
Sample records for sheet durham nc

  1. EnviroAtlas - Durham, NC - Demo (Parent)

    U.S. Environmental Protection Agency — This EnviroAtlas dataset is the base layer for the Durham, NC EnviroAtlas Area. The block groups are from the US Census Bureau and are included/excluded based on...

  2. The Built Environment and Childhood Obesity in Durham, NC

    Miranda, Marie Lynn; Edwards, Sharon E.; Anthopolos, Rebecca; Dolinsky, Diana H.; Kemper, Alex R.


    The relationship between childhood obesity and aspects of the built environment characterizing neighborhood social context is understudied. We evaluate the association between seven built environment domains and childhood obesity in Durham, NC. Measures of housing damage, property disorder, vacancy, nuisances, and territoriality were constructed using data from a 2008 community assessment. Renter-occupied housing and crime measures were developed from public databases. We linked these measures to 2008–2009 Duke University Medical Center pediatric preventive care visits. Age- and sex-specific body mass index percentiles were used to classify children as normal weight (>5th and ≤ 85th percentile), overweight (>85th and ≤ 95th percentile), or obese (> 95th percentile). Ordinal logistic regression models with cluster-corrected standard errors evaluated the association between weight status and the built environment. Adjusting for child-level socioeconomic characteristics, nuisances and crime were associated with childhood overweight/obesity (Penvironment characteristics appear important to childhood weight status in Durham, NC. PMID:22563061

  3. EnviroAtlas - Durham, NC - Meter-Scale Urban Land Cover (MULC) Data (2010)

    U.S. Environmental Protection Agency — The EnviroAtlas Durham, NC Meter-Scale Urban Land Cover (MULC) data was generated from USDA NAIP (National Agricultural Imagery Program) four band (red, green, blue...

  4. EnviroAtlas - Durham, NC - Ecosystem Services by Block Group

    U.S. Environmental Protection Agency — This EnviroAtlas dataset presents environmental benefits of the urban forest in 193 block groups in Durham, North Carolina. Carbon attributes, temperature reduction,...

  5. Forging Hispanic communities in new destinations: A case study of Durham, NC1

    Flippen, Chenoa A.; Parrado, Emilio A.


    The Chicago School of urban sociology and its extension in the spatial assimilation model have provided the dominant framework for understanding the interplay between immigrant social and spatial mobility. However, the main tenets of the theory were derived from the experience of pre-war, centralized cities; scholars falling under the umbrella of the Los Angeles school have recently challenged the extent to which they are applicable to the contemporary urban form, which is characterized by sprawling, decentralized, and multi-nucleated development. Indeed, new immigrant destinations, such as those scattered throughout the American Southeast, are both decentralized and lack prior experience with large scale immigration. Informed by this debate this paper traces the formation and early evolution of Hispanic neighborhoods in Durham, NC, a new immigrant destination. Using qualitative data we construct a social history of immigrant neighborhoods and apply survey and census information to examine the spatial pattern of neighborhood succession. We also model the sorting of immigrants across neighborhoods according to personal characteristics. Despite the many differences in urban form and experience with immigration, the main processes forging the early development of Hispanic neighborhoods in Durham are remarkably consistent with the spatial expectations from the Chicago School, though the sorting of immigrants across neighborhoods is more closely connected to family dynamics and political economy considerations than purely human capital attributes. PMID:24482612

  6. Forging Hispanic communities in new destinations: A case study of Durham, NC.

    Flippen, Chenoa A; Parrado, Emilio A


    The Chicago School of urban sociology and its extension in the spatial assimilation model have provided the dominant framework for understanding the interplay between immigrant social and spatial mobility. However, the main tenets of the theory were derived from the experience of pre-war, centralized cities; scholars falling under the umbrella of the Los Angeles school have recently challenged the extent to which they are applicable to the contemporary urban form, which is characterized by sprawling, decentralized, and multi-nucleated development. Indeed, new immigrant destinations, such as those scattered throughout the American Southeast, are both decentralized and lack prior experience with large scale immigration. Informed by this debate this paper traces the formation and early evolution of Hispanic neighborhoods in Durham, NC, a new immigrant destination. Using qualitative data we construct a social history of immigrant neighborhoods and apply survey and census information to examine the spatial pattern of neighborhood succession. We also model the sorting of immigrants across neighborhoods according to personal characteristics. Despite the many differences in urban form and experience with immigration, the main processes forging the early development of Hispanic neighborhoods in Durham are remarkably consistent with the spatial expectations from the Chicago School, though the sorting of immigrants across neighborhoods is more closely connected to family dynamics and political economy considerations than purely human capital attributes.

  7. EnviroAtlas - Durham, NC - BenMAP Results by Block Group

    U.S. Environmental Protection Agency — This EnviroAtlas dataset demonstrates the effect of changes in pollution concentration on local populations in 193 block groups in Durham, North Carolina. The US...

  8. EnviroAtlas - Durham, NC - 51m Riparian Buffer Vegetated Cover

    This EnviroAtlas dataset describes the percentage of a 51-m riparian buffer that is vegetated. There is a potential for decreased water quality in areas where the riparian buffer is less vegetated. The displayed line represents the center of the analyzed riparian buffer. The water bodies analyzed include hydrologically connected streams, rivers, connectors, reservoirs, lakes/ponds, ice masses, washes, locks, and rapids within the Atlas Area. This dataset was produced by the US EPA to support research and online mapping activities related to EnviroAtlas. EnviroAtlas ( ) allows the user to interact with a web-based, easy-to-use, mapping application to view and analyze multiple ecosystem services for the contiguous United States. The dataset is available as downloadable data ( or as an EnviroAtlas map service. Additional descriptive information about each attribute in this dataset can be found in its associated EnviroAtlas Fact Sheet ( ).

  9. EnviroAtlas - Durham, NC - 51m Riparian Buffer Forest Cover

    This EnviroAtlas dataset describes the percentage of a 51-m riparian buffer that is forested. There is a potential for decreased water quality in areas where the riparian buffer is less forested. The displayed line represents the center of the analyzed riparian buffer. The water bodies analyzed include hydrologically connected streams, rivers, connectors, reservoirs, lakes/ponds, ice masses, washes, locks, and rapids within the Atlas Area. This dataset was produced by the US EPA to support research and online mapping activities related to EnviroAtlas. EnviroAtlas ( ) allows the user to interact with a web-based, easy-to-use, mapping application to view and analyze multiple ecosystem services for the contiguous United States. The dataset is available as downloadable data ( or as an EnviroAtlas map service. Additional descriptive information about each attribute in this dataset can be found in its associated EnviroAtlas Fact Sheet ( ).

  10. Research on NC laser combined cutting optimization model of sheet metal parts

    Wu, Z. Y.; Zhang, Y. L.; Li, L.; Wu, L. H.; Liu, N. B.


    The optimization problem for NC laser combined cutting of sheet metal parts was taken as the research object in this paper. The problem included two contents: combined packing optimization and combined cutting path optimization. In the problem of combined packing optimization, the method of “genetic algorithm + gravity center NFP + geometric transformation” was used to optimize the packing of sheet metal parts. In the problem of combined cutting path optimization, the mathematical model of cutting path optimization was established based on the parts cutting constraint rules of internal contour priority and cross cutting. The model played an important role in the optimization calculation of NC laser combined cutting.

  11. Durham Neighborhood Compass Neighborhoods

    City and County of Durham, North Carolina — The Durham Neighborhood Compass is a quantitative indicators project with qualitative values, integrating data from local government, the Census Bureau and other...

  12. Durham County Demographic Profile

    City and County of Durham, North Carolina — (a) Includes persons reporting only one race.(b) Hispanics may be of any race, so also are included in applicable race categories. D: Suppressed to avoid disclosure...

  13. 2016 Presidential Election Durham

    City and County of Durham, North Carolina — Voting totals for the 2016 Presidential Election by voting method and precinct. Voting Method Definitions: PROV = Provisional IN-PERSON = In PersonABS-1STOP =...

  14. Durham Neighborhood Compass Block Groups

    City and County of Durham, North Carolina — The Durham Neighborhood Compass is a quantitative indicators project with qualitative values, integrating data from local government, the Census Bureau and other...

  15. City of Durham Police Crime Reports

    City and County of Durham, North Carolina — This metadata contains information on crime definitions and location obfuscation techniques to protect citizen identification data. Officers responding to incidents...

  16. EnviroAtlas - Durham, NC - Greenspace Proximity Gradient

    U.S. Environmental Protection Agency — In any given 1-square meter point in this EnviroAtlas dataset, the value shown gives the percentage of square meters of greenspace within 1/4 square kilometer...

  17. EnviroAtlas - Durham, NC - Near Road Tree Buffer

    U.S. Environmental Protection Agency — This EnviroAtlas dataset addresses the tree buffer along heavily traveled roads. The roads are interstates, arterials, and collectors within the EnviroAtlas...

  18. EnviroAtlas - Durham, NC - Near Road Block Group Summary

    U.S. Environmental Protection Agency — This EnviroAtlas dataset addresses the tree buffer along heavily traveled roads. The roads are interstates, arterials, and collectors within the EnviroAtlas...

  19. Non-Public Schools in Durham County by Type

    City and County of Durham, North Carolina — A list and the locations along with contact phone numbers of private schools within Durham County. The School Type field is either "religious" or independant....

  20. Phenomenal result for Durham in particle physics


    The University of Durham has beaten ten rivals to house a new 12 million pound institute for particle physics phenomenology. The institute will be supported for a minimum of ten years by PPARC and the university. Its first director will be Professor James Stirling (2 paragraphs).

  1. Sustaining Community-University Collaborations: The Durham University Model

    Andrew Russell


    Full Text Available Durham University has initiated a community outreach and engagement program based on an evolving multifaceted model. This article analyses the components of the model and looks at how our work at Durham has become increasingly embedded in the structures and processes of the university as it has developed. The strengths and weaknesses in what has been achieved are highlighted, as is the future vision for the further development of this innovative community-university program. Keywords Public engagement; community partnerships; employer supported volunteering; corporate social responsibility

  2. The Durham Adaptive Optics Simulation Platform (DASP): Current status

    Basden, Alastair; Bharmal, Nazim; Jenkins, David; Morris, Timothy; Osborn, James; Jia, Peng; Staykov, Lazar


    The Durham Adaptive Optics Simulation Platform (DASP) is a Monte-Carlo modelling tool used for the simulation of astronomical and solar adaptive optics systems. In recent years, this tool has been used to predict the expected performance of the forthcoming extremely large telescope adaptive optics systems, and has seen the addition of several modules with new features, including Fresnel optics propagation and extended object wavefront sensing. Here, we provide an overview of the features of D...

  3. EnviroAtlas - Durham, NC - Estimated Intersection Density of Walkable Roads

    U.S. Environmental Protection Agency — This EnviroAtlas dataset estimates the intersection density of walkable roads within a 750 meter radius of any given 10 meter pixel in the community. Intersections...

  4. EnviroAtlas - Durham, NC - Historic Places by Census Block Group

    U.S. Environmental Protection Agency — This EnviroAtlas dataset portrays the total number of historic places located within each Census Block Group (CBG). The historic places data were compiled from the...

  5. EnviroAtlas - Durham, NC - Estimated Percent Tree Cover Along Walkable Roads

    U.S. Environmental Protection Agency — This EnviroAtlas dataset estimates tree cover along walkable roads. The road width is estimated for each road and percent tree cover is calculated in a 8.5 meter...

  6. EnviroAtlas - Durham, NC - Estimated Percent Green Space Along Walkable Roads

    U.S. Environmental Protection Agency — This EnviroAtlas dataset estimates green space along walkable roads. Green space within 25 meters of the road centerline is included and the percentage is based on...

  7. EnviroAtlas - Durham, NC - Land Cover Summaries by Block Group

    U.S. Environmental Protection Agency — This EnviroAtlas dataset describes the percentage of each block group that is classified as impervious, forest, green space, wetland, and agriculture. Impervious is...

  8. EnviroAtlas - Durham, NC - Tree Cover Configuration and Connectivity, Water Background

    U.S. Environmental Protection Agency — This EnviroAtlas dataset categorizes forest land cover into structural elements (e.g. core, edge, connector, etc.). In this community, forest is only trees &...

  9. EnviroAtlas - Durham, NC - Residents with Potential Window Views of Water by Block Group

    U.S. Environmental Protection Agency — This EnviroAtlas dataset describes the block group population and the percentage of the block group population that has potential views of water bodies. A potential...

  10. EnviroAtlas - Durham, NC - 51m Riparian Buffer Forest Cover

    U.S. Environmental Protection Agency — This EnviroAtlas dataset describes the percentage of a 51-m riparian buffer that is forested. There is a potential for decreased water quality in areas where the...

  11. EnviroAtlas - Durham, NC - 51m Riparian Buffer Vegetated Cover

    U.S. Environmental Protection Agency — This EnviroAtlas dataset describes the percentage of a 51-m riparian buffer that is vegetated. There is a potential for decreased water quality in areas where the...

  12. EnviroAtlas - Durham, NC - People and Land Cover in Floodplains by Block Group

    U.S. Environmental Protection Agency — This EnviroAtlas dataset describes the total counts and percentage of population, land area, and impervious surface in the 1% Annual Chance Flood Hazard area or 0.2%...

  13. Proximity to Parks in the Durham, NC EnviroAtlas Community Area

    People use parks to socialize, exercise, recreate, and enjoy nature. Having a park within walking distance creates opportunities for individuals to experience the benefits of trees and other green space on health and well-being. These maps are part of the US Environmental Protect...

  14. The Constabulus manuscript in Durham Cathedral Library: A Forgotten Treasure?

    Robinson, Maureen


    Full Text Available Johannes Hispalensis (John of Seville, working from Limia in Portugal and then Toledo in twelfth century Spain, translated mostly mathematical treatises from Arabic into Latin. His early work began in Limia with three medical translations c. 1118. One, the De differentia spiritus et animae originally bore the signature 'Johannes Hispalensis et Limiensis'. Not all scholars agree that this translator was Johannes Hispalensis. However, evidence supporting the theory that there was only one translator is provided by the De differentia, which resurfaced years later in a revised version dedicated to Raymond, Archbishop of Toledo from 1125 to 1152. It bore the shortened name: Johannes Hispalensis. An unknown copy of this revised version has been discovered in Durham Cathedral where it has lain dormant for 800 years. It contains a plethora of scribal mistakes, helping to prove that many of the inconsistencies between different copies of the same Latin manuscripts are due to human error rather than multiple identities working on the same translation.

    Johannes Hispalensis (Juan de Sevilla, que trabajó en Limia (Portugal y más tarde en Toledo, en la España del siglo XII, tradujo sobre todo tratados matemáticos del árabe al latín. Sus primeras obras comenzaron en Limia con tres traducciones sobre medicina alrededor del año 1118. Una de ellas, De differentia spiritus et animae, llevó originalmente la firma 'Johannes Hispalensis et Limiensis'. No todos los especialistas en esta época están de acuerdo en que este traductor fuera Johannes Hispalensis, Sin embargo, la obra De differentia aporta pruebas que apoyan la teoría de que hubo un único traductor. Dicha obra reapareció unos años más tarde en una versión revisada y dedicada a Raimundo, el Arzobispo de Toledo, entre 1125 y 1152. Llevaba el nombre abreviado: Johannes Hispalensis. Una copia desconocida de esta versión revisada fue hallada en la catedral de

  15. The Durham Strategic Energy Alliance : building a roadmap to meet Ontario's present and future energy needs

    Gabriel, K.; Lindeblom, D.


    The challenge facing Ontario in gaining access to affordable, flexible and reliable energy at a time when energy demand is escalating was discussed. The Durham Strategic Energy Alliance (DSEA) was created in 2005 to position Ontario's Durham Region as a Canadian leader in timely, sustainable and reliable energy solutions. Durham employs about 10,000 workers directly in the energy industry. The region also produces nearly 30 per cent of the province's power from local generating stations. It is also home to an energy focused teaching and research institution at the University of Ontario Institute of Technology. The DSEA is composed of business, industry, government and academic institutions committed to taking action on advancing energy solutions in all aspects of the energy life-cycle. Members have a stake in promoting sustainable energy solutions in energy supply and generation, manufacturing of energy solutions, transmission, distribution, conservation and/or consumption of all forms of energy. Since its creation, the DSEA has taken measures to exploit the energy opportunities in Durham Region and plans to significantly expand its activities in the future, particularly in building commercialization capabilities through an energy cluster. New links and formalized networks will be established to achieve this goal. Innovative networks will be developed to connect Durham's academic community with business, industry and energy clusters which are developing globally. The overall DSEA strategy is to develop Durham's energy cluster so that it evolves quickly into Ontario's energy commercialization center. There are three areas where such strategy will be recognized: energy technology adoption/demonstration centre; energy technology adoption officer; and, energy cluster outreach/network. 1 fig

  16. EnviroAtlas - Durham, NC - Domestic Water Use per Day by U.S. Census Block Group

    U.S. Environmental Protection Agency — As included in this EnviroAtlas dataset, the community domestic water use was calculated using locally available water use data per capita in gallons of water per...

  17. 20180416 - Understanding the Biology and Technology of ToxCast and Tox21 Assays (SETAC Durham NC)

    The ToxCast high-throughput toxicity (HTT) testing methods have been developed to evaluate the hazard potential of diverse environmental, industrial and consumer product chemicals. The main goal is prioritizing the compounds of greatest concern for more detailed toxicological stu...

  18. 78 FR 37118 - Approval and Promulgation of Air Quality Implementation Plans; Charlotte, Raleigh/Durham and...


    ... the core maintenance area exists; c. alternative fuel vehicle programs to include compressed natural... Promulgation of Air Quality Implementation Plans; Charlotte, Raleigh/Durham and Winston-Salem Carbon Monoxide... (CO), showing continued attainment of the 8-hour CO national ambient air quality standard for the...

  19. Decontamination sheet

    Hirose, Emiko; Kanesaki, Ken.


    The decontamination sheet of the present invention is formed by applying an adhesive on one surface of a polymer sheet and releasably appending a plurality of curing sheets. In addition, perforated lines are formed on the sheet, and a decontaminating agent is incorporated in the adhesive. This can reduce the number of curing operation steps when a plurality steps of operations for radiation decontamination equipments are performed, and further, the amount of wastes of the cured sheets, and operator's exposure are reduced, as well as an efficiency of the curing operation can be improved, and propagation of contamination can be prevented. (T.M.)

  20. Characterization of Durham virus, a novel rhabdovirus that encodes both a C and SH protein.

    Allison, A B; Palacios, G; Travassos da Rosa, A; Popov, V L; Lu, L; Xiao, S Y; DeToy, K; Briese, T; Lipkin, W I; Keel, M K; Stallknecht, D E; Bishop, G R; Tesh, R B


    The family Rhabdoviridae is a diverse group of non-segmented, negative-sense RNA viruses that are distributed worldwide and infect a wide range of hosts including vertebrates, invertebrates, and plants. Of the 114 currently recognized vertebrate rhabdoviruses, relatively few have been well characterized at both the antigenic and genetic level; hence, the phylogenetic relationships between many of the vertebrate rhabdoviruses remain unknown. The present report describes a novel rhabdovirus isolated from the brain of a moribund American coot (Fulica americana) that exhibited neurological signs when found in Durham County, North Carolina, in 2005. Antigenic characterization of the virus revealed that it was serologically unrelated to 68 other known vertebrate rhabdoviruses. Genomic sequencing of the virus indicated that it shared the highest identity to Tupaia rhabdovirus (TUPV), and as only previously observed in TUPV, the genome encoded a putative C protein in an overlapping open reading frame (ORF) of the phosphoprotein gene and a small hydrophobic (SH) protein located in a novel ORF between the matrix and glycoprotein genes. Phylogenetic analysis of partial amino acid sequences of the nucleoprotein and polymerase protein indicated that, in addition to TUPV, the virus was most closely related to avian and small mammal rhabdoviruses from Africa and North America. In this report, we present the morphological, pathological, antigenic, and genetic characterization of the new virus, tentatively named Durham virus (DURV), and discuss its potential evolutionary relationship to other vertebrate rhabdoviruses. Copyright © 2010 Elsevier B.V. All rights reserved.

  1. Characterization of Durham virus, a novel rhabdovirus that encodes both a C and SH protein

    Allison, A. B.; Palacios, G.; Rosa, A. Travassos da; Popov, V. L.; Lu, L.; Xiao, S. Y.; DeToy, K.; Briese, T.; Lipkin, W. Ian; Keel, M. K.; Stallknecht, D. E.; Bishop, G. R.; Tesh, R. B.


    The family Rhabdoviridae is a diverse group of non-segmented, negative-sense RNA viruses that are distributed worldwide and infect a wide range of hosts including vertebrates, invertebrates, and plants. Of the 114 currently recognized vertebrate rhabdoviruses, relatively few have been well characterized at both the antigenic and genetic level; hence, the phylogenetic relationships between many of the vertebrate rhabdoviruses remain unknown. The present report describes a novel rhabdovirus isolated from the brain of a moribund American coot (Fulica americana) that exhibited neurological signs when found in Durham County, North Carolina, in 2005. Antigenic characterization of the virus revealed that it was serologically unrelated to 68 other known vertebrate rhabdoviruses. Genomic sequencing of the virus indicated that it shared the highest identity to Tupaia rhabdovirus (TUPV), and as only previously observed in TUPV, the genome encoded a putative C protein in an overlapping open reading frame (ORF) of the phosphoprotein gene and a small hydrophobic protein located in a novel ORF between the matrix and glycoprotein genes. Phylogenetic analysis of partial amino acid sequences of the nucleoprotein and polymerase proteins indicated that, in addition to TUPV, the virus was most closely related to avian and small mammal rhabdoviruses from Africa and North America. In this report, we present the morphological, pathological, antigenic, and genetic characterization of the new virus, tentatively named Durham virus (DURV), and discuss its potential evolutionary relationship to other vertebrate rhabdoviruses. PMID:20863863

  2. Access to food retail outlets in County Durham, UK: a pragmatic cross-sectional study.

    Mills, Susanna; Wright, Tim


    Strong links exist between deprivation, obesity, and dietary quality. Increasing interest has focussed on the concept of access to food and so-called food deserts, defined by a policy working group of the UK Low Income Project Team in 1995 as "areas of relative exclusion where people experience physical and economic barriers to accessing healthy food". We aimed to establish the accessibility of food retail outlets in County Durham, a county in north-east England, UK, considering physical access, affordability, and food range and quality. In a pragmatic cross-sectional study in County Durham, we used information from town surveys and food business databases to locate and identify food retail outlets. The prevalence of deprivation, obesity, retail outlets, takeaway outlets, and ratio of retail to takeaway outlets was mapped, to establish local food access, and any associations with deprivation and obesity. The times taken to travel from residences to supermarkets using private car and public transport were also measured. 400 members of the community participated in eight focus groups and commissioned on-street surveys. Focus group transcripts were reviewed alongside the on-street survey responses to identify key issues. Most residents shopped at least weekly for food (n=368, 92%), used a supermarket for their main food shop (372, 93%), travelled for up to 15 min (340, 85%), and used a car for transport (188, 47%). Many survey respondents indicated high levels of satisfaction with food retail outlets (average rating 8·7 out of 10 for agreement with the statement "Overall I am satisfied with the shop where I do my main food shopping"), although financial constraints and transport inconvenience were identified as barriers. Difficulties with food shopping were more widely described in focus groups, and many individuals felt that local shopping provision had declined, with an emergent excess of takeaway outlets. Food retail access was reduced for the disabled, full

  3. 78 FR 17635 - Foreign-Trade Zone 93-Raleigh-Durham, North Carolina; Notification of Proposed Production...


    ... DEPARTMENT OF COMMERCE Foreign-Trade Zones Board [B-23-2013] Foreign-Trade Zone 93--Raleigh-Durham, North Carolina; Notification of Proposed Production Activity; Southern Lithoplate, Inc. (Aluminum Printing Plates); Youngsville, North Carolina The Triangle J Council of Governments grantee of FTZ 93...

  4. 78 FR 43141 - Foreign-Trade Zone 93-Raleigh-Durham, North Carolina, Authorization of Production Activity...


    ... DEPARTMENT OF COMMERCE Foreign-Trade Zones Board [B-23-2013] Foreign-Trade Zone 93--Raleigh-Durham, North Carolina, Authorization of Production Activity, Southern Lithoplate, Inc. (Aluminum Printing Plates), Youngsville, North Carolina On March 18, 2013, the Triangle J Council of Governments, grantee of...

  5. The wild heart of a wild land. Tra le Alpi albanesi sulle orme di Mary Edith Durham

    M. Genesin


    Full Text Available ENIn 2007 we decided to follow the same route through northern Albania which was covered almost 100 years ago by the victorian traveller Mary Edith Durham, author of the books High Albania and Some Tribal Origins, Laws and Customs of the Balkans. The journey described in High Albania was the culmination of seven years of regular Balkan travels during which she was rewarded with insights into north Albanian life denied to all previous travellers. Unlike her other expeditions in the Balkans, her journey in northern Albania was an existential experience which deeply affected Durham’s perception of the tribespeople’s world and marked a turning point in her life. In the second part of the article some ethnographical aspects which were pointed out by Durham and are still alive in those regions are dealt with. Keywords: Balkan Studies; Cultural Studies; Ethnography; Mary Edith Durham; Albania  ITNel 2007 abbiamo deciso di organizzare una spedizione a carattere linguistico e etnogrfico nell’Albania settentrionale sulle orme dell’itinerario percorso quasi 100 anni prima dalla viaggiatrice vittoriana Mary Edith Durham, autrice dei volumi High Albania e Some Tribal Origins, Laws and Customs of the Balkans. L’itinerario descritto in High Albania coronò setti lunghi anni di esplorazioni balcaniche nel corso delle quali l’autrice riuscì a penetrare nella vita della popolazione locale, un importante esperienza che era invece mancata a tutti i precedenti viaggiatori. A differenza dagli altri viaggi precedenti nei balcani, quello nell’Albania settentrionale costituì un esperienza esistenziale che segnò profondamente la percezione della Durham del mondo delle alpi albanesi e rappresentò una svolta nella sua vita. Nella seconda parte dell’articolo sono illustrati alcuni fenomeni di carattere etnografico che furono rilevati dalla Durham e che, con nostra grande sorpresa, abbiamo potuto riscontrare sul campo nel corso della spedizione.

  6. The Durham elementary particle data bank, data analysis and model comparison project

    Gault, F D; Chadwick, B; Cooper, C S


    In comparing theoretical models with data the first problem encountered is the retrieval of data from published sources and its storage in such a way as to make it readily accessible. The second is to implement programs which check the data for consistency and any recurring characteristics. The third is to produce an efficiently written program to compare the theoretical model with the data, the program being written as a function of N parameters so that it can be coupled to a minimizing program such as CERN MINUIT. Between each step, interface, retrieval and storage problems arise. The authors discuss the organization of the Durham project, the Data Bank software and retrieval techniques and the integration of model independent software with the Data Bank. This project is being carried out on the Northumbrian Universities Multiple Access Computer (NUMAC) an IBM 360 /67 operating under the Michigan Terminal System (MTS). (10 refs).

  7. Feasibility study for a biodiesel refining facility in the Regional Municipality of Durham

    Villeneuve, S.; Saville, B.


    Although both public and political support for renewable fuels is currently strong, the next decade will determine if the biodiesel industry in North America will expand to make significant contributions to rural economic development and to improve urban air quality. The feasibility of establishing a biodiesel production facility in the Region of Durham, Ontario was investigated. The study included an assessment of potential sites, feedstock assessments, biodiesel market analysis, preliminary cost estimates and financial analysis. The purpose was to establish which feedstocks and technology options are viable and to document the underlying assumptions with historical data, cost estimates and projections. Six suitable sites in the region were evaluated. Two had access to feedstocks brought in by boat, but they were also among the furthest from existing rail lines, which increased the overall site development costs. A sensitivity analysis was conducted to determine the effect of land and site development costs on the return on investment (ROI). It was shown that a $2 MM difference in these costs affects the ROI by 3 to 4 per cent, but not enough to significantly influence the viability of a biodiesel plant in the region. The research and financial analysis revealed that Durham could potentially support a biodiesel production facility that produces up to 38 million litres per year of biodiesel from crude corn oil extracted from corn-to-ethanol processing facilities, supplemented by recycled fats, oils and greases. It was determined that the plant location may depend on access to infrastructure and community, or political acceptance. At $325 per tonne for crude oil, the projected average annual pre-tax ROI for a 38 MM litre per year biodiesel plant using only corn oil is 39 per cent sufficient to recommend a project. It was also determined that there is insufficient animal-derived material available locally to support a biodiesel production facility on recycled fats

  8. Underground, overground: labour productivity in British coalmining, Co. Durham, 1890-93

    Treble, J.G.


    This paper contributes a new twist to a long-standing debate over the determinants of productivity in British coal-mining in the late nineteenth and early twentieth centuries. Attempts to measure responses of productivity to the various influences outlined by Taylor at the start of the modern debate have failed to solve an identification problem that has its roots in the fact that wage rates were set to compensate for differences in the productivity of seams. The County Average System adopted in the northeastern coalfields was an explicit method for achieving this compensation, but other coalfields adopted compensations of a similar sort, albeit less formal in nature. The Victorian Household Panel Study provides the opportunity to use three separate sources of wage rate variation, information about workplace assignments and personal characteristics of workers to measure the determinants of hewer productivity in a single County Durham coal mine. Although the data cover only a short period (June 1890-January 1893) the exercise is worthwhile both because of the large productivity variation that occurs, and also because of the level of detail available and the panel nature of the data, which enables identification of wage rate effects independently of geology. 14 refs., 7 figs., 4 tabs.

  9. Preliminary study of the uranium potential of the northern part of the Durham Triassic Basin, North Carolina

    Harris, W.B.; Thayer, P.A.


    This report presents results of a four-channel spectrometric survey of the northern part of the Durham Triassic basin and adjacent Piedmont, North Carolina. Gamma-ray spectrometric measurements were obtained at 112 localities from 136 different lithologies. The nominal sampling density in the Durham Basin is one site per 2 mi 2 . Surface radiometric surveys reveal no anomalous radioactivity in the northern part of the Durham Basin. Uranium concentrations in Triassic rocks are from 0.6 to 9.7 ppM and average 2.9 ppM. Mudrocks contain from 1.3 to 9.7 ppM, and the average is 4.5 ppM. Sandstones contain from 0.6 to 8.8 ppM, and the average is 2.5 ppM. Fanglomerates contain the lowest concentrations of uranium, from 1.4 to 2.0 ppM, for an average of 1.8 ppM. Uranium/thorium ratios average 0.27 for Triassic rocks and are from 0.04 to 1.85. The mean log uranium/log thorium for Triassic rocks is 0.37. Mudrock has the highest average uranium/thorium ratio (0.32), and the range is 0.09 to 0.66. Sandstones have an average uranium/thorium ratio of 0.26, and the range is 0.04 to 1.85. Fanglomerates have the lowest range uranium/thorium ratio (0.19), and the range is 0.12 to 0.19. On the basis of surface radiometric surveys and geologic studies, it is believed that sedimentary strata in the northern part of the Durham Basin are poor targets for further uranium exploration. This conclusion is based on the lack of favorable characteristics commonly present in fluvial uranium deposits. Among these are: (1) carbonaceous material is absent in Triassic rocks of the northern basin, (2) indicators of a reduzate facies in sandstones are not present, and (3) no tuffaceous beds are associated with sediments in the northern Durham Basin

  10. Numerical and experimental analysis of resistance projection welding of square nuts to sheets

    Nielsen, Chris Valentin; Zhang, Wenqi; Martins, Paulo A.F.


    Projection welding of nuts to sheets is a widely utilized manufacturing process in the automotive industry. The process entails challenges due the necessity of joining different sheet thicknesses and nut sizes made from dissimilar materials, and due to the fact of experiencing large local deforma...... of the square nut to the sheet under different operating conditions. © 2014 The Authors. Published by Elsevier Ltd. This is an open access article under the CC BY-NC-ND license...

  11. Chlamydia - CDC Fact Sheet

    ... Archive STDs Home Page Bacterial Vaginosis (BV) Chlamydia Gonorrhea Genital Herpes Hepatitis HIV/AIDS & STDs Human Papillomavirus ( ... sheet Pelvic Inflammatory Disease (PID) – CDC fact sheet Gonorrhea – CDC fact sheet STDs Home Page Bacterial Vaginosis ( ...

  12. GASN sheets


    This document gathers around 50 detailed sheets which describe and present various aspects, data and information related to the nuclear sector or, more generally to energy. The following items are addressed: natural and artificial radioactive environment, evolution of energy needs in the world, radioactive wastes, which energy for France tomorrow, the consequences in France of the Chernobyl accident, ammunitions containing depleted uranium, processing and recycling of used nuclear fuel, transport of radioactive materials, seismic risk for the basic nuclear installations, radon, the precautionary principle, the issue of low doses, the EPR, the greenhouse effect, the Oklo nuclear reactors, ITER on the way towards fusion reactors, simulation and nuclear deterrence, crisis management in the nuclear field, does nuclear research put a break on the development of renewable energies by monopolizing funding, nuclear safety and security, the plutonium, generation IV reactors, comparison of different modes of electricity production, medical exposure to ionizing radiations, the control of nuclear activities, food preservation by ionization, photovoltaic solar collectors, the Polonium 210, the dismantling of nuclear installations, wind energy, desalination and nuclear reactors, from non-communication to transparency about nuclear safety, the Jules Horowitz reactor, CO 2 capture and storage, hydrogen, solar energy, the radium, the subcontractors of maintenance of the nuclear fleet, biomass, internal radio-contamination, epidemiological studies, submarine nuclear propulsion, sea energy, the Three Mile Island accident, the Chernobyl accident, the Fukushima accident, the nuclear after Fukushima

  13. Atmospheric electricity at Durham: the scientific contributions and legacy of J. A. ("Skip") Chalmers (1904-1967)

    Aplin, Karen L.


    John Alan Chalmers made major contributions to atmospheric electricity over almost 40 years spent at Durham University, UK. He is particularly remembered in the atmospheric science community for his accessible and insightful textbook, Atmospheric Electricity, and his work on corona currents, which are still regularly cited. He also supervised over 35 research students. This article discusses his background, scientific contributions, and significant legacy to modern atmospheric science within the context of a long and productive career spent at one of England's principal northern universities.

  14. Durham Zoo: Powering a Search-&-Innovation Engine with Collective Intelligence

    Richard Absalom


    Full Text Available Purpose – Durham Zoo (hereinafter – DZ is a project to design and operate a concept search engine for science and technology. In DZ, a concept includes a solution to a problem in a particular context.Design – Concept searching is rendered complex by the fuzzy nature of a concept, the many possible implementations of the same concept, and the many more ways that the many implementations can be expressed in natural language. An additional complexity is the diversity of languages and formats, in which the concepts can be disclosed.Humans understand language, inference, implication and abstraction and, hence, concepts much better than computers, that in turn are much better at storing and processing vast amounts of data.We are 7 billion on the planet and we have the Internet as the backbone for Collective Intelligence. So, our concept search engine uses humans to store concepts via a shorthand that can be stored, processed and searched by computers: so, humans IN and computers OUT.The shorthand is classification: metadata in a structure that can define the content of a disclosure. The classification is designed to be powerful in terms of defining and searching concepts, whilst suited to a crowdsourcing effort. It is simple and intuitive to use. Most importantly, it is adapted to restrict ambiguity, which is the poison of classification, without imposing a restrictive centralised management.In the classification scheme, each entity is shown together in a graphical representation with related entities. The entities are arranged on a sliding scale of similarity. This sliding scale is effectively fuzzy classification.Findings – The authors of the paper have been developing a first classification scheme for the technology of traffic cones, this in preparation for a trial of a working system. The process has enabled the authors to further explore the practicalities of concept classification. The CmapTools knowledge modelling kit to develop the

  15. Some aspects of the effect of atmospheric pollution on the lichen flora to the west of Consett Co. , Durham

    Griffith, J L


    The effect of atmospheric pollution on the growth of lichens has long been discussed. This work was aimed at obtaining data on the effect of such pollution, from the Iron and Steel works at Consett Co. Durham, on the lichen flora of the district. The degree of pollution found to the west of Consett was evaluated by analysis of lichen thallus for sulfur and from bark washings for amounts of deposited matter. These results were compared with standard pollution data at Consett, obtained from the DSIR, and a pollution gradient passing west from Consett was plotted. The distribution of corticolous, saxicolous and terricolous lichens in this area was mapped. The results from these distributions were applied to the pollution data and the control of lichens by pollution shown. The modification of the pollution effect by humidity factors is also discussed.

  16. 33 CFR 80.525 - Cape Lookout, NC to Cape Fear, NC.


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Cape Lookout, NC to Cape Fear, NC... INTERNATIONAL NAVIGATION RULES COLREGS DEMARCATION LINES Fifth District § 80.525 Cape Lookout, NC to Cape Fear... southeast side of the Inlet. (g) Except as provided elsewhere in this section from Cape Lookout to Cape Fear...

  17. Successful transplantation of in vitro expanded human cadaver corneal endothelial precursor cells on to a cadaver bovine's eye using a nanocomposite gel sheet.

    Parikumar, Periyasamy; Haraguchi, Kazutoshi; Ohbayashi, Akira; Senthilkumar, Rajappa; Abraham, Samuel J K


    In vitro expansion of human corneal endothelial precursor (HCEP) cells has been reported via production of cell aggregated spheres. However, to translate this procedure in human patients warrants maintaining the position of the eyeballs facing down for 36 h, which is not feasible. In this study, we report a method using a nanocomposite (NC) gel sheet to accomplish the integration of HCEP cells to the endothelium of cadaver bovine's eyes. HCEP cells were isolated from the corneal endothelium of a cadaver human eye and then expanded using a thermoreversible gelation polymer (TGP) as reported earlier. For the study, three cadaver bovine eyes were used. The NC gel sheets were inserted into the bovine eyes', aligned and suture-fixed in position under the host endothelium. HCEP cells previously expanded in the TGP were harvested and injected using a 26-gauge syringe between the endothelium and the NC gel sheet. The eyes were left undisturbed for three hours following which the NC gel sheets were gently removed. The corneas were harvested and subjected to histopathological studies. Histopathological studies showed that all the three corneas used for NC gel sheet implantation showed the presence of engrafted HCEP cells, seen as multi-layered cells over the native endothelium of the bovine cornea. Examination of the NC gel sheets used for implantation showed that only very few corneal endothelial cells remained on the sheets amounting to what could be considered negligible. The use of the NC gel sheet makes HCEP cell transplantation feasible for human patients. Further in vitro basic studies followed by translational studies are necessary to bring this method for clinical application in appropriate indications.

  18. Can typical US home visits affect infant attachment? Preliminary findings from a randomized trial of Healthy Families Durham.

    Berlin, Lisa J; Martoccio, Tiffany L; Appleyard Carmody, Karen; Goodman, W Benjamin; O'Donnell, Karen; Williams, Janis; Murphy, Robert A; Dodge, Kenneth A


    US government-funded early home visiting services are expanding significantly. The most widely implemented home visiting models target at-risk new mothers and their infants. Such home visiting programs typically aim to support infant-parent relationships; yet, such programs' effects on infant attachment quality per se are as yet untested. Given these programs' aims, and the crucial role of early attachments in human development, it is important to understand attachment processes in home visited families. The current, preliminary study examined 94 high-risk mother-infant dyads participating in a randomized evaluation of the Healthy Families Durham (HFD) home visiting program. We tested (a) infant attachment security and disorganization as predictors of toddler behavior problems and (b) program effects on attachment security and disorganization. We found that (a) infant attachment disorganization (but not security) predicted toddler behavior problems and (b) participation in HFD did not significantly affect infant attachment security or disorganization. Findings are discussed in terms of the potential for attachment-specific interventions to enhance the typical array of home visiting services.

  19. Ice sheet in peril

    Hvidberg, Christine Schøtt


    Earth's large ice sheets in Greenland and Antarctica are major contributors to sea level change. At present, the Greenland Ice Sheet (see the photo) is losing mass in response to climate warming in Greenland (1), but the present changes also include a long-term response to past climate transitions...

  20. Mobility Balance Sheet 2009

    Jorritsma, P.; Derriks, H.; Francke, J.; Gordijn, H.; Groot, W.; Harms, L.; Van der Loop, H.; Peer, S.; Savelberg, F.; Wouters, P.


    The Mobility Balance Sheet provides an overview of the state of the art of mobility in the Netherlands. In addition to describing the development of mobility this report also provides explanations for the growth of passenger and freight transport. Moreover, the Mobility Balance Sheet also focuses on a topical theme: the effects of economic crises on mobility. [nl

  1. Carbon sheet pumping

    Ohyabu, N.; Sagara, A.; Kawamura, T.; Motojima, O.; Ono, T.


    A new hydrogen pumping scheme has been proposed which controls recycling of the particles for significant improvement of the energy confinement in toroidal magnetic fusion devices. In this scheme, a part of the vacuum vessel surface near the divertor is covered with carbon sheets of a large surface area. Before discharge initiation, the sheets are baked up to 700 ∼ 1000degC to remove the previously trapped hydrogen atoms. After being cooled down to below ∼ 200degC, the unsaturated carbon sheets trap high energy charge exchange hydrogen atoms effectively during a discharge and overall pumping efficiency can be as high as ∼ 50 %. (author)

  2. PREFACE: Joint IPPP Durham/Cockcroft Institute/ICFA Workshop on Advanced QED methods for Future Accelerators

    Bailey, I. R.; Barber, D. P.; Chattopadhyay, S.; Hartin, A.; Heinzl, T.; Hesselbach, S.; Moortgat-Pick, G. A.


    The joint IPPP Durham/Cockcroft Institute/ICFA workshop on advanced QED methods for future accelerators took place at the Cockcroft Institute in early March 2009. The motivation for the workshop was the need for a detailed consideration of the physics processes associated with beam-beam effects at the interaction points of future high-energy electron-positron colliders. There is a broad consensus within the particle physics community that the next international facility for experimental high-energy physics research beyond the Large Hadron Collider at CERN should be a high-luminosity electron-positron collider working at the TeV energy scale. One important feature of such a collider will be its ability to deliver polarised beams to the interaction point and to provide accurate measurements of the polarisation state during physics collisions. The physics collisions take place in very dense charge bunches in the presence of extremely strong electromagnetic fields of field strength of order of the Schwinger critical field strength of 4.4×1013 Gauss. These intense fields lead to depolarisation processes which need to be thoroughly understood in order to reduce uncertainty in the polarisation state at collision. To that end, this workshop reviewed the formalisms for describing radiative processes and the methods of calculation in the future strong-field environments. These calculations are based on the Furry picture of organising the interaction term of the Lagrangian. The means of deriving the transition probability of the most important of the beam-beam processes - Beamsstrahlung - was reviewed. The workshop was honoured by the presentations of one of the founders, V N Baier, of the 'Operator method' - one means for performing these calculations. Other theoretical methods of performing calculations in the Furry picture, namely those due to A I Nikishov, V I Ritus et al, were reviewed and intense field quantum processes in fields of different form - namely those

  3. Anesthesia Fact Sheet

    ... Education About NIGMS NIGMS Home > Science Education > Anesthesia Anesthesia Tagline (Optional) Middle/Main Content Area En español ... Version (464 KB) Other Fact Sheets What is anesthesia? Anesthesia is a medical treatment that prevents patients ...

  4. Structural Biology Fact Sheet

    ... NIGMS NIGMS Home > Science Education > Structural Biology Structural Biology Tagline (Optional) Middle/Main Content Area PDF Version (688 KB) Other Fact Sheets What is structural biology? Structural biology is the study of how biological ...

  5. Radiation protecting sheet

    Makiguchi, Hiroshi.


    As protection sheets used in radioactivity administration areas, a thermoplastic polyurethane composition sheet with a thickness of less 0.5 mm, solid content (ash) of less than 5% and a shore D hardness of less than 60 is used. A composite sheet with thickness of less than 0.5 mm laminated or coated with such a thermoplastic polyurethane composition as a surface layer and the thermoplastic polyurethane composition sheet applied with secondary fabrication are used. This can satisfy all of the required properties, such as draping property, abrasion resistance, high breaking strength, necking resistance, endurance strength, as well as chemical resistance and easy burnability in burning furnace. Further, by forming uneveness on the surface by means of embossing, etc. safety problems such as slippage during operation and walking can be overcome. (T.M.)

  6. Global ice sheet modeling

    Hughes, T.J.; Fastook, J.L.


    The University of Maine conducted this study for Pacific Northwest Laboratory (PNL) as part of a global climate modeling task for site characterization of the potential nuclear waste respository site at Yucca Mountain, NV. The purpose of the study was to develop a global ice sheet dynamics model that will forecast the three-dimensional configuration of global ice sheets for specific climate change scenarios. The objective of the third (final) year of the work was to produce ice sheet data for glaciation scenarios covering the next 100,000 years. This was accomplished using both the map-plane and flowband solutions of our time-dependent, finite-element gridpoint model. The theory and equations used to develop the ice sheet models are presented. Three future scenarios were simulated by the model and results are discussed

  7. Energy information sheets



    The National Energy Information Center (NEIC), as part of its mission, provides energy information and referral assistance to Federal, State, and local governments, the academic community, business and industrial organizations, and the public. The Energy Information Sheets was developed to provide general information on various aspects of fuel production, prices, consumption, and capability. Additional information on related subject matter can be found in other Energy Information Administration (EIA) publications as referenced at the end of each sheet.

  8. Achieving health for a lifetime: a community engagement assessment focusing on school-age children to decrease obesity in Durham, North Carolina.

    Corsino, Leonor; McDuffie, Jennifer R; Kotch, Jonathan; Coeytaux, Remy; Fuemmeler, Bernard F; Murphy, Gwen; Miranda, Marie Lynn; Poirier, Brenda; Morton, Janet; Reese, David; Baker, Sharon; Carter, Heidi; Freeman, Rebecca; Blue, Colleen; Yancy, William S


    Obesity is a prominent problem in the United States and in North Carolina. One way of combating it is with community-engaged interventions that foster collaboration between health-oriented organizations and community residents. Our purpose was to assemble a multifaceted group in Durham, North Carolina, to identify factors affecting obesity-related lifestyle behaviors; assess policies, resources, and the population's perception of the problem of obesity; and develop plans to improve health outcomes related to obesity. A team consisting of more than 2 dozen partners was assembled to form Achieving Health for a Lifetime (AHL) in order to study and address obesity in the community, initially focusing on elementary school-age children. The team developed a resource guide by collecting information by telephone interviews of provider organizations; geospatial resource maps were created using high-resolution geographic information systems, Duke's Data Support Repository, and county and city records; and focus groups were conducted using the nominal group technique. The AHL team, in collaboration with 2 other teams focused on diabetes and cardiovascular disease, identified 32 resources for diabetes, 20 for obesity, and 13 for cardiovascular disease. Using Geographic Information Systems (GIS), the team identified an area of Durham that had only 1 supermarket, but 34 fast-food restaurants and 84 convenience stores. The focus on particular neighborhoods means that the information obtained might not pertain to all neighborhoods. The AHL team was able to assemble a large community partnership in Durham that will allow the members of the community to continue to work toward making residents healthier. Communities facing similar challenges can learn from this experience.

  9. ORF Sequence: NC_002695 [GENIUS II[Archive


  10. ORF Sequence: NC_004307 [GENIUS II[Archive


  11. ORF Sequence: NC_005027 [GENIUS II[Archive


  12. ORF Sequence: NC_002942 [GENIUS II[Archive


  13. ORF Sequence: NC_005027 [GENIUS II[Archive


  14. Disintegration of liquid sheets

    Mansour, Adel; Chigier, Norman


    The development, stability, and disintegration of liquid sheets issuing from a two-dimensional air-assisted nozzle is studied. Detailed measurements of mean drop size and velocity are made using a phase Doppler particle analyzer. Without air flow the liquid sheet converges toward the axis as a result of surface tension forces. With airflow a quasi-two-dimensional expanding spray is formed. The air flow causes small variations in sheet thickness to develop into major disturbances with the result that disruption starts before the formation of the main break-up region. In the two-dimensional variable geometry air-blast atomizer, it is shown that the air flow is responsible for the formation of large, ordered, and small chaotic 'cell' structures.

  15. Safety advice sheets

    HSE Unit


    You never know when you might be faced with questions such as: when/how should I dispose of a gas canister? Where can I find an inspection report? How should I handle/store/dispose of a chemical substance…?   The SI section of the DGS/SEE Group is primarily responsible for safety inspections, evaluating the safety conditions of equipment items, premises and facilities. On top of this core task, it also regularly issues “Safety Advice Sheets” on various topics, designed to be of assistance to users but also to recall and reinforce safety rules and procedures. These clear and concise sheets, complete with illustrations, are easy to display in the appropriate areas. The following safety advice sheets have been issued so far: Other sheets will be published shortly. Suggestions are welcome and should be sent to the SI section of the DGS/SEE Group. Please send enquiries to

  16. 78 FR 24071 - Safety Zone; Pasquotank River; Elizabeth City, NC


    ... 1625-AA00 Safety Zone; Pasquotank River; Elizabeth City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary... Pasquotank River in Elizabeth City, NC in support of the Fireworks display for the Potato Festival. This... Guard is establishing a safety zone on the navigable waters of Pasquotank River in Elizabeth City, NC...

  17. 78 FR 72009 - Establishment of Class E Airspace; Star, NC


    ...-0440; Airspace Docket No. 13-ASO-10] Establishment of Class E Airspace; Star, NC AGENCY: Federal... at Star, NC, to accommodate a new Area Navigation (RNAV) Global Positioning System (GPS) Standard... Federal Register a notice of proposed rulemaking to establish Class E airspace at Star, NC (78 FR 54413...

  18. Ice Sheets & Ice Cores

    Mikkelsen, Troels Bøgeholm

    Since the discovery of the Ice Ages it has been evident that Earth’s climate is liable to undergo dramatic changes. The previous climatic period known as the Last Glacial saw large oscillations in the extent of ice sheets covering the Northern hemisphere. Understanding these oscillations known....... The first part concerns time series analysis of ice core data obtained from the Greenland Ice Sheet. We analyze parts of the time series where DO-events occur using the so-called transfer operator and compare the results with time series from a simple model capable of switching by either undergoing...

  19. Energy information sheets


    The National Energy Information Center (NEIC), as part of its mission, provides energy information and referral assistance to Federal, State, and local governments, the academic community, business and industrial organizations, and the general public. Written for the general public, the EIA publication Energy Information Sheets was developed to provide information on various aspects of fuel production, prices, consumption and capability. The information contained herein pertains to energy data as of December 1991. Additional information on related subject matter can be found in other EIA publications as referenced at the end of each sheet.

  20. Mutations of Glucose-6-Phosphate Dehydrogenase Durham, Santa-Maria and A+ Variants Are Associated with Loss Functional and Structural Stability of the Protein

    Gómez-Manzo, Saúl; Marcial-Quino, Jaime; Vanoye-Carlo, America; Enríquez-Flores, Sergio; De la Mora-De la Mora, Ignacio; González-Valdez, Abigail; García-Torres, Itzhel; Martínez-Rosas, Víctor; Sierra-Palacios, Edgar; Lazcano-Pérez, Fernando; Rodríguez-Bustamante, Eduardo; Arreguin-Espinosa, Roberto


    Glucose-6-phosphate dehydrogenase (G6PD) deficiency is the most common enzymopathy in the world. More than 160 mutations causing the disease have been identified, but only 10% of these variants have been studied at biochemical and biophysical levels. In this study we report on the functional and structural characterization of three naturally occurring variants corresponding to different classes of disease severity: Class I G6PD Durham, Class II G6PD Santa Maria, and Class III G6PD A+. The results showed that the G6PD Durham (severe deficiency), and the G6PD Santa Maria and A+ (less severe deficiency) (Class I, II and III, respectively) affect the catalytic efficiency of these enzymes, are more sensitive to temperature denaturing, and affect the stability of the overall protein when compared to the wild type WT-G6PD. In the variants, the exposure of more and buried hydrophobic pockets was induced and monitored with 8-Anilinonaphthalene-1-sulfonic acid (ANS) fluorescence, directly affecting the compaction of structure at different levels and probably reducing the stability of the protein. The degree of functional and structural perturbation by each variant correlates with the clinical severity reported in different patients. PMID:26633385

  1. Mutations of Glucose-6-Phosphate Dehydrogenase Durham, Santa-Maria and A+ Variants Are Associated with Loss Functional and Structural Stability of the Protein

    Saúl Gómez-Manzo


    Full Text Available Glucose-6-phosphate dehydrogenase (G6PD deficiency is the most common enzymopathy in the world. More than 160 mutations causing the disease have been identified, but only 10% of these variants have been studied at biochemical and biophysical levels. In this study we report on the functional and structural characterization of three naturally occurring variants corresponding to different classes of disease severity: Class I G6PD Durham, Class II G6PD Santa Maria, and Class III G6PD A+. The results showed that the G6PD Durham (severe deficiency, and the G6PD Santa Maria and A+ (less severe deficiency (Class I, II and III, respectively affect the catalytic efficiency of these enzymes, are more sensitive to temperature denaturing, and affect the stability of the overall protein when compared to the wild type WT-G6PD. In the variants, the exposure of more and buried hydrophobic pockets was induced and monitored with 8-Anilinonaphthalene-1-sulfonic acid (ANS fluorescence, directly affecting the compaction of structure at different levels and probably reducing the stability of the protein. The degree of functional and structural perturbation by each variant correlates with the clinical severity reported in different patients.

  2. Thus the Colliers and their wives...': migration, mate choice and population structure of some County Durham parishes in the mid-19th century

    M.T. Smith; L.J. Fletcher-Jones [University of Durham, Durham (United Kingdom). Department of Anthropology


    Historical accounts of the mining population in County Durham, UK, offer two persistent representations of demographic behaviour - substantial mobility and occupational endogamy - which would influence the distribution of genes in the population. The aim of this paper is to test these predictions against 19th-century demographic data, comparing miners with other contemporary occupations. Four parishes in County Durham yielded data on 3653 birthplace-residence distances, calculated from locations recorded in the 1851 census enumerators' books, and on occupational endogamy and exogamy for 3784 marriages recorded in the Anglican registers, 1834-76. Endogamy was analysed by log-linear models and odds ratios. Median migration distances were similar in the miners and other occupations, though the proportion of migrants among the miners (99.7%) was higher than agricultural (87.0%) and general labourers (91%). Endogamy in the miners (76%) was higher than in other populations, but further analysis showed that the miners' tendency to marry women from the same occupational background was less than among agricultural labourers or professional men.

  3. An approach to eliminate stepped features in multistage incremental sheet forming process: Experimental and FEA analysis

    Nirala, Harish Kumar; Jain, Prashant K.; Tandon, Puneet [PDPM Indian Institute of Information Technology, Design and Manufacturing Jabalpur Jabalpur-482005, Madhya Pradesh (India); Roy, J. J.; Samal, M. K. [Bhabha Atomic Research Centre, Mumbai (India)


    Incremental sheet forming (ISF) is a recently developed manufacturing technique. In ISF, forming is done by applying deformation force through the motion of Numerically controlled (NC) single point forming tool on the clamped sheet metal blank. Single Point Incremental sheet forming (SPISF) is also known as a die-less forming process because no die is required to fabricate any component by using this process. Now a day it is widely accepted for rapid manufacturing of sheet metal components. The formability of SPISF process improves by adding some intermediate stages into it, which is known as Multi-stage SPISF (MSPISF) process. However during forming in MSPISF process because of intermediate stages stepped features are generated. This paper investigates the generation of stepped features with simulation and experimental results. An effective MSPISF strategy is proposed to remove or eliminate this generated undesirable stepped features.

  4. Collisionless current sheet equilibria

    Neukirch, T.; Wilson, F.; Allanson, O.


    Current sheets are important for the structure and dynamics of many plasma systems. In space and astrophysical plasmas they play a crucial role in activity processes, for example by facilitating the release of magnetic energy via processes such as magnetic reconnection. In this contribution we will focus on collisionless plasma systems. A sensible first step in any investigation of physical processes involving current sheets is to find appropriate equilibrium solutions. The theory of collisionless plasma equilibria is well established, but over the past few years there has been a renewed interest in finding equilibrium distribution functions for collisionless current sheets with particular properties, for example for cases where the current density is parallel to the magnetic field (force-free current sheets). This interest is due to a combination of scientific curiosity and potential applications to space and astrophysical plasmas. In this paper we will give an overview of some of the recent developments, discuss their potential applications and address a number of open questions.

  5. Cholera Fact Sheet

    ... news-room/fact-sheets/detail/cholera","@context":"","@type":"Article"}; العربية 中文 français русский español ... that includes feedback at the local level and information-sharing at the global level. Cholera cases are ...

  6. Pseudomonas - Fact Sheet

    Public Health Agency


    Fact sheet on Pseudomonas, including:What is Pseudomonas?What infections does it cause?Who is susceptible to pseudomonas infection?How will I know if I have pseudomonas infection?How can Pseudomonas be prevented from spreading?How can I protect myself from Pseudomonas?How is Pseudomonas infection treated?

  7. NTPR Fact Sheets

    History Documents US Underground Nuclear Test History Reports NTPR Radiation Exposure Reports Enewetak Atoll Cleanup Documents TRAC About Who We Are Our Values History Locations Our Leadership Director Support Center Contact Us FAQ Sheet Links Success Stories Contracts Business Opportunities Current

  8. Production (information sheets)


    Documentation sheets: Geo energy 2 Integrated System Approach Petroleum Production (ISAPP) The value of smartness 4 Reservoir permeability estimation from production data 6 Coupled modeling for reservoir application 8 Toward an integrated near-wellbore model 10 TNO conceptual framework for "E&P

  9. Hibernia fact sheet



    This fact sheet gives details of the Hibernia oil field including its location, discovery date, oil company's interests in the project, the recoverable reserves of the two reservoirs, the production system used, capital costs of the project, and overall targets for Canadian benefit. Significant dates for the Hibernia project are listed. (UK)

  10. Ethanol Basics (Fact Sheet)


    Ethanol is a widely-used, domestically-produced renewable fuel made from corn and other plant materials. More than 96% of gasoline sold in the United States contains ethanol. Learn more about this alternative fuel in the Ethanol Basics Fact Sheet, produced by the U.S. Department of Energy's Clean Cities program.

  11. Virtual NC machine model with integrated knowledge data

    Sidorenko, Sofija; Dukovski, Vladimir


    The concept of virtual NC machining was established for providing a virtual product that could be compared with an appropriate designed product, in order to make NC program correctness evaluation, without real experiments. This concept is applied in the intelligent CAD/CAM system named VIRTUAL MANUFACTURE. This paper presents the first intelligent module that enables creation of the virtual models of existed NC machines and virtual creation of new ones, applying modular composition. Creation of a virtual NC machine is carried out via automatic knowledge data saving (features of the created NC machine). (Author)

  12. NC10 bacteria in marine oxygen minimum zones

    Padilla, Cory C; Bristow, Laura A; Sarode, Neha


    Bacteria of the NC10 phylum link anaerobic methane oxidation to nitrite denitrification through a unique O2-producing intra-aerobic methanotrophy pathway. A niche for NC10 in the pelagic ocean has not been confirmed. We show that NC10 bacteria are present and transcriptionally active in oceanic....... rRNA and mRNA transcripts assignable to NC10 peaked within the OMZ and included genes of the putative nitrite-dependent intra-aerobic pathway, with high representation of transcripts containing the unique motif structure of the nitric oxide (NO) reductase of NC10 bacteria, hypothesized...

  13. Rubella - Fact Sheet for Parents

    ... and 4 through 6 years Fact Sheet for Parents Color [2 pages] Español: Rubéola The best way ... according to the recommended schedule. Fact Sheets for Parents Diseases and the Vaccines that Prevent Them Chickenpox ...

  14. Film sheet cassette


    A novel film sheet cassette is described for handling CAT photographic films under daylight conditions and facilitating their imaging. A detailed description of the design and operation of the cassette is given together with appropriate illustrations. The resulting cassette is a low-cost unit which is easily constructed and yet provides a sure light-tight seal for the interior contents of the cassette. The individual resilient fingers on the light-trap permit the ready removal of the slide plate for taking pictures. The stippled, non-electrostatic surface of the pressure plate ensures an air layer and free slidability of the film for removal and withdrawal of the film sheet. The advantage of the daylight system is that a darkroom need not be used for inserting and removing the film in and out of the cassette resulting in a considerable time saving. (U.K.)

  15. Clean Cities Fact Sheet


    This fact sheet explains the Clean Cities Program and provides contact information for all coalitions and regional offices. It answers key questions such as: What is the Clean Cities Program? What are alternative fuels? How does the Clean Cities Program work? What sort of assistance does Clean Cities offer? What has Clean Cities accomplished? What is Clean Cities International? and Where can I find more information?

  16. Information sheets on energy


    These sheets, presented by the Cea, bring some information, in the energy domain, on the following topics: the world energy demand and the energy policy in France and in Europe, the part of the nuclear power in the energy of the future, the greenhouse gases emissions and the fight against the greenhouse effect, the carbon dioxide storage cost and the hydrogen economy. (A.L.B.)

  17. Biomolecular Science (Fact Sheet)


    A brief fact sheet about NREL Photobiology and Biomolecular Science. The research goal of NREL's Biomolecular Science is to enable cost-competitive advanced lignocellulosic biofuels production by understanding the science critical for overcoming biomass recalcitrance and developing new product and product intermediate pathways. NREL's Photobiology focuses on understanding the capture of solar energy in photosynthetic systems and its use in converting carbon dioxide and water directly into hydrogen and advanced biofuels.

  18. Sheet pinch devices

    Anderson, O.A.; Baker, W.R.; Ise, J. Jr.; Kunkel, W.B.; Pyle, R.V.; Stone, J.M.


    Three types of sheet-like discharges are being studied at Berkeley. The first of these, which has been given the name 'Triax', consists of a cylindrical plasma sleeve contained between two coaxial conducting cylinders A theoretical analysis of the stability of the cylindrical sheet plasma predicts the existence of a 'sausage-mode' instability which is, however, expected to grow more slowly than in the case of the unstabilized linear pinch (by the ratio of the radial dimensions). The second pinch device employs a disk shaped discharge with radial current guided between flat metal plates, this configuration being identical to that of the flat hydromagnetic capacitor without external magnetic field. A significant feature of these configurations is the absence of a plasma edge, i.e., there are no regions of sharply curved magnetic field lines anywhere in these discharges. The importance of this fact for stability is not yet fully investigated theoretically. As a third configuration a rectangular, flat pinch tube has been constructed, and the behaviour of a flat plasma sheet with edges is being studied experimentally

  19. Technical development of a retrofit wood burner for coal under-fed stokers in County Durham, and set up of demonstration facility

    Smith, N.


    Durham County Council wishes to convert its coal-burning solid fuel boilers to make use of readily-available waste wood dust. It is intended that the wood dust be converted to pelleted fuel. The emphasis was on cost-cutting rather than boiler efficiency. The experimental studies were carried out at two schools where the boilers were welded steel and cast iron sectional boilers. Factors studied were air supply to the boilers, fuel feed systems, fuel storage, fuel delivery and pelletization. The results have shown that operating costs of wood burning boilers are a little greater than coal-burning but this is slightly offset by savings elsewhere. The environmental benefits were significant in terms of lower emissions from the boilers, reduced road transport, and the wood waste is no longer sent to landfill. Further areas of study are recommended. The contractor for this study was North Energy Associates Ltd, and the study was part of the DTI Sustainable Energy Programme.

  20. Non-leptonic kaon decays at large Nc

    Donini, Andrea; Hernández, Pilar; Pena, Carlos; Romero-López, Fernando


    We study the scaling with the number of colors Nc of the weak amplitudes mediating kaon mixing and decay, in the limit of light charm masses (mu = md = ms = mc). The amplitudes are extracted directly on the lattice for Nc = 3 - 7 (with preliminar results for Nc = 8 and 17) using twisted mass QCD. It is shown that the (sub-leading) 1 /Nc corrections to B\\hatk are small and that the naive Nc → ∞ limit, B\\hatk = 3/4, seems to be recovered. On the other hand, the O (1/Nc) corrections in K → ππ amplitudes (derived from K → π matrix elements) are large and fully anti-correlated in the I = 0 and I = 2 channels. This may have some implications for the understanding of the ΔI = 1/2 rule.

  1. Dense sheet Z-pinches

    Tetsu, Miyamoto


    The steady state and quasi-steady processes of infinite- and finite-width sheet z-pinches are studied. The relations corresponding to the Bennett relation and Pease-Braginskii current of cylindrical fiber z-pinches depend on a geometrical factor in the sheet z-pinches. The finite-width sheet z-pinch is approximated by a segment of infinite-width sheet z-pinch, if it is wide enough, and corresponds to a number of (width/thickness) times fiber z-pinch plasmas of the diameter that equals the sheet thickness. If the sheet current equals this number times the fiber current, the plasma created in the sheet z-pinches is as dense as in the fiber z-pinches. The total energy of plasma and magnetic field per unit mass is approximately equal in both pinches. Quasi-static transient processes are different in several aspects from the fiber z-pinch. No radiation collapse occurs in the sheet z-pinch. The stability is improved in the sheet z-pinches. The fusion criterions and the experimental arrangements to produce the sheet z-pinches are also discussed. (author)

  2. ORF Sequence: NC_003909 [GENIUS II[Archive


  3. ORF Sequence: NC_005363 [GENIUS II[Archive

    Full Text Available NC_005363 gi|42523756 >gi|42523756|ref|NP_969136.1| membrane protein necessary for nodulation/ [Bdellovibrio bacteriovorus HD100] MKSLMLILFVSLLSVVAKADCTTAITINEAISASTSDYLERAEKR

  4. ORF Sequence: NC_003078 [GENIUS II[Archive

    Full Text Available etitiveness [Sinorhizobium meliloti 1021] MQLSACARRREAVRYRRRMARILILLFSLLSAFAFPVTPVP... NC_003078 gi|16264863 >gi|16264863|ref|NP_437655.1| probable membrane protein necessary for nodulation comp

  5. ORF Sequence: NC_002678 [GENIUS II[Archive

    Full Text Available NC_002678 gi|13471138 >gi|13471138|ref|NP_102707.1| transcriptional regulatory protein, nodulation competit...iveness determinant [Mesorhizobium loti MAFF303099] MTNESDTRSAELAELTADIVSAYVSNNPLPV

  6. ORF Sequence: NC_005296 [GENIUS II[Archive


  7. ORF Sequence: NC_003047 [GENIUS II[Archive

    Full Text Available NC_003047 gi|15964332 >gi|15964332|ref|NP_384685.1| PROBABLE PYRAZINAMIDASE/NICOTINAMIDAS...E (INCLUDES: PYRAZINAMIDASE, NICOTINAMIDASE) PROTEIN [Sinorhizobium meliloti 1021] MADAARPDLREAMADEAL

  8. ORF Sequence: NC_006155 [GENIUS II[Archive

    Full Text Available g protein (involved in environmental [Yersinia pseudotuberculosis IP 32953] MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPTVWQHVK ... NC_006155 gi|51595328 >gi|51595328|ref|YP_069519.1| hemolysin expression modulatin

  9. ORF Sequence: NC_003279 [GENIUS II[Archive

    Full Text Available NC_003279 gi|17507795 >gi|17507795|ref|NP_493043.1| putative protein, with at least 2 transme...YLNIQIADETTDLPVSIDRANVDMRIYRAFEMSMEKDIISLSTSNTSHAEISTPKSRKKKSRKLGLKNLEEVINSKYNSCQKQDNSMSIQ

  10. ORF Sequence: NC_005027 [GENIUS II[Archive

    Full Text Available NC_005027 gi|32475512 >gi|32475512|ref|NP_868506.1| hypothetical protein-signal peptide and transme...VLVGLLLPAVQAAREAARRMSCSNNIAQLTLATHNYEFSMEHLPPGTTNPTGPIVNTPNGEHISFLVRLLPYIEQQGTADDFDLTASVYAPANAKVRAYQISAFLCPS

  11. ORF Sequence: NC_003070 [GENIUS II[Archive

    Full Text Available NC_003070 gi|18407972 >gi|18407972|ref|NP_564823.1| no apical meristem (NAM) famil...y protein [Arabidopsis thaliana] MQAEEIICRVSDEEIIENYLRPKINGETSSIPRYVVELAEELYTVEPWLLPRQTAPILNPGEWFYFGKRNRKYSN

  12. ORF Sequence: NC_003280 [GENIUS II[Archive

    Full Text Available NC_003280 gi|17533935 >gi|17533935|ref|NP_496777.1| ZYXin (zyx-1) [Caenorhabditis elegans] MNQIFHVDC...FAPRCALCSKPIVPQDGEKESVRVVAMDKSFHVDCYKCEDCGMQLSSKLEGQGCYPIDNHLLCKTCNGNRLRVVSST

  13. ORF Sequence: NC_002162 [GENIUS II[Archive


  14. ORF Sequence: NC_002162 [GENIUS II[Archive


  15. ORF Sequence: NC_002162 [GENIUS II[Archive

    Full Text Available NC_002162 gi|13358146 >gi|13358146|ref|NP_078420.1| transcription antitermination factor [Ureap...lasma parvum serovar 3 str. ATCC 700970] MAYKIKDLDSKLLSDLKIDFNHRHQWYIVTVVSGNEQKVIENIKDKLNGYGYGDKLSDLKIIKEKIKEVKIYEPSEAP

  16. Perforation of metal sheets

    Steenstrup, Jens Erik

    simulation is focused on the sheet deformation. However, the effect on the tool and press is included. The process model is based on the upper bound analysis in order to predict the force progress and hole characteristics etc. Parameter analyses are divided into two groups, simulation and experimental tests......The main purposes of this project are:1. Development of a dynamic model for the piercing and performation process2. Analyses of the main parameters3. Establishing demands for process improvements4. Expansion of the existing parameter limitsThe literature survey describes the process influence...

  17. Experiments on sheet metal shearing

    Gustafsson, Emil


    Within the sheet metal industry, different shear cutting technologies are commonly used in several processing steps, e.g. in cut to length lines, slitting lines, end cropping etc. Shearing has speed and cost advantages over competing cutting methods like laser and plasma cutting, but involves large forces on the equipment and large strains in the sheet material.Numerical models to predict forces and sheared edge geometry for different sheet metal grades and different shear parameter set-ups a...

  18. 76 FR 29645 - Safety Zone, Newport River; Morehead City, NC


    ...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary final... the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC. This safety... Zone, Newport River; Morehead City, North Carolina in the Federal Register (33 FR 165). We received no...

  19. 76 FR 18669 - Safety Zone, Newport River; Morehead City, NC


    ...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Notice of proposed... River under the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC... Newport River at Morehead City, North Carolina. The contract provides for cleaning, painting, and steel...

  20. 76 FR 38018 - Safety Zone, Newport River; Morehead City, NC


    ...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary final... the main span US 70/Morehead City-Newport River high rise bridge in Carteret County, NC. This safety...) entitled Safety Zone, Newport River; Morehead City, North Carolina in the Federal Register (33 FR 165). We...

  1. 76 FR 23227 - Safety Zone, Newport River; Morehead City, NC


    ...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Notice of proposed... River under the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC... Newport River at Morehead City, North Carolina. The contract provides for cleaning, painting, and steel...

  2. ncRNA consensus secondary structure derivation using grammar strings.

    Achawanantakun, Rujira; Sun, Yanni; Takyar, Seyedeh Shohreh


    Many noncoding RNAs (ncRNAs) function through both their sequences and secondary structures. Thus, secondary structure derivation is an important issue in today's RNA research. The state-of-the-art structure annotation tools are based on comparative analysis, which derives consensus structure of homologous ncRNAs. Despite promising results from existing ncRNA aligning and consensus structure derivation tools, there is a need for more efficient and accurate ncRNA secondary structure modeling and alignment methods. In this work, we introduce a consensus structure derivation approach based on grammar string, a novel ncRNA secondary structure representation that encodes an ncRNA's sequence and secondary structure in the parameter space of a context-free grammar (CFG) and a full RNA grammar including pseudoknots. Being a string defined on a special alphabet constructed from a grammar, grammar string converts ncRNA alignment into sequence alignment. We derive consensus secondary structures from hundreds of ncRNA families from BraliBase 2.1 and 25 families containing pseudoknots using grammar string alignment. Our experiments have shown that grammar string-based structure derivation competes favorably in consensus structure quality with Murlet and RNASampler. Source code and experimental data are available at

  3. Inherent and antigen-induced airway hyperreactivity in NC mice

    Tetsuto Kobayashi


    Full Text Available In order to clarify the airway physiology of NC mice, the following experiments were carried out. To investigate inherent airway reactivity, we compared tracheal reactivity to various chemical mediators in NC, BALB/c, C57BL/6 and A/J mice in vitro. NC mice showed significantly greater reactivity to acetylcholine than BALB/c and C57BL/6 mice and a reactivity comparable to that of A/J mice, which are known as high responders. Then, airway reactivity to acetylcholine was investigated in those strains in vivo. NC mice again showed comparable airway reactivity to that seen in A/J mice and a significantly greater reactivity than that seen in BALB/c and C57BL/6 mice. To investigate the effects of airway inflammation on airway reactivity to acetylcholine in vivo, NC and BALB/c mice were sensitized to and challenged with antigen. Sensitization to and challenge with antigen induced accumulation of inflammatory cells, especially eosinophils, in lung and increased airway reactivity in NC and BALB/c mice. These results indicate that NC mice exhibit inherent and antigen-induced airway hyperreactivity. Therefore, NC mice are a suitable strain to use in investigating the mechanisms underlying airway hyperreactivity and such studies will provide beneficial information for understanding the pathophysiology of asthma.

  4. On pseudorandom generators in NC0

    Cryan, Mary; Miltersen, Peter Bro


    In this paper we consider the question of whether NC 0 circuits can generate pseudorandom distributions. While we leave the general question unanswered, we show – • Generators computed by NC 0 circuits where each output bit depends on at most 3 input bits (i.e, DNC 3 0 circuits) and with stretch ...

  5. Human corneal endothelial cell transplantation using nanocomposite gel sheet in bullous keratopathy.

    Parikumar, Periasamy; Haraguchi, Kazutoshi; Senthilkumar, Rajappa; Abraham, Samuel Jk


    Transplantation of in vitro expanded human corneal endothelial precursors (HCEP) cells using a nanocomposite (D25-NC) gel sheet as supporting material in bovine's cornea has been earlier reported. Herein we report the transplantation of HCEP cells derived from a cadaver donor cornea to three patients using the NC gel sheet. In three patients with bullous keratopathy, one after cataract surgery, one after trauma and another in the corneal graft, earlier performed for congenital corneal dystrophy, not amenable to medical management HCEP cells isolated from a human cadaver donor cornea in vitro expanded using a thermoreversible gelation polymer (TGP) for 26 days were divided into three equal portions and 1.6 × 10 5 HCEP cells were injected on to the endothelium of the affected eye in each patient using the D25-NC gel sheet as a supporting material. The sheets were removed after three days. The bullae in the cornea disappeared by the 3 rd -11 th post-operative day in all the three patients. Visual acuity improved from Perception of light (PL)+/Projection of rays (PR)+ to Hand movements (HM)+ in one of the patients by post-operative day 3 which was maintained at 18 months follow-up. At 18 months follow-up, in another patient the visual acuity had improved from HM+ to 6/60 while in the third patient, visual acuity remained HM+ as it was prior to HCEP transplantation. There were no adverse effects during the follow-up in any of the patients.

  6. Soft Costs Fact Sheet



    This fact sheet is an overview of the systems integration subprogram at the U.S. Department of Energy SunShot Initiative. Soft costs can vary significantly as a result of a fragmented energy marketplace. In the U.S., there are 18,000 jurisdictions and 3,000 utilities with different rules and regulations for how to go solar. The same solar equipment may vary widely in its final installation price due to process and market variations across jurisdictions, creating barriers to rapid industry growth. SunShot supports the development of innovative solutions that enable communities to build their local economies and establish clean energy initiatives that meet their needs, while at the same time creating sustainable solar market conditions.

  7. Photovoltaics Fact Sheet



    This fact sheet is an overview of the Photovoltaics (PV) subprogram at the U.S. Department of Energy SunShot Initiative. The U.S. Department of Energy (DOE)’s Solar Energy Technologies Office works with industry, academia, national laboratories, and other government agencies to advance solar PV, which is the direct conversion of sunlight into electricity by a semiconductor, in support of the goals of the SunShot Initiative. SunShot supports research and development to aggressively advance PV technology by improving efficiency and reliability and lowering manufacturing costs. SunShot’s PV portfolio spans work from early-stage solar cell research through technology commercialization, including work on materials, processes, and device structure and characterization techniques.

  8. Systems Integration Fact Sheet



    This fact sheet is an overview of the Systems Integration subprogram at the U.S. Department of Energy SunShot Initiative. The Systems Integration subprogram enables the widespread deployment of safe, reliable, and cost-effective solar energy technologies by addressing the associated technical and non-technical challenges. These include timely and cost-effective interconnection procedures, optimal system planning, accurate prediction of solar resources, monitoring and control of solar power, maintaining grid reliability and stability, and many more. To address the challenges associated with interconnecting and integrating hundreds of gigawatts of solar power onto the electricity grid, the Systems Integration program funds research, development, and demonstration projects in four broad, interrelated focus areas: grid performance and reliability, dispatchability, power electronics, and communications.

  9. Hyperspectral light sheet microscopy

    Jahr, Wiebke; Schmid, Benjamin; Schmied, Christopher; Fahrbach, Florian O.; Huisken, Jan


    To study the development and interactions of cells and tissues, multiple fluorescent markers need to be imaged efficiently in a single living organism. Instead of acquiring individual colours sequentially with filters, we created a platform based on line-scanning light sheet microscopy to record the entire spectrum for each pixel in a three-dimensional volume. We evaluated data sets with varying spectral sampling and determined the optimal channel width to be around 5 nm. With the help of these data sets, we show that our setup outperforms filter-based approaches with regard to image quality and discrimination of fluorophores. By spectral unmixing we resolved overlapping fluorophores with up to nanometre resolution and removed autofluorescence in zebrafish and fruit fly embryos.

  10. Settlement during vibratory sheet piling

    Meijers, P.


    During vibratory sheet piling quite often the soil near the sheet pile wall will settle. In many cases this is not a problem. For situations with houses, pipelines, roads or railroads at relative short distance these settlements may not be acceptable. The purpose of the research described in this

  11. Plasma dynamics in current sheets

    Bogdanov, S.Yu.; Drejden, G.V.; Kirij, N.P.; AN SSSR, Leningrad


    Plasma dynamics in successive stages of current sheet evolution is investigated on the base of analysis of time-spatial variations of electron density and electrodynamic force fields. Current sheet formation is realized in a two-dimensional magnetic field with zero line under the action of relatively small initial disturbances (linear regimes). It is established that in the limits of the formed sheet is concentrated dense (N e ∼= 10 16 cm -3 ) (T i ≥ 100 eV, bar-Z i ≥ 2) hot pressure of which is balanced by the magnetic action of electrodynamic forces is carried out both plasma compression in the sheet limits and the acceleration along the sheet surface from a middle to narrow side edges

  12. NC CATCH: Advancing Public Health Analytics.

    Studnicki, James; Fisher, John W; Eichelberger, Christopher; Bridger, Colleen; Angelon-Gaetz, Kim; Nelson, Debi


    The North Carolina Comprehensive Assessment for Tracking Community Health (NC CATCH) is a Web-based analytical system deployed to local public health units and their community partners. The system has the following characteristics: flexible, powerful online analytic processing (OLAP) interface; multiple sources of multidimensional, event-level data fully conformed to common definitions in a data warehouse structure; enabled utilization of available decision support software tools; analytic capabilities distributed and optimized locally with centralized technical infrastructure; two levels of access differentiated by the user (anonymous versus registered) and by the analytical flexibility (Community Profile versus Design Phase); and, an emphasis on user training and feedback. The ability of local public health units to engage in outcomes-based performance measurement will be influenced by continuing access to event-level data, developments in evidence-based practice for improving population health, and the application of information technology-based analytic tools and methods.

  13. Vitamin and Mineral Supplement Fact Sheets

    ... website Submit Search NIH Office of Dietary Supplements Vitamin and Mineral Supplement Fact Sheets Search the list ... Supplements: Background Information Botanical Dietary Supplements: Background Information Vitamin and Mineral Fact Sheets Botanical Supplement Fact Sheets ...

  14. Selectively reflective transparent sheets

    Waché, Rémi; Florescu, Marian; Sweeney, Stephen J.; Clowes, Steven K.


    We investigate the possibility to selectively reflect certain wavelengths while maintaining the optical properties on other spectral ranges. This is of particular interest for transparent materials, which for specific applications may require high reflectivity at pre-determined frequencies. Although there exist currently techniques such as coatings to produce selective reflection, this work focuses on new approaches for mass production of polyethylene sheets which incorporate either additives or surface patterning for selective reflection between 8 to 13 μ m. Typical additives used to produce a greenhouse effect in plastics include particles such as clays, silica or hydroxide materials. However, the absorption of thermal radiation is less efficient than the decrease of emissivity as it can be compared with the inclusion of Lambertian materials. Photonic band gap engineering by the periodic structuring of metamaterials is known in nature for producing the vivid bright colors in certain organisms via strong wavelength-selective reflection. Research to artificially engineer such structures has mainly focused on wavelengths in the visible and near infrared. However few studies to date have been carried out to investigate the properties of metastructures in the mid infrared range even though the patterning of microstructure is easier to achieve. We present preliminary results on the diffuse reflectivity using FDTD simulations and analyze the technical feasibility of these approaches.

  15. Superfund fact sheet: The remedial program. Fact sheet


    The fact sheet describes what various actions the EPA can take to clean up hazardous wastes sites. Explanations of how the criteria for environmental and public health risk assessment are determined and the role of state and local governments in site remediation are given. The fact sheet is one in a series providing reference information about Superfund issues and is intended for readers with no formal scientific training

  16. Inherent and antigen-induced airway hyperreactivity in NC mice

    Tetsuto Kobayashi; Toru Miura; Tomoko Haba; Miyuki Sato; Masao Takei; Isao Serizawa


    In order to clarify the airway physiology of NC mice, the following experiments were carried out. To investigate inherent airway reactivity, we compared tracheal reactivity to various chemical mediators in NC, BALB/c, C57BL/6 and A/J mice in vitro. NC mice showed significantly greater reactivity to acetylcholine than BALB/c and C57BL/6 mice and a reactivity comparable to that of A/J mice, which are known as high responders. Then, airway reactivity to acetylcholine was investigated in those st...

  17. 2012 Swimming Season Fact Sheets

    To help beachgoers make informed decisions about swimming at U.S. beaches, EPA annually publishes state-by-state data about beach closings and advisories for the previous year's swimming season. These fact sheets summarize that information by state.

  18. State Fact Sheets on COPD

    ... Submit Search The CDC Chronic Obstructive Pulmonary Disease (COPD) Note: Javascript is disabled or is not supported ... message, please visit this page: About . COPD Homepage Data and Statistics Fact Sheets Publications Publications ...

  19. Australian Government Balance Sheet Management

    Wilson Au-Yeung; Jason McDonald; Amanda Sayegh


    Since almost eliminating net debt, the Australian Government%u2019s attention has turned to the financing of broader balance sheet liabilities, such as public sector superannuation. Australia will be developing a significant financial asset portfolio in the %u2018Future Fund%u2019 to smooth the financing of expenses through time. This raises the significant policy question of how best to manage the government balance sheet to reduce risk. This paper provides a framework for optimal balance sh...

  20. Energy information sheets, July 1998



    The National Energy Information Center (NEIC), as part of its mission, provides energy information and referral assistance to Federal, State, and local governments, the academic community, business and industrial organizations, and the public. The Energy Information Sheets was developed to provide general information on various aspects of fuel production, prices, consumption, and capability. Additional information on related subject matter can be found in other Energy Information Administration (EIA) publications as referenced at the end of each sheet.

  1. Energy information sheets, September 1996



    The National Energy Information Center (NEIC), as part of its mission, provides energy information and referral assistance to Federal, State, and local governments, the academic community, business and industrial organizations, and the public. The Energy Information Sheets was developed to provide general information on various aspects of fuel production, prices, consumption, and capability. Additional information on related subject matter can be found in other Energy Information Administration (EIA) publications as referenced at the end of each sheet.

  2. ORF Alignment: NC_003902 [GENIUS II[Archive

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003902 gi|21232942 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  3. ORF Alignment: NC_003919 [GENIUS II[Archive

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21242877 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  4. ORF Alignment: NC_004663 [GENIUS II[Archive

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004663 gi|29348666 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  5. ORF Alignment: NC_004578 [GENIUS II[Archive

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004578 gi|28867366 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  6. ORF Alignment: NC_005139 [GENIUS II[Archive

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_005139 gi|37678876 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  7. ORF Alignment: NC_003919 [GENIUS II[Archive

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21241391 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  8. ORF Alignment: NC_006177 [GENIUS II[Archive

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006177 gi|51892124 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  9. ORF Alignment: NC_006349 [GENIUS II[Archive

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006349 gi|53716793 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  10. ORF Alignment: NC_006840 [GENIUS II[Archive

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006840 gi|59711756 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  11. ORF Alignment: NC_006370 [GENIUS II[Archive

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006370 gi|54310137 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  12. ORF Alignment: NC_003919 [GENIUS II[Archive

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21243399 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  13. ORF Alignment: NC_003869 [GENIUS II[Archive

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003869 gi|20807352 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  14. ORF Alignment: NC_006351 [GENIUS II[Archive

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006351 gi|53722013 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  15. ORF Alignment: NC_004459 [GENIUS II[Archive

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004459 gi|27363966 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  16. ORF Alignment: NC_006834 [GENIUS II[Archive

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006834 gi|58583632 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  17. ORF Sequence: NC_001139 [GENIUS II[Archive

    Full Text Available NC_001139 gi|6321518 >gi|6321518|ref|NP_011595.1| Protein of unknown function; deletion... mutant has synthetic fitness defect with an sgs1 deletion mutant; Slx9p [Saccharomyces cerevisiae] MVA

  18. Observations of NC stop nets for bottlenose dolphin takes

    National Oceanic and Atmospheric Administration, Department of Commerce — To observe the NC stop net fishery to document the entanglement of bottlenose dolphins and movement of dolphins around the nets.

  19. ORF Alignment: NC_002947 [GENIUS II[Archive

    Full Text Available NC_002947 gi|26988182 >1rwrA 1 265 36 293 1e-50 ... ref|NP_743607.1| surface colonization... ... gb|AAN67071.1| surface colonization protein, putative ... [Pseudomonas putida KT2440] ...

  20. ORF Sequence: NC_003281 [GENIUS II[Archive

    Full Text Available NC_003281 gi|25151987 >gi|25151987|ref|NP_499440.2| TRAnsformer : XX animals trans...formed into males TRA-1, HERmaphrodization of XO animals HER-2, sex determination zinc-finger protein, alter

  1. ORF Sequence: NC_003282 [GENIUS II[Archive

    Full Text Available inization of XX and XO animals FEM-3 (46.2 kD) (fem-3) [Caenorhabditis elegans] MEVDPGSDDVEADRETRAQKLKLKRNVK... NC_003282 gi|17540880 >gi|17540880|ref|NP_501587.1| sex determination protein, FEM

  2. ORF Sequence: NC_003282 [GENIUS II[Archive

    Full Text Available NC_003282 gi|17540144 >gi|17540144|ref|NP_500824.1| feminization 1 homolog a, FEMinization of XX and XO ani...mals FEM-1 (fem-1) [Caenorhabditis elegans] MTPNGHHFRTVIYNAAAVGNLQRIKVFTINSRNDRQWII

  3. ORF Sequence: NC_002945 [GENIUS II[Archive

    Full Text Available NC_002945 gi|31792282 >gi|31792282|ref|NP_854775.1| PROBABLE CELLULASE CELA2A (ENDO-1,4-BETA-GLUCA...NASE) (ENDOGLUCANASE) (CARBOXYMETHYL CELLULASE) [Mycobacterium bovis AF2122/97] MNGAAPTNGAPLSYPSICEGVHWGHLVGGHQPAY

  4. ORF Sequence: NC_000962 [GENIUS II[Archive

    Full Text Available NC_000962 gi|57116825 >gi|57116825|ref|YP_177638.1| PROBABLE CELLULASE CELA2A (ENDO-1,4-BETA-GLUCA...NASE) (ENDOGLUCANASE) (CARBOXYMETHYL CELLULASE) [Mycobacterium tuberculosis H37Rv] MNGAAPTNGAPLSYPSICEGVHWGHLVGGHQPAY

  5. ORF Sequence: NC_000913 [GENIUS II[Archive

    Full Text Available NC_000913 gi|16131649 >gi|16131649|ref|NP_418241.1| TDP-Fuc4NAc:lipidII transferase; synthesis of enterobac...terial common antigen (ECA) [Escherichia coli K12] MSLLQFSGLFVVWLLCTLFIATLTWFEFRRVR

  6. ORF Sequence: NC_000913 [GENIUS II[Archive

    Full Text Available erobacterial common antigen (ECA) [Escherichia coli K12] MKVLTVFGTRPEAIKMAPLVHALAKD... NC_000913 gi|49176409 >gi|49176409|ref|YP_026253.1| UDP-N-acetyl glucosamine -2-epimerase; synthesis of ent

  7. ORF Sequence: NC_002655 [GENIUS II[Archive

    Full Text Available erobacterial common antigen (ECA) [Escherichia coli O157:H7 EDL933] MSAKALAAYSKRIDV... NC_002655 gi|15804377 >gi|15804377|ref|NP_290417.1| UDP-N-acetyl glucosamine -2-epimerase; synthesis of ent

  8. ORF Sequence: NC_006905 [GENIUS II[Archive

    Full Text Available of cations and cationic drugs [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] MQQFEWI... NC_006905 gi|62180071 >gi|62180071|ref|YP_216488.1| putative membrane transporter

  9. ORF Alignment: NC_002977 [GENIUS II[Archive

    Full Text Available NC_002977 gi|53804693 >1fgjA 20 492 48 517 e-179 ... gb|AAU92745.1| hydroxylamine oxy...doreductase [Methylococcus capsulatus str. Bath] ... ref|YP_113436.1| hydroxylamine oxydoreductase ...

  10. ORF Alignment: NC_006569 [GENIUS II[Archive

    Full Text Available NC_006569 gi|56708985 >1fgjA 5 498 32 521 0.0 ... ref|YP_165030.1| hydroxylamine oxid...oreductase [Silicibacter pomeroyi DSS-3] ... gb|AAV97335.1| hydroxylamine oxidoreductase ... [

  11. ORF Sequence: NC_006905 [GENIUS II[Archive

    Full Text Available of cations and cationic drugs [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] MFYWILL... NC_006905 gi|62180070 >gi|62180070|ref|YP_216487.1| putative membrane transporter

  12. Explorations of the extended ncKP hierarchy

    Dimakis, Aristophanes; Mueller-Hoissen, Folkert


    A recently obtained extension (xncKP) of the Moyal-deformed KP hierarchy (ncKP hierarchy) by a set of evolution equations in the Moyal-deformation parameters is further explored. Formulae are derived to compute these equations efficiently. Reductions of the xncKP hierarchy are treated, in particular to the extended ncKdV and ncBoussinesq hierarchies. Furthermore, a good part of the Sato formalism for the KP hierarchy is carried over to the generalized framework. In particular, the well-known bilinear identity theorem for the KP hierarchy, expressed in terms of the (formal) Baker-Akhiezer function, extends to the xncKP hierarchy. Moreover, it is demonstrated that N-soliton solutions of the ncKP equation are also solutions of the first few deformation equations. This is shown to be related to the existence of certain families of algebraic identities

  13. ORF Alignment: NC_003295 [GENIUS II[Archive

    Full Text Available NC_003295 gi|17546028 >1fjgR 2 71 22 91 5e-16 ... emb|CAD15011.1| PROBABLE PRIMOSOMAL REPLICATION... PROTEIN [Ralstonia solanacearum] ... ref|NP_519430.1| PROBABLE PRIMOSOMAL REPLICATION ...

  14. ORF Sequence: NC_004307 [GENIUS II[Archive

    Full Text Available se/invertase); possible inulinase [Bifidobacterium longum NCC2705] MTDFTPETPVLTPIHDHAAELAKAEAGVAEMAANRNNRWYP... NC_004307 gi|23464731 >gi|23464731|ref|NP_695334.1| beta-fructofuranosidase (sucra

  15. ORF Alignment: NC_006371 [GENIUS II[Archive

    Full Text Available NC_006371 gi|54302237 >1r690 2 63 15 79 7e-05 ... ref|YP_132230.1| hypotethical trans...criptional regulator [Photobacterium profundum ... SS9] emb|CAG22430.1| hypotethical transcriptional ...

  16. ORF Alignment: NC_005296 [GENIUS II[Archive

    Full Text Available NC_005296 gi|39936477 >1kmoA 7 661 92 753 2e-72 ... emb|CAE28855.1| putative hydroxamate-type ferris... ... putative hydroxamate-type ferrisiderophore receptor ... [Rhodopseudomonas palustris CGA009] ...

  17. ORF Alignment: NC_006155 [GENIUS II[Archive

    Full Text Available NC_006155 gi|51597538 >1kmoA 5 661 59 714 9e-71 ... ref|YP_071729.1| putative hydroxamate-type ferris...ive ... hydroxamate-type ferrisiderophore receptor. [Yersinia ... pseudotuberculosis IP 32953

  18. ORF Alignment: NC_004307 [GENIUS II[Archive

    Full Text Available NC_004307 gi|23465117 >1g5aA 80 628 2 589 5e-59 ... gb|AAL05573.1| alpha-glucosidase [Bifidobacterium adolesce...ntis] ... Length = 588 ... Query: 1 ... MTANNLNDDWWKQAVVYQIYPRSFKDVNGDGLGDIAGVTEK

  19. ORF Sequence: NC_006905 [GENIUS II[Archive

    Full Text Available NC_006905 gi|62181272 >gi|62181272|ref|YP_217689.1| H inversion: regulation of fla...gellar gene expression by site-specific inversion of DNA [Salmonella enterica subsp. enterica serovar Choler

  20. ORF Sequence: NC_000913 [GENIUS II[Archive

    Full Text Available NC_000913 gi|16128606 >gi|16128606|ref|NP_415156.1| RNA chaperone, transcription antiterm...inator, affects expression of rpoS and uspA [Escherichia coli K12] MSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQTNGFKTLAEGQRVEFEITNGAKGPSAANVIAL

  1. ORF Sequence: NC_001147 [GENIUS II[Archive

    Full Text Available NC_001147 gi|6324442 >gi|6324442|ref|NP_014511.1| Plasma membrane Mg(2+) transporter, expression and are regulated by Mg(2+) concentration; overexpression confers increased toleranc

  2. ORF Sequence: NC_004605 [GENIUS II[Archive

    Full Text Available protein) (involved in swarmer cell regulation) [Vibrio parahaemolyticus RIMD 2210633] MKKAVKKISSKKIITISAIIV... NC_004605 gi|28901366 >gi|28901366|ref|NP_801021.1| ScrC (sensory box/GGDEF family

  3. ORF Sequence: NC_006905 [GENIUS II[Archive

    Full Text Available g protein (involved in environmental regulation of virulence factors) [Salmonella enterica subsp. enterica s... NC_006905 gi|62179085 >gi|62179085|ref|YP_215502.1| hemolysin expression modulatin

  4. ORF Sequence: NC_003283 [GENIUS II[Archive

    Full Text Available NC_003283 gi|17563066 >gi|17563066|ref|NP_506462.1| putative protein family member, with a transme...mbrane domain (5O433) [Caenorhabditis elegans] MWNLVSPIHISSKFSMEMAEVNVVAVPEENRQTYLETDNDRLVMAIIWLIMPPMAVFFKCRGCTKHVFINFLLYLLLVLPAYKHATWFCFVKGREFEAEDGFVRAR

  5. ORF Sequence: NC_003280 [GENIUS II[Archive

    Full Text Available NC_003280 gi|17535455 >gi|17535455|ref|NP_495314.1| putative endoplasmic reticulum protein, with a transme...mbrane domain (2G788) [Caenorhabditis elegans] MTDVRFIIWNCIALLVALMMALTSIIILSDAPHNSME

  6. 76 FR 78331 - Environmental Impact Statement: Jackson County, NC


    ... following purpose description: ``The purpose of this project is to relieve traffic congestion in the Sylva... that improves the NC 107 north/south vehicular mobility by increasing average speeds for through...

  7. ORF Sequence: NC_001137 [GENIUS II[Archive

    Full Text Available ull mutation has global effects on transcription; Yer064cp [Saccharomyces cerevisiae] MIDDTENSKIHLEGSHKTGKYT... NC_001137 gi|6320907 >gi|6320907|ref|NP_010986.1| Non-essential nuclear protein; n

  8. ORF Sequence: NC_001145 [GENIUS II[Archive

    Full Text Available NC_001145 gi|6323710 >gi|6323710|ref|NP_013781.1| Protein required for nuclear mem...brane fusion during karyogamy, localizes to the membrane with a soluble portion in the endoplasmic reticulum

  9. ORF Alignment: NC_003888 [GENIUS II[Archive

    Full Text Available NC_003888 gi|21219041 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce

  10. ORF Alignment: NC_003888 [GENIUS II[Archive

    Full Text Available tide synthetase [Actinoplanes teichomyceticus] ... Length = 427 ... Query: 12 ... LSPLQEGMLFHNLFDEEELDAYNVQ... NC_003888 gi|32141196 >1l5aA 1 423 12 438 2e-57 ... emb|CAE53352.1| non-ribosomal pep

  11. ORF Alignment: NC_003306 [GENIUS II[Archive

    Full Text Available NC_003306 gi|17938860 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce

  12. ORF Alignment: NC_005363 [GENIUS II[Archive

    Full Text Available NC_005363 gi|42523916 >1a12A 35 375 64 376 3e-39 ... emb|CAE53335.1| putative RCC1 repeats protein [ teichomyceticus] ... Length = 313 ... Query: 425 GVGFACALYDNNDLKCFGANDYGQLGD

  13. ORF Alignment: NC_003064 [GENIUS II[Archive

    Full Text Available NC_003064 gi|16119505 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce

  14. ORF Sequence: NC_002162 [GENIUS II[Archive

    Full Text Available NC_002162 gi|13357802 >gi|13357802|ref|NP_078076.1| ribosomal protein L24 [Ureapla...sma parvum serovar 3 str. ATCC 700970] MNRIKKGDTVVVISGKNKNKSGVVIQVNPKEQTALVEGVNKIKRHQKKDQTHEQSGIIEKEAPIRLCKLALVDPKGKDKGKATKVKYLLKDNKKVRVARKSGSELDVNKK

  15. 77 FR 46631 - Television Broadcasting Services; Greenville, NC


    ...] Television Broadcasting Services; Greenville, NC AGENCY: Federal Communications Commission. ACTION: Final... acceptance of full power television rulemaking petitions requesting channel substitutions in May 2011, it... Subjects in 47 CFR Part 73 Television. Federal Communications Commission. Barbara A. Kreisman, Chief, Video...

  16. ORF Alignment: NC_005090 [GENIUS II[Archive

    Full Text Available NC_005090 gi|34558174 >1wcv1 4 239 4 244 2e-25 ... ref|NP_907989.1| SEPTUM SITE-DETERMINING...| SEPTUM ... SITE-DETERMINING PROTEIN MIND CELL DIVISION INHIBITOR ... MIND [Wolinella succino

  17. ORF Sequence: NC_003047 [GENIUS II[Archive

    Full Text Available NC_003047 gi|15965329 >gi|15965329|ref|NP_385682.1| PROBABLE CARBAMOYL-PHOSPHATE SYNTHASE LARGE CHAIN (AMMO...NIA CHAIN ARGININE BIOSYNTHESIS) PROTEIN [Sinorhizobium meliloti 1021] MPKRQDIKSILI

  18. ORF Sequence: NC_001134 [GENIUS II[Archive

    Full Text Available ivery of heterogeneous nuclear ribonucleoproteins to the nucleoplasm, binds rg-nucl... NC_001134 gi|6319491 >gi|6319491|ref|NP_009573.1| Transportin, cytosolic karyopherin beta 2 involved in del

  19. BChPT x 1/Nc: masses and currents

    Goity, Jose L. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Hampton Univ., Hampton, VA (United States); Fernando, Ishara P. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Hampton Univ., Hampton, VA (United States)


    A summary of the implementation of the combined BChPT X 1/Nc expansion for three flavors is presented, along with its applications to the octet and decuplet baryon masses, SU(3) charges and axial couplings.

  20. ORF Alignment: NC_003919 [GENIUS II[Archive

    Full Text Available NC_003919 gi|21242752 >1iwlA 2 180 23 207 3e-47 ... gb|AAM36870.1| outer-membrane lipoproteins... ... outer-membrane lipoproteins carrier protein precursor ... [Xanthomonas axonopodis pv. citr

  1. ORF Alignment: NC_006370 [GENIUS II[Archive

    Full Text Available NC_006370 gi|54308356 >1iwlA 4 181 22 199 2e-52 ... ref|YP_129376.1| hypothetical outer membrane lipoproteins... ... hypothetical outer membrane lipoproteins carrier protein ... [Photobacterium profundum] ... L

  2. ORF Sequence: NC_002655 [GENIUS II[Archive

    Full Text Available NC_002655 gi|15800754 >gi|15800754|ref|NP_286768.1| periplasmic protein effects translocation of lipoprotei...ns from inner membrane to outer [Escherichia coli O157:H7 EDL933] MMKKIAITCALLSSLVA

  3. ORF Sequence: NC_000913 [GENIUS II[Archive

    Full Text Available NC_000913 gi|16128858 >gi|16128858|ref|NP_415411.1| periplasmic chaperone effects translocation of lipoprot...eins from inner membrane to outer membrane [Escherichia coli K12] MMKKIAITCALLSSLVA

  4. ORF Sequence: NC_006905 [GENIUS II[Archive

    Full Text Available NC_006905 gi|62179485 >gi|62179485|ref|YP_215902.1| periplasmic protein effects translocation of lipoprotei...ns from inner membrane to outer membrane [Salmonella enterica subsp. enterica serov

  5. precision deburring using NC and robot equipment. Final report

    Gillespie, L.K.


    Deburring precision miniature components is often time consuming and inconsistent. Although robots are available for deburring parts, they are not precise enough for precision miniature parts. Numerical control (NC) machining can provide edge break consistencies to meet requirements such as maximum edge break (chamfer). Although NC machining has a number of technical limitations which prohibits its use on many geometries, it can be an effective approach to features that are particularly difficult to deburr.

  6. FDTD modeling of thin impedance sheets

    Luebbers, Raymond J.; Kunz, Karl S.


    Thin sheets of resistive or dielectric material are commonly encountered in radar cross section calculations. Analysis of such sheets is simplified by using sheet impedances. In this paper it is shown that sheet impedances can be modeled easily and accurately using Finite Difference Time Domain (FDTD) methods.

  7. On Jovian plasma sheet structure

    Khurana, K.K.; Kivelson, M.G.


    The authors evaluate several models of Jovian plasma sheet structure by determining how well they organize several aspects of the observed Voyager 2 magnetic field characteristics as a function of Jovicentric radial distance. It is shown that in the local time sector of the Voyager 2 outbound pass (near 0300 LT) the published hinged-magnetodisc models with wave (i.e., models corrected for finite wave velocity effects) are more successful than the published magnetic anomaly model in predicting locations of current sheet crossings. They also consider the boundary between the plasma sheet and the magnetotail lobe which is expected to vary slowly with radial distance. They use this boundary location as a further test of the models of the magnetotail. They show that the compressional MHD waves have much smaller amplitude in the lobes than in the plasma sheet and use this criterion to refine the identification of the plasma-sheet-lobe boundary. When the locations of crossings into and out of the lobes are examined, it becomes evident that the magnetic-anomaly model yields a flaring plasma sheet with a halfwidth of ∼ 3 R J at a radial distance of 20 R J and ∼ 12 R J at a radial distance of 100 R J . The hinged-magnetodisc models with wave, on the other hand, predict a halfwidth of ∼ 3.5 R J independent of distance beyond 20 R J . New optimized versions of the two models locate both the current sheet crossings and lobe encounters equally successfully. The optimized hinged-magnetodisc model suggests that the wave velocity decreases with increasing radial distance. The optimized magnetic anomaly model yields lower velocity contrast than the model of Vasyliunas and Dessler (1981)

  8. Automobile sheet metal part production with incremental sheet forming

    İsmail DURGUN


    Full Text Available Nowadays, effect of global warming is increasing drastically so it leads to increased interest on energy efficiency and sustainable production methods. As a result of adverse conditions, national and international project platforms, OEMs (Original Equipment Manufacturers, SMEs (Small and Mid-size Manufacturers perform many studies or improve existing methodologies in scope of advanced manufacturing techniques. In this study, advanced manufacturing and sustainable production method "Incremental Sheet Metal Forming (ISF" was used for sheet metal forming process. A vehicle fender was manufactured with or without die by using different toolpath strategies and die sets. At the end of the study, Results have been investigated under the influence of method and parameters used.Keywords: Template incremental sheet metal, Metal forming

  9. Structural studies of n-type nc-Si-QD thin films for nc-Si solar cells

    Das, Debajyoti; Kar, Debjit


    A wide optical gap nanocrystalline silicon (nc-Si) dielectric material is a basic requirement at the n-type window layer of nc-Si solar cells in thin film n-i-p structure on glass substrates. Taking advantage of the high atomic-H density inherent to the planar inductively coupled low-pressure (SiH4 + CH4)-plasma, development of an analogous material in P-doped nc-Si-QD/a-SiC:H network has been tried. Incorporation of C in the Si-network extracted from the CH4 widens the optical band gap; however, at enhanced PH3-dilution of the plasma spontaneous miniaturization of the nc-Si-QDs below the dimension of Bohr radius (∼4.5 nm) further enhances the band gap by virtue of the quantum size effect. At increased flow rate of PH3, dopant induced continuous amorphization of the intrinsic crystalline network is counterbalanced by the further crystallization promoted by the supplementary atomic-H extracted from PH3 (1% in H2) in the plasma, eventually holding a moderately high degree of crystallinity. The n-type wide band gap (∼1.93 eV) window layer with nc-Si-QDs in adequate volume fraction (∼52%) could furthermore be instrumental as an effective seed layer for advancing sequential crystallization in the i-layer of nc-Si solar cells with n-i-p structure in superstrate configuration.

  10. Uranium mining sites - Thematic sheets


    A first sheet proposes comments, data and key numbers about uranium extraction in France: general overview of uranium mining sites, status of waste rock and tailings after exploitation, site rehabilitation. The second sheet addresses the sources of exposure to ionizing radiations due to ancient uranium mining sites: discussion on the identification of these sources associated with these sites, properly due to mining activities or to tailings, or due to the transfer of radioactive substances towards water and to the contamination of sediments, description of the practice and assessment of radiological control of mining sites. A third sheet addresses the radiological exposure of public to waste rocks, and the dose assessment according to exposure scenarios: main exposure ways to be considered, studied exposure scenarios (passage on backfilled path and grounds, stay in buildings built on waste rocks, keeping mineralogical samples at home). The fourth sheet addresses research programmes of the IRSN on uranium and radon: epidemiological studies (performed on mine workers; on French and on European cohorts, French and European studies on the risk of lung cancer associated with radon in housing), study of the biological effects of chronic exposures. The last sheet addresses studies and expertises performed by the IRSN on ancient uranium mining sites in France: studies commissioned by public authorities, radioactivity control studies performed by the IRSN about mining sites, participation of the IRSN to actions to promote openness to civil society

  11. Improving Earth Science Metadata: Modernizing ncISO

    O'Brien, K.; Schweitzer, R.; Neufeld, D.; Burger, E. F.; Signell, R. P.; Arms, S. C.; Wilcox, K.


    ncISO is a package of tools developed at NOAA's National Center for Environmental Information (NCEI) that facilitates the generation of ISO 19115-2 metadata from NetCDF data sources. The tool currently exists in two iterations: a command line utility and a web-accessible service within the THREDDS Data Server (TDS). Several projects, including NOAA's Unified Access Framework (UAF), depend upon ncISO to generate the ISO-compliant metadata from their data holdings and use the resulting information to populate discovery tools such as NCEI's ESRI Geoportal and NOAA's CKAN system. In addition to generating ISO 19115-2 metadata, the tool calculates a rubric score based on how well the dataset follows the Attribute Conventions for Dataset Discovery (ACDD). The result of this rubric calculation, along with information about what has been included and what is missing is displayed in an HTML document generated by the ncISO software package. Recently ncISO has fallen behind in terms of supporting updates to conventions such updates to the ACDD. With the blessing of the original programmer, NOAA's UAF has been working to modernize the ncISO software base. In addition to upgrading ncISO to utilize version1.3 of the ACDD, we have been working with partners at Unidata and IOOS to unify the tool's code base. In essence, we are merging the command line capabilities into the same software that will now be used by the TDS service, allowing easier updates when conventions such as ACDD are updated in the future. In this presentation, we will discuss the work the UAF project has done to support updated conventions within ncISO, as well as describe how the updated tool is helping to improve metadata throughout the earth and ocean sciences.

  12. Root-growth-inhibiting sheet

    Burton, F.G.; Cataldo, D.A.; Cline, J.F.; Skiens, W.E.; Van Voris, P.


    In accordance with this invention, a porous sheet material is provided at intervals with bodies of a polymer which contain a 2,6-dinitroaniline. The sheet material is made porous to permit free passage of water. It may be either a perforated sheet or a woven or non-woven textile material. A particularly desirable embodiment is a non-woven fabric of non-biodegradable material. This type of material is known as a geotextile'' and is used for weed control, prevention of erosion on slopes, and other landscaping purposes. In order to obtain a root repelling property, a dinitroaniline is blended with a polymer which is attached to the geotextile or other porous material.

  13. Optimal swimming of a sheet.

    Montenegro-Johnson, Thomas D; Lauga, Eric


    Propulsion at microscopic scales is often achieved through propagating traveling waves along hairlike organelles called flagella. Taylor's two-dimensional swimming sheet model is frequently used to provide insight into problems of flagellar propulsion. We derive numerically the large-amplitude wave form of the two-dimensional swimming sheet that yields optimum hydrodynamic efficiency: the ratio of the squared swimming speed to the rate-of-working of the sheet against the fluid. Using the boundary element method, we show that the optimal wave form is a front-back symmetric regularized cusp that is 25% more efficient than the optimal sine wave. This optimal two-dimensional shape is smooth, qualitatively different from the kinked form of Lighthill's optimal three-dimensional flagellum, not predicted by small-amplitude theory, and different from the smooth circular-arc-like shape of active elastic filaments.

  14. Root-growth-inhibiting sheet

    Burton, Frederick G.; Cataldo, Dominic A.; Cline, John F.; Skiens, W. Eugene; Van Voris, Peter


    In accordance with this invention, a porous sheet material is provided at intervals with bodies of a polymer which contain a 2,6-dinitroaniline. The sheet material is made porous to permit free passage of water. It may be either a perforated sheet or a woven or non-woven textile material. A particularly desirable embodiment is a non-woven fabric of non-biodegradable material. This type of material is known as a "geotextile" and is used for weed control, prevention of erosion on slopes, and other landscaping purposes. In order to obtain a root repelling property, a dinitroaniline is blended with a polymer which is attached to the geotextile or other porous material.

  15. Ice sheet hydrology - a review

    Jansson, Peter; Naeslund, Jens-Ove [Dept. of Physical Geography and Quaternary Geology, Stockholm Univ., Stockholm (Sweden); Rodhe, Lars [Geological Survey of Sweden, Uppsala (Sweden)


    This report summarizes the theoretical knowledge on water flow in and beneath glaciers and ice sheets and how these theories are applied in models to simulate the hydrology of ice sheets. The purpose is to present the state of knowledge and, perhaps more importantly, identify the gaps in our understanding of ice sheet hydrology. Many general concepts in hydrology and hydraulics are applicable to water flow in glaciers. However, the unique situation of having the liquid phase flowing in conduits of the solid phase of the same material, water, is not a commonly occurring phenomena. This situation means that the heat exchange between the phases and the resulting phase changes also have to be accounted for in the analysis. The fact that the solidus in the pressure-temperature dependent phase diagram of water has a negative slope provides further complications. Ice can thus melt or freeze from both temperature and pressure variations or variations in both. In order to provide details of the current understanding of water flow in conjunction with deforming ice and to provide understanding for the development of ideas and models, emphasis has been put on the mathematical treatments, which are reproduced in detail. Qualitative results corroborating theory or, perhaps more often, questioning the simplifications made in theory, are also given. The overarching problem with our knowledge of glacier hydrology is the gap between the local theories of processes and the general flow of water in glaciers and ice sheets. Water is often channelized in non-stationary conduits through the ice, features which due to their minute size relative to the size of glaciers and ice sheets are difficult to incorporate in spatially larger models. Since the dynamic response of ice sheets to global warming is becoming a key issue in, e.g. sea-level change studies, the problems of the coupling between the hydrology of an ice sheet and its dynamics is steadily gaining interest. New work is emerging

  16. Modelling the Antarctic Ice Sheet

    Pedersen, Jens Olaf Pepke; Holm, A.


    to sea level high stands during past interglacial periods. A number of AIS models have been developed and applied to try to understand the workings of the AIS and to form a robust basis for future projections of the AIS contribution to sea level change. The recent DCESS (Danish Center for Earth System......The Antarctic ice sheet is a major player in the Earth’s climate system and is by far the largest depository of fresh water on the planet. Ice stored in the Antarctic ice sheet (AIS) contains enough water to raise sea level by about 58 m, and ice loss from Antarctica contributed significantly...

  17. Ice sheet hydrology - a review

    Jansson, Peter; Naeslund, Jens-Ove; Rodhe, Lars


    This report summarizes the theoretical knowledge on water flow in and beneath glaciers and ice sheets and how these theories are applied in models to simulate the hydrology of ice sheets. The purpose is to present the state of knowledge and, perhaps more importantly, identify the gaps in our understanding of ice sheet hydrology. Many general concepts in hydrology and hydraulics are applicable to water flow in glaciers. However, the unique situation of having the liquid phase flowing in conduits of the solid phase of the same material, water, is not a commonly occurring phenomena. This situation means that the heat exchange between the phases and the resulting phase changes also have to be accounted for in the analysis. The fact that the solidus in the pressure-temperature dependent phase diagram of water has a negative slope provides further complications. Ice can thus melt or freeze from both temperature and pressure variations or variations in both. In order to provide details of the current understanding of water flow in conjunction with deforming ice and to provide understanding for the development of ideas and models, emphasis has been put on the mathematical treatments, which are reproduced in detail. Qualitative results corroborating theory or, perhaps more often, questioning the simplifications made in theory, are also given. The overarching problem with our knowledge of glacier hydrology is the gap between the local theories of processes and the general flow of water in glaciers and ice sheets. Water is often channelized in non-stationary conduits through the ice, features which due to their minute size relative to the size of glaciers and ice sheets are difficult to incorporate in spatially larger models. Since the dynamic response of ice sheets to global warming is becoming a key issue in, e.g. sea-level change studies, the problems of the coupling between the hydrology of an ice sheet and its dynamics is steadily gaining interest. New work is emerging

  18. Sheet Beam Klystron Instability Analysis

    Bane, K.


    Using the principle of energy balance we develop a 2D theory for calculating growth rates of instability in a two-cavity model of a sheet beam klystron. An important ingredient is a TE-like mode in the gap that also gives a longitudinal kick to the beam. When compared with a self-consistent particle-in-cell calculation, with sheet beam klystron-type parameters, agreement is quite good up to half the design current, 65 A; at full current, however, other, current-dependent effects come in and the results deviate significantly

  19. The social balance sheet 2004

    Ph. Delhez; P. Heuse


    Each year, in the 4th quarter’s Economic Review, the National Bank examines the provisional results of the social balance sheets. As all the social balance sheets are not yet available for 2004, the study is based on a limited population of enterprises, compiled according to the principle of a constant sample. This population is made up of 38,530 enterprises employing around 1,331,000 workers in 2004. The main results of the analysis, in terms of employment, working hours, labour cost and tra...

  20. An overview on STEP-NC compliant controller development

    Othman, M. A.; Minhat, M.; Jamaludin, Z.


    The capabilities of conventional Computer Numerical Control (CNC) machine tools as termination organiser to fabricate high-quality parts promptly, economically and precisely are undeniable. To date, most CNCs follow the programming standard of ISO 6983, also called G & M code. However, in fluctuating shop floor environment, flexibility and interoperability of current CNC system to react dynamically and adaptively are believed still limited. This outdated programming language does not explicitly relate to each other to have control of arbitrary locations other than the motion of the block-by-block. To address this limitation, new standard known as STEP-NC was developed in late 1990s and is formalized as an ISO 14649. It adds intelligence to the CNC in term of interoperability, flexibility, adaptability and openness. This paper presents an overview of the research work that have been done in developing a STEP-NC controller standard and the capabilities of STEP-NC to overcome modern manufacturing demands. Reviews stated that most existing STEP-NC controller prototypes are based on type 1 and type 2 implementation levels. There are still lack of effort being done to develop type 3 and type 4 STEP-NC compliant controller.

  1. Learning from Balance Sheet Visualization

    Tanlamai, Uthai; Soongswang, Oranuj


    This exploratory study examines alternative visuals and their effect on the level of learning of balance sheet users. Executive and regular classes of graduate students majoring in information technology in business were asked to evaluate the extent of acceptance and enhanced capability of these alternative visuals toward their learning…

  2. Off-Balance Sheet Financing.

    Adams, Matthew C.


    Examines off-balance sheet financing, the facilities use of outsourcing for selected needs, as a means of saving operational costs and using facility assets efficiently. Examples of using outside sources for energy supply and food services, as well as partnering with business for facility expansion are provided. Concluding comments address tax…

  3. Comparison of mechanical behavior of TiN, TiNC, CrN/TiNC, TiN/TiNC films on 9Cr18 steel by PVD

    Feng, Xingguo; Zhang, Yanshuai; Hu, Hanjun; Zheng, Yugang; Zhang, Kaifeng; Zhou, Hui


    TiN, TiNC, CrN/TiNC and TiN/TiNC films were deposited on 9Cr18 steel using magnetron sputtering technique. The morphology, composition, chemical state and crystalline structure of the films were observed and analyzed by X-ray photoelectron spectroscopy (XPS), X-ray diffraction (XRD) and scanning electron microscopy (SEM). Hardness and adhesion force were tested by nanoindentation and scratch tester, respectively. The friction and wear behavior of TiN, TiNC, CrN/TiNC and TiN/TiNC films sliding against GCr15 balls were investigated and compared synthetically using ball-on-disk tribometer. It was found that Tisbnd N, Tisbnd C, Tisbnd Nsbnd C and Csbnd C bonds were formed. The TiN/TiNC film was composed of TiN, TiC and TiNC phases. Hardness and adhesion force results indicated that although the TiN film possessed the highest hardness, its adhesion force was lowest among all the films. Tribological test results showed that the friction coefficient of TiN/TiNC was much lower than that of TiN and the wear rate decreases remarkably from 2.3 × 10-15 m3/Nm to 7.1 × 10-16 m3/Nm, which indicated the TiN/TiNC film has better wear resistance.

  4. Genetic testing for breast and ovarian cancer susceptibility: evaluating direct-to-consumer marketing--Atlanta, Denver, Raleigh-Durham, and Seattle, 2003.


    Breast and ovarian cancer are the second and fifth leading causes of cancer death, respectively, among women in the United States. One in eight women will have breast cancer during their lifetimes, and one in 70 will have ovarian cancer. Mutations in two genes, BRCA1 and BRCA2 (BRCA1/2), are associated with predisposition for inherited breast and ovarian cancer and are identified in 5%-10% of women with breast or ovarian cancer (BOC). Since 1996, genetic testing for these mutations has been available clinically; however, population-based screening is not recommended because of the complexity of test interpretation and limited data on clinical validity and utility. Despite the test's limited applicability in the general population, the U.S. provider of clinical BRCA1/2 testing (Myriad Genetic Laboratories, Inc., Salt Lake City, Utah) conducted a pilot direct-to-consumer (DTC) marketing campaign in two cities (Atlanta, Georgia, and Denver, Colorado) during September 2002-February 2003. Although DTC advertisements have been used to raise consumer awareness about pharmaceuticals, this was the first time an established genetic test was marketed to the public. To assess the impact of the campaign on consumer behaviors and health-care provider practices, CDC and the respective state health departments for the pilot cities and two comparison cities (Raleigh-Durham, North Carolina, and Seattle, Washington) surveyed consumers and providers. This report summarizes results of those surveys, which indicated that consumer and provider awareness of BRCA1/2 testing increased in the pilot cities and that providers in these cities perceived an impact on their practice (e.g., more questions asked about testing, more BRCA1/2 tests requested, and more tests ordered). However, in all four cities, providers often lacked knowledge to advise patients about inherited BOC and testing. These findings underscore the need for evidence-based recommendations on appropriate use of genetic tests

  5. Whooping Cough (Pertussis) - Fact Sheet for Parents

    ... months 4 through 6 years Fact Sheet for Parents Color [2 pages] Español: Tosferina (pertussis) The best ... according to the recommended schedule. Fact Sheets for Parents Diseases and the Vaccines that Prevent Them Chickenpox ...

  6. 21 CFR 880.5180 - Burn sheet.


    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Burn sheet. 880.5180 Section 880.5180 Food and... Burn sheet. (a) Identification. A burn sheet is a device made of a porous material that is wrapped aroung a burn victim to retain body heat, to absorb wound exudate, and to serve as a barrier against...

  7. Manifold free multiple sheet superplastic forming

    Elmer, John W.; Bridges, Robert L.


    Fluid-forming compositions in a container attached to enclosed adjacent sheets are heated to relatively high temperatures to generate fluids (gases) that effect inflation of the sheets. Fluid rates to the enclosed space between the sheets can be regulated by the canal from the container. Inflated articles can be produced by a continuous, rather than batch-type, process.

  8. On the possible eigenoscillations of neutral sheets

    Almeida, W.A.; Costa, J.M. da; Aruquipa, E.G.; Sudano, J.P.


    A neutral sheet model with hyperbolic tangent equilibrium magnetic field and hyperbolic square secant density profiles is considered. It is shown that the equation for small oscillations takes the form of an eigenvalue oscillation problem. Computed eigenfrequencies of the geomagnetic neutral sheet were found to be in the range of the resonant frequencies of the geomagnetic plasma sheet computed by other authors

  9. Comparative Evaluation of Ultrafiltration/Microfiltration Membranes for Removal of Nitrocellulose (NC) Fines from Wastewater

    Kim, Byung


    .... In Phase II, a pilot-scale crossflow membrane filtration system was constructed to: (1) investigate the concentration polarization and fouling mechanism caused by NC fines during crossflow filtration of NC wastewater, (2...

  10. Synergistic enhancing effect of N+C alloying on cyclic deformation behaviors in austenitic steel

    Kang, J. [State Key Laboratory of Metastable Materials Science and Technology, Yanshan University, Qinhuangdao 066004 (China); Zhang, F.C., E-mail: [State Key Laboratory of Metastable Materials Science and Technology, Yanshan University, Qinhuangdao 066004 (China); Long, X.Y. [State Key Laboratory of Metastable Materials Science and Technology, Yanshan University, Qinhuangdao 066004 (China); Yang, Z.N. [National Engineering Research Center for Equipment and Technology of Cold Strip Rolling, Yanshan University, Qinhuangdao 066004 (China)


    Cyclic plastic and elastic strain controlled deformation behaviors of Mn18Cr7 austenitic steel with N0.6C0.3 synergistic enhancing alloying have been investigated using tension-compression low cycle fatigue and three-point bending high cycle fatigue testing. Results of cyclic deformation characteristic and fatigue damage mechanism have been compared to that in Mn12C1.2 steel. Mn18Cr7N0.6C0.3 steel always shows cyclic softening caused by enhanced planar sliding due to the interaction between N+C and the substitutional atoms as well as the dislocation, which is totally different from cyclic hardening in Mn12C1.2 steel caused by the interaction between C members of C–Mn couples with the dislocation. Enhanced effective stress is obtained due to the solid solution strengthening effect caused by the short range order at low strain amplitude while this effect does not work at high strain amplitude. Internal stress contributes most to the cyclic softening with the increase of strain amplitudes. Significant planar slip characteristic can be observed resulting from low stacking fault energy and high short range order effects in Mn18Cr7N0.6C0.3 steel and finally the parallel or intersecting thin sheets with dislocation tangles separated by dislocation free sheets are obtained with the prolonged cycles under cyclic elastic or plastic strain controlled fatigue testing. There exist amounts of small cracks on the surface of the Mn18Cr7N0.6C0.3 steel because fatigue crack initiation is promoted by the cyclic plastic strain localization. However, the zigzag configuration of the cracks reveals that the fatigue crack propagation is highly inhibited by the planar slip characteristic, which eventually improves the fatigue life.

  11. Geometry of thin liquid sheet flows

    Chubb, Donald L.; Calfo, Frederick D.; Mcconley, Marc W.; Mcmaster, Matthew S.; Afjeh, Abdollah A.


    Incompresible, thin sheet flows have been of research interest for many years. Those studies were mainly concerned with the stability of the flow in a surrounding gas. Squire was the first to carry out a linear, invicid stability analysis of sheet flow in air and compare the results with experiment. Dombrowski and Fraser did an experimental study of the disintegration of sheet flows using several viscous liquids. They also detected the formulation of holes in their sheet flows. Hagerty and Shea carried out an inviscid stability analysis and calculated growth rates with experimental values. They compared their calculated growth rates with experimental values. Taylor studied extensively the stability of thin liquid sheets both theoretically and experimentally. He showed that thin sheets in a vacuum are stable. Brown experimentally investigated thin liquid sheet flows as a method of application of thin films. Clark and Dumbrowski carried out second-order stability analysis for invicid sheet flows. Lin introduced viscosity into the linear stability analysis of thin sheet flows in a vacuum. Mansour and Chigier conducted an experimental study of the breakup of a sheet flow surrounded by high-speed air. Lin et al. did a linear stability analysis that included viscosity and a surrounding gas. Rangel and Sirignano carried out both a linear and nonlinear invisid stability analysis that applies for any density ratio between the sheet liquid and the surrounding gas. Now there is renewed interest in sheet flows because of their possible application as low mass radiating surfaces. The objective of this study is to investigate the fluid dynamics of sheet flows that are of interest for a space radiator system. Analytical expressions that govern the sheet geometry are compared with experimental results. Since a space radiator will operate in a vacuum, the analysis does not include any drag force on the sheet flow.

  12. Ice sheet hydrology from observations

    Jansson, Peter [Dept. of Physical Geography and Quaternary Geology, Stockholm Univ-, Stockholm (Sweden)


    The hydrological systems of ice sheets are complex. Our view of the system is split, largely due to the complexity of observing the systems. Our basic knowledge of processes have been obtained from smaller glaciers and although applicable in general to the larger scales of the ice sheets, ice sheets contain features not observable on smaller glaciers due to their size. The generation of water on the ice sheet surface is well understood and can be satisfactorily modeled. The routing of water from the surface down through the ice is not complicated in terms of procat has been problematic is the way in which the couplings between surface and bed has been accomplished through a kilometer of cold ice, but with the studies on crack propagation and lake drainage on Greenland we are beginning to understand also this process and we know water can be routed through thick cold ice. Water generation at the bed is also well understood but the main problem preventing realistic estimates of water generation is lack of detailed information about geothermal heat fluxes and their geographical distribution beneath the ice. Although some average value for geothermal heat flux may suffice, for many purposes it is important that such values are not applied to sub-regions of significantly higher fluxes. Water generated by geothermal heat constitutes a constant supply and will likely maintain a steady system beneath the ice sheet. Such a system may include subglacial lakes as steady features and reconfiguration of the system is tied to time scales on which the ice sheet geometry changes so as to change pressure gradients in the basal system itself. Large scale re-organization of subglacial drainage systems have been observed beneath ice streams. The stability of an entirely subglacially fed drainage system may hence be perturbed by rapid ice flow. In the case of Antarctic ice streams where such behavior has been observed, the ice streams are underlain by deformable sediments. It is

  13. Periodic folding of viscous sheets

    Ribe, Neil M.


    The periodic folding of a sheet of viscous fluid falling upon a rigid surface is a common fluid mechanical instability that occurs in contexts ranging from food processing to geophysics. Asymptotic thin-layer equations for the combined stretching-bending deformation of a two-dimensional sheet are solved numerically to determine the folding frequency as a function of the sheet’s initial thickness, the pouring speed, the height of fall, and the fluid properties. As the buoyancy increases, the system bifurcates from “forced” folding driven kinematically by fluid extrusion to “free” folding in which viscous resistance to bending is balanced by buoyancy. The systematics of the numerically predicted folding frequency are in good agreement with laboratory experiments.

  14. Ice sheet hydrology from observations

    Jansson, Peter


    The hydrological systems of ice sheets are complex. Our view of the system is split, largely due to the complexity of observing the systems. Our basic knowledge of processes have been obtained from smaller glaciers and although applicable in general to the larger scales of the ice sheets, ice sheets contain features not observable on smaller glaciers due to their size. The generation of water on the ice sheet surface is well understood and can be satisfactorily modeled. The routing of water from the surface down through the ice is not complicated in terms of procat has been problematic is the way in which the couplings between surface and bed has been accomplished through a kilometer of cold ice, but with the studies on crack propagation and lake drainage on Greenland we are beginning to understand also this process and we know water can be routed through thick cold ice. Water generation at the bed is also well understood but the main problem preventing realistic estimates of water generation is lack of detailed information about geothermal heat fluxes and their geographical distribution beneath the ice. Although some average value for geothermal heat flux may suffice, for many purposes it is important that such values are not applied to sub-regions of significantly higher fluxes. Water generated by geothermal heat constitutes a constant supply and will likely maintain a steady system beneath the ice sheet. Such a system may include subglacial lakes as steady features and reconfiguration of the system is tied to time scales on which the ice sheet geometry changes so as to change pressure gradients in the basal system itself. Large scale re-organization of subglacial drainage systems have been observed beneath ice streams. The stability of an entirely subglacially fed drainage system may hence be perturbed by rapid ice flow. In the case of Antarctic ice streams where such behavior has been observed, the ice streams are underlain by deformable sediments. It is

  15. Load Test in Sheet Pile

    Luis Orlando Ibanez


    In this work, are discussed experiences in the use of mathematical modeling and testing in hydraulic engineering structures. For this purpose the results of load tests in sheet pile, evaluating horizontal and vertical deformations that occur in the same exposed. Comparisons between theoretical methods for calculating deformations and mathematical models based on the Finite Element Method are established. Finally, the coincidence between the numerical model and the results of the load test ful...

  16. Ohm's law for a current sheet

    Lyons, L. R.; Speiser, T. W.


    The paper derives an Ohm's law for single-particle motion in a current sheet, where the magnetic field reverses in direction across the sheet. The result is considerably different from the resistive Ohm's law often used in MHD studies of the geomagnetic tail. Single-particle analysis is extended to obtain a self-consistency relation for a current sheet which agrees with previous results. The results are applicable to the concept of reconnection in that the electric field parallel to the current is obtained for a one-dimensional current sheet with constant normal magnetic field. Dissipated energy goes directly into accelerating particles within the current sheet.

  17. ORF Alignment: NC_002678 [GENIUS II[Archive

    Full Text Available NC_002678 gi|13474471 >1gkpA 2 454 5 422 3e-10 ... ref|NP_106039.1| creatinine deamin...ase [Mesorhizobium loti MAFF303099] ... dbj|BAB51825.1| creatinine deaminase [Mesorhizobium loti ...

  18. ORF Alignment: NC_002570 [GENIUS II[Archive

    Full Text Available NC_002570 gi|15612789 >1v7zA 3 254 1 238 1e-53 ... dbj|BAB03945.1| creatinine amidohy...drolase [Bacillus halodurans C-125] ... ref|NP_241092.1| creatinine amidohydrolase [Bacillus ...

  19. ORF Alignment: NC_002952 [GENIUS II[Archive

    Full Text Available NC_002952 gi|49483221 >1pwgA 4 329 74 373 1e-38 ... ref|YP_040445.1| autolysis and me...thicillin resistant-related protein [Staphylococcus ... aureus subsp. aureus MRSA252] emb|CAG40034.1| autolysis

  20. ORF Alignment: NC_004461 [GENIUS II[Archive

    Full Text Available NC_004461 gi|27467672 >1pwgA 4 344 72 389 1e-36 ... ref|NP_764309.1| autolysis and me...thicillin resistant-related protein [Staphylococcus ... epidermidis ATCC 12228] gb|AAO04351.1| autolysis

  1. ORF Alignment: NC_003098 [GENIUS II[Archive

    Full Text Available NC_003098 gi|15902282 >1in4A 3 311 20 328 5e-98 ... ref|NP_357832.1| Branch migration of Holliday structures... [Streptococcus pneumoniae ... R6] gb|AAK99042.1| Branch migration of Holliday ... structures... [Streptococcus pneumoniae R6] pir||F97901 ... branch migration of Holliday structures

  2. ORF Alignment: NC_005363 [GENIUS II[Archive

    Full Text Available NC_005363 gi|42524871 >1tjlA 27 144 16 133 6e-10 ... ref|NP_970251.1| dnaK deletion s...uppressor protein [Bdellovibrio bacteriovorus HD100] ... emb|CAE78310.1| dnaK deletion suppressor pro

  3. ORF Alignment: NC_004463 [GENIUS II[Archive

    Full Text Available NC_004463 gi|27380945 >1tjlA 26 141 1 116 7e-32 ... ref|NP_772474.1| dnaK deletion su...ppressor protein [Bradyrhizobium japonicum USDA ... 110] dbj|BAC51099.1| dnaK deletion suppressor pro

  4. ORF Alignment: NC_003317 [GENIUS II[Archive

    Full Text Available ... regulator, internal deletion [Caulobacter crescentus ... CB15] pir||A87693 transcription regulato... NC_003317 gi|17988031 >1etoB 1 97 211 307 4e-07 ... ref|NP_422373.1| transcriptional regulator, internal delet...r, internal ... deletion [imported] - Caulobacter crescentus ... Len...ion [Caulobacter ... crescentus CB15] gb|AAK25541.1| transcriptional ...

  5. ORF Alignment: NC_002696 [GENIUS II[Archive

    Full Text Available ... regulator, internal deletion [Caulobacter crescentus ... CB15] pir||A87693 transcription regulato... NC_002696 gi|16127809 >1etoB 1 97 211 307 4e-07 ... ref|NP_422373.1| transcriptional regulator, internal delet...r, internal ... deletion [imported] - Caulobacter crescentus ... Len...ion [Caulobacter ... crescentus CB15] gb|AAK25541.1| transcriptional ...

  6. ORF Alignment: NC_002696 [GENIUS II[Archive

    Full Text Available NC_002696 gi|16124962 >1mgtA 4 167 79 239 2e-25 ... ref|NP_419526.1| ada regulatory protein, internal deletion... [Caulobacter crescentus ... CB15] gb|AAK22694.1| ada regulatory protein, internal ... deletio...n [Caulobacter crescentus CB15] pir||B87337 ada ... regulatory protein, internal deletion

  7. ORF Alignment: NC_002696 [GENIUS II[Archive

    Full Text Available NC_002696 gi|16124962 >1adn0 1 76 1 75 1e-17 ... ref|NP_419526.1| ada regulatory protein, internal deletion... [Caulobacter crescentus ... CB15] gb|AAK22694.1| ada regulatory protein, internal ... deletion... [Caulobacter crescentus CB15] pir||B87337 ada ... regulatory protein, internal deletion

  8. ORF Alignment: NC_004431 [GENIUS II[Archive

    Full Text Available NC_004431 gi|26247437 >1j9iA 1 68 1 68 7e-21 ... ref|NP_753477.1| Prophage Qin DNA packaging... protein NU1 homolog [Escherichia coli ... CFT073] gb|AAN80037.1| Prophage Qin DNA packaging ... ...teriophage ... 21] pir||A49849 DNA-packaging protein Nu1 - phage 21 ...

  9. ORF Alignment: NC_006905 [GENIUS II[Archive

    Full Text Available NC_006905 gi|62179784 >1j9iA 1 68 1 68 5e-21 ... ref|YP_216201.1| Gifsy-1 prophage DNA packaging... ... gb|AAX65120.1| Gifsy-1 prophage DNA packaging protein ... [Phage Gifsy-1] ... Length = 68 ... Q

  10. ORF Sequence: NC_001136 [GENIUS II[Archive

    Full Text Available NC_001136 gi|6320573 >gi|6320573|ref|NP_010653.1| Nucleolar protein involved in pre-rRNA processing; deplet...ion causes severely decreased 18S rRNA levels; Esf1p [Saccharomyces cerevisiae] MAG

  11. ORF Alignment: NC_006840 [GENIUS II[Archive

    Full Text Available NC_006840 gi|59712585 >1bxwA 8 170 21 215 9e-07 ... ref|NP_800205.1| accessory colonization... factor AcfA [Vibrio parahaemolyticus RIMD ... 2210633] dbj|BAC62038.1| accessory colonization

  12. ORF Alignment: NC_004605 [GENIUS II[Archive

    Full Text Available NC_004605 gi|28900550 >1bxwA 8 170 21 215 9e-07 ... ref|NP_800205.1| accessory colonization... factor AcfA [Vibrio parahaemolyticus RIMD ... 2210633] dbj|BAC62038.1| accessory colonization

  13. ORF Alignment: NC_002929 [GENIUS II[Archive

    Full Text Available NC_002929 gi|33592330 >1uynX 1 299 352 647 5e-40 ... ref|NP_879974.1| tracheal colonization... factor precursor [Bordetella pertussis Tohama ... I] emb|CAA08832.2| tracheal colonization fac...tor ... [Bordetella pertussis] emb|CAE41497.1| tracheal ... colonization factor precursor [Bor

  14. ORF Alignment: NC_003070 [GENIUS II[Archive

    Full Text Available NC_003070 gi|18397761 >1wocC 2 96 2 97 5e-15 ... ref|YP_063428.1| ssb1 [Campylobacter... ... gb|EAL55921.1| single-strand binding protein, putative ... [Campylobacter coli RM2228] gb|AAR29517.1| ssb1

  15. ORF Alignment: NC_003075 [GENIUS II[Archive

    Full Text Available NC_003075 gi|30692533 >3ullA 5 115 1 104 8e-18 ... ref|YP_063478.1| ssb1 [ jejuni] gb|AAR29567.1| ssb1 [Campylobacter ... jejuni] ... Length = 104 ... Query: 31 ... GQDSDVS

  16. ORF Alignment: NC_003282 [GENIUS II[Archive

    Full Text Available NC_003282 gi|17540144 >1n0rA 2 124 89 212 5e-26 ... gb|AAA96093.1| Feminization of xx and xo animals... ... homolog a, FEMinization of XX and XO animals FEM-1 ... (fem-1) [Caenorhabditis elegans] pir||

  17. ORF Alignment: NC_004605 [GENIUS II[Archive

    Full Text Available NC_004605 gi|28900808 >1l3wA 6 536 1265 1798 3e-11 ... ref|NP_800463.1| putative biofilm...-associated surface protein [Vibrio parahaemolyticus ... RIMD 2210633] dbj|BAC62296.1| putative biofilm

  18. ORF Sequence: NC_002655 [GENIUS II[Archive

    Full Text Available NC_002655 gi|15804385 >gi|15804385|ref|NP_290425.1| TDP-Fuc4NAc:lipidII transferase; synthesis of enterobac...terial common antigen (ECA) [Escherichia coli O157:H7 EDL933] MSLLQFSGLFVVWLLCTLFIA

  19. ORF Alignment: NC_003070 [GENIUS II[Archive

    Full Text Available NC_003070 gi|15221381 >1bq00 2 77 15 90 4e-20 ... ref|NP_177004.1| gravity-responsive... protein / altered response to gravity protein ... (ARG1) [Arabidopsis thaliana] gb|AAD13758.1| Altere

  20. ORF Alignment: NC_004463 [GENIUS II[Archive

    Full Text Available NC_004463 gi|27377041 >1xewY 1 130 1026 1153 2e-37 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta

  1. ORF Alignment: NC_000909 [GENIUS II[Archive

    Full Text Available NC_000909 gi|15669839 >1ii8A 3 194 4 202 2e-10 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta

  2. ORF Alignment: NC_000909 [GENIUS II[Archive

    Full Text Available NC_000909 gi|15669839 >1gxlA 2 204 475 685 1e-34 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta

  3. ORF Alignment: NC_003237 [GENIUS II[Archive

    Full Text Available NC_003237 gi|19075000 >1xewY 1 130 1026 1153 2e-37 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta

  4. ORF Alignment: NC_000909 [GENIUS II[Archive

    Full Text Available NC_000909 gi|15669839 >1xewY 1 130 1026 1153 2e-37 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus jannaschii ... DSM 2661] gb|AAB99663.1| chromosome segreta

  5. ORF Alignment: NC_002947 [GENIUS II[Archive

    Full Text Available 1| ... acyl-CoA dehydrogenase, ferrulic acid biotransformation ... protein, putative [Pseudomo...ransformation protein, ... putative [Pseudomonas putida KT2440] gb|AAN68958.... NC_002947 gi|26990069 >1u8vA 9 432 4 458 7e-34 ... ref|NP_745494.1| acyl-CoA dehydrogenase, ferrulic acid biot

  6. ORF Alignment: NC_002947 [GENIUS II[Archive

    Full Text Available NC_002947 gi|26990072 >1uzbA 37 513 3 472 6e-68 ... ref|NP_745497.1| vanillin dehydro...genase [Pseudomonas putida KT2440] gb|AAN68961.1| ... vanillin dehydrogenase [Pseudomonas putida KT24

  7. ORF Alignment: NC_004463 [GENIUS II[Archive

    Full Text Available NC_004463 gi|27381528 >1uzbA 40 515 6 475 3e-74 ... ref|NP_773057.1| vanillin: NAD ox...idoreductase [Bradyrhizobium japonicum USDA 110] ... dbj|BAC51682.1| vanillin: NAD oxidoreductase ...

  8. ORF Alignment: NC_004463 [GENIUS II[Archive

    Full Text Available NC_004463 gi|27377799 >1uzbA 40 515 5 474 3e-69 ... ref|NP_769328.1| vanillin: NAD ox...idoreductase [Bradyrhizobium japonicum USDA 110] ... dbj|BAC47953.1| vanillin: NAD oxidoreductase ...

  9. ORF Alignment: NC_002696 [GENIUS II[Archive

    Full Text Available NC_002696 gi|16126641 >1uzbA 58 515 12 462 8e-77 ... ref|NP_421205.1| vanillin dehydr...ogenase [Caulobacter crescentus CB15] gb|AAK24373.1| ... vanillin dehydrogenase [Caulobacter CB15] ... pir||A87547 vanillin dehydrogenase [imported] - ... Caulobacter crescentus ...

  10. ORF Alignment: NC_005090 [GENIUS II[Archive

    Full Text Available NC_005090 gi|34557929 >1kmoA 12 661 39 664 3e-52 ... ref|NP_907744.1| RECEPTOR Fe transport [Wolinella succinogenes DSM ... 1740] emb|CAE10644.1| RECEPTOR PRECURSOR-Most

  11. ORF Alignment: NC_006085 [GENIUS II[Archive

    Full Text Available NC_006085 gi|50842772 >1qr0A 1 205 2 202 3e-27 ... ref|YP_055999.1| biosurfactants pr...oduction protein [Propionibacterium acnes ... KPA171202] gb|AAT83041.1| biosurfactants production ...

  12. ORF Alignment: NC_000917 [GENIUS II[Archive

    Full Text Available NC_000917 gi|11498546 >1yozA 1 116 1 116 6e-47 ... pdb|1YOZ|B Chain B, Predicted Coding... Region Af0941 From Archaeoglobus Fulgidus ... pdb|1YOZ|A Chain A, Predicted Coding Region Af0941 F

  13. ORF Alignment: NC_003283 [GENIUS II[Archive

    Full Text Available NC_003283 gi|17561408 >1bor0 2 53 282 342 3e-04 ... ref|NP_757385.1| synoviolin 1 iso...form b [Homo sapiens] gb|AAH30530.1| Synoviolin 1, ... isoform b [Homo sapiens] ... Length = 61

  14. ORF Alignment: NC_006841 [GENIUS II[Archive

    Full Text Available NC_006841 gi|59714046 >1gntA 1 552 1 553 0.0 ... ref|YP_206821.1| hydroxylamine reduc...tase [Vibrio fischeri ES114] gb|AAW87933.1| ... hydroxylamine reductase [Vibrio fischeri ES114] ...

  15. ORF Alignment: NC_003228 [GENIUS II[Archive

    Full Text Available NC_003228 gi|60681683 >1gntA 1 551 3 543 0.0 ... emb|CAH07898.1| hydroxylamine reduct...ase [Bacteroides fragilis NCTC 9343] ... ref|YP_211827.1| hydroxylamine reductase [Bacteroides ...

  16. ORF Alignment: NC_000963 [GENIUS II[Archive

    Full Text Available NC_000963 gi|15604438 >1xvqA 17 163 47 203 4e-07 ... ref|NP_220956.1| SCO2 PROTEIN PRECURSOR (sco2...) [Rickettsia prowazekii str. Madrid E] ... emb|CAA15032.1| SCO2 PROTEIN PRECURSOR (sco2...) ... [Rickettsia prowazekii] pir||F71663 sco2 protein ... precursor (sco2) RP587 - Rickettsia

  17. ORF Alignment: NC_006142 [GENIUS II[Archive

    Full Text Available NC_006142 gi|51473766 >1xvqA 17 163 40 196 7e-07 ... ref|YP_067523.1| Sco2-like [Rickettsia typhi str. Wilmington] gb|AAU04041.1| ... Sco2-like protein [Rickettsia typhi str. Wil

  18. ORF Alignment: NC_003911 [GENIUS II[Archive

    Full Text Available NC_003911 gi|56698151 >1wy2A 3 347 27 396 7e-44 ... gb|AAV96554.1| creatinase [Silici...bacter pomeroyi DSS-3] ref|YP_168523.1| ... creatinase [Silicibacter pomeroyi DSS-3] ... Length

  19. ORF Alignment: NC_003366 [GENIUS II[Archive

    Full Text Available NC_003366 gi|18309739 >1v7zA 1 255 3 250 3e-61 ... dbj|BAB80463.1| creatinase [Clostr...idium perfringens str. 13] ref|NP_561673.1| ... creatinase [Clostridium perfringens str. 13] ...

  20. ORF Alignment: NC_002947 [GENIUS II[Archive

    Full Text Available NC_002947 gi|26990378 >1wy2A 3 347 23 393 2e-45 ... ref|NP_745803.1| creatinase [Pseu...domonas putida KT2440] gb|AAN69267.1| creatinase ... [Pseudomonas putida KT2440] ... Length = 3

  1. ORF Alignment: NC_003030 [GENIUS II[Archive

    Full Text Available NC_003030 gi|15895740 >1w3oA 13 174 5 153 2e-30 ... ref|NP_349089.1| Possible 5-Nitroimidazole antibiotics... ... gb|AAK80429.1| Possible 5-Nitroimidazole antibiotics ... resistance protein, NimA-family [Clost...ridium ... acetobutylicum ATCC 824] pir||B97205 probable ... 5-Nitroimidazole antibiotics

  2. ORF Alignment: NC_000964 [GENIUS II[Archive

    Full Text Available NC_000964 gi|16078891 >1jmkC 6 230 1056 1270 2e-59 ... ref|NP_389712.1| plipastatin s...ynthetase [Bacillus subtilis subsp. subtilis str. 168] ... emb|CAB13713.1| plipastatin synthetase [B

  3. ORF Alignment: NC_003921 [GENIUS II[Archive

    Full Text Available NC_003921 gi|21264213 >1ub4C 1 63 1 63 4e-10 ... gb|AAM39232.1| plasmid stable inheritance... protein I [Xanthomonas axonopodis pv. ... citri str. 306] ref|NP_644714.1| plasmid stable ... inheritance

  4. ORF Alignment: NC_002946 [GENIUS II[Archive

    Full Text Available NC_002946 gi|59800954 >1ub4B 4 109 2 113 3e-22 ... ref|YP_207666.1| putative plasmid stable inheritance... ... gb|AAW89254.1| putative plasmid stable inheritance ... protein putative phage associated prote

  5. ORF Alignment: NC_006370 [GENIUS II[Archive

    Full Text Available pothetical stbA Plasmid stable inheritance protein ... [Photobacterium profundum] ... Length = ... NC_006370 gi|54307287 >1mwmA 2 317 24 344 3e-96 ... ref|YP_128307.1| Hypothetical stbA Plasmid stable inherita...nce protein ... [Photobacterium profundum SS9] emb|CAG18505.1| ... Hy

  6. ORF Alignment: NC_003921 [GENIUS II[Archive

    Full Text Available NC_003921 gi|21264212 >1m1fA 1 109 2 110 1e-34 ... gb|AAM39231.1| plasmid stable inheritance... protein K [Xanthomonas axonopodis pv. ... citri str. 306] ref|NP_644713.1| plasmid stable ... inheritance

  7. ORF Alignment: NC_005791 [GENIUS II[Archive

    Full Text Available NC_005791 gi|45358156 >1wcv1 4 241 4 235 5e-21 ... ref|NP_987713.1| walker type ATPas...e [Methanococcus maripaludis S2] emb|CAF30149.1| ... walker type ATPase [Methanococcus maripaludis S2

  8. ORF Alignment: NC_004547 [GENIUS II[Archive

    Full Text Available NC_004547 gi|50121646 >1kmoA 14 661 37 705 8e-56 ... ref|YP_050813.1| exogenous ferri...c siderophore TonB-dependent receptor [Erwinia ... carotovora subsp. atroseptica SCRI1043] emb|CAG75622.1| ... exogenou

  9. ORF Alignment: NC_003305 [GENIUS II[Archive

    Full Text Available NC_003305 gi|17937619 >1kmoA 2 661 49 702 6e-54 ... ref|NP_534408.1| exogenous ferric... siderophore receptor [Agrobacterium tumefaciens ... str. C58] gb|AAL44724.1| exogenous ferric sidero...phore ... receptor [Agrobacterium tumefaciens str. C58] ... pir||AF3038 exogenous ferric sider

  10. ORF Alignment: NC_003063 [GENIUS II[Archive

    Full Text Available NC_003063 gi|15891046 >1kmoA 2 661 49 702 6e-54 ... ref|NP_534408.1| exogenous ferric... siderophore receptor [Agrobacterium tumefaciens ... str. C58] gb|AAL44724.1| exogenous ferric sidero...phore ... receptor [Agrobacterium tumefaciens str. C58] ... pir||AF3038 exogenous ferric sider

  11. ORF Alignment: NC_002927 [GENIUS II[Archive

    Full Text Available NC_002927 gi|33603734 >1kmoA 3 661 60 754 2e-50 ... ref|NP_891294.1| exogenous ferric... siderophore receptor [Bordetella bronchiseptica ... RB50] gb|AAB51774.1| exogenous ferric siderophor...e ... receptor emb|CAE35124.1| exogenous ferric siderophore ... receptor [Bordetella bronchise

  12. ORF Alignment: NC_005085 [GENIUS II[Archive

    Full Text Available NC_005085 gi|34497787 >1f39A 3 98 107 198 1e-23 ... gb|AAQ60004.1| SOS mutagenesis [C...hromobacterium violaceum ATCC 12472] ... ref|NP_902002.1| SOS mutagenesis [Chromobacterium ...

  13. ORF Alignment: NC_005861 [GENIUS II[Archive

    Full Text Available NC_005861 gi|46446610 >1f39A 5 95 55 141 1e-16 ... ref|YP_007975.1| probable SOS mutagenesis... and repair protein UmuD [Parachlamydia sp. ... UWE25] emb|CAF23700.1| probable SOS mutagenesis

  14. ORF Alignment: NC_005070 [GENIUS II[Archive

    Full Text Available NC_005070 gi|33865578 >1f39A 4 97 54 143 4e-22 ... ref|NP_897137.1| putative SOS mutagenesis... protein UmuD [Synechococcus sp. WH 8102] ... emb|CAE07559.1| putative SOS mutagenesis protein

  15. ORF Alignment: NC_003233 [GENIUS II[Archive

    Full Text Available NC_003233 gi|19074284 >1ltlE 10 233 29 251 7e-31 ... emb|CAD25394.1| DNA REPLICATION ...LICENSING FACTOR OF THE MCM FAMILY MCM5 ... [Encephalitozoon cuniculi GB-M1] ref|NP_585790.1| DNA ... REPLICATION

  16. ORF Alignment: NC_003236 [GENIUS II[Archive

    Full Text Available NC_003236 gi|19074669 >1ewiA 5 113 54 161 1e-18 ... emb|CAD25779.1| DNA REPLICATION F...ACTOR A PROTEIN 1 [Encephalitozoon cuniculi GB-M1] ... ref|NP_586175.1| DNA REPLICATION FACTOR A PROT

  17. ORF Alignment: NC_003238 [GENIUS II[Archive

    Full Text Available NC_003238 gi|19173253 >1a5t0 17 316 29 298 4e-25 ... emb|CAD27104.1| REPLICATION FACT...OR C (ACTIVATOR 1) 37kDa SUBUNIT [Encephalitozoon ... cuniculi GB-M1] ref|NP_597056.1| REPLICATION FA

  18. ORF Alignment: NC_003238 [GENIUS II[Archive

    Full Text Available NC_003238 gi|19173256 >1g8pA 7 311 329 597 1e-04 ... emb|CAD27107.1| DNA REPLICATION ...LICENSING FACTOR OF THE MCM FAMILY MCM7 ... [Encephalitozoon cuniculi GB-M1] ref|NP_597059.1| DNA ... REPLICATION

  19. ORF Alignment: NC_002945 [GENIUS II[Archive

    Full Text Available NC_002945 gi|31791180 >1ii8A 1 187 1 168 2e-14 ... ref|NP_853673.1| DNA REPLICATION A...D92865.1| ... DNA REPLICATION AND REPAIR PROTEIN RECF (SINGLE-STRAND ... DNA BINDING PROTEIN)

  20. ORF Alignment: NC_003238 [GENIUS II[Archive

    Full Text Available NC_003238 gi|19173256 >1ltlE 44 240 100 302 2e-23 ... emb|CAD27107.1| DNA REPLICATION... LICENSING FACTOR OF THE MCM FAMILY MCM7 ... [Encephalitozoon cuniculi GB-M1] ref|NP_597059.1| DNA ... REPLICATION

  1. ORF Alignment: NC_003364 [GENIUS II[Archive

    Full Text Available NC_003364 gi|18312259 >1g8pA 7 306 385 684 6e-05 ... emb|CAD25272.1| DNA REPLICATION ...LICENSING FACTOR MCM2 [Encephalitozoon cuniculi ... GB-M1] ref|NP_584768.1| DNA REPLICATION LICENSING

  2. ORF Alignment: NC_003236 [GENIUS II[Archive

    Full Text Available NC_003236 gi|19074669 >1jmcA 1 238 213 445 1e-62 ... emb|CAD25779.1| DNA REPLICATION ...FACTOR A PROTEIN 1 [Encephalitozoon cuniculi GB-M1] ... ref|NP_586175.1| DNA REPLICATION FACTOR A PRO

  3. ORF Alignment: NC_005787 [GENIUS II[Archive

    Full Text Available NC_005787 gi|45198873 >1g8pA 7 311 329 597 1e-04 ... emb|CAD27107.1| DNA REPLICATION ...LICENSING FACTOR OF THE MCM FAMILY MCM7 ... [Encephalitozoon cuniculi GB-M1] ref|NP_597059.1| DNA ... REPLICATION

  4. ORF Alignment: NC_002607 [GENIUS II[Archive

    Full Text Available NC_002607 gi|15791012 >1g8pA 7 306 385 684 6e-05 ... emb|CAD25272.1| DNA REPLICATION ...LICENSING FACTOR MCM2 [Encephalitozoon cuniculi ... GB-M1] ref|NP_584768.1| DNA REPLICATION LICENSING

  5. ORF Alignment: NC_003317 [GENIUS II[Archive

    Full Text Available NC_003317 gi|17987645 >1j1vA 4 94 20 109 8e-10 ... gb|AAL52543.1| CHROMOSOMAL REPLICATION... INITIATOR PROTEIN DNAA [Brucella melitensis ... 16M] ref|NP_540279.1| CHROMOSOMAL REPLICATION IN

  6. ORF Alignment: NC_003229 [GENIUS II[Archive

    Full Text Available NC_003229 gi|19074034 >1ltlE 2 242 49 290 7e-40 ... emb|CAD25144.1| DNA REPLICATION L...ICENSING FACTOR OF THE MCM FAMILY (MCM4) ... [Encephalitozoon cuniculi GB-M1] ref|NP_584640.1| DNA ... REPLICATION

  7. ORF Alignment: NC_003236 [GENIUS II[Archive

    Full Text Available NC_003236 gi|19074669 >1l1oC 2 175 456 623 1e-43 ... emb|CAD25779.1| DNA REPLICATION ...FACTOR A PROTEIN 1 [Encephalitozoon cuniculi GB-M1] ... ref|NP_586175.1| DNA REPLICATION FACTOR A PRO

  8. ORF Alignment: NC_003229 [GENIUS II[Archive

    Full Text Available NC_003229 gi|19073988 >1a5t0 2 324 6 283 2e-17 ... emb|CAD25098.1| DNA REPLICATION FA...CTOR (ACTIVATOR 1) 36 kDa SUBUNIT ... [Encephalitozoon cuniculi GB-M1] ref|NP_584594.1| DNA ... REPLICATION

  9. ORF Alignment: NC_003232 [GENIUS II[Archive

    Full Text Available NC_003232 gi|19173617 >1ltlE 7 224 22 242 3e-38 ... ref|NP_597420.1| DNA REPLICATION ...LICENSING FACTOR OF THE MCM FAMILY (MCM6) ... [Encephalitozoon cuniculi] emb|CAD26597.1| DNA ... REPLICATION

  10. Stepping Motor - Hydraulic Motor Servo Drives for an NC Milling ...

    In this paper the retrofit design of the control system of an NC milling machine with a stepping motor and stepping motor - actuated hydraulic motor servo mechanism on the machines X-axis is described. The servo designed in the course of this study was tested practically and shown to be linear - the velocity following errors ...

  11. ORF Alignment: NC_000117 [GENIUS II[Archive

    Full Text Available NC_000117 gi|15605324 >1jgmA 39 326 7 260 4e-33 ... ref|NP_220110.1| PHP superfamily hydrolase [Chlamydia trachomatis D/UW-3/CX] ... gb|AAC68196.1| PHP... ... trachomatis D/UW-3/CX] pir||G71494 probable php ... hydrolase - Chlamydia trachomatis (sero

  12. ORF Alignment: NC_003902 [GENIUS II[Archive

    Full Text Available NC_003902 gi|21229523 >1p6rA 5 81 4 80 4e-10 ... ref|NP_635440.1| methicillin resista...nce protein [Xanthomonas campestris pv. ... campestris str. ATCC 33913] gb|AAM39364.1| methicillin ...

  13. ORF Alignment: NC_006582 [GENIUS II[Archive

    Full Text Available NC_006582 gi|56962048 >1sd4A 2 99 6 103 1e-24 ... ref|YP_173770.1| methicillin resist...ance regulatory protein MecI [Bacillus clausii ... KSM-K16] dbj|BAD62809.1| methicillin resistance ...

  14. ORF Alignment: NC_003919 [GENIUS II[Archive

    Full Text Available NC_003919 gi|21240843 >1p6rA 5 81 4 80 8e-10 ... gb|AAM34961.1| methicillin resistanc...e protein [Xanthomonas axonopodis pv. citri ... str. 306] ref|NP_640425.1| methicillin resistance ...

  15. ORF Alignment: NC_002678 [GENIUS II[Archive

    Full Text Available NC_002678 gi|13472874 >1b4uB 49 289 86 299 5e-14 ... ref|NP_104441.1| encapsulation p...rotein CapA [Mesorhizobium loti MAFF303099] ... dbj|BAB50227.1| encapsulation protein; CapA ...

  16. ORF Alignment: NC_006177 [GENIUS II[Archive

    Full Text Available NC_006177 gi|51893967 >1b4uB 49 289 86 299 5e-14 ... ref|NP_104441.1| encapsulation p...rotein CapA [Mesorhizobium loti MAFF303099] ... dbj|BAB50227.1| encapsulation protein; CapA ...

  17. ORF Alignment: NC_002967 [GENIUS II[Archive

    Full Text Available NC_002967 gi|42528039 >1b4uB 49 289 86 299 5e-14 ... ref|NP_104441.1| encapsulation p...rotein CapA [Mesorhizobium loti MAFF303099] ... dbj|BAB50227.1| encapsulation protein; CapA ...

  18. ORF Alignment: NC_002945 [GENIUS II[Archive

    Full Text Available NC_002945 gi|31792055 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  19. ORF Alignment: NC_002945 [GENIUS II[Archive

    Full Text Available NC_002945 gi|31793631 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  20. ORF Alignment: NC_002755 [GENIUS II[Archive

    Full Text Available NC_002755 gi|15841974 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  1. ORF Alignment: NC_002755 [GENIUS II[Archive

    Full Text Available NC_002755 gi|15840280 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  2. ORF Alignment: NC_000962 [GENIUS II[Archive

    Full Text Available NC_000962 gi|15609587 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  3. ORF Alignment: NC_003155 [GENIUS II[Archive

    Full Text Available NC_003155 gi|29830077 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  4. ORF Alignment: NC_000962 [GENIUS II[Archive

    Full Text Available NC_000962 gi|15608007 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  5. ORF Alignment: NC_004331 [GENIUS II[Archive

    Full Text Available NC_004331 gi|23619306 >1wfiA 3 125 209 328 1e-34 ... ref|NP_705268.1| nuclear movement... protein, putative [Plasmodium falciparum 3D7] ... emb|CAD52505.1| nuclear movement protein, putativ

  6. ORF Alignment: NC_003071 [GENIUS II[Archive

    Full Text Available NC_003071 gi|18403860 >1rl1A 4 90 215 300 7e-09 ... ref|NP_705268.1| nuclear movement... protein, putative [Plasmodium falciparum 3D7] ... emb|CAD52505.1| nuclear movement protein, putative

  7. Large-Nc quantum chromodynamics and harmonic sums


    Jun 8, 2012 ... This has led us to consider a class of analytic number theory .... The self-energy function LR(Q2) in the chiral limit vanishes order by order in QCD ... the 1/Nc expansion, the Goldstone loop corrections are subleading and, ...

  8. ORF Alignment: NC_004310 [GENIUS II[Archive

    Full Text Available NC_004310 gi|23502014 >1y7mA 26 161 48 214 1e-16 ... gb|AAL52029.1| PROBABLE CARNITINE... OPERON OXIDOREDUCTASE CAIA [Brucella melitensis ... 16M] ref|NP_539765.1| PROBABLE CARNITINE OPERON

  9. ORF Alignment: NC_003317 [GENIUS II[Archive

    Full Text Available NC_003317 gi|17987131 >1y7mA 26 161 48 214 1e-16 ... gb|AAL52029.1| PROBABLE CARNITINE... OPERON OXIDOREDUCTASE CAIA [Brucella melitensis ... 16M] ref|NP_539765.1| PROBABLE CARNITINE OPERON

  10. ORF Alignment: NC_002771 [GENIUS II[Archive

    Full Text Available NC_002771 gi|15829246 >1nm8A 15 579 43 592 3e-82 ... ref|NP_326606.1| CARNITINE O-ACE...TYLTRANSFERASE [Mycoplasma pulmonis UAB CTIP] ... emb|CAC13948.1| CARNITINE O-ACETYLTRANSFERASE ...

  11. ORF Alignment: NC_002655 [GENIUS II[Archive

    Full Text Available f|NP_289264.1| PTS system enzyme II ABC (asc), ... cryptic, transports specific beta-glucosides ... ...ABC (asc), cryptic, transports specific ... beta-glucosides [Escherichia coli O157:H7 EDL933] ... ... NC_002655 gi|15803232 >1iba0 1 77 8 85 7e-10 ... gb|AAG57822.1| PTS system enzyme II

  12. ORF Alignment: NC_006370 [GENIUS II[Archive

    Full Text Available NC_006370 gi|54310050 >1r0wC 43 281 30 288 6e-50 ... ref|YP_131070.1| putative ABC-type oligopeptide transport...putative ... ABC-type oligopeptide transportsystem, ATPase component ... [Photobacterium profu

  13. ORF Alignment: NC_006370 [GENIUS II[Archive

    Full Text Available NC_006370 gi|54310056 >1r0wC 45 273 39 283 1e-54 ... ref|YP_131076.1| putative ABC-type metal ion transports...ative ... ABC-type metal ion transportsystem, ATPase component ... [Photobacterium profundum

  14. ORF Alignment: NC_000913 [GENIUS II[Archive

    Full Text Available f|NP_289264.1| PTS system enzyme II ABC (asc), ... cryptic, transports specific beta-glucosides ... ...ABC (asc), cryptic, transports specific ... beta-glucosides [Escherichia coli O157:H7 EDL933] ... ... NC_000913 gi|49176263 >1iba0 1 77 8 85 7e-10 ... gb|AAG57822.1| PTS system enzyme II

  15. ORF Alignment: NC_002695 [GENIUS II[Archive

    Full Text Available f|NP_289264.1| PTS system enzyme II ABC (asc), ... cryptic, transports specific beta-glucosides ... ...ABC (asc), cryptic, transports specific ... beta-glucosides [Escherichia coli O157:H7 EDL933] ... ... NC_002695 gi|15832825 >1iba0 1 77 8 85 7e-10 ... gb|AAG57822.1| PTS system enzyme II

  16. ORF Alignment: NC_006361 [GENIUS II[Archive

    Full Text Available NC_006361 gi|54022220 >1y7yA 7 68 12 73 3e-05 ... ref|YP_132230.1| hypotethical trans...criptional regulator [Photobacterium profundum ... SS9] emb|CAG22430.1| hypotethical transcriptional ...

  17. ORF Alignment: NC_002758 [GENIUS II[Archive

    Full Text Available NC_002758 gi|15923033 >1sd4A 3 117 7 121 9e-28 ... dbj|BAB56205.1| methicillin resist...ance regulatory protein [Staphylococcus aureus ... subsp. aureus Mu50] sp|Q932L5|MECI_STAAM ... resistance regulatory protein mecI ref|NP_370567.1| ... methicillin resistance regulato

  18. ORF Alignment: NC_002506 [GENIUS II[Archive

    Full Text Available NC_002506 gi|15600953 >1cqxA 1 398 1 388 e-107 ... gb|AAF96096.1| ferrisiderophore re...ductase [Vibrio cholerae O1 biovar eltor str. ... N16961] ref|NP_232583.1| ferrisiderophore reductase... ... [Vibrio cholerae O1 biovar eltor str. N16961] ... pir||F82491 ferrisiderophore reductase

  19. ORF Alignment: NC_000913 [GENIUS II[Archive

    Full Text Available outer ... membrane receptor for iron transport; outer membrane ... porin protein, putative ferris...porin protein, putative ferrisiderophore receptor ... [Escherichia coli K12] gb|AAC73892.1| putative ... NC_000913 gi|16128773 >1kmoA 12 661 63 760 6e-50 ... ref|NP_415326.1| outer membrane

  20. ORF Alignment: NC_002928 [GENIUS II[Archive

    Full Text Available NC_002928 gi|33596933 >1kmoA 7 661 65 702 8e-60 ... ref|NP_884576.1| putative ferrisi...derophore receptor [Bordetella parapertussis 12822] ... emb|CAE37631.1| putative ferrisiderophore rec

  1. ORF Alignment: NC_002929 [GENIUS II[Archive

    Full Text Available NC_002929 gi|33592999 >1kmoA 7 661 65 702 1e-60 ... ref|NP_880643.1| putative ferrisi...derophore receptor [Bordetella pertussis Tohama I] ... emb|CAE42244.1| putative ferrisiderophore rece

  2. ORF Alignment: NC_003143 [GENIUS II[Archive

    Full Text Available NC_003143 gi|16121259 >1kmoA 5 661 44 699 5e-70 ... emb|CAC89799.1| putative hydroxamate-type ferris...iderophore receptor [Yersinia ... pestis CO92] ref|NP_404572.1| putative hydroxamate-type ... ferris...iderophore receptor [Yersinia pestis CO92] ... pir||AD0117 probable hydroxamate-type ferris

  3. ORF Alignment: NC_006677 [GENIUS II[Archive

    Full Text Available NC_006677 gi|58039110 >1kmoA 11 661 79 730 2e-52 ... ref|YP_191074.1| Hydroxamate-type ferris...iderophore receptor [Gluconobacter oxydans ... 621H] gb|AAW60418.1| Hydroxamate-type ferrisid

  4. ORF Alignment: NC_003063 [GENIUS II[Archive

    Full Text Available NC_003063 gi|15890948 >1kmoA 11 661 74 716 3e-76 ... ref|NP_534507.1| hydroxamate-type ferris...iderophore receptor [Agrobacterium ... tumefaciens str. C58] gb|AAL44823.1| hydroxamate-type ... ferris...iderophore receptor [Agrobacterium tumefaciens ... str. C58] pir||AI3050 hydroxamate-type ferris

  5. ORF Alignment: NC_005810 [GENIUS II[Archive

    Full Text Available NC_005810 gi|45443224 >1kmoA 5 661 44 699 5e-70 ... emb|CAC89799.1| putative hydroxamate-type ferris...iderophore receptor [Yersinia ... pestis CO92] ref|NP_404572.1| putative hydroxamate-type ... ferris...iderophore receptor [Yersinia pestis CO92] ... pir||AD0117 probable hydroxamate-type ferris

  6. ORF Alignment: NC_002927 [GENIUS II[Archive

    Full Text Available NC_002927 gi|33600770 >1kmoA 7 661 65 702 2e-60 ... ref|NP_888330.1| putative ferrisi...derophore receptor [Bordetella bronchiseptica RB50] ... emb|CAE32282.1| putative ferrisiderophore rec

  7. ORF Alignment: NC_004088 [GENIUS II[Archive

    Full Text Available NC_004088 gi|22127219 >1kmoA 5 661 44 699 5e-70 ... emb|CAC89799.1| putative hydroxamate-type ferris...iderophore receptor [Yersinia ... pestis CO92] ref|NP_404572.1| putative hydroxamate-type ... ferris...iderophore receptor [Yersinia pestis CO92] ... pir||AD0117 probable hydroxamate-type ferris

  8. ORF Alignment: NC_006677 [GENIUS II[Archive

    Full Text Available NC_006677 gi|58039006 >1kmoA 12 661 92 773 1e-43 ... ref|YP_190970.1| Hydroxamate-type ferris...iderophore receptor [Gluconobacter oxydans ... 621H] gb|AAW60314.1| Hydroxamate-type ferrisid

  9. ORF Alignment: NC_003305 [GENIUS II[Archive

    Full Text Available NC_003305 gi|17937718 >1kmoA 11 661 74 716 3e-76 ... ref|NP_534507.1| hydroxamate-type ferris...iderophore receptor [Agrobacterium ... tumefaciens str. C58] gb|AAL44823.1| hydroxamate-type ... ferris...iderophore receptor [Agrobacterium tumefaciens ... str. C58] pir||AI3050 hydroxamate-type ferris

  10. ORF Alignment: NC_003888 [GENIUS II[Archive

    Full Text Available NC_003888 gi|21225320 >1k12A 3 151 580 722 8e-15 ... dbj|BAC69434.1| putative [Streptomyces avermitilis MA-4680] ... ref|NP_822899.1| putative mycodextranase [Streptomyces

  11. ORF Alignment: NC_003888 [GENIUS II[Archive

    Full Text Available NC_003888 gi|21225300 >1k12A 3 151 580 722 8e-15 ... dbj|BAC69434.1| putative [Streptomyces avermitilis MA-4680] ... ref|NP_822899.1| putative mycodextranase [Streptomyces

  12. ORF Alignment: NC_003284 [GENIUS II[Archive

    Full Text Available NC_003284 gi|17551448 >1rw3A 32 443 156 555 3e-25 ... gb|AAF64414.1| Pol [equine foam...y virus] ref|NP_054716.1| Pol [equine foamy virus] ... Length = 400 ... Query: 980 ... KLRIVLD--ASSPPGPEPSL

  13. ORF Alignment: NC_002655 [GENIUS II[Archive

    Full Text Available NC_002655 gi|15800390 >1j3eA 1 115 2 116 2e-47 ... pdb|1IU3|F Chain F, Crystal Structure Of The E.Coli... ... Structure Of The E.Coli Seqa Protein Complexed With ... Hemimethylated Dna ... Length = ... Seqa Protein Complexed ... With Hemimethylated Dna pdb|1IU3|C Chain C, Crystal ...

  14. ORF Alignment: NC_004741 [GENIUS II[Archive

    Full Text Available NC_004741 gi|30062138 >1j3eA 1 115 2 116 2e-47 ... pdb|1IU3|F Chain F, Crystal Structure Of The E.Coli... ... Structure Of The E.Coli Seqa Protein Complexed With ... Hemimethylated Dna ... Length = ... Seqa Protein Complexed ... With Hemimethylated Dna pdb|1IU3|C Chain C, Crystal ...

  15. ORF Alignment: NC_004431 [GENIUS II[Archive

    Full Text Available NC_004431 gi|26246664 >1j3eA 1 115 2 116 2e-47 ... pdb|1IU3|F Chain F, Crystal Structure Of The E.Coli... ... Structure Of The E.Coli Seqa Protein Complexed With ... Hemimethylated Dna ... Length = ... Seqa Protein Complexed ... With Hemimethylated Dna pdb|1IU3|C Chain C, Crystal ...

  16. ORF Alignment: NC_002695 [GENIUS II[Archive

    Full Text Available NC_002695 gi|15829972 >1j3eA 1 115 2 116 2e-47 ... pdb|1IU3|F Chain F, Crystal Structure Of The E.Coli... ... Structure Of The E.Coli Seqa Protein Complexed With ... Hemimethylated Dna ... Length = ... Seqa Protein Complexed ... With Hemimethylated Dna pdb|1IU3|C Chain C, Crystal ...

  17. ORF Alignment: NC_004337 [GENIUS II[Archive

    Full Text Available NC_004337 gi|56479698 >1j3eA 1 115 2 116 2e-47 ... pdb|1IU3|F Chain F, Crystal Structure Of The E.Coli... ... Structure Of The E.Coli Seqa Protein Complexed With ... Hemimethylated Dna ... Length = ... Seqa Protein Complexed ... With Hemimethylated Dna pdb|1IU3|C Chain C, Crystal ...

  18. ORF Alignment: NC_004337 [GENIUS II[Archive

    Full Text Available NC_004337 gi|24115225 >1e94E 1 443 7 449 e-162 ... pdb|1E94|F Chain F, Hslv-Hslu From E.Coli... pdb|1E94|E Chain E, Hslv-Hslu From ... E.Coli pdb|1HQY|F Chain F, Nucleotide-Dependent ...

  19. ORF Alignment: NC_004337 [GENIUS II[Archive

    Full Text Available NC_004337 gi|56480239 >1us0A 2 305 26 295 5e-61 ... pdb|1MZR|B Chain B, Structure Of Dkga From ... Of Dkga From E.Coli At 2.13 A Resolution Solved By ... Molecular Replacement ...

  20. ORF Alignment: NC_000913 [GENIUS II[Archive

    Full Text Available NC_000913 gi|49176300 >1us0A 2 305 26 295 5e-61 ... pdb|1MZR|B Chain B, Structure Of Dkga From ... Of Dkga From E.Coli At 2.13 A Resolution Solved By ... Molecular Replacement ...

  1. ORF Alignment: NC_005085 [GENIUS II[Archive

    Full Text Available NC_005085 gi|34495619 >1t06A 1 193 1 205 2e-24 ... gb|AAQ57843.1| DNA alkylation enzyme [Chromobacterium violaceum ATCC 12472] ... ref|NP_899834.1| DNA alkylation repair enzyme ...

  2. ORF Alignment: NC_004307 [GENIUS II[Archive

    Full Text Available NC_004307 gi|23466169 >1u94A 19 326 67 387 5e-28 ... ref|NP_696772.1| alkylation repair protein [Bifidobacterium longum NCC2705] ... gb|AAN25408.1| alkylation damage repair protei

  3. ORF Alignment: NC_006087 [GENIUS II[Archive

    Full Text Available NC_006087 gi|50955643 >1u94A 24 325 68 337 3e-32 ... ref|YP_062931.1| alkylation DNA repair protein [Leifsonia xyli subsp. xyli ... str. CTCB07] gb|AAT89826.1| alkylation damage D

  4. ORF Alignment: NC_005027 [GENIUS II[Archive

    Full Text Available NC_005027 gi|32477023 >1t06A 1 191 9 220 1e-24 ... ref|NP_870017.1| probable DNA alkylation... repair enzyme [Rhodopirellula baltica SH 1] ... emb|CAD79170.1| probable DNA alkylation repair

  5. ORF Alignment: NC_004350 [GENIUS II[Archive

    Full Text Available NC_004350 gi|24378587 >1t06A 1 191 11 210 3e-32 ... gb|AAN57848.1| DNA alkylation rep...air enzyme [Streptococcus mutans UA159] ... ref|NP_720542.1| DNA alkylation repair enzyme ...

  6. ORF Alignment: NC_006348 [GENIUS II[Archive

    Full Text Available NC_006348 gi|53726196 >1umqA 5 59 22 76 8e-06 ... ref|ZP_00216666.1| COG2901: Factor for inversion...ef|ZP_00221526.1| COG2901: Factor for inversion ... stimulation Fis, transcriptional activator ...

  7. ORF Alignment: NC_000907 [GENIUS II[Archive

    Full Text Available NC_000907 gi|16272918 >1etoB 1 97 1 98 9e-28 ... ref|ZP_00320663.1| COG2901: Factor for inversion... ... ref|ZP_00156839.1| COG2901: Factor for inversion ... stimulation Fis, transcriptional activator [Hae

  8. ORF Alignment: NC_002528 [GENIUS II[Archive

    Full Text Available NC_002528 gi|15617004 >1etoB 1 98 1 98 1e-23 ... ref|NP_240217.1| factor-for-inversion... ... DNA-binding protein fis dbj|BAB13103.1| ... factor-for-inversion stimulation protein [Buchnera ... ... aphidicola str. APS (Acyrthosiphon pisum)] pir||G84976 ... factor-for-inversion

  9. ORF Alignment: NC_004459 [GENIUS II[Archive

    Full Text Available NC_004459 gi|27364633 >1etoB 1 98 1 98 7e-29 ... ref|YP_131497.1| putative factor-for-inversion... stimulation protein [Photobacterium ... profundum SS9] emb|CAG21695.1| putative ... factor-for-inversion

  10. ORF Alignment: NC_004603 [GENIUS II[Archive

    Full Text Available NC_004603 gi|28899659 >1etoB 1 98 1 98 7e-29 ... ref|YP_131497.1| putative factor-for-inversion... stimulation protein [Photobacterium ... profundum SS9] emb|CAG21695.1| putative ... factor-for-inversion

  11. ORF Alignment: NC_004061 [GENIUS II[Archive

    Full Text Available NC_004061 gi|21672661 >1etoB 1 98 1 99 3e-23 ... ref|NP_660728.1| factor-for-inversion... stimulation protein [Buchnera aphidicola ... str. Sg (Schizaphis graminum)] gb|AAM67939.1| ... factor-for-inversion

  12. ORF Alignment: NC_006512 [GENIUS II[Archive

    Full Text Available NC_006512 gi|56461389 >1etoB 1 98 1 97 7e-25 ... ref|YP_156670.1| Factor for inversion... stimulation Fis, transcriptional activator ... [Idiomarina loihiensis L2TR] gb|AAV83121.1| Factor for ... inversion

  13. ORF Alignment: NC_006350 [GENIUS II[Archive

    Full Text Available NC_006350 gi|53720503 >1umqA 5 59 22 76 8e-06 ... ref|ZP_00216666.1| COG2901: Factor for inversion...ef|ZP_00221526.1| COG2901: Factor for inversion ... stimulation Fis, transcriptional activator ...

  14. ORF Alignment: NC_005139 [GENIUS II[Archive

    Full Text Available NC_005139 gi|37681323 >1etoB 1 98 1 98 7e-29 ... ref|YP_131497.1| putative factor-for-inversion... stimulation protein [Photobacterium ... profundum SS9] emb|CAG21695.1| putative ... factor-for-inversion

  15. ORF Alignment: NC_006370 [GENIUS II[Archive

    Full Text Available NC_006370 gi|54310477 >1etoB 1 98 1 98 7e-29 ... ref|YP_131497.1| putative factor-for-inversion... stimulation protein [Photobacterium ... profundum SS9] emb|CAG21695.1| putative ... factor-for-inversion

  16. ORF Alignment: NC_006511 [GENIUS II[Archive

    Full Text Available NC_006511 gi|56414667 >1hcrA 1 48 25 72 5e-05 ... ref|YP_151742.1| inversion of adjac... ... 9150] gb|AAV78430.1| inversion of adjacent DNA; at ... locus of e14 element [Salmonella ent

  17. ORF Alignment: NC_003280 [GENIUS II[Archive

    Full Text Available NC_003280 gi|25149956 >1qauA 5 99 56 151 2e-04 ... gb|AAN38752.1| axon identity speci...rm b ... [Caenorhabditis elegans] ref|NP_495592.2| SYnapse ... Defective SYD-1, axon identity

  18. ORF Alignment: NC_003280 [GENIUS II[Archive

    Full Text Available NC_003280 gi|25149956 >1tx4A 1 170 679 853 1e-24 ... gb|AAN38752.1| axon identity spe...form b ... [Caenorhabditis elegans] ref|NP_495592.2| SYnapse ... Defective SYD-1, axon identity

  19. ORF Alignment: NC_004722 [GENIUS II[Archive

    Full Text Available NC_004722 gi|30021592 >1vkpA 12 368 2 333 2e-83 ... ref|NP_833223.1| Agmatine [Bacillus cereus ATCC 14579] gb|AAP10424.1| ... Agmatine deiminase [Bacillus cereus ATCC 14579] ...

  20. ORF Alignment: NC_002607 [GENIUS II[Archive

    Full Text Available NC_002607 gi|15790649 >1b22A 10 70 5 63 2e-10 ... pdb|1XU4|A Chain A, Atpase In Compl...ex With Amp-Pnp, Magnesium And Potassium ... Co-F pdb|1T4G|A Chain A, Atpase In Complex With Amp-Pnp ...

  1. ORF Alignment: NC_003551 [GENIUS II[Archive

    Full Text Available NC_003551 gi|20094872 >1b22A 10 70 5 63 2e-10 ... pdb|1XU4|A Chain A, Atpase In Compl...ex With Amp-Pnp, Magnesium And Potassium ... Co-F pdb|1T4G|A Chain A, Atpase In Complex With Amp-Pnp

  2. ORF Alignment: NC_000909 [GENIUS II[Archive

    Full Text Available NC_000909 gi|15669589 >1vhtA 3 200 2 186 2e-14 ... ref|NP_248402.1| alignment in /usr/local/projects...408.1| ... alignment in ... /usr/local/projects/ARG/Intergenic/ ... [Me

  3. ORF Alignment: NC_005791 [GENIUS II[Archive

    Full Text Available NC_005791 gi|45359158 >1q7hA 13 141 446 567 8e-09 ... ref|NP_248016.1| alignment in /usr/local/projects...B99026.1| ... alignment in ... /usr/local/projects/ARG/Intergenic/ ...

  4. ORF Alignment: NC_000909 [GENIUS II[Archive

    Full Text Available NC_000909 gi|15669211 >1q7hA 13 141 446 567 8e-09 ... ref|NP_248016.1| alignment in /usr/local/projects...B99026.1| ... alignment in ... /usr/local/projects/ARG/Intergenic/ ...

  5. ORF Alignment: NC_000918 [GENIUS II[Archive

    Full Text Available NC_000918 gi|15606868 >1tg6E 33 200 25 196 8e-08 ... ref|NP_214248.1| nodulation competitiveness... protein NfeD [Aquifex aeolicus VF5] ... gb|AAC07639.1| nodulation competitiveness protein... NfeD ... [Aquifex aeolicus VF5] pir||H70456 nodulation ... competitiveness protein NfeD - Aqu

  6. ORF Alignment: NC_005296 [GENIUS II[Archive

    Full Text Available NC_005296 gi|39936538 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

  7. ORF Alignment: NC_002745 [GENIUS II[Archive

    Full Text Available NC_002745 gi|15925955 >1n8kA 34 374 26 339 4e-06 ... dbj|BAB56414.1| similar to xylitol... ... SA0242 [Staphylococcus aureus subsp. aureus N315] ... ref|NP_370776.1| similar to xylitol

  8. ORF Alignment: NC_006351 [GENIUS II[Archive

    Full Text Available NC_006351 gi|53722258 >1kolA 2 388 1 341 4e-33 ... ref|YP_111243.1| putative zinc-binding xylitol... ... zinc-binding xylitol/sorbitol dehydrogenase ... [Burkholderia pseudomallei K96243] ... .../sorbitol dehydrogenase [Burkholderia ... pseudomallei K96243] emb|CAH38702.1| putative ...

  9. ORF Alignment: NC_002758 [GENIUS II[Archive

    Full Text Available NC_002758 gi|15923242 >1n8kA 34 374 26 339 4e-06 ... dbj|BAB56414.1| similar to xylitol... ... SA0242 [Staphylococcus aureus subsp. aureus N315] ... ref|NP_370776.1| similar to xylitol

  10. ORF Alignment: NC_002745 [GENIUS II[Archive

    Full Text Available NC_002745 gi|15925959 >1kolA 35 389 28 338 2e-04 ... dbj|BAB56418.1| similar to xylitol... ... SA0246 [Staphylococcus aureus subsp. aureus N315] ... ref|NP_370780.1| similar to xylitol

  11. ORF Alignment: NC_003155 [GENIUS II[Archive

    Full Text Available NC_003155 gi|29828632 >1w1oA 22 489 11 408 6e-19 ... dbj|BAC69801.1| putative xylitol... oxidase [Streptomyces avermitilis MA-4680] ... ref|NP_823266.1| putative xylitol oxidase [Streptomyc

  12. ORF Alignment: NC_004461 [GENIUS II[Archive

    Full Text Available NC_004461 gi|27467238 >1kolA 35 391 30 342 2e-04 ... ref|NP_763875.1| xylitol dehydro...genase [Staphylococcus epidermidis ATCC 12228] ... gb|AAO03917.1| xylitol dehydrogenase [Staphylococc

  13. ORF Alignment: NC_002758 [GENIUS II[Archive

    Full Text Available NC_002758 gi|15923246 >1kolA 35 389 28 338 2e-04 ... dbj|BAB56418.1| similar to xylitol... ... SA0246 [Staphylococcus aureus subsp. aureus N315] ... ref|NP_370780.1| similar to xylitol

  14. ORF Alignment: NC_006677 [GENIUS II[Archive

    Full Text Available NC_006677 gi|58039331 >1hxhA 1 247 2 262 8e-39 ... pir||JC7939 xylitol dehydrogenase ...(EC 1.1.1.-) - Gluconobacter oxydans (Strain ... ATCC621) dbj|BAC16227.1| xylitol dehydrogenase ...

  15. ORF Alignment: NC_001137 [GENIUS II[Archive

    Full Text Available ograde regulon which ... consists of genes whose expression is stimulated by... NC_001137 gi|6320764 >1wvfA 13 508 29 496 1e-67 ... ref|NP_010843.1| D-lactate dehydrogenase, part of the retr

  16. ORF Sequence: NC_001136 [GENIUS II[Archive

    Full Text Available NC_001136 gi|6320230 >gi|6320230|ref|NP_010310.1| Component of the GARP (Golgi-associated retrograde... protein) complex, Vps51p-Vps52p-Vps53p-Vps54p, which is required for retrograde transport

  17. ORF Sequence: NC_001141 [GENIUS II[Archive

    Full Text Available NC_001141 gi|6322114 >gi|6322114|ref|NP_012189.1| Part of a heptameric protein complex that regulates retro...grade Golgi-to-ER protein traffic in eukaryotic cells; coatomer forms the COP I ves

  18. ORF Alignment: NC_006274 [GENIUS II[Archive

    Full Text Available NC_006274 gi|52142162 >1gpuA 4 663 4 663 0.0 ... ref|YP_084669.1| transketolase (glycoal...dehyde transferase) [Bacillus cereus ZK] ... gb|AAU17181.1| transketolase (glycoaldehyde transfera

  19. ORF Alignment: NC_005363 [GENIUS II[Archive

    Full Text Available NC_005363 gi|42522087 >3ncmA 2 92 125 205 3e-07 ... gb|AAQ14642.1| HK97 major tail subunit [Bacteriophage Feli...x 01] ref|NP_944848.1| ... HK97 major tail subunit [Bacteriophage Felix 01

  20. ORF Alignment: NC_000917 [GENIUS II[Archive

    Full Text Available NC_000917 gi|11498586 >1b0uA 5 258 11 250 4e-55 ... ref|NP_069814.1| osmoprotection p...rotein (proV) [Archaeoglobus fulgidus DSM 4304] ... gb|AAB90260.1| osmoprotection protein (proV) ... ... ... [Archaeoglobus fulgidus DSM 4304] pir||E69372 ... osmoprotection protein (proV) homolog - Arch

  1. ORF Alignment: NC_000915 [GENIUS II[Archive

    Full Text Available NC_000915 gi|15645437 >1r9lA 6 291 286 549 7e-39 ... gb|AAD07866.1| osmoprotection pr...otein (proWX) [Helicobacter pylori 26695] ... pir||B64622 osmoprotection protein - Helicobacter pylor...i ... (strain 26695) ref|NP_207611.1| osmoprotection protein ... (proWX) [Helicobacter pylori

  2. ORF Sequence: NC_001146 [GENIUS II[Archive

    Full Text Available inal member of the mitochondrial inner membrane electron transport chain; predominantly express...ed during aerobic growth while its isoform Vb (Cox5Bp) is expressed during anaerobic growth; Cox5ap ... NC_001146 gi|6324276 >gi|6324276|ref|NP_014346.1| Subunit Va of cytochrome c oxidase, which is the term

  3. ORF Sequence: NC_001141 [GENIUS II[Archive

    Full Text Available inal member of the mitochondrial inner membrane electron transport chain; predominantly express...ed during anaerobic growth while its isoform Va (Cox5Ap) is expressed during aerobic growth; Cox5bp ... NC_001141 gi|6322080 >gi|6322080|ref|NP_012155.1| Subunit Vb of cytochrome c oxidase, which is the term

  4. ORF Alignment: NC_003071 [GENIUS II[Archive

    Full Text Available NC_003071 gi|42569531 >1wd2A 1 58 290 342 7e-13 ... gb|AAD32294.1| similar to Ariadne... protein from Drosophila [Arabidopsis thaliana] ... emb|CAD52893.1| ARIADNE-like protein ARI11 [Arabi...dopsis ... thaliana] pir||A84725 similar to Ariadne protein from ... Drosophila [imported] - A

  5. ORF Alignment: NC_005027 [GENIUS II[Archive

    Full Text Available NC_005027 gi|32475765 >1zrn0 11 219 5 254 2e-04 ... ref|NP_868759.1| N-acetylglucosamine-6-phosha... ... N-acetylglucosamine-6-phoshatase or p-nitrophenyl ... phosphatase [Pirellula sp.] ... Len

  6. ORF Alignment: NC_000912 [GENIUS II[Archive

    Full Text Available NC_000912 gi|13507986 >1txoB 6 236 9 257 6e-28 ... gb|AAB96233.1| protein phoshatase ...iae ... M129] pir||S73911 protein phoshatase 2C homolog ptc1 - ... Mycoplasma pneumoniae (stra... ... ref|NP_109935.1| protein phoshatase 2C homolog; similar ... to Swiss-Prot Accession Number P3518

  7. ORF Alignment: NC_003304 [GENIUS II[Archive

    Full Text Available NC_003304 gi|17934663 >1k4iA 3 216 7 208 1e-70 ... ref|NP_531453.1| 3,4-dihydroxy-2-butanone-4-phosha...9.1| ... 3,4-dihydroxy-2-butanone-4-phoshate synthase/GTP ... cyclo... ... 3,4-dihydroxy-2-butanone-4-phoshate synthase (AJ000053) ... [imported] - Agrobacterium tumefaci

  8. ORF Alignment: NC_003062 [GENIUS II[Archive

    Full Text Available NC_003062 gi|15888096 >1k4iA 3 216 7 208 1e-70 ... ref|NP_531453.1| 3,4-dihydroxy-2-butanone-4-phosha...9.1| ... 3,4-dihydroxy-2-butanone-4-phoshate synthase/GTP ... cyclo... ... 3,4-dihydroxy-2-butanone-4-phoshate synthase (AJ000053) ... [imported] - Agrobacterium tumefaci

  9. ORF Alignment: NC_004463 [GENIUS II[Archive

    Full Text Available NC_004463 gi|27377726 >1k4iA 2 216 3 205 5e-67 ... ref|NP_769255.1| 3,4-dihydroxy-2-butanone-4-phosha...0.1| ... 3,4-dihydroxy-2-butanone-4-phoshate synthase/GTP ... cyclohydrolase II [Bradyrhizobiu

  10. ORF Alignment: NC_005126 [GENIUS II[Archive

    Full Text Available NC_005126 gi|37527217 >1b12A 1 247 78 326 7e-74 ... ref|NP_930561.1| Signal peptidase I (SPase I) (Leader...| ... Signal peptidase I (SPase I) (Leader peptidase I) ... [Photorhabdus luminescens subsp. l

  11. ORF Alignment: NC_003295 [GENIUS II[Archive

    Full Text Available ASE AND NICOTINAMIDASE ... HYDROLASE (NICOTINE DEAMIDASE) [Ralstonia solanac...earum] ... ref|NP_519881.1| PROBABLE BIFUNCTIONAL PROTEIN: ... PYRAZINAMIDASE AND NICOTINAMIDAS...E HYDROLASE (NICOTINE ... DEAMIDASE) [Ralstonia solanacearum GMI1000] ... ... NC_003295 gi|17546479 >1j2rA 11 186 9 209 4e-27 ... emb|CAD15462.1| PROBABLE BIFUNCTIONAL PROTEIN: PYRAZINAMID

  12. ORF Alignment: NC_002695 [GENIUS II[Archive

    Full Text Available NC_002695 gi|15830716 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  13. ORF Alignment: NC_002655 [GENIUS II[Archive

    Full Text Available NC_002655 gi|15801201 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  14. ORF Alignment: NC_003197 [GENIUS II[Archive

    Full Text Available NC_003197 gi|16764541 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  15. ORF Alignment: NC_006511 [GENIUS II[Archive

    Full Text Available NC_006511 gi|56413828 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  16. ORF Alignment: NC_003198 [GENIUS II[Archive

    Full Text Available NC_003198 gi|16760062 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  17. ORF Alignment: NC_004631 [GENIUS II[Archive

    Full Text Available NC_004631 gi|29142167 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  18. ORF Alignment: NC_000913 [GENIUS II[Archive

    Full Text Available NC_000913 gi|16129047 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  19. ORF Alignment: NC_004741 [GENIUS II[Archive

    Full Text Available NC_004741 gi|30062618 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  20. ORF Alignment: NC_006905 [GENIUS II[Archive

    Full Text Available NC_006905 gi|62179702 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  1. ORF Alignment: NC_004337 [GENIUS II[Archive

    Full Text Available NC_004337 gi|56479819 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  2. ORF Alignment: NC_004431 [GENIUS II[Archive

    Full Text Available NC_004431 gi|26247224 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  3. ORF Alignment: NC_003070 [GENIUS II[Archive

    Full Text Available NC_003070 gi|42572131 >1ig6A 3 105 144 247 2e-18 ... ref|NP_177777.3| ARID/BRIGHT DNA...-binding domain-containing protein [Arabidopsis ... thaliana] ref|NP_974156.1| ARID/BRIGHT DNA-bindin

  4. ORF Alignment: NC_003070 [GENIUS II[Archive

    Full Text Available NC_003070 gi|42563264 >1ig6A 3 105 144 247 2e-18 ... ref|NP_177777.3| ARID/BRIGHT DNA...-binding domain-containing protein [Arabidopsis ... thaliana] ref|NP_974156.1| ARID/BRIGHT DNA-bindin

  5. ORF Alignment: NC_000854 [GENIUS II[Archive

    Full Text Available NC_000854 gi|14601919 >1n62B 44 802 1 748 0.0 ... ref|NP_148464.1| nicotine dehydroge...nase chain C [Aeropyrum pernix K1] ... dbj|BAA81228.1| 750aa long hypothetical nicotine ... de...hydrogenase chain C [Aeropyrum pernix K1] pir||D72530 ... probable nicotine dehydrogenase chain C APE

  6. ORF Alignment: NC_000854 [GENIUS II[Archive

    Full Text Available NC_000854 gi|14601920 >1n62C 1 286 1 287 2e-71 ... ref|NP_148465.1| nicotine dehydrog...enase chain A [Aeropyrum pernix K1] ... dbj|BAA81231.1| 292aa long hypothetical nicotine ... d...ehydrogenase chain A [Aeropyrum pernix K1] pir||G72530 ... probable nicotine dehydrogenase chain A AP

  7. ORF Alignment: NC_003106 [GENIUS II[Archive

    Full Text Available NC_003106 gi|15922820 >1n62B 24 793 4 684 e-115 ... ref|NP_378489.1| hypothetical nicotine... dehydrogenase subunit C [Sulfolobus tokodaii ... str. 7] dbj|BAB67598.1| 685aa long hypothetical nicotine

  8. ORF Alignment: NC_006509 [GENIUS II[Archive

    Full Text Available NC_006509 gi|56410456 >1n62C 1 286 1 287 4e-70 ... ref|YP_145830.1| nicotine dehydrog...enase chain A [Geobacillus kaustophilus HTA426] ... dbj|BAD74262.1| nicotine dehydrogenase chain A ...

  9. ORF Alignment: NC_000117 [GENIUS II[Archive

    Full Text Available NC_000117 gi|15605507 >2bjiA 3 266 5 313 9e-29 ... ref|NP_220293.1| Sulfite Synthesis.../biphosphate phosphatase [Chlamydia trachomatis ... D/UW-3/CX] gb|AAC68369.1| Sulfite Synthesis/bipho

  10. ORF Alignment: NC_000117 [GENIUS II[Archive

    Full Text Available NC_000117 gi|15605545 >1u7nA 1 327 4 316 2e-67 ... ref|NP_220331.1| FA/Phospholipid Synthesis... Protein [Chlamydia trachomatis D/UW-3/CX] ... gb|AAC68407.1| FA/Phospholipid Synthesis Prote

  11. ORF Alignment: NC_006361 [GENIUS II[Archive

    Full Text Available NC_006361 gi|54024866 >1jmvA 2 140 154 297 6e-16 ... ref|YP_227183.1| UNIVERSAL STRESS...icum ATCC 13032] ... emb|CAF20967.1| UNIVERSAL STRESS PROTEIN FAMILY ... [Corynebacterium glut

  12. ORF Alignment: NC_003295 [GENIUS II[Archive

    Full Text Available NC_003295 gi|17546366 >1bxdA 1 144 297 447 7e-18 ... emb|CAD15349.1| PROBABLE OXIDATIVE STRESS...PROTEIN ... [Ralstonia solanacearum] ref|NP_519768.1| PROBABLE ... OXIDATIVE STRESS RESISTANCE

  13. ORF Alignment: NC_003450 [GENIUS II[Archive

    Full Text Available NC_003450 gi|19554128 >1jmvA 2 140 154 297 6e-16 ... ref|YP_227183.1| UNIVERSAL STRESS...icum ATCC 13032] ... emb|CAF20967.1| UNIVERSAL STRESS PROTEIN FAMILY ... [Corynebacterium glut

  14. ORF Alignment: NC_003295 [GENIUS II[Archive

    Full Text Available NC_003295 gi|17546366 >1joyA 1 67 230 295 9e-16 ... emb|CAD15349.1| PROBABLE OXIDATIVE STRESS...ROTEIN ... [Ralstonia solanacearum] ref|NP_519768.1| PROBABLE ... OXIDATIVE STRESS RESISTANCE

  15. ORF Alignment: NC_005090 [GENIUS II[Archive

    Full Text Available NC_005090 gi|34556965 >1mzbA 1 134 1 130 7e-21 ... ref|NP_906780.1| PEROXIDE STRESS R...EGULATOR [Wolinella succinogenes DSM 1740] ... emb|CAE09680.1| PEROXIDE STRESS REGULATOR [Wolinella ...

  16. ORF Alignment: NC_003295 [GENIUS II[Archive

    Full Text Available NC_003295 gi|17546367 >1kgsA 3 221 7 234 1e-40 ... emb|CAD15350.1| PROBABLE OXIDATIVE STRESS... ... solanacearum] ref|NP_519769.1| PROBABLE OXIDATIVE STRESS ... RESISTANCE TWO-COMPONENT RESPON

  17. ORF Alignment: NC_003075 [GENIUS II[Archive


  18. ORF Alignment: NC_002737 [GENIUS II[Archive

    Full Text Available NC_002737 gi|15675767 >1g5aA 89 627 2 535 3e-86 ... gb|AAK34662.1| dextran glucosidas...e [Streptococcus pyogenes M1 GAS] ... ref|NP_269941.1| dextran glucosidase [Streptococcus ...

  19. ORF Alignment: NC_003485 [GENIUS II[Archive

    Full Text Available NC_003485 gi|19746879 >1g5aA 89 627 2 535 1e-86 ... gb|AAL98514.1| putative dextran g...lucosidase [Streptococcus pyogenes MGAS8232] ... ref|NP_608015.1| putative dextran glucosidase ...

  20. ORF Alignment: NC_003485 [GENIUS II[Archive

    Full Text Available NC_003485 gi|19746967 >1g5aA 98 625 11 538 6e-94 ... gb|AAL98602.1| putative dextran ...glucosidase [Streptococcus pyogenes MGAS8232] ... ref|NP_608103.1| putative dextran glucosidase ...

  1. ORF Alignment: NC_002737 [GENIUS II[Archive

    Full Text Available NC_002737 gi|15675852 >1g5aA 98 625 11 538 9e-95 ... gb|AAK34747.1| putative dextran ...glucosidase [Streptococcus pyogenes M1 GAS] ... ref|NP_270026.1| putative dextran glucosidase ...

  2. ORF Alignment: NC_004350 [GENIUS II[Archive

    Full Text Available NC_004350 gi|24379337 >1g5aA 90 627 3 535 7e-83 ... gb|AAN58598.1| dextran glucosidas...e DexB [Streptococcus mutans UA159] ... ref|NP_721292.1| dextran glucosidase DexB [Streptococcus ... ... ... (Exo-1,6-alpha-glucosidase) (Glucodextranase) ... Length = 533 ... Que

  3. ORF Alignment: NC_004310 [GENIUS II[Archive

    Full Text Available NC_004310 gi|23502301 >1p3dA 28 461 27 463 e-121 ... ref|YP_222116.1| MurC, UDP-N-ace...tylmuramate--alanine ligase [Brucella abortus biovar ... 1 str. 9-941] gb|AAX74755.1| MurC, ...

  4. ORF Alignment: NC_002942 [GENIUS II[Archive

    Full Text Available NC_002942 gi|52842820 >1p3dA 3 461 10 467 e-125 ... ref|YP_096619.1| UDP-N-acetylmuramate:L-alanine ligase Mur...28672.1| ... UDP-N-acetylmuramate:L-alanine ligase MurC [Legionella ... pneumophila subsp. pne

  5. ORF Alignment: NC_006300 [GENIUS II[Archive

    Full Text Available NC_006300 gi|52425721 >1p3dA 1 463 15 477 e-153 ... ref|YP_088858.1| MurC protein [Ma...nnheimia succiniciproducens MBEL55E] gb|AAU38273.1| ... MurC protein [Mannheimia succiniciproducens M

  6. ORF Alignment: NC_002944 [GENIUS II[Archive

    Full Text Available NC_002944 gi|41407994 >4uagA 7 413 12 470 1e-38 ... ref|NP_960830.1| MurC [Mycobacter... ... ligase (UDP-N-acetylmuramoyl-L-alanine synthetase) ... gb|AAS04213.1| MurC [Mycobacterium

  7. ORF Alignment: NC_006300 [GENIUS II[Archive

    Full Text Available NC_006300 gi|52425669 >4uagA 6 428 2 453 3e-46 ... ref|YP_088806.1| MurC protein [Man...nheimia succiniciproducens MBEL55E] gb|AAU38221.1| ... MurC protein [Mannheimia succiniciproducens MB

  8. ORF Alignment: NC_002663 [GENIUS II[Archive

    Full Text Available NC_002663 gi|15602008 >1p3dA 1 463 17 479 e-156 ... ref|NP_245080.1| MurC [Pasteurell...a multocida subsp. multocida str. Pm70] ... gb|AAK02227.1| MurC [Pasteurella multocida subsp. ...

  9. ORF Alignment: NC_003317 [GENIUS II[Archive

    Full Text Available NC_003317 gi|17986863 >1p3dA 28 461 27 463 e-121 ... ref|YP_222116.1| MurC, UDP-N-ace...tylmuramate--alanine ligase [Brucella abortus biovar ... 1 str. 9-941] gb|AAX74755.1| MurC, ...

  10. ORF Alignment: NC_006322 [GENIUS II[Archive

    Full Text Available NC_006322 gi|52786856 >4uagA 8 419 4 423 5e-47 ... ref|YP_092685.1| MurC [Bacillus li...cheniformis ATCC 14580] gb|AAU41992.1| MurC ... [Bacillus licheniformis DSM 13] sp|Q65G22|MURC_BACLD

  11. ORF Alignment: NC_003911 [GENIUS II[Archive

    Full Text Available NC_003911 gi|56696447 >1dlwA 19 115 21 125 4e-12 ... gb|AAV94850.1| protozoan/cyanoba...cterial globin family protein [Silicibacter ... pomeroyi DSS-3] ref|YP_166804.1| ... protozoan

  12. ORF Alignment: NC_006348 [GENIUS II[Archive

    Full Text Available NC_006348 gi|53725407 >1dlwA 1 115 25 145 1e-19 ... ref|YP_103467.1| protozoan/cyanob...acterial globin family protein [Burkholderia mallei ... ATCC 23344] gb|AAU49423.1| protozoan/cyanobac

  13. ORF Alignment: NC_002952 [GENIUS II[Archive

    Full Text Available NC_002952 gi|49483165 >1dlwA 19 115 21 120 3e-19 ... ref|YP_040389.1| protozoan/cyano...bacterial globin family protein [Staphylococcus ... aureus subsp. aureus MRSA252] emb|CAG39975.1| ... protozoa

  14. ORF Alignment: NC_002976 [GENIUS II[Archive

    Full Text Available NC_002976 gi|57866545 >1dlwA 19 115 47 146 6e-19 ... ref|YP_188173.1| protozoan/cyano...bacterial globin family protein [Staphylococcus ... epidermidis RP62A] gb|AAW53991.1| ... protozoa

  15. ORF Alignment: NC_002977 [GENIUS II[Archive

    Full Text Available NC_002977 gi|53804116 >1dlwA 19 113 26 120 5e-13 ... gb|AAU92168.1| protozoan/cyanoba...cterial globin family protein [Methylococcus ... capsulatus str. Bath] ref|YP_114018.1| ... protozoa

  16. ORF Alignment: NC_002951 [GENIUS II[Archive

    Full Text Available NC_002951 gi|57650195 >1dlwA 19 115 21 120 3e-19 ... ref|YP_185875.1| protozoan/cyano...bacterial globin family protein [Staphylococcus ... aureus subsp. aureus COL] gb|AAW36475.1| ... protozoa

  17. ORF Alignment: NC_004578 [GENIUS II[Archive

    Full Text Available NC_004578 gi|28871348 >1dlwA 1 114 25 138 3e-25 ... ref|NP_793967.1| protozoan/cyanob...acterial globin family protein [Pseudomonas ... syringae pv. tomato str. DC3000] gb|AAO57662.1| ... protozoa

  18. ORF Alignment: NC_006350 [GENIUS II[Archive

    Full Text Available NC_006350 gi|53718816 >1dlwA 1 115 25 145 1e-19 ... ref|YP_103467.1| protozoan/cyanob...acterial globin family protein [Burkholderia mallei ... ATCC 23344] gb|AAU49423.1| protozoan/cyanobac

  19. ORF Alignment: NC_003155 [GENIUS II[Archive

    Full Text Available NC_003155 gi|29832733 >1chkA 1 236 48 283 9e-87 ... dbj|BAC73902.1| putative chitosan...ase [Streptomyces avermitilis MA-4680] ... ref|NP_827367.1| putative chitosanase [Streptomyces ...

  20. ORF Alignment: NC_003155 [GENIUS II[Archive

    Full Text Available NC_003155 gi|29828557 >1chkA 1 236 35 270 4e-95 ... dbj|BAC69726.1| putative chitosan...ase [Streptomyces avermitilis MA-4680] ... ref|NP_823191.1| putative chitosanase [Streptomyces ...

  1. ORF Alignment: NC_005085 [GENIUS II[Archive

    Full Text Available NC_005085 gi|34499386 >1qgiA 1 259 102 360 4e-95 ... gb|AAQ61593.1| probable chitosan...ase A [Chromobacterium violaceum ATCC 12472] ... ref|NP_903601.1| probable chitosanase A [Chromobacte

  2. ORF Alignment: NC_003888 [GENIUS II[Archive

    Full Text Available NC_003888 gi|21219207 >1chkA 2 236 45 279 3e-87 ... ref|NP_624986.1| secreted chitosan...ase [Streptomyces coelicolor A3(2)] ... emb|CAB61194.1| secreted chitosanase [Streptomyces ...

  3. ORF Alignment: NC_003888 [GENIUS II[Archive

    Full Text Available NC_003888 gi|21220505 >1chkA 2 236 70 304 9e-83 ... ref|NP_626284.1| putative chitosan...ase (putative secreted protein) [Streptomyces ... coelicolor A3(2)] emb|CAB52859.1| putative chitosan...ase ... (putative secreted protein) [Streptomyces coelicolor ... A3(2)] pir||T34867 probable chitosan

  4. ORF Alignment: NC_006274 [GENIUS II[Archive

    Full Text Available NC_006274 gi|52142820 >1kwfA 3 362 53 435 5e-85 ... ref|YP_084010.1| chitosanase; gly...cosyl hydrolases family 8; endoglucanase [Bacillus ... cereus ZK] gb|AAU17839.1| chitosanase; glycosy

  5. ORF Alignment: NC_002678 [GENIUS II[Archive

    Full Text Available NC_002678 gi|13475854 >1el5A 4 378 18 430 4e-33 ... ref|NP_107424.1| agaE protein, conversion of agropini...c acid to mannopinic acid ... [Mesorhizobium loti MAFF303099] dbj|BAB53210.1| Aga

  6. ORF Alignment: NC_002678 [GENIUS II[Archive

    Full Text Available NC_002678 gi|13475930 >1el5A 6 379 7 420 7e-42 ... ref|NP_107500.1| AgaE protein, conversion of agropini...c acid to mannopinic acid ... [Mesorhizobium loti MAFF303099] dbj|BAB53286.1| AgaE

  7. ORF Alignment: NC_002679 [GENIUS II[Archive

    Full Text Available NC_002679 gi|13488188 >1el5A 4 377 26 437 3e-36 ... ref|NP_085608.1| agaE(conversion of agropini...c acid to mannopinic acid) ... [Mesorhizobium loti MAFF303099] dbj|BAB54449.1| AgaE ...

  8. ORF Alignment: NC_002678 [GENIUS II[Archive

    Full Text Available NC_002678 gi|13473528 >1u07A 4 89 172 254 2e-09 ... ref|NP_105096.1| energy transduce...r TonB [Mesorhizobium loti MAFF303099] ... dbj|BAB50882.1| energy transducer; TonB [Mesorhizobium ...

  9. ORF Alignment: NC_005296 [GENIUS II[Archive

    Full Text Available NC_005296 gi|39935198 >1u07A 9 88 204 283 1e-12 ... emb|CAE27570.1| possible energy t...ransducer TonB, C-terminal region ... [Rhodopseudomonas palustris CGA009] ref|NP_947474.1| ... possible energy

  10. ORF Alignment: NC_006905 [GENIUS II[Archive

    Full Text Available NC_006905 gi|62180303 >1u07A 2 90 193 281 2e-32 ... ref|YP_216720.1| energy transduce...terica ... serovar Choleraesuis str. SC-B67] gb|AAX65639.1| energy ... transducer; uptake of i

  11. ORF Alignment: NC_005810 [GENIUS II[Archive

    Full Text Available NC_005810 gi|45441793 >1u07A 1 89 164 251 4e-26 ... ref|NP_669352.1| energy transduce...] ... ref|NP_993332.1| TonB protein [Yersinia pestis biovar ... Medievalis str. 91001] gb|AAM85603.1| energy

  12. ORF Alignment: NC_002939 [GENIUS II[Archive

    Full Text Available NC_002939 gi|39995137 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

  13. ORF Alignment: NC_006511 [GENIUS II[Archive

    Full Text Available NC_006511 gi|56413338 >1u07A 2 90 193 281 2e-32 ... ref|YP_216720.1| energy transduce...terica ... serovar Choleraesuis str. SC-B67] gb|AAX65639.1| energy ... transducer; uptake of i

  14. ORF Alignment: NC_004088 [GENIUS II[Archive

    Full Text Available NC_004088 gi|22125929 >1u07A 1 89 164 251 4e-26 ... ref|NP_669352.1| energy transduce...] ... ref|NP_993332.1| TonB protein [Yersinia pestis biovar ... Medievalis str. 91001] gb|AAM85603.1| energy

  15. ORF Alignment: NC_006576 [GENIUS II[Archive

    Full Text Available NC_006576 gi|56751418 >1kgsA 3 222 4 231 2e-39 ... ref|YP_172119.1| two-component response regulator for energ... ... PCC 6301] dbj|BAD79599.1| two-component response ... regulator for energy transfer from ph

  16. ORF Alignment: NC_002939 [GENIUS II[Archive

    Full Text Available NC_002939 gi|39996799 >1u07A 9 88 204 283 1e-12 ... emb|CAE27570.1| possible energy t...ransducer TonB, C-terminal region ... [Rhodopseudomonas palustris CGA009] ref|NP_947474.1| ... possible energy

  17. ORF Alignment: NC_003143 [GENIUS II[Archive

    Full Text Available NC_003143 gi|16122423 >1u07A 1 89 164 251 4e-26 ... ref|NP_669352.1| energy transduce...] ... ref|NP_993332.1| TonB protein [Yersinia pestis biovar ... Medievalis str. 91001] gb|AAM85603.1| energy

  18. ORF Alignment: NC_002678 [GENIUS II[Archive

    Full Text Available NC_002678 gi|13471241 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris ... CGA009] ref|NP_948814.1| possible energy transducer ...

  19. ORF Alignment: NC_004463 [GENIUS II[Archive

    Full Text Available NC_004463 gi|27379019 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

  20. ORF Alignment: NC_002940 [GENIUS II[Archive

    Full Text Available NC_002940 gi|33151562 >1u07A 8 84 201 279 1e-08 ... gb|AAP95304.1| TobB energy transd...ucing protein [Haemophilus ducreyi 35000HP] ... ref|NP_872915.1| TobB energy transducing protein ...

  1. ORF Alignment: NC_003197 [GENIUS II[Archive

    Full Text Available NC_003197 gi|16765081 >1u07A 2 90 193 281 2e-32 ... ref|YP_216720.1| energy transduce...terica ... serovar Choleraesuis str. SC-B67] gb|AAX65639.1| energy ... transducer; uptake of i

  2. ORF Alignment: NC_003911 [GENIUS II[Archive

    Full Text Available NC_003911 gi|56698296 >1eljA 1 332 19 332 1e-06 ... gb|AAV96699.1| polyamine ABC trasnporte...snporter, periplasmic polyamine-binding protein ... [Silicibacter pomeroyi D...r, periplasmic polyamine-binding protein ... [Silicibacter pomeroyi DSS-3] ref|YP_168669.1| polyamine ... ABC tra

  3. ORF Alignment: NC_006834 [GENIUS II[Archive

    Full Text Available NC_006834 gi|58581923 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  4. ORF Alignment: NC_004757 [GENIUS II[Archive

    Full Text Available NC_004757 gi|30250333 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  5. ORF Alignment: NC_004572 [GENIUS II[Archive

    Full Text Available NC_004572 gi|28493349 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  6. ORF Alignment: NC_005966 [GENIUS II[Archive

    Full Text Available NC_005966 gi|50085709 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  7. ORF Alignment: NC_003919 [GENIUS II[Archive

    Full Text Available NC_003919 gi|21242823 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  8. ORF Alignment: NC_003116 [GENIUS II[Archive

    Full Text Available NC_003116 gi|15793872 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  9. ORF Alignment: NC_006085 [GENIUS II[Archive

    Full Text Available NC_006085 gi|50842381 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  10. ORF Alignment: NC_006513 [GENIUS II[Archive

    Full Text Available NC_006513 gi|56478742 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  11. ORF Alignment: NC_004551 [GENIUS II[Archive

    Full Text Available NC_004551 gi|28572541 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  12. ORF Alignment: NC_003112 [GENIUS II[Archive

    Full Text Available NC_003112 gi|15676600 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  13. ORF Alignment: NC_006369 [GENIUS II[Archive

    Full Text Available NC_006369 gi|54293610 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  14. ORF Alignment: NC_002488 [GENIUS II[Archive

    Full Text Available NC_002488 gi|15837680 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  15. ORF Alignment: NC_002946 [GENIUS II[Archive

    Full Text Available NC_002946 gi|59800726 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  16. ORF Alignment: NC_005085 [GENIUS II[Archive

    Full Text Available NC_005085 gi|34495926 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  17. ORF Alignment: NC_006368 [GENIUS II[Archive

    Full Text Available NC_006368 gi|54296649 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  18. ORF Alignment: NC_002977 [GENIUS II[Archive

    Full Text Available NC_002977 gi|53803220 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  19. ORF Alignment: NC_002942 [GENIUS II[Archive

    Full Text Available NC_002942 gi|52840863 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  20. ORF Alignment: NC_003869 [GENIUS II[Archive

    Full Text Available NC_003869 gi|20807422 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19