complex-band structure method, the boundary treatment of this open boundary system within the non-equilibrium Green’s function framework is so straightforward and quite sophisticated. The transmission function, conductance, and density of states of zMoSNR devices are calculated using the proposed method. The important findings in zMoSNR devices such as conductance quantization, van Hove singularities in the density of states, and contact interaction on channel are presented and explored in detail.

  18. Quantum transport model for zigzag molybdenum disulfide nanoribbon structures : A full quantum framework

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Chun-Nan, E-mail: quantum@mail.tku.edu.tw, E-mail: ccn1114@kimo.com [Quantum Engineering Laboratory, Department of Physics, Tamkang University, Tamsui, New Taipei 25137, Taiwan (China); Shyu, Feng-Lin [Department of Physics, R.O.C. Military Academy, Kaohsiung 830, Taiwan (China); Chung, Hsien-Ching; Lin, Chiun-Yan [Department of Physics, National Cheng Kung University, Tainan 70101, Taiwan (China); Wu, Jhao-Ying [Center of General Studies, National Kaohsiung Marine University, Kaohsiung 811, Taiwan (China)

    2016-08-15

    Mainly based on non-equilibrium Green’s function technique in combination with the three-band model, a full atomistic-scale and full quantum method for solving quantum transport problems of a zigzag-edge molybdenum disulfide nanoribbon (zMoSNR) structure is proposed here. For transport calculations, the relational expressions of a zMoSNR crystalline solid and its whole device structure are derived in detail and in its integrity. By adopting the complex-band structure method, the boundary treatment of this open boundary system within the non-equilibrium Green’s function framework is so straightforward and quite sophisticated. The transmission function, conductance, and density of states of zMoSNR devices are calculated using the proposed method. The important findings in zMoSNR devices such as conductance quantization, van Hove singularities in the density of states, and contact interaction on channel are presented and explored in detail.

  19. Pulsar Wind Nebulae inside Supernova Remnants as Cosmic-Ray PeVatrons

    Science.gov (United States)

    Ohira, Yutaka; Kisaka, Shota; Yamazaki, Ryo

    2018-05-01

    We propose that cosmic-ray PeVatrons are pulsar wind nebulae (PWNe) inside supernova remnants (SNRs). The PWN initially expands into the freely expanding stellar ejecta. Then, the PWN catches up with the shocked region of the SNR, where particles can be slightly accelerated by the back and forth motion between the PWN and the SNR, and some particles diffuse into the PWN. Afterwards the PWN is compressed by the SNR, where the particles in the PWN are accelerated by the adiabatic compression. Using a Monte Carlo simulation, we show that particles accelerated by the SNR to 0.1 PeV can be reaccelerated to 1 PeV until the end of the PWN compression.

  20. Super-virtual refraction interferometry: an engineering field data example

    KAUST Repository

    Hanafy, Sherif M.; Alhagan, Ola

    2012-01-01

    The theory of super-virtual refraction interferometry (SVI) was recently developed to enhance the signal-to-noise ratio (SNR) of far-offset traces in refraction surveys. This enhancement of the SNR is proportional to √N and can be as high as N if an iterative procedure is used. Here N is the number of post-critical shot positions that coincides with the receiver locations. We now demonstrate the SNR enhancement of super-virtual refraction traces for one engineering-scale synthetic data and two field seismic data sets. The field data are collected over a normal fault in Saudi Arabia. Results show that both the SNR of the super-virtual data set and the number of reliable first-arrival traveltime picks are significantly increased. © 2012 European Association of Geoscientists & Engineers.

  1. Exact Outage Probability of Dual-Hop CSI-Assisted AF Relaying Over Nakagami-m Fading Channels

    KAUST Repository

    Xia, Minghua; Aissa, Sonia; Wu, Yik-Chung

    2012-01-01

    to evaluate the outage performance of the system under study. The analytical results of outage probability coincide exactly with Monte-Carlo simulation results and outperform the previously reported upper bounds in the low and medium SNR regions.

  2. Limitations and Strengths of the Fourier Transform Method to Detect Accelerating Targets

    National Research Council Canada - National Science Library

    Thayaparan, Thayananthan

    2000-01-01

    .... In using a Pulse Doppler Radar to detect a non-accelerating target in additive white Gaussian noise and to estimate its radial velocity, the Fourier method provides an output signal-to-noise ratio (SNR...

  3. Phenomenon of entropic stochastic resonance with asymmetric dichotomous noise and white noise

    International Nuclear Information System (INIS)

    Guo, Feng; Li, Shao-Fu; Cheng, Xiao-Feng

    2012-01-01

    The entropic stochastic resonance (ESR) in a confined system subject to asymmetric dichotomous noise, white noise, and a periodic square-wave signal is investigated. Under the adiabatic approximation condition, by use of the properties of the dichotomous noise, we obtain the expression of the output signal-to-noise ratio (SNR) based on two-state theory. The SNR is shown to be a nonmonotonic function of the strength and asymmetry of the dichotomous noise, the intensity of the white noise, and the amplitude of the square-wave signal. The SNR varies non-monotonically with increases in the parameters of the confined structure. The influence of the correlation rate of the dichotomous noise and the frequency of the external constant force on the SNR is also discussed.

  4. A Comparative Study for Orthogonal Subspace Projection and Constrained Energy Minimization

    National Research Council Canada - National Science Library

    Du, Qian; Ren, Hsuan; Chang, Chein-I

    2003-01-01

    ...: orthogonal subspace projection (OSP) and constrained energy minimization (CEM). It is shown that they are closely related and essentially equivalent provided that the noise is white with large SNR...

  5. Stochastic resonance in an asymmetric bistable system driven by multiplicative colored noise and additive white noise

    International Nuclear Information System (INIS)

    Zhou Bingchang; Xu Wei

    2008-01-01

    The phenomenon of stochastic resonance (SR) in a bistable system driven by multiplicative colored and additive white noises and a periodic rectangular signal with a constant component is studied by using the unified colored noise approximation and the theory of signal-to-noise (SNR) in the adiabatic limit. The analytic expression of the SNR is obtained for arbitrary signal amplitude without being restricted to small amplitudes. The SNR is a non-monotonic function of intensities of multiplicative colored and additive white noises and correlation time of multiplicative colored noise, so SR exhibits in the bistable system. The effects of potential asymmetry r and correlation time τ of multiplicative colored noise on SNR are opposite. Moreover, It is more sensitive to control SR through adjusting the additive white noise intensity D than adjusting the multiplicative colored noise intensity Q

  6. Plant dynamics and safety analysis of fast breeder reactors

    International Nuclear Information System (INIS)

    Ertel, V.

    1982-01-01

    Some general features of sodium cooled fast breeders which influence the thermohydraulics and differ from LWR'S are discussed. Using the SNR-300 as a reference, some thermohydraulic transients from normal operation and from design accidents are presented. (orig.)

  7. Steam generation at Rihand STPP Stage 1

    Energy Technology Data Exchange (ETDEWEB)

    1987-12-01

    The steam generation plant at Rihand in India has two 500 MW boilers. The boilers are of the balanced draught, single cell, radiant furnace type, and are controlled automatically. Cochran Thermax shell type auxillary steam boilers are used for preheating air to the main boilers and for heating fuel oil during storage and pumping. Electrostatic precipitators and ash handling plants are provided to keep dust and ash within limits. 2 figs.

  8. Structure and Stability of Pt-Y Alloy Particles for Oxygen Reduction Studied by Electron Microscopy

    DEFF Research Database (Denmark)

    Deiana, Davide; Wagner, Jakob Birkedal; Hansen, Thomas Willum

    2015-01-01

    Platinum-yttrium alloy nanoparticles show both a high activity and stability for the oxygen reduction reaction. The catalysts were prepared by magnetron sputter aggregation and mass filtration providing a model catalyst system with a narrow size distribution. The structure and stability of nanost...... the catalyst after reaction and after aging tests shows the development of a core-shell type structure after being exposed to reaction conditions....

  9. Transformers analysis, design, and measurement

    CERN Document Server

    Lopez-Fernandez, Xose M; Turowski, Janusz

    2012-01-01

    This book focuses on contemporary economic, design, diagnostics, and maintenance aspects of power, instrument, and high frequency transformers, which are critical to designers for a transformer stations. The text covers such topics as shell type and superconducting transformers as well as coreless PCB and planar transformers. It emphasizes challenges and strategies in transformer design and illustrates the importance of economics in transformers management by reviewing life cycle cost design and the use of decision methods to manage risk.

  10. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    ... chemical bonds can be established between the SiO2 silanol surface groups and the MPR carboxylic chains, to render SiO2/MPR core-shell-type compounds. The presence of PFR or MPR resins during the sol–gel production of silica microspheres allows to control: the sizes of final SiO2 particles and; the transparency or ...

  11. Structural design study of tritium breeding blanket with a lead layer as a neutron multiplier

    International Nuclear Information System (INIS)

    Iida, Hiromasa; Kitamura, Kazunori; Minato, Akio; Sakamoto, Hiroki; Yamamoto, Takashi

    1980-12-01

    Thermal and structural design study of a tritium breeding blanket with a lead layer for a International Tokamak Reactor (INTOR) is carried out. Tube in shell type blanket with a lead layer is found to be promising. The volume fraction of structural material in the lead layer can be small enough to keep the neutron multiplication effect of lead. Reasonable value of shell effect is attainable due to lead layer in the front part of the blanket. (author)

  12. A Wide Area Bipolar Cascade Resonant Cavity Light Emitting Diode for a Hybrid Range-Intensity Sensor

    Science.gov (United States)

    2008-06-19

    to produce the required SNR. Also, through parametric analysis, we determined that a system iii trade -off, between the collection optic diameter, and...edition, 1989. 65. van der Ziel, J. P. and W. T. Tsang. “ Intergrated multilayer GaAs laser separated by tunnel junctions”. Applied Physics Letters...can deliver sufficient energy to produce the required SNR. Also, through parametric analysis, we determined that a system trade -off, between the

  13. Automatic Modulation Classification of LFM and Polyphase-coded Radar Signals

    Directory of Open Access Journals (Sweden)

    S. B. S. Hanbali

    2017-12-01

    Full Text Available There are several techniques for detecting and classifying low probability of intercept radar signals such as Wigner distribution, Choi-Williams distribution and time-frequency rate distribution, but these distributions require high SNR. To overcome this problem, we propose a new technique for detecting and classifying linear frequency modulation signal and polyphase coded signals using optimum fractional Fourier transform at low SNR. The theoretical analysis and simulation experiments demonstrate the validity and efficiency of the proposed method.

  14. Quality assurance in MRI breast screening: comparing signal-to-noise ratio in dynamic contrast-enhanced imaging protocols

    Science.gov (United States)

    Kousi, Evanthia; Borri, Marco; Dean, Jamie; Panek, Rafal; Scurr, Erica; Leach, Martin O.; Schmidt, Maria A.

    2016-01-01

    MRI has been extensively used in breast cancer staging, management and high risk screening. Detection sensitivity is paramount in breast screening, but variations of signal-to-noise ratio (SNR) as a function of position are often overlooked. We propose and demonstrate practical methods to assess spatial SNR variations in dynamic contrast-enhanced (DCE) breast examinations and apply those methods to different protocols and systems. Four different protocols in three different MRI systems (1.5 and 3.0 T) with receiver coils of different design were employed on oil-filled test objects with and without uniformity filters. Twenty 3D datasets were acquired with each protocol; each dataset was acquired in under 60 s, thus complying with current breast DCE guidelines. In addition to the standard SNR calculated on a pixel-by-pixel basis, we propose other regional indices considering the mean and standard deviation of the signal over a small sub-region centred on each pixel. These regional indices include effects of the spatial variation of coil sensitivity and other structured artefacts. The proposed regional SNR indices demonstrate spatial variations in SNR as well as the presence of artefacts and sensitivity variations, which are otherwise difficult to quantify and might be overlooked in a clinical setting. Spatial variations in SNR depend on protocol choice and hardware characteristics. The use of uniformity filters was shown to lead to a rise of SNR values, altering the noise distribution. Correlation between noise in adjacent pixels was associated with data truncation along the phase encoding direction. Methods to characterise spatial SNR variations using regional information were demonstrated, with implications for quality assurance in breast screening and multi-centre trials.

  15. Masking Release for Igbo and English

    OpenAIRE

    Ebem, Deborah U.; Desloge, Joseph G.; Reed, Charlotte M.; Braida, Louis D.; Uguru, Joy O.

    2013-01-01

    In this research, we explored the effect of noise interruption rate on speech intelligibility. Specifically, we used the Hearing In Noise Test (HINT) procedure with the original HINT stimuli (English) and Igbo stimuli to assess speech reception ability in interrupted noise. For a given noise level, the HINT test provides an estimate of the signal-to-noise ratio (SNR) required for 50%-correct speech intelligibility. The SNR for 50%-correct intelligibility changes depending upon the interruptio...

  16. Simultaneous multi-slice echo planar diffusion weighted imaging of the liver and the pancreas: Optimization of signal-to-noise ratio and acquisition time and application to intravoxel incoherent motion analysis

    Energy Technology Data Exchange (ETDEWEB)

    Boss, Andreas, E-mail: andreas.boss@usz.ch [Institute of Diagnostic and Interventional Radiology, University Hospital Zurich (Switzerland); Barth, Borna; Filli, Lukas; Kenkel, David; Wurnig, Moritz C. [Institute of Diagnostic and Interventional Radiology, University Hospital Zurich (Switzerland); Piccirelli, Marco [Institute of Neuroradiology, University Hospital of Zurich (Switzerland); Reiner, Caecilia S. [Institute of Diagnostic and Interventional Radiology, University Hospital Zurich (Switzerland)

    2016-11-15

    Purpose: To optimize and test a diffusion-weighted imaging (DWI) echo-planar imaging (EPI) sequence with simultaneous multi-slice (SMS) excitation in the liver and pancreas regarding acquisition time (TA), number of slices, signal-to-noise ratio (SNR), image quality (IQ), apparent diffusion coefficient (ADC) quantitation accuracy, and feasibility of intravoxel incoherent motion (IVIM) analysis. Materials and methods: Ten healthy volunteers underwent DWI of the upper abdomen at 3T. A SMS DWI sequence with CAIPIRINHA unaliasing technique (acceleration factors 2/3, denoted AF2/3) was compared to standard DWI-EPI (AF1). Four schemes were evaluated: (i) reducing TA, (ii) keeping TA identical with increasing number of averages, (iii) increasing number of slices with identical TA (iv) increasing number of b-values for IVIM. Acquisition schemes i-iii were evaluated qualitatively (reader score) and quantitatively (ADC values, SNR). Results: In scheme (i) no differences in SNR were observed (p = 0.321 − 0.038) with reduced TA (AF2 increase in SNR/time 75.6%, AF3 increase SNR/time 102.4%). No SNR improvement was obtained in scheme (ii). Increased SNR/time could be invested in acquisition of more and thinner slices or higher number of b-values. Image quality scores were stable for AF2 but decreased for AF3. Only for AF3, liver ADC values were systematically lower. Conclusion: SMS-DWI of the liver and pancreas provides substantially higher SNR/time, which either may be used for shorter scan time, higher slice resolution or IVIM measurements.

  17. Radiometric and signal-to-noise ratio properties of multiplex dispersive spectrometry

    International Nuclear Information System (INIS)

    Barducci, Alessandro; Guzzi, Donatella; Lastri, Cinzia; Nardino, Vanni; Marcoionni, Paolo; Pippi, Ivan

    2010-01-01

    Recent theoretical investigations have shown important radiometric disadvantages of interferential multiplexing in Fourier transform spectrometry that apparently can be applied even to coded aperture spectrometers. We have reexamined the methods of noninterferential multiplexing in order to assess their signal-to-noise ratio (SNR) performance, relying on a theoretical modeling of the multiplexed signals. We are able to show that quite similar SNR and radiometric disadvantages affect multiplex dispersive spectrometry. The effect of noise on spectral estimations is discussed.

  18. Heaters to simulate fuel pins for heat transfer tests in single-phase liquid-metal-flow

    International Nuclear Information System (INIS)

    Casal, V.; Graf, E.; Hartmann, W.

    1976-09-01

    The development of heaters for thermal simulation of the fuel elements of liquid metal cooled fast breeder reactors (SNR) is reported. Beginning with the experimental demands various heating methods are discussed for thermodynamic investigations of the heat transfer in liquid metals. Then a preferred heater rod is derived to simulate the fuel pins of a SNR. Finally it is reported on the fabrication and the operation practice. (orig.) [de

  19. Benefit of a Contralateral Routing of Signal Device for Unilateral Cochlear Implant Users.

    OpenAIRE

    Weder, Stefan; Kompis, Martin; Caversaccio, Marco; Stieger, Christof

    2014-01-01

    Objective: To investigate objective and subjective effects of an adjunctive contralateral routing of signal (CROS) device at the untreated ear in patients with a unilateral cochlear implant (CI). Design: Prospective study of 10 adult experienced unilateral CI users with bilateral severe-to-profound hearing loss. Speech in noise reception (SNR) and sound localization were measured with and without the additional CROS device. SNR was measured by applying speech signals at the untreated/CROS sid...

  20. The influence of the maximal value and peak enhancement value of arterial and venous enhancement curve on CT perfusion parameters and signal-to-noise ratio

    International Nuclear Information System (INIS)

    Ju Haiyue; Gao Sijia; Xu Ke; Wang Qiang

    2007-01-01

    Objective: To explore the influence of the maximal value and peak enhancement value of arterial and venous enhancement curve on CT perfusion parameters and signal-to-noise ratio (SNR). Methods: Seventeen patients underwent brain CT perfusion scanning. All row data were analyzed with perfusion software for 6 times, and get different arterial and venous enhancement curves for each patient. The maximal values and peak enhancement values of each arterial and venous enhancement curves, as well as mean perfusion parameters including cerebral blood flow (CBF), cerebral blood volume (CBV), mean transit time (MTT), permeability surface area product (PS), and their standard deviations (SD) in homolateral white and gray matter were measured and recorded. SNR was calculated by dividing the mean perfusion parameter value by its SD. Pearson correlation analysis and two-tailed paired Student t test were used for statistics. Results: The maximal values and peak enhancement values of arterial and venous curves were correlated with mean SNR CBF , SNR CBV and SNR MTT in both white matter and gray matters (r value range: 0.332-0.922, P PS in white matter(r=0.256, P PS (in both white matter and gray matters) and arterial peak enhancement values, the maximal values and venous peak enhancement values, or between SNR PS (in gray matter) and the maximal values of venous curve(r value range: -0.058-0.210, P>0.05). (2) Mean CBF, CBV and PS values in the group with low venous peak enhancement values were significantly different from the group with high venous peak enhancement values in both white and gray matters (t value range: 3.830-5.337, P 0.05). Conclusions: The mean perfusion parameters and SNR are influenced by the maximal values and peak enhancement values of the arterial and venous curves. Peak enhancement of arterial and venous curves should be adjusted to higher level to make parameter values more reliable and increase the SNR. (authors)

  1. Power Adaptive Feedback Communication over an Additive Individual Noise Sequence Channel

    OpenAIRE

    Lomnitz, Yuval; Feder, Meir

    2009-01-01

    We consider a real-valued additive channel with an individual unknown noise sequence. We present a simple sequential communication scheme based on the celebrated Schalkwijk-Kailath scheme, which varies the transmit power according to the power of the sequence, so that asymptotically the relation between the SNR and the rate matches the Gaussian channel capacity 1/2 log(1+SNR)for almost every noise sequence.

  2. Signal-to-noise limitations in white light holography.

    Science.gov (United States)

    Ribak, E; Roddier, C; Roddier, F; Breckinridge, J B

    1988-03-15

    A simple derivation is given for the signal-to-noise ratio (SNR) in images reconstructed from incoherent holograms. Dependence is shown to be on the hologram SNR, object complexity, and the number of pixels in the detector. Reconstruction of involved objects becomes possible with high dynamic range detectors such as charge coupled devices. We have produced such white light holograms by means of a rotational shear interferometer combined with a chromatic corrector. A digital inverse transform recreated the object.

  3. Identification of a jet-driven supernova remnant in the Small Magellanic Cloud: Possible evidence for the enhancement of bipolar explosions at low metallicity

    International Nuclear Information System (INIS)

    Lopez, Laura A.; Castro, Daniel; Slane, Patrick O.; Ramirez-Ruiz, Enrico; Badenes, Carles

    2014-01-01

    Recent evidence has suggested that the supernova remnant (SNR) 0104–72.3 in the Small Magellanic Cloud (SMC) may be the result of a 'prompt' Type Ia SN on the basis of enhanced iron abundances and its association with a star-forming region. In this paper, we present evidence that SNR 0104–72.3 arose from a jet-driven bipolar core-collapse (CC) SN. Specifically, we use serendipitous Chandra data of SNR 0104–72.3 taken because of its proximity to the calibration source SNR E0102–72.3. We analyze 56 Advanced CCD Imaging Spectrometer (ACIS) observations of SNR 0104–72.3 to produce imaging and spectra with an effective exposure of 528.6 ks. We demonstrate that SNR 0104–72.3 is highly elliptical relative to other nearby young SNRs, suggesting a CC SN origin. Furthermore, we compare ejecta abundances derived from spectral fits to nucleosynthetic yields of Type Ia and CC SNe, and we find that the iron, neon, and silicon abundances are consistent with either a spherical CC SN of a 18-20 M ☉ progenitor or an aspherical CC SN of a 25 M ☉ progenitor. We show that the star formation history at the site of SNR 0104–72.3 is also consistent with a CC origin. Given the bipolar morphology of the SNR, we favor the aspherical CC SN scenario. This result may suggest jet-driven SNe occur frequently in the low-metallicity environment of the SMC, consistent with the observational and theoretical work on broad-line Type Ic SNe and long-duration gamma-ray bursts.

  4. Changes in signal-to-noise ratios and contrast-to-noise ratios of hypervascular hepatocellular carcinomas on ferucarbotran-enhanced dynamic MR imaging

    International Nuclear Information System (INIS)

    Park, Yulri; Choi, Dongil; Kim, Seong Hyun; Kim, Seung Hoon; Kim, Min Ju; Lee, Jongmee; Lim, Jae Hoon; Lee, Won Jae; Lim, Hyo K.

    2006-01-01

    Purpose: To verify changes in the signal-to-noise ratios (SNRs) and contrast-to-noise ratios (CNRs) of hypervascular hepatocellular carcinomas (HCCs) on ferucarbotran-enhanced dynamic T1-weighted MR imaging. Materials and methods: Fifty-two patients with 61 hypervascular HCCs underwent ferucarbotran-enhanced dynamic MR imaging, and then hepatic resection. Hypervascular HCCs were identified when definite enhancement was noted during the arterial dominant phase of three-phase MDCT. Dynamic MR Images with T1-weighted fast multiplanar spoiled gradient-recalled echo sequence (TR200/TE4.2) were obtained before and 20 s, and 1, 3, 5, and 10 min, after bolus injection of ferucarbotran. We estimated the signal intensities of tumors and livers, and calculated the SNRs and CNRs of the tumors. Results: On ferucarbotran-enhanced dynamic MR imaging, SNR measurements showed a fluctuating pattern, namely, an increase in SNR followed by a decrease and a subsequent increase (or a decrease in SNR followed by a increase and a subsequent decrease) in 50 (82.0%) of 61 tumors, a single-peak SNR pattern (highest SNR on 20 s, 1, 3, or 5 min delayed images followed by a decrease) in seven (11.5%), and a decrease in SNR followed by an increase in four (6.6%). Maximum absolute CNRs with positive value were noted on 10 min delayed images in 41 (67.2%) tumors, and maximum absolute CNRs with negative value were observed on 20 s delayed images in 12 (19.7%) and on 1 min delayed images in eight (13.1%). Conclusion: Despite showing various SNR and CNR changes, the majority of hypervascular HCCs demonstrated a fluctuating SNR pattern on ferucarbotran-enhanced dynamic MR imaging and a highest CNR on 10 min delayed image, which differed from the classic enhancement pattern on multiphasic CT

  5. Simultaneous multi-slice echo planar diffusion weighted imaging of the liver and the pancreas: Optimization of signal-to-noise ratio and acquisition time and application to intravoxel incoherent motion analysis

    International Nuclear Information System (INIS)

    Boss, Andreas; Barth, Borna; Filli, Lukas; Kenkel, David; Wurnig, Moritz C.; Piccirelli, Marco; Reiner, Caecilia S.

    2016-01-01

    Purpose: To optimize and test a diffusion-weighted imaging (DWI) echo-planar imaging (EPI) sequence with simultaneous multi-slice (SMS) excitation in the liver and pancreas regarding acquisition time (TA), number of slices, signal-to-noise ratio (SNR), image quality (IQ), apparent diffusion coefficient (ADC) quantitation accuracy, and feasibility of intravoxel incoherent motion (IVIM) analysis. Materials and methods: Ten healthy volunteers underwent DWI of the upper abdomen at 3T. A SMS DWI sequence with CAIPIRINHA unaliasing technique (acceleration factors 2/3, denoted AF2/3) was compared to standard DWI-EPI (AF1). Four schemes were evaluated: (i) reducing TA, (ii) keeping TA identical with increasing number of averages, (iii) increasing number of slices with identical TA (iv) increasing number of b-values for IVIM. Acquisition schemes i-iii were evaluated qualitatively (reader score) and quantitatively (ADC values, SNR). Results: In scheme (i) no differences in SNR were observed (p = 0.321 − 0.038) with reduced TA (AF2 increase in SNR/time 75.6%, AF3 increase SNR/time 102.4%). No SNR improvement was obtained in scheme (ii). Increased SNR/time could be invested in acquisition of more and thinner slices or higher number of b-values. Image quality scores were stable for AF2 but decreased for AF3. Only for AF3, liver ADC values were systematically lower. Conclusion: SMS-DWI of the liver and pancreas provides substantially higher SNR/time, which either may be used for shorter scan time, higher slice resolution or IVIM measurements.

  6. Using optical fibers with different modes to improve the signal-to-noise ratio of diffuse correlation spectroscopy flow-oximeter measurements

    OpenAIRE

    He, Lian; Lin, Yu; Shang, Yu; Shelton, Brent J.; Yu, Guoqiang

    2013-01-01

    The dual-wavelength diffuse correlation spectroscopy (DCS) flow-oximeter is an emerging technique enabling simultaneous measurements of blood flow and blood oxygenation changes in deep tissues. High signal-to-noise ratio (SNR) is crucial when applying DCS technologies in the study of human tissues where the detected signals are usually very weak. In this study, single-mode, few-mode, and multimode fibers are compared to explore the possibility of improving the SNR of DCS flow-oximeter measure...

  7. Signal-to-noise limitations in white light holography

    Science.gov (United States)

    Ribak, Erez; Breckinridge, James B.; Roddier, Claude; Roddier, Francois

    1988-01-01

    A simple derivation is given for the SNR in images reconstructed from incoherent holograms. Dependence is shown to be on the hologram SNR, object complexity, and the number of pixels in the detector. Reconstruction of involved objects becomes possible with high-dynamic-range detectors such as CCDs. White-light holograms have been produced by means of a rotational shear interferometer combined with a chromatic corrector. A digital inverse transform recreated the object.

  8. Stochastic resonance in a time-delayed mono-stable system with correlated multiplicative and additive white noise

    International Nuclear Information System (INIS)

    Zhou Yu-Rong

    2011-01-01

    This paper considers the stochastic resonance for a time-delayed mono-stable system, driven by correlated multiplicative and additive white noise. It finds that the output signal-to-noise ratio (SNR) varies non-monotonically with the delayed times. The SNR varies non-monotonically with the increase of the intensities of the multiplicative and additive noise, with the increase of the correlation strength between the two noises, as well as with the system parameter. (general)

  9. Molecular and functional differences in voltage-activated sodium currents between GABA projection neurons and dopamine neurons in the substantia nigra

    OpenAIRE

    Ding, Shengyuan; Wei, Wei; Zhou, Fu-Ming

    2011-01-01

    GABA projection neurons (GABA neurons) in the substantia nigra pars reticulata (SNr) and dopamine projection neurons (DA neurons) in substantia nigra pars compacta (SNc) have strikingly different firing properties. SNc DA neurons fire low-frequency, long-duration spikes, whereas SNr GABA neurons fire high-frequency, short-duration spikes. Since voltage-activated sodium (NaV) channels are critical to spike generation, the different firing properties raise the possibility that, compared with DA...

  10. Intrinsic and integrative properties of substantia nigra pars reticulata neurons

    Science.gov (United States)

    Zhou, Fu-Ming; Lee, Christian R.

    2011-01-01

    The GABA projection neurons of the substantia nigra pars reticulata (SNr) are output neurons for the basal ganglia and thus critical for movement control. Their most striking neurophysiological feature is sustained, spontaneous high frequency spike firing. A fundamental question is: what are the key ion channels supporting the remarkable firing capability in these neurons? Recent studies indicate that these neurons express tonically active TRPC3 channels that conduct a Na-dependent inward current even at hyperpolarized membrane potentials. When the membrane potential reaches −60 mV, a voltage-gated persistent sodium current (INaP) starts to activate, further depolarizing the membrane potential. At or slightly below −50 mV, the large transient voltage-activated sodium current (INaT) starts to activate and eventually triggers the rapid rising phase of action potentials. SNr GABA neurons have a higher density of (INaT), contributing to the faster rise and larger amplitude of action potentials, compared with the slow-spiking dopamine neurons. INaT also recovers from inactivation more quickly in SNr GABA neurons than in nigral dopamine neurons. In SNr GABA neurons, the rising phase of the action potential triggers the activation of high-threshold, inactivation-resistant Kv3-like channels that can rapidly repolarize the membrane. These intrinsic ion channels provide SNr GABA neurons with the ability to fire spontaneous and sustained high frequency spikes. Additionally, robust GABA inputs from direct pathway medium spiny neurons in the striatum and GABA neurons in the globus pallidus may inhibit and silence SNr GABA neurons, whereas glutamate synaptic input from the subthalamic nucleus may induce burst firing in SNr GABA neurons. Thus, afferent GABA and glutamate synaptic inputs sculpt the tonic high frequency firing of SNr GABA neurons and the consequent inhibition of their targets into an integrated motor control signal that is further fine-tuned by neuromodulators

  11. Metabolism regulates the spontaneous firing of substantia nigra pars reticulata neurons via KATP and nonselective cation channels.

    Science.gov (United States)

    Lutas, Andrew; Birnbaumer, Lutz; Yellen, Gary

    2014-12-03

    Neurons use glucose to fuel glycolysis and provide substrates for mitochondrial respiration, but neurons can also use alternative fuels that bypass glycolysis and feed directly into mitochondria. To determine whether neuronal pacemaking depends on active glucose metabolism, we switched the metabolic fuel from glucose to alternative fuels, lactate or β-hydroxybutyrate, while monitoring the spontaneous firing of GABAergic neurons in mouse substantia nigra pars reticulata (SNr) brain slices. We found that alternative fuels, in the absence of glucose, sustained SNr spontaneous firing at basal rates, but glycolysis may still be supported by glycogen in the absence of glucose. To prevent any glycogen-fueled glycolysis, we directly inhibited glycolysis using either 2-deoxyglucose or iodoacetic acid. Inhibiting glycolysis in the presence of alternative fuels lowered SNr firing to a slower sustained firing rate. Surprisingly, we found that the decrease in SNr firing was not mediated by ATP-sensitive potassium (KATP) channel activity, but if we lowered the perfusion flow rate or omitted the alternative fuel, KATP channels were activated and could silence SNr firing. The KATP-independent slowing of SNr firing that occurred with glycolytic inhibition in the presence of alternative fuels was consistent with a decrease in a nonselective cationic conductance. Although mitochondrial metabolism alone can prevent severe energy deprivation and KATP channel activation in SNr neurons, active glucose metabolism appears important for keeping open a class of ion channels that is crucial for the high spontaneous firing rate of SNr neurons. Copyright © 2014 the authors 0270-6474/14/3416336-12$15.00/0.

  12. Separative analyses of a chromatographic column packed with a core-shell adsorbent for lithium isotope separation

    International Nuclear Information System (INIS)

    Sugiyama, T.; Sugura, K.; Enokida, Y.; Yamamoto, I.

    2015-01-01

    Lithium-6 is used as a blanket material for sufficient tritium production in DT fueled fusion reactors. A core-shell type adsorbent was proposed for lithium isotope separation by chromatography. The mass transfer model in a chromatographic column consisted of 4 steps, such as convection and dispersion in the column, transfer through liquid films, intra-particle diffusion and and adsorption or desorption at the local adsorption sites. A model was developed and concentration profiles and time variation in the column were numerically simulated. It became clear that core-shell type adsorbents with thin porous shell were saturated rapidly relatively to fully porous one and established a sharp edge of adsorption band. This is very important feature because lithium isotope separation requires long-distance development of adsorption band. The values of HETP (Height Equivalent of a Theoretical Plate) for core-shell adsorbent packed column were estimated by statistical moments of the step response curve. The value of HETP decreased with the thickness of the porous shell. A core-shell type adsorbent is, then, useful for lithium isotope separation. (authors)

  13. Evaluation and comparison of signal to noise ratio according to histogram equalization of heart shadow on chest image

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Ki Won [Dept. of Radiology, Kyung Hee University Hospital at Gang-dong, Seoul (Korea, Republic of); Lee, Eul Kyu [Inje Paik University Hospital at Jeo-dong, Seoul (Korea, Republic of); Jeong, Hoi Woun [The Baekseok Culture University, Cheonan (Korea, Republic of); Kang, Byung Sam; Kim, Hyun Soo; Min, Jung Whan; Son, Jin Hyun [The Shingu University, Seongnam (Korea, Republic of)

    2017-06-15

    The purpose of this study was to measure signal to noise ratio (SNR) according to change of equalization from region of interest (ROI) of heart shadow in chest image. We examined images of chest image of 87 patients in a University-affiliated hospital, Seoul, Korea. Chest images of each patient were calculated by using Image. We have analysis socio-demographical variables, SNR according to images, 95% confidence according to SNR of difference in a mean of SNR. Differences of SNR among change of equalization were tested by SPSS Statistics21 ANOVA test for there was statistical significance 95%(p < 0.05). In SNR results, with the quality of distributions in the order of original chest image, original chest image heart shadow and equalization chest image, equalization chest image heart shadow(p < 0.001). In conclusion, this study would be that quantitative evaluation of heart shadow on chest image can be used as an adjunct to the histogram equalization chest image.

  14. Evaluation and comparison of signal to noise ratio according to histogram equalization of heart shadow on chest image

    International Nuclear Information System (INIS)

    Kim, Ki Won; Lee, Eul Kyu; Jeong, Hoi Woun; Kang, Byung Sam; Kim, Hyun Soo; Min, Jung Whan; Son, Jin Hyun

    2017-01-01

    The purpose of this study was to measure signal to noise ratio (SNR) according to change of equalization from region of interest (ROI) of heart shadow in chest image. We examined images of chest image of 87 patients in a University-affiliated hospital, Seoul, Korea. Chest images of each patient were calculated by using Image. We have analysis socio-demographical variables, SNR according to images, 95% confidence according to SNR of difference in a mean of SNR. Differences of SNR among change of equalization were tested by SPSS Statistics21 ANOVA test for there was statistical significance 95%(p < 0.05). In SNR results, with the quality of distributions in the order of original chest image, original chest image heart shadow and equalization chest image, equalization chest image heart shadow(p < 0.001). In conclusion, this study would be that quantitative evaluation of heart shadow on chest image can be used as an adjunct to the histogram equalization chest image

  15. Physical evaluation of prototype high-performance anti-scatter grids: potential for improved digital radiographic image quality

    International Nuclear Information System (INIS)

    Fetterly, Kenneth A; Schueler, Beth A

    2009-01-01

    Grid evaluation for a screen-film x-ray system has typically included independent measurement of the opposing contrast improvement factor and Bucky factor. Neither of these metrics, however, is appropriate when assessing grid performance in a digital imaging environment. For digital radiographic systems, the benefit of an anti-scatter grid is well characterized by the quantum signal-to-noise ratio improvement factor (K SNR ) provided by the grid. The purpose of this work was to measure K SNR of prototype grids designed for use with digital radiographic systems. The prototype grids had 5 mm tall lead septa, fiber interspace material, line rate N = 25 and 36 cm -1 and ratio r = 15 and 21, respectively. The primary and scatter transmission properties of the grids were measured, and K SNR was evaluated over a phantom thickness range of 10-50 cm. To provide a comparison, the K SNR of similarly constructed N44r15 and N80r15 grids is also reported. K SNR of the prototype grids ranged from 1.4 for the 10 cm phantom to 2.4 for the 50 cm phantom. For the thickest phantom, the SNR improvement factor of the prototype grids was 18-83% higher than that of the N44r15 and N80r15 grids, respectively. (note)

  16. Perbandingan Kinerja Deteksi Multiuser Linier Dan Deteksi Multiuser Dengan Jaringan Syaraf Tiruan Pada Sistem DS-CDMA

    Directory of Open Access Journals (Sweden)

    Popy Maria

    2016-03-01

    Full Text Available Beberapa hal yang dapat menurunkan kapasitas dan kualitas sinyal informasi yang diterima pada sistem DS-CDMA (Direct Sequence Code Division Multiple Access adalah interferensi, noise dan efek near-far. Pada umumnya efek near-far diatasi dengan menggunakan power control. Namun demikian power control tidak dapat mengatasi interferensi yang disebabkan oleh user lain pada kanal yang sama atau yang lebih dikenal dengan MAI (Multiple Access Interference. Pendekatan lain yang digunakan untuk mengatasi hal ini adalah dengan deteksi multiuser (MUD. Pada tugas akhir ini akan dibandingkan kinerja dari MUD linier yang terdiri dari decorrelating dan MMSE dengan MUD yang menggunakan jaringan syaraf tiruan (JST dan mengacu pada deteksi konvensional. Jaringan syaraf tiruan ini menggunakan algoritma propagasi balik. Deteksi multiuser ini diaplikasikan pada  output deteksi konvensional. Kinerja dari masing-masing detektor dilihat dari BER sebagai fungsi nilai SNR  atau jumlah user pada kanal AWGN dan Rayleigh fading. Hasil simulasi pada  kanal AWGN, menunjukkan bahwa MUD dengan JST mempunyai kinerja yang lebih baik. Untuk target BER 10-3 pada kanal  AWGN, MUD decorrelating mencapainya pada SNR 6.3 dB, MUD MMSE pada SNR 5.97 dB, dan MUD dengan JST pada SNR 5.89 dB sedangkan pada kanal Rayleigh, MUD decorrelating mencapainya pada SNR 11.74 dB, MUD MMSE pada SNR 10.91 dB, dan MUD dengan JST pada SNR 10.31 dB

  17. PSEUDO-CODEWORD LANDSCAPE

    Energy Technology Data Exchange (ETDEWEB)

    CHERTKOV, MICHAEL [Los Alamos National Laboratory; STEPANOV, MIKHAIL [Los Alamos National Laboratory

    2007-01-10

    The authors discuss performance of Low-Density-Parity-Check (LDPC) codes decoded by Linear Programming (LP) decoding at moderate and large Signal-to-Noise-Ratios (SNR). Frame-Error-Rate (FER) dependence on SNR and the noise space landscape of the coding/decoding scheme are analyzed by a combination of the previously introduced instanton/pseudo-codeword-search method and a new 'dendro' trick. To reduce complexity of the LP decoding for a code with high-degree checks, {ge} 5, they introduce its dendro-LDPC counterpart, that is the code performing identifically to the original one under Maximum-A-Posteriori (MAP) decoding but having reduced (down to three) check connectivity degree. Analyzing number of popular LDPC codes and their dendro versions performing over the Additive-White-Gaussian-Noise (AWGN) channel, they observed two qualitatively different regimes: (i) error-floor sets early, at relatively low SNR, and (ii) FER decays with SNR increase faster at moderate SNR than at the largest SNR. They explain these regimes in terms of the pseudo-codeword spectra of the codes.

  18. A Dynamical System Exhibits High Signal-to-noise Ratio Gain by Stochastic Resonance

    Science.gov (United States)

    Makra, Peter; Gingl, Zoltan

    2003-05-01

    On the basis of mixed-signal simulations, we demonstrate that signal-to-noise ratio (SNR) gains much greater than unity can be obtained in the double-well potential through stochastic resonance (SR) with a symmetric periodic pulse train as deterministic and Gaussian white noise as random excitation. We also show that significant SNR improvement is possible in this system even for a sub-threshold sinusoid input if, instead of the commonly used narrow-band SNR, we apply an equally simple but much more realistic wide-band SNR definition. Using the latter result as an argument, we draw attention to the fact that the choice of the measure to reflect signal quality is critical with regard to the extent of signal improvement observed, and urge reconsideration of the practice prevalent in SR studies that most often the narrow-band SNR is used to characterise SR. Finally, we pose some questions concerning the possibilities of applying SNR improvement in practical set-ups.

  19. Submillimeter/millimeter observations of the molecular clouds associated with Tycho's supernova remnant

    International Nuclear Information System (INIS)

    Xu Jinlong; Wang Junjie; Miller, Martin

    2011-01-01

    We have carried out CO J = 2 - 1 and CO J = 3 - 2 observations toward Tycho's supernova remnant (SNR) using the KOSMA 3m-telescope. From these observations, we identified three molecular clouds (MCs) around the SNR. The small cloud in the southwest was discovered for the first time. In the north and east, two MCs (Cloud A and Cloud B) adjacent in space display a bow-shaped morphology, and have broad emission lines, which provide some direct evidences of the SNR-MCs interaction. The MCs are revealed at -69∼ -59 km s -1 , coincident with Tycho's SNR. The MCs associated with Tycho's SNR have a mass of ∼ 2.13 x 10 3 M circleddot . Position-velocity diagrams show the two clouds to be adjacent in velocity, which means cloud-cloud collision could occur in this region. The maximum value (0.66 ± 0.10) of the integrated CO line intensity ratio (I COJ=3-2 /I COJ=2-1 ) for the three MCs agrees well with the previous measurement of individual Galactic MCs, implying that the SNR shock drove into the MCs. The two MCs have a line intensity ratio gradient. The distribution of the ratio appears to indicate that the shock propagates from the southwest to the northeast.

  20. Modeling of the write and read back performances of hexagonal Ba-ferrite particulate media for high density tape recording

    International Nuclear Information System (INIS)

    Lee, Jehyun; Fuger, Markus; Fidler, Josef; Suess, Dieter; Schrefl, Thomas; Shimizu, Osamu

    2010-01-01

    In this study, the signal-to-noise ratio (SNR) performances of longitudinally, randomly, and perpendicularly oriented particles, based on hexagonal barium ferrite (h-BaFe) platelets with an average volume of 2400 nm 3 have been studied as a function of the recording head to media distance by numerical micromagnetic simulations. The distances from the write head to media and from the read head to media were varied independently. For a fixed read distance and varied writing distances, the SNR was decreasing in larger write distance. An optimum write distance of 40 and 50 nm was found for the longitudinally oriented media and the perpendicularly oriented media, respectively. The optimum write distance for longitudinally oriented media, 40 nm, resulted in the local minimum SNR for the perpendicularly oriented media. In most write distances the perpendicularly oriented media show the outstanding best performance, but near the write distance of 40 nm the longitudinally oriented media work as good as the perpendicularly oriented media. In a fixed write distance with various read distances, the SNR was almost constant in each media whereas the average signal amplitude was exponentially decayed in larger read head to media distance. The best SNR was found in the perpendicularly oriented media at write head to media distance d write =20 nm and read head to media distance d read =40 nm. The best SNR value is 11.9 and 24.4 dB in time domain and frequency domain, respectively.