WorldWideScience

Sample records for shd b7 turn

  1. Dicty_cDB: SHD492 [Dicty_cDB

    Full Text Available SH (Link to library) SHD492 (Link to dictyBase) - - - Contig-U16471-1 SHD492P (Link to Original site) SHD492...F 121 SHD492Z 819 SHD492P 920 - - Show SHD492 Library SH (Link to library) Clone ID SHD492... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SH/SHD4-D/SHD492Q.Seq.d/ Representative seq. ID SHD492...P (Link to Original site) Representative DNA sequence >SHD492 (SHD492Q) /CSM/SH/SHD4-D/SHD492....Seq.d/ 805 0.0 SHD613 (SHD613Q) /CSM/SH/SHD6-A/SHD613Q.Seq.d/ 805 0.0 SHD492 (SHD492Q) /CSM/SH/SHD4-D/SHD492

  2. Dicty_cDB: SHD573 [Dicty_cDB

    Full Text Available SH (Link to library) SHD573 (Link to dictyBase) - - - Contig-U11503-1 SHD573E (Link...Clone ID SHD573 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Original site URL http://dict...LFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGCGFNN EPICTSLKDAVSRAFLLISNNSRVCIGIIGNINVTSEQITLGNYCGALWITSENINNENN NYTI...ststtts ax***d*eyyhcysyfgldl Frame C: fsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGCGFNN EPICTSLKD...vegicus clone CH230-428C17, WORKING DRAFT SEQUENCE, 3 unordered pieces. 48 3e-12 3 AC116984 |AC116984.2 Dict

  3. Experience of slowly infused high-iodine-dose contrast computed tomography (SHD) of intracranial tumors

    Muraoka, Kiyoaki; Numata, Hideharu; Hokama, Yasuo

    1983-01-01

    A study was done on 20 patients with intracranial tumors by means of the slowly infused high-iodine-dose (SHD) contrast-enhancement technique. An intravenous drip infusion of 300 ml of Angiografin was given for three hours. Computerized tomograms were taken 1 hour, (2 hours), and 3 hours after the beginning of the drip infusion. The authors divided the lesions into four groups by analyzing the sequential changes in CT numbers using a histograms or profile of the region of interest. In group I, additional lesions were visible on the SHD scan (one case of metastatic brain tumors from lung cancer). In group 2, lesions were better displayed on the SHD scan due to increased enhancement (17 cases). In group 3, SHD scans showed no change (2 cases of fibrous astrocytoma). In group 4, the enhancement was diminished, but the lesion per se was still clealy identifiable (no case). Finally, in 18 cases out of 20 (90%), an additional or better display of the lesion was detected on SHD enhanced CT. The rational for doing the SHD enhancement is to detect a lesion with a minimally impaired blood-brain barrier by exposing a prolonged high blood-iodine level, and so the scanning is delayed until detectable levels of the contrast medium have accumulated within the vascular-channel pool or extravascular space of the lesion. SHD enhancement is useful: I) for revealing any additional lesion in a metastatic brain tumor; 2) for better displaying an obscure lesion on a usual scan; 3) for differentiating the quality of the lesion (for example, malignancy or cyst formation), and 4) for predicting the prognosis of the lesion. (J.P.N.)

  4. Structure and Cancer Immunotherapy of the B7 Family Member B7x

    Jeon, Hyungjun; Vigdorovich, Vladimir; Garrett-Thomson, Sarah C.; Janakiram, Murali; Ramagopal, Udupi A.; Abadi, Yael M.; Lee, Jun Sik; Scandiuzzi, Lisa; Ohaegbulam, Kim C; Chinai, Jordan M; Zhao, Ruihua; Yao, Yu; Mao, Ying; Sparano, Joseph A.; Almo, Steven C.; Zang, Xingxing

    2014-01-01

    SUMMARY B7x (B7-H4 or B7S1) is a member of the B7 family that can inhibit T cell function. B7x protein is absent in most normal human tissues and immune cells, but is overexpressed in human cancers and often correlates with negative clinical outcome. The expression pattern and function of B7x suggest that it may be a potent immunosuppressive pathway in human cancers. Here we determined the crystal structure of human B7x IgV domain at 1.59Å resolution and mapped the epitopes recognized by monoclonal antibodies. We developed a new in vivo system to screen therapeutic monoclonal antibodies against B7x, and found that the clone 1H3 significantly inhibited growth of B7x-expressing tumor in vivo via multiple mechanisms. Furthermore, the surviving mice given 1H3 treatment were resistant to tumor re-challenge. Our data suggest that targeting B7x on tumors is a promising cancer immunotherapy and humanized 1H3 may be efficacious for immunotherapy of human cancers. PMID:25437562

  5. Structure and Cancer Immunotherapy of the B7 Family Member B7x

    Hyungjun Jeon

    2014-11-01

    Full Text Available B7x (B7-H4 or B7S1 is a member of the B7 family that can inhibit T cell function. B7x protein is absent in most normal human tissues and immune cells, but it is overexpressed in human cancers and often correlates with negative clinical outcome. The expression pattern and function of B7x suggest that it may be a potent immunosuppressive pathway in human cancers. Here, we determined the crystal structure of the human B7x immunoglobulin variable (IgV domain at 1.59 Å resolution and mapped the epitopes recognized by monoclonal antibodies. We developed an in vivo system to screen therapeutic monoclonal antibodies against B7x and found that the clone 1H3 significantly inhibited growth of B7x-expressing tumors in vivo via multiple mechanisms. Furthermore, the surviving mice given 1H3 treatment were resistant to tumor rechallenge. Our data suggest that targeting B7x on tumors is a promising cancer immunotherapy and humanized 1H3 may be efficacious for immunotherapy of human cancers.

  6. Targeting B7x and B7-H3 as New Immunotherapies for Prostate Cancer

    2016-09-01

    activated and express receptors for B7x and B7-H3 and human prostate cancer cells express B7x or B7-H3. FACS showed the approach how we identified human...Immunomodu- latory pathways include members of the TNF receptor family and their ligands which have been studied as targets for cancer immunotherapy. These...urothelial bladder cancer patients resulting in an FDA breakthrough designation [50], and MSB0010718C which exhibits antitumor activ- ity by blocking PD-L1

  7. Turns prediction : Turns prediction

    Fuchs, Patrick; Etchebest, Catherine; De Brevern, Alexandre

    2007-01-01

    The description of protein 3D structure usually focuses on the repetitive local folds (alpha-helices and beta-sheets). The remaining class, sometimes called unordered region, has often been considered as random (one also calls it ‘random coil'). However, some interesting local folds are also highly recurrent and definitely more structured than a real random region. One of such particularly interesting motif is tight turn; this latter is characterized by few residues (3 to 5) and by the revers...

  8. UV irradiation of Shigella Dysenteriae induced the transformation and excision of a presumed integrated lysogenic prophage Shd-4L10 into a lytic phase

    Rodrigues, F. K.; Addy, B.; Armah, G.; Fobil, J.; Steiner-Asiedu, M.; Efavi, J.

    2012-01-01

    Repeated exposures of Shigella dysenteriae strain A to ultra-violet radiation (253.7 nm) with intervening outgrowth of survivors gave rise to clear bacteriophage plaques. Isolation, propagation and partial purification of the new Shd-4LI0 phages showed that they are similar in morphology to the Myxobacteriaphage Mx-4 described earlier. The new phages retained the general characteristics of S. dystenteriae phageShd-4L3, including serological properties and phage typing. It is suggested that ultra-violet irradiation may have played a role in the transformation and excision of the presumed lysogen of S. dysenteriaestrain A into a lytic phase. PhageShd-4LI0 was subsequently partially characterized. It has a density of 1.61, a DNA: protein ratio of 0.42 and thus a cryptogram of D/2:54.3/32.5:X/X: B/O. The phage was further characterised by fractionation of its protein using SDS-polyacrilamide gel electrophoresis. DNA extracted from phages was hydrolysed with restriction endonuclease R., EcoR1. The restriction fragments were catalogued and their apparent molecular weights calculated from electrophoresis gels calibrated with fragments from DNA of coliphageλ λ. From the total fragments obtained with nuclease R., EcoR1, the apparent minimum molecular weight of phage Shd-4LI0DNA was found to be 54.3 x 10 6 Daltons. The molecular weight of the phage DNA was also calculated from measurements of contour length of purified DNA samples, using the formula MW = 1.97 x 10 10 1/(magnification), where 1 is the measured length of DNA in centimetres). The very close relatedness with phage Shd-4L3 was confirmed by these techniques. (au)

  9. Targeting B7x and B7-H3 as New Immunotherapies for Prostate Cancer

    2017-11-01

    prostate   cancer  and  other   cancers .   15. SUBJECT TERMS B7x, B7-H3, HHLA2, TMIGD2, Receptors , Immune Checkpoint, Prostate Cancer , Monoclonal...H3,  HHLA2,  TMIGD2,   Receptors ,  Immune  Checkpoint,   Prostate   Cancer ,   Monoclonal  Antibodies,  Crystal  Structure,  Immunotherapy,  T  Cells... prostate   cancer  immunotherapy.       Unlike  B7x  and  B7-­H3  whose   receptors  have  not  been  found  yet,  we  have   quickly  discovered  two

  10. Expressions of B7-H4 and B7-H3 Proteins and Effect of Sorafenib on ...

    21. Pardoll DM. The blockage of immune checkpoints in cancer immunotherapy. Nat Rev Cancer 2012; 12(4):. 252-264. 22. Wang L, Liu LH, Shan BE. B7-H3: a promising target for tumor immunotherapy. Immunol J 2012; 28(8): 726-729. 23. Liu CZ, Yang KG, Cheng SS. B7-H4: a new negative regulator of T cell immunity.

  11. Turned on/turned off

    Petersen, Eva Bendix

    2016-01-01

    position, it attempts to sense into the lived experience of being subject to, and of, turns in social theory. As a whole the paper seeks to work with and allow for multiplicity in tone, focus, researcher positioning, reader positioning, and more, to see what knowledge that does not seek confident closure......Through cacophonic story-telling, emerging from ethnographic observations from academic scenes in Australia and elsewhere, the article seeks to explore the timeliness and untimeliness of feminist knowledge production. Rather than arguing a particular point or making a claim for a particular...

  12. 32 CFR 242b.7 - Officers of the University.

    2010-07-01

    ..., developing, and directing the military activities and functions of the University. (ii) In the absence of the... Services University of the Health Sciences. (9) Dean of the Military Medical Education Institute. (i) The... 32 National Defense 2 2010-07-01 2010-07-01 false Officers of the University. 242b.7 Section 242b...

  13. New ENDF/B-7.0 library

    Oblozinsky, P.

    2008-01-01

    We describe the new version of the Evaluated Nuclear Data File, Endf/B-7.0, of recommended nuclear data for advanced nuclear science and technology applications. The library, produced by the US Cross Section Evaluation Working Group, was released in December 2006. The library contains data in 14 sub-libraries, primarily for reactions with incident neutrons, protons and photons, based on the experimental data and nuclear reaction theory predictions. The neutron reaction sub-library contains data for 393 materials. The new library was extensively tested and shows considerable improvements over the earlier Endf/B-6.8 library. (author)

  14. B7-H3 is a potent inhibitor of human T cell activation: No evidence for B7-H3 and TREML2 interaction

    Leitner, Judith; Klauser, Christoph; Pickl, Winfried F.; Stöckl, Johannes; Majdic, Otto; Bardet, Anaïs F.; Kreil, David P.; Dong, Chen; Yamazaki, Tomohide; Zlabinger, Gerhard; Pfistershammer, Katharina; Steinberger, Peter

    2010-01-01

    B7-H3 belongs to the B7 superfamily, a group of molecules that costimulate or down-modulate T cell responses. Although it was shown that B7-H3 can inhibit T cell responses, several studies - most of them performed in murine systems - found B7-H3 to act in a costimulatory manner. In this study we have specifically addressed a potential functional dualism of human B7-H3 by assessing the effect of this molecule under varying experimental conditions as well as on different T cell subsets. We show that B7-H3 does not costimulate human T cells. In presence of strong activating signals, B7-H3 potently and consistently down-modulated human T cell responses. This inhibitory effect was evident when analyzing proliferation and cytokine production and affected naïve as well as pre-activated T cells. We furthermore demonstrate that B7-H3 - T cell interaction is characterized by an early suppression of IL-2 and that T cell inhibition can be reverted by exogenous IL-2. Since TREML2 has been recently described as costimulatory receptor of murine B7-H3 we have extensively analysed interaction of human B7-H3 with TREML2 (TLT2). In these experiments we found no evidence for such an interaction. Furthermore our data do not point to a role for murine TREML2 as a receptor for murine B7-H3. PMID:19544488

  15. Overexpression of B7-H3 augments anti-apoptosis of colorectal cancer cells by Jak2-STAT3.

    Zhang, Ting; Jiang, Bo; Zou, Shi-Tao; Liu, Fen; Hua, Dong

    2015-02-14

    To investigate the role of the overexpression of B7-H3 in apoptosis in colorectal cancer cell lines and the underlying molecular mechanisms. SW620 cells that highly overexpressed B7-H3 (SW620-B7-H3-EGFP) and HCT8 cells stably transfected with B7-H3 shRNA (HCT8-shB7-H3) were previously constructed in our laboratory. Cells transfected with pIRES2-EGFP were used as negative controls (SW620-NC and HCT8-NC). Real-time PCR and western blotting analysis were used to detect the mRNA and protein expressions of the apoptosis regulator proteins Bcl-2, Bcl-xl and Bax. A cell proliferation assay was used to evaluate the survival rate and drug sensitivity of the cells. The effect of drug resistance was detected by a cell cycle assay. Active caspase-3 western blotting was used to reflect the anti-apoptotic ability of cells. Western blotting was also performed to determine the expression of proteins associated with the Jak2-STAT3 signaling pathway and the apoptosis regulator proteins after the treatment with AG490, a Jak2 specific inhibitor, in B7-H3 overexpressing cells. The data were analyzed by GraphPad Prism 6 using a non-paired t-test. Whether by overexpression in SW620 cells or downregulation in HCT8, B7-H3 significantly affected the expression of anti- and pro-apoptotic proteins, at both the transcriptional and translational levels, compared with the negative control (P overexpression increased the drug resistance of cells and resulted in a higher survival rate (P overexpression inhibited apoptosis in colorectal cancer cell lines (P overexpression improved Jak2 and STAT3 phosphorylation and, in turn, increased the expression of the downstream anti-apoptotic proteins B-cell CLL/lymphoma 2 (Bcl-2) and Bcl-xl, based on western blotting (P overexpressing cells with the Jak2-specific inhibitor AG490, the phosphorylation of Jak2 and STAT3, and the expression of Bcl-2 and Bcl-xl, decreased accordingly (P overexpression of B7-H3 induces resistance to apoptosis in colorectal cancer

  16. The expression of B7-H1 and B7-H4 molecules on immature myeloid and lymphoid dendritic cells in cord blood of healthy neonates

    Kludka-Sternik M

    2010-04-01

    Full Text Available The aim of our study was to estimate both B7-H1 and B7-H4 molecules on immature myeloid and lymphoid dendriticcells in umbilical cord blood of healthy neonates in comparison with peripheral blood of healthy adults. Thirty ninehealthy full-term neonates from physiological single pregnancies and 27 healthy adults were included in the study. Theexpression of B7-H1 and B7-H4 was revealed using the immunofluorescence method. Statistical analysis was performedusing a non-parametric test (Mann-Whitney U-Test. The percentages of BDCA-1+ dendritic cells with B7-H1 and B7-H4expressions were significantly higher in peripheral blood of healthy adults (p<0.00003. It was either observed that the percentageof BDCA-2+ dendritic cells with the expression of B7-H4 molecules was significantly higher in peripheral blood ofhealthy adults in comparison with umbilical cord blood (p<0.02. Decreased percentages of dendritic cells and co-stimulatorymolecules indicate that neonates have immature immune system. Depletion of co-stimulatory B7-H1 and B7-H4 moleculesenable appropriate development of immune response.

  17. The expression of B7-H1 and B7-H4 molecules on immature myeloid and lymphoid dendritic cells in cord blood of healthy neonates.

    S Radej

    2011-04-01

    Full Text Available The aim of our study was to estimate both B7-H1 and B7-H4 molecules on immature myeloid and lymphoid dendritic cells in umbilical cord blood of healthy neonates in comparison with peripheral blood of healthy adults. Thirty nine healthy full-term neonates from physiological single pregnancies and 27 healthy adults were included in the study. The expression of B7-H1 and B7-H4 was revealed using the immunofluorescence method. Statistical analysis was performed using a non-parametric test (Mann-Whitney U-Test. The percentages of BDCA-1+ dendritic cells with B7-H1 and B7-H4 expressions were significantly higher in peripheral blood of healthy adults (p<0.00003. It was either observed that the percentage of BDCA-2+ dendritic cells with the expression of B7-H4 molecules was significantly higher in peripheral blood of healthy adults in comparison with umbilical cord blood (p<0.02. Decreased percentages of dendritic cells and co-stimulatory molecules indicate that neonates have immature immune system. Depletion of co-stimulatory B7-H1 and B7-H4 molecules enable appropriate development of immune response.

  18. B7-H3 in tumors: friend or foe for tumor immunity?

    Li, Gen; Quan, Yanchun; Che, Fengyuan; Wang, Lijuan

    2018-02-01

    B7-H3 is a type I transmembrane co-stimulatory molecule of the B7 family. B7-H3 mRNA is widely distributed in most tissues; however, B7-H3 protein is not constitutively expressed. Few molecules have been shown to mediate the regulation of B7-H3 expression, and their regulatory mechanisms remain unexplored. Recently, TREM-like transcript 2 (TLT-2) has been identified as a potential receptor of B7-H3. However, TLT-2 may not be the only receptor of B7-H3, as B7-H3 has many contradictory roles. As a co-stimulatory molecule, B7-H3 increases the proliferation of both CD4+ and CD8+ T-cells and enhances cytotoxic T-cell activity. However, greatly increased T-cell proliferation and IL-2 levels have been observed in the absence of B7-H3. Thus far, it has been shown that various tumors test positive for B7-H3 expression and that B7-H3 levels correlate with tumor growth, invasion, metastasis, malignant stage, and recurrence rate. Furthermore, transfection of cells with a B7-H3 plasmid and treatment with monoclonal antibodies to block B7-H3 are the main immunotherapeutic strategies for cancer treatment. Several groups have generated anti-B7-H3 antibodies and observed tumor growth suppression in vitro and in vivo. Therefore, it is likely that B7-H3 plays an important role in cancer diagnosis and treatment, aside from its role as a co-stimulatory molecule.

  19. 17 CFR 240.16b-7 - Mergers, reclassifications, and consolidations.

    2010-04-01

    ... financial statements for a 12 month period before the merger, reclassification or consolidation, or such..., and consolidations. 240.16b-7 Section 240.16b-7 Commodity and Securities Exchanges SECURITIES AND...) § 240.16b-7 Mergers, reclassifications, and consolidations. (a) The following transactions shall be...

  20. Heterologous expression of Helicoverpa armigera cytochrome P450 CYP6B7 in Pichia pastoris and interactions of CYP6B7 with insecticides.

    Zhao, Chunqing; Song, Genmiao; Duan, Hongxia; Tang, Tao; Wang, Chen; Qiu, Lihong

    2017-09-01

    Previous studies indicated that constitutive over-expression of cytochrome P450 CYP6B7 was involved in fenvalerate resistance in Helicoverpa armigera. In this study, the CYP6B7 gene from H. armigera (namely HaCYP6B7), was heterologously expressed in Pichia pastoris GS115. A vector pPICZA-HaCYP6B7 was constructed and transformed into P. pastoris GS115, the transformant of pPICZA-HaCYP6B7-GS115 was then cultured and induced by 1% (v/v) methanol and the heterologous expression of HaCYP6B7 protein in P. pastoris was confirmed by SDS-PAGE and western blot. Microsomes containing the expressed HaCYP6B7 showed activities against model substrate p-nitroanisole and 7-ethoxycoumarin, with p-nitroanisole O-demethylation (PNOD) and 7-ethoxycoumarin O-deethylation (ECOD) activities of 15.66- and 4.75-fold of the control, respectively. Moreover, it showed degradation activities against the insecticides bifenthrin, fenvalerate and chlorpyrifos, with clearance activities of 6.88-, 1.49- and 2.27-fold of the control, respectively. The interactions of HaCYP6B7 with insecticides were further confirmed by molecular docking in silico with binding scores of 5.450, 5.295 and 2.197 between putative HaCYP6B7 protein and bifenthrin, fenvalerate and chlorpyrifos, respectively. The results of present study provided more direct and important evidence on the role of HaCYP6B7 conferring pyrethroid resistance in H. armigera. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  1. The Translator's Turn: in the Cultural Turn

    徐玮玮

    2003-01-01

    @@ Introduction: Douglas Robinson rose to the defense of the " atheoretical" American literary translator in The Translator's Turn (1991). Here, I borrowed the title from him, but I will write my paper in the thought of the translator's role in translating. In his book, Robinson argued that the literary translator embodies an integration of feeling and thought, of intuition and systematization. In analyzing the " turn" that the translator take from the source text to the target text, Robinson offered a " dialogical" model, that is the translator's dialogical engagement with the source language and with the ethic of the target language. Robinson allows for the translator to intervene, subvert, divert, even entertain, emphasizing the creative aspect of literary translation. The translation linguists, scientists, and philosophers have had their chance at translation theory; now it is time, he argued, for the literary translators to have their " turn".

  2. Any value of podocyte B7-1 as a biomarker in human MCD and FSGS?

    Novelli, Rubina; Gagliardini, Elena; Ruggiero, Barbara; Benigni, Ariela; Remuzzi, Giuseppe

    2016-03-01

    Minimal change disease (MCD) and focal segmental glomerulosclerosis (FSGS) are the most common causes of nephrotic syndrome in children and in young adults. Relapsing MCD carries the risk of severe complications and prolonged immunosuppression, whereas FSGS remains largely untreatable and urgently needs more effective treatments. Recently, induction of B7-1 (CD80), an immune-related protein expressed by antigen-presenting cells, was observed in podocytes of MCD and FSGS patients, suggesting that B7-1 plays a role in the pathogenesis of these diseases, and hence that abatacept, a B7-1 inhibitor, could be a possible treatment. Since previous studies raised serious concerns regarding the reliability of immunohistochemical assays for B7-1 detection and the efficacy of B7-1 inhibitory treatment, we investigated B7-1 podocyte expression in MCD and FSGS patients. Using different primary antibodies and immunohistochemical assays, no significant upregulation of podocyte B7-1 was detected in patients' biopsies compared with controls. To further confirm our findings, we analyzed mice with adriamycin-induced nephropathy, a model of human FSGS, and mice injected with LPS as additional control. Podocyte B7-1 was not observed in mice injected with adriamycin or LPS either. In conclusion, since B7-1 is not induced in podocyte of MCD and FSGS patients, the antiproteinuric action of abatacept, if confirmed, may not be the result of an effect on podocyte B7-1. Copyright © 2016 the American Physiological Society.

  3. B7-H4 as a Target for Breast Cancer Immunotherapy

    2013-06-01

    papain proteinase K pronase trypsin B7-H4R B """""" B7-H4R-APC CD25-FITC...Figure 5. B7-H4 receptor is protease resistant. Karpas 299 cells were treated with 0.3 mg/mL papain , 0.025 mg/mL proteinase K, 0.15 mg/mL pronase

  4. Development and testing of the VITAMIN-B7/BUGLE-B7 coupled neutron-gamma multigroup cross-section libraries

    Risner, J.M.; Wiarda, D.; Miller, T.M.; Peplow, D.E.; Patton, B.W.; Dunn, M.E. [Oak Ridge National Laboratory, MS 6170, P.O. Box 2008, Oak Ridge, TN 37831-6170 (United States); Parks, B.T. [U.S. Nuclear Regulatory Commission, Office of Nuclear Reactor Regulation, Mail Stop O10-B3, 11555 Rockville Pike, Rockville, MD 20852 (United States)

    2011-07-01

    The U.S. Nuclear Regulatory Commission's Regulatory Guide 1.190 states that calculational methods used to estimate reactor pressure vessel (RPV) fluence should use the latest version of the evaluated nuclear data file (ENDF). The VITAMIN-B6 fine-group library and BUGLE-96 broad-group library, which are widely used for RPV fluence calculations, were generated using ENDF/B-VI.3 data, which was the most current data when Regulatory Guide 1.190 was issued. We have developed new fine-group (VITAMIN-B7) and broad-group (BUGLE-B7) libraries based on ENDF/B-VII.0. These new libraries, which were processed using the AMPX code system, maintain the same group structures as the VITAMIN-B6 and BUGLE-96 libraries. Verification and validation of the new libraries were accomplished using diagnostic checks in AMPX, 'unit tests' for each element in VITAMIN-B7, and a diverse set of benchmark experiments including critical evaluations for fast and thermal systems, a set of experimental benchmarks that are used for SCALE regression tests, and three RPV fluence benchmarks. The benchmark evaluation results demonstrate that VITAMIN-B7 and BUGLE-B7 are appropriate for use in RPV fluence calculations and meet the calculational uncertainty criterion in Regulatory Guide 1.190. (authors)

  5. Development and Testing of the VITAMIN-B7/BUGLE-B7 Coupled Neutron-Gamma Multigroup Cross-Section Libraries

    Risner, Joel M.; Wiarda, Dorothea; Miller, Thomas Martin; Peplow, Douglas E.; Patton, Bruce W.; Dunn, Michael E.; Parks, Benjamin T.

    2011-01-01

    The U.S. Nuclear Regulatory Commission's Regulatory Guide 1.190 states that calculational methods used to estimate reactor pressure vessel (RPV) fluence should use the latest version of the Evaluated Nuclear Data File (ENDF). The VITAMIN-B6 fine-group library and BUGLE-96 broad-group library, which are widely used for RPV fluence calculations, were generated using ENDF/B-VI data, which was the most current data when Regulatory Guide 1.190 was issued. We have developed new fine-group (VITAMIN-B7) and broad-group (BUGLE-B7) libraries based on ENDF/B-VII. These new libraries, which were processed using the AMPX code system, maintain the same group structures as the VITAMIN-B6 and BUGLE-96 libraries. Verification and validation of the new libraries was accomplished using diagnostic checks in AMPX, unit tests for each element in VITAMIN-B7, and a diverse set of benchmark experiments including critical evaluations for fast and thermal systems, a set of experimental benchmarks that are used for SCALE regression tests, and three RPV fluence benchmarks. The benchmark evaluation results demonstrate that VITAMIN-B7 and BUGLE-B7 are appropriate for use in LWR shielding applications, and meet the calculational uncertainty criterion in Regulatory Guide 1.190.

  6. Review Essay: Turn, Turn, Turn Around—Till Categories Blur

    Lars Allolio-Näcke

    2008-01-01

    Full Text Available I begin this review by introducing the book and discussing its manifest content chapter by chapter (see 2.1, focusing particularly on the author's argumentation concerning the development of new orientations in cultural studies and on how, in relation to the turns discussed, the names of the researchers and central categories involved are collected. In a second step, I give a close reading of the book's latent content, which I consider to be more important (see 2.2. In this context I discuss several questions of scientific politics—especially the issue of hegemonic claims. Thirdly, I read the book from the critical standpoint of a psychologist, a sociologist and a theologian and show the shortcomings of BACHMANN-MEDICK's outsider perspective on these disciplines. In this regard I read the book again and provide a critique of the quality of the author's scientific performance (see 3. Finally, I state the reasons I do not recommend reading this book (see 4. URN: urn:nbn:de:0114-fqs0801266

  7. Differential effects of B7-1 blockade in the rat experimental autoimmune encephalomyelitis model

    Gallon, L; Chandraker, A; Issazadeh-Navikas, Shohreh

    1997-01-01

    that CD28-B7 blockade by systemic administration of CTLA4Ig prevents actively induced EAE. Since CTLA4Ig binds to both B7-1 and B7-2, we used a mutant form of CTLA4Ig (CTLA4IgY100F) that binds only B7-1, to study the role of B7-1 blockade in this model. Such a reagent avoids the potential of signaling...... treated with systemic CTLA4gY100F did not. More importantly, systemic administration of CTLA4IgY100F abrogated the protective effect of ex vivo treated APCs. These data suggest an important regulatory role for B7-1, perhaps through binding to CTLA4, in this model of EAE. Understanding the role......Blocking the CD28-B7 T cell costimulatory activation pathway protects animals from developing experimental autoimmune encephalomyelitis (EAE). In the mouse EAE model, selective blockade of B7-1 by specific mAbs has been shown to protect animals from EAE. In the Lewis rat model, we have shown...

  8. B7-H4 Treatment of T Cells Inhibits ERK, JNK, p38, and AKT Activation.

    Xiaojie Wang

    Full Text Available B7-H4 is a newly identified B7 homolog that plays an important role in maintaining T-cell homeostasis by inhibiting T-cell proliferation and lymphokine-secretion. In this study, we investigated the signal transduction pathways inhibited by B7-H4 engagement in mouse T cells. We found that treatment of CD3(+ T cells with a B7-H4.Ig fusion protein inhibits anti-CD3 elicited T-cell receptor (TCR/CD28 signaling events, including phosphorylation of the MAP kinases, ERK, p38, and JNK. B7-H4.Ig treatment also inhibited the phosphorylation of AKT kinase and impaired its kinase activity as assessed by the phosphorylation of its endogenous substrate GSK-3. Expression of IL-2 is also reduced by B7-H4. In contrast, the phosphorylation state of the TCR proximal tyrosine kinases ZAP70 and lymphocyte-specific protein tyrosine kinase (LCK are not affected by B7-H4 ligation. These results indicate that B7-H4 inhibits T-cell proliferation and IL-2 production through interfering with activation of ERK, JNK, and AKT, but not of ZAP70 or LCK.

  9. [Clinical significance of determination of serum B7-H4 in patients with malignant hematologic diseases].

    Wang, Xiao-Mei; Hu, Guo-Yan; Liu, Wei; Zheng, Shu-Hua; Lv, Jing; Wang, Hong-Mei; Xu, Jun-Fa

    2010-09-01

    To study the clinical significance of determination of serum B7-H4 in patients with malignant hematologic diseases. Serum B7-H4 levels were determined in 65 patients with leucemia, 34 patients with lymphoma, 12 patients with multiple myeloma as well as in 50 healthy controls. The serum B7-H4 levels in patients with lymphoma [(38.81+/-10.34) kappag/L] were significantly higher than healthy controls [(31.62+/-9.850) kappag/L] (Pleucemia, patients with multiple myeloma and healthy controls. These results suggest that the B7-H4 may correlated with lymphoma, but uncorrelated with leucemia and multiple myeloma. Measurement of serum B7-H4 level provide useful information for distinctive diagnosis of different kinds of malignant hematologic diseases.

  10. Turn-around improvements

    Redaelli, S.; Venturini Delsolaro, W.

    2012-01-01

    An efficient turn-around will be an important parameter for the integrated luminosity performance at LHC in 2012, when an operation with steady beam parameters and machine configuration will be achieved at the beginning of the run. Improvements of the operational cycle were already put successfully in place after the 2010 experience but additional ways to reduce the time required to setup collisions are possible. In this paper, the 2011 turn-around performance is reviewed and the benefits of the improvements from 2010 are presented. Phases of the operational cycle when further amelioration is possible are discussed and some proposal for a faster turn-around in 2012 are outlined. (authors)

  11. B7H6-derived peptides trigger TNF-α-dependent immunostimulatory activity of lymphocytic NK92-MI cells.

    Phillips, Mariana; Romeo, Francesca; Bitsaktsis, Constantine; Sabatino, David

    2016-09-01

    The rise of biologics that can stimulate immune responses towards the eradication of tumors has led to the evolution of cancer-based immunotherapy. Representatively, B7H6 has been recently identified as a protein ligand on tumor cells that binds specifically to the NKp30 receptor and triggers NK cell-derived cytokine production, which ultimately leads to tumor cell lysis and death. In an effort to develop effective immunotherapy approaches, the rational design of a novel class of immunostimulatory peptides (IPs) derived from the binding interface of B7H6:NKp30 is described in this study. The IPs comprised the B7H6 active site sequence for NKp30 binding and immunostimulatory activity. An aminohexanoic acid linker was also introduced at the N-terminus of the peptides for FITC-labeling by Fmoc-solid phase peptide synthesis. The peptides were characterized by LCMS to confirm identities and purities >95%. The secondary structures of the peptides were examined by CD spectroscopy in H2 O, PBS and a H2 O:TFE mixture which demonstrated versatile peptide structures which transitioned from random coil (H2 O) to α-helical (PBS) and turn-type (H2 O:TFE) conformations. Their biological properties were then evaluated by flow cytometry, enzyme-linked immunosorbent assays (ELISAs), and cell death assays. The occupancy of the synthetic peptides to a human NK cell line demonstrated comparable binding relative to the natural NKp30 ligand, B7H6, and the human anti-NKp30 monoclonal antibody (mAb), in a concentration dependent manner. A competitive binding assay between the human anti-NKp30 mAb or B7H6, and the synthetic peptides, demonstrated partial displacement of the ligands upon anti-NKp30 mAb treatment, suggesting NKp30 receptor specificities by the synthetic peptides. Moreover, the immunostimulatory activity of B7H6 was demonstrated by the secretion of the pro-inflammatory cytokines tumor necrosis factor-alfa (TNF-α) and interferon gamma (IFN-γ) by the human NK cell line. The

  12. B7-2 Expressed on EL4 Lymphoma Suppresses Antitumor Immunity by an Interleukin 4–dependent Mechanism

    Stremmel, C.; Greenfield, E.A.; Howard, E.; Freeman, G.J.; Kuchroo, V.K.

    1999-01-01

    For T cells to become functionally activated they require at least two signals. The B7 costimulatory molecules B7-1 and B7-2 provide the “second signal” pivotal for T cell activation. In this report, we studied the relative roles of B7-1 and B7-2 molecules in the induction of antitumor immunity to the T cell thymoma, EL4. We generated EL4 tumor cells that expressed B7-1, B7-2, and B7-1+B7-2 by transfecting murine cDNAs. Our results demonstrate that EL4–B7-1 cells are completely rejected in sy...

  13. B7-2 Expressed on EL4 Lymphoma Suppresses Antitumor Immunity by an Interleukin 4–dependent Mechanism

    Stremmel, C.; Greenfield, E.A.; Howard, E.; Freeman, G.J.; Kuchroo, V.K.

    1999-01-01

    For T cells to become functionally activated they require at least two signals. The B7 costimulatory molecules B7-1 and B7-2 provide the “second signal” pivotal for T cell activation. In this report, we studied the relative roles of B7-1 and B7-2 molecules in the induction of antitumor immunity to the T cell thymoma, EL4. We generated EL4 tumor cells that expressed B7-1, B7-2, and B7-1+B7-2 by transfecting murine cDNAs. Our results demonstrate that EL4–B7-1 cells are completely rejected in syngeneic mice. Unlike EL4–B7-1 cells, we find that EL4–B7-2 cells are not rejected but progressively grow in the mice. A B7-1– and B7-2–EL4 double transfectant was generated by introducing B7-2 cDNA into the EL4–B7-1 tumor line that regressed in vivo. The EL4–B7-1+B7-2 double transfectant was not rejected when implanted into syngeneic mice but progressively grew to produce tumors. The double transfectant EL4 cells could costimulate T cell proliferation that could be blocked by anti–B7-1 antibodies, anti–B7-2 antibodies, or hCTLA4 immunoglobulin, showing that the B7-1 and B7-2 molecules expressed on the EL4 cells were functional. In vivo, treatment of mice implanted with double-transfected EL4 cells with anti–B7-2 monoclonal antibody resulted in tumor rejection. Furthermore, the EL4–B7-2 and EL4–B7-1+B7-2 cells, but not the wild-type EL4 cells, were rejected in interleukin 4 (IL-4) knockout mice. Our data suggests that B7-2 expressed on some T cell tumors inhibits development of antitumor immunity, and IL-4 appears to play a critical role in abrogation of the antitumor immune response. PMID:10075975

  14. B7-2 expressed on EL4 lymphoma suppresses antitumor immunity by an interleukin 4-dependent mechanism.

    Stremmel, C; Greenfield, E A; Howard, E; Freeman, G J; Kuchroo, V K

    1999-03-15

    For T cells to become functionally activated they require at least two signals. The B7 costimulatory molecules B7-1 and B7-2 provide the "second signal" pivotal for T cell activation. In this report, we studied the relative roles of B7-1 and B7-2 molecules in the induction of antitumor immunity to the T cell thymoma, EL4. We generated EL4 tumor cells that expressed B7-1, B7-2, and B7-1+B7-2 by transfecting murine cDNAs. Our results demonstrate that EL4-B7-1 cells are completely rejected in syngeneic mice. Unlike EL4-B7-1 cells, we find that EL4-B7-2 cells are not rejected but progressively grow in the mice. A B7-1- and B7-2-EL4 double transfectant was generated by introducing B7-2 cDNA into the EL4-B7-1 tumor line that regressed in vivo. The EL4-B7-1+B7-2 double transfectant was not rejected when implanted into syngeneic mice but progressively grew to produce tumors. The double transfectant EL4 cells could costimulate T cell proliferation that could be blocked by anti-B7-1 antibodies, anti-B7-2 antibodies, or hCTLA4 immunoglobulin, showing that the B7-1 and B7-2 molecules expressed on the EL4 cells were functional. In vivo, treatment of mice implanted with double-transfected EL4 cells with anti-B7-2 monoclonal antibody resulted in tumor rejection. Furthermore, the EL4-B7-2 and EL4-B7-1+B7-2 cells, but not the wild-type EL4 cells, were rejected in interleukin 4 (IL-4) knockout mice. Our data suggests that B7-2 expressed on some T cell tumors inhibits development of antitumor immunity, and IL-4 appears to play a critical role in abrogation of the antitumor immune response.

  15. Turn key contracts

    Feretic, D.

    1975-01-01

    The aim of this summary is to point out some specific areas which have to be covered in a turn-key contract and which are of primarily interest to the buyer of a nuclear plant. It will be assumed that the buyer is utility company in a developing country and a plant supplier a company in an industrial country. (orig./FW) [de

  16. Turning to alcohol?

    Reiboro, S.K.

    1998-01-01

    Brazil is examining whether turning to alcohol could solve its problems. The fuel alcohol producers are lobbying hard for the government to increase the use of alcohol to fuel the country's cars. Not only does using alcohol reduce CO 2 , runs the argument, but the Kyoto agreement might just attract international financing for the project. (author)

  17. Comparative analysis of B7-1 and B7-2 expression in Langerhans cells: differential regulation by T helper type 1 and T helper type 2 cytokines.

    Kawamura, T; Furue, M

    1995-07-01

    Epidermal Langerhans cells (LC) are Ia-bearing potent antigen-presenting cells (APC) of dendritic cell lineage that play a crucial role in primary and secondary T cell-dependent immune responses. LC express several costimulatory molecules such as B7, which has been implicated as one of the important determinants of professional APC. Recently, B7 antigens have been shown to include three distinct molecules termed B7-1, B7-2, and B7-3, and the expression of B7-1 and B7-2 in LC has been already confirmed. However, little is known of the regulation of B7-1 and B7-2 expression in LC. We demonstrated that LC do not express B7-1 and B7-2 in situ; however, the expression of both molecules is rapidly induced during the first 3 days of culture, and high levels of expression are maintained at least until day 6. We show that the expression of B7-2 in LC is much higher than that of B7-1 in each experiment, and that B7-1 and B7-2 expression is reproducibly augmented by interleukin (IL)-4 in a dose-dependent manner; however, IL-2 affected expression very little. Finally, B7-1 expression is significantly and dose-dependently down-regulated by interferon (IFN)-gamma or IL-10, and B7-2 expression is consistently inhibited by IL-10, but not by IFN-gamma. The effects of these cytokines are active only in the induction phase (during first 3 days of culture) of B7 expression: the modulatory effects of cytokines are hardly detected in the plateau phase (days 4 to 6 of culture) of B7 expression in LC. These findings suggest that B7-1 and B7-2 expression are indeed selectively and differentially regulated by these T cell-derived cytokines, and that the cytokines may modulate the synthesis of B7 molecules rather than the degradation of already-expressed B7 molecules.

  18. Diamond turning of glass

    Blackley, W.S.; Scattergood, R.O.

    1988-12-01

    A new research initiative will be undertaken to investigate the critical cutting depth concepts for single point diamond turning of brittle, amorphous materials. Inorganic glasses and a brittle, thermoset polymer (organic glass) are the principal candidate materials. Interrupted cutting tests similar to those done in earlier research are Ge and Si crystals will be made to obtain critical depth values as a function of machining parameters. The results will provide systematic data with which to assess machining performance on glasses and amorphous materials

  19. Hydrodynamics of Turning Flocks

    Yang, Xingbo; Marchetti, M. Cristina

    2014-01-01

    We present a hydrodynamic model of flocking that generalizes the familiar Toner-Tu equations to incorporate turning inertia of well-polarized flocks. The continuum equations controlled by only two dimensionless parameters, orientational inertia and alignment strength, are derived by coarse graining the inertial spin model recently proposed by Cavagna et al. The interplay between orientational inertia and bend elasticity of the flock yields anisotropic spin waves that mediate the propagation o...

  20. A microbial transformation using Bacillus subtilis B7-S to produce natural vanillin from ferulic acid.

    Chen, Peng; Yan, Lei; Wu, Zhengrong; Li, Suyue; Bai, Zhongtian; Yan, Xiaojuan; Wang, Ningbo; Liang, Ning; Li, Hongyu

    2016-02-04

    Bacillus subtilis strain B7-S screened from18 strains is an aerobic, endospore-forming, model organism of Gram-positive bacteria which is capable to form vanillin during ferulic acid bioconversion. The bioconversion of ferulic acid to vanillin by Bacillus subtilis B7-S (B. subtilis B7-S) was investigated. Based on our results, the optimum bioconversion conditions for the production of vanillin by B. subtilis B7-S can be summarized as follows: temperature 35 °C; initial pH 9.0; inoculum volume 5%; ferulic acid concentration 0.6 g/L; volume of culture medium 20%; and shaking speed 200 r/min. Under these conditions, several repeated small-scale batch experiments showed that the maximum conversion efficiency was 63.30% after 3 h of bioconversion. The vanillin products were confirmed by spectral data achieved from UV-vis, inductively coupled plasma atomic emission spectroscope (ICP-AES) and Fourier transform infrared spectrometer (FT-IR) spectra. Scanning electron microscopy (SEM) and transmission electron spectroscopy (TEM) results confirmed that the cell surface of B. subtilis plays a role in the induction of ferulic acid tolerance. These results demonstrate that B. subtilis B7-S has the potential for use in vanillin production through bioconversion of ferulic acid.

  1. Turning lead into gold

    Jensen, Steffen Moltrup Ernø

    For years the field of entrepreneurship has been blinded by the alchemical promise of turning lead into gold, of finding the ones most likely to become the next Branson, Zuckerberg or Gates. The promise has been created in the midst of political and scientific agendas where certain individuals...... is not to accumulate state or market wealth, but for entrepreneurial skills to become tools towards the liberation of the individual from oppressive systems of control – essentially to add public value rather than economic value. In this presentation I will sketch an anarchist perspective on entrepreneurship, looking...

  2. Expression of the costimulatory molecule B7-H3 is associated with prolonged survival in human pancreatic cancer

    Loos, Martin; Hedderich, Dennis M; Ottenhausen, Malte; Giese, Nathalia A; Laschinger, Melanie; Esposito, Irene; Kleeff, Jörg; Friess, Helmut

    2009-01-01

    Costimulatory signaling has been implicated as a potential regulator of antitumor immunity in various human cancers. In contrast to the negative prognostic value of aberrant B7-H1 expression by pancreatic cancer cells, the role of B7-H3 is still unknown. Therefore, we investigated the expression pattern and clinical significance of B7-H3 expression in human pancreatic cancer. B7-H3 expression was evaluated by immunohistochemistry in 68 patients with pancreatic cancer who underwent surgical tumor resection. Expression data was correlated with clinicopathologic features and with the number of tumor-infiltrating T cells. B7-H3 expression was significantly upregulated in pancreatic cancer compared to normal pancreas (p < 0.05). In 60 of 68 examined tumors B7-H3 protein was detectable in pancreatic cancer cells. Patients with high tumor B7-H3 levels had a significantly better postoperative prognosis than patients with low tumor B7-H3 levels (p = 0.0067). Furthermore, tumor B7-H3 expression significantly correlated with the number of tumor-infiltrating CD8+ T cells (p = 0.018). We demonstrate for the first time that B7-H3 is abundantly expressed in pancreatic cancer and that tumor-associated B7-H3 expression significantly correlates with prolonged postoperative survival. Our findings suggest that B7-H3 might play an important role as a potential stimulator of antitumor immune response in pancreatic cancer

  3. Produksi, isolasi dan karakterisasi enzim dekstranase dari Arthrobacter sp. B7

    Afaf Baktir

    2012-02-01

    Full Text Available Dextranase enzyme has been purified and characterized from Arthrobacter sp. B7. This enzyme was purified from the culture supernatant of Arthrobacter sp. B7 by procedure of native PAGE. The molecular size of the enzyme was estimated 72,5 kDa by SDSPAGE. The N-terminal amino acid sequence of this enzyme determined using Edman degradation techniques were APVTADVGNLHT. SDS-PAGE and native-PAGE analysis revealed that the enzyme molecule consisted of one sub-unit.

  4. Fermilab turns 50! Congratulations!

    Staff Association

    2017-01-01

    This year Fermilab turns 50 and the celebrations are ongoing. The ties between CERN and Fermilab are numerous and have been ranging from competition between two labs at the forefront of their field, e.g. with the chase of the top quark, finally discovered by Fermilab, to outright collaboration, e.g. on LHC low-beta quadrupole magnet development and production and in the CMS collaboration. In June, in the name of the CERN staff and scientific community, the CERN Staff Association sent a message to the Fermilab staff and scientific community, through Dr. Nigel Lockyer, Fermilab Director. The letter, and the assurance from Nigel Lockyer that the message has been passed onto the Fermilab community can be found on our website. Congratulations to Fermilab on its fiftieth Anniversary, and to the staff and collaborators who made this laboratory through their hard work, dedication and vision!

  5. Virtual turning points

    Honda, Naofumi; Takei, Yoshitsugu

    2015-01-01

    The discovery of a virtual turning point truly is a breakthrough in WKB analysis of higher order differential equations. This monograph expounds the core part of its theory together with its application to the analysis of higher order Painlevé equations of the Noumi–Yamada type and to the analysis of non-adiabatic transition probability problems in three levels. As M.V. Fedoryuk once lamented, global asymptotic analysis of higher order differential equations had been thought to be impossible to construct. In 1982, however, H.L. Berk, W.M. Nevins, and K.V. Roberts published a remarkable paper in the Journal of Mathematical Physics indicating that the traditional Stokes geometry cannot globally describe the Stokes phenomena of solutions of higher order equations; a new Stokes curve is necessary.

  6. Identification of immunogenic HLA-B7 "Achilles' heel" epitopes within highly conserved regions of HIV

    De Groot, Anne S; Rivera, Daniel S; McMurry, Julie A

    2008-01-01

    Genetic polymorphisms in class I human leukocyte antigen molecules (HLA) have been shown to determine susceptibility to HIV infection as well as the rate of progression to AIDS. In particular, the HLA-B7 supertype has been shown to be associated with high viral loads and rapid progression to dise...

  7. 29 CFR 2530.200b-7 - Day of service for employees in the maritime industry.

    2010-07-01

    ... 29 Labor 9 2010-07-01 2010-07-01 false Day of service for employees in the maritime industry. 2530... BENEFIT PLANS Scope and General Provisions § 2530.200b-7 Day of service for employees in the maritime industry. (a) General rule. A day of service in the maritime industry which must, as a minimum, be counted...

  8. Enantioselective inhibition of carprofen towards UDP-glucuronosyltransferase (UGT) 2B7.

    Fang, Zhong-Ze; Wang, Haina; Cao, Yun-Feng; Sun, Dong-Xue; Wang, Li-Xuan; Hong, Mo; Huang, Ting; Chen, Jian-Xing; Zeng, Jia

    2015-03-01

    UDP-glucuronosyltransferases (UGTs)-catalyzed glucuronidation conjugation reaction plays an important role in the elimination of many important clinical drugs and endogenous substances. The present study aims to investigate the enantioselective inhibition of carprofen towards UGT isoforms. In vitro a recombinant UGT isoforms-catalyzed 4-methylumbelliferone (4-MU) glucuronidation incubation mixture was used to screen the inhibition potential of (R)-carprofen and (S)-carprofen towards multiple UGT isoforms. The results showed that (S)-carprofen exhibited stronger inhibition potential than (R)-carprofen towards UGT2B7. However, no significant difference was observed for the inhibition of (R)-carprofen and (S)-carprofen towards other UGT isoforms. Furthermore, the inhibition kinetic behavior was compared for the inhibition of (S)-carprofen and (R)-carprofen towards UGT2B7. A Lineweaver-Burk plot showed that both (S)-carprofen and (R)-carprofen exhibited competitive inhibition towards UGT2B7-catalyzed 4-MU glucuronidation. The inhibition kinetic parameter (Ki ) was calculated to be 7.0 μM and 31.1 μM for (S)-carprofen and (R)-carprofen, respectively. Based on the standard for drug-drug interaction, the threshold for (S)-carprofen and (R)-carprofen to induce a drug-drug interaction is 0.7 μM and 3.1 μM, respectively. In conclusion, enantioselective inhibition of carprofen towards UDP-glucuronosyltransferase (UGT) 2B7 was demonstrated in the present study. Using the in vitro inhibition kinetic parameter, the concentration threshold of (S)-carprofen and (R)-carprofen to possibly induce the drug-drug interaction was obtained. Therefore, clinical monitoring of the plasma concentration of (S)-carprofen is more important than (R)-carprofen to avoid a possible drug-drug interaction between carprofen and the drugs mainly undergoing UGT2B7-catalyzed metabolism. © 2014 Wiley Periodicals, Inc.

  9. Turn by Turn Measurements at the KEK-ATF

    Renier, Y; Tomas, R; Wendt, M; Eddy, N; Kubo, K; Kuroda, S; Naito, T; Okugi, T; Terunuma, N; Urakawa, J

    2013-01-01

    The ATF damping ring has been upgraded with new read-out electronics for the beam position monitors (BPM), capable to acquire the beam orbits on a turn-by-turn basis, as well as in a high resolution averaging mode. The new BPM system allows to improve optic corrections and to achieve an even smaller vertical emittance (<2pm). Experimental results are presented based on turn-by-turn beam orbit measurements in the ring, for estimating the β functions and dispersion along the lattice. A fast method to measure spectral line amplitude in a few turns is also presented, including the evaluation of chromaticity.

  10. The Potency of Dextranase from Arthrobacter sp. Strain B7 as Dental Plaque Removal

    AFAF BAKTIR

    2005-12-01

    Full Text Available Dextranase of Arthrobacter sp. strain B7 (B7DEX enzyme was characterized in this study. This enzyme hydrolyzed sucrose and dextran, but not other glucans (starch, nigeran, cellulose, -soluble glucan. It also hydrolyzed glucan from dental plaque with the activity of 7.38 + 0.66 U/ml, where the activity toward dextran was 31.88 + 1.24 U/ml. The enzyme exhibited the pH optimum of 7 and the temperature optimum of 50 oC. Its optimum stability was at pH 7 and 50 oC. The enzyme was inhibited by Fe3+, Cu2+, Zn2+, and Ag+, but not by the anionic detergent (SDS and the nonionic detergent (Triton-X. The enzyme was activated by Ca2+, Na+, Mg2+, and saliva.

  11. Potensi Enzim Dekstranase dari Arthrobacter sp. Galur B7 sebagai Penghambat Plak Gigi

    AFAF BAKTIR

    2005-12-01

    Full Text Available Dextranase of Arthrobacter sp. strain B7 (B7DEX enzyme was characterized in this study. This enzyme hydrolyzed sucrose and dextran, but not other glucans (starch, nigeran, cellulose, β-soluble glucan. It also hydrolyzed glucan from dental plaque with the activity of 7.38 ± 0.66 U/ml, where the activity toward dextran was 31.88 ± 1.24 U/ml. The enzyme exhibited the pH optimum of 7 and the temperature optimum of 50 °C. Its optimum stability was at pH 7 and 50 °C. The enzyme was inhibited by Fe3+, Cu2+, Zn2+, and Ag+, but not by the anionic detergent (SDS and the nonionic detergent (Triton-X. The enzyme was activated by Ca2+, Na+, Mg2+, and saliva.

  12. Mass and heat transfer on B7 ordered packing in hydrogen isotope separation by distillation

    Croitoru, Cornelia; Pop, Floarea; Titescu, Gheorghe; Stefanescu, Ioan; Trancota, Dan; Peculea, Marius

    2002-01-01

    This work presents theoretical and experimental data referring to mass and heat transfer on B7 ordered packing in deuterium isotope separation by distillation. The first part is devoted to the study of mass transfer in hydrogen isotopic distillation while the second one treats the mass and heat transfer in water isotopic distillation. A stationary mathematical model for the mass and heat transfer was developed based on multitubular column model with wet wall. This model allowed the calculation starting from theoretical data of the ordered packing efficiency, expressed by the transfer unit height, TUH. Also, from theoretical data the mass and heat transfer coefficients were determined. A test of the mathematical model was performed with the experimental data obtained from two laboratory installations for hydrogen isotope separation by distillation. From the first installation, experimental data concerning the B7 ordered packing efficiency were obtained for the deuterium separation by cryogenic distillation at the - 250 deg C level. With the second one data referring to the mass and heat transfer on the same packing were obtained for the deuterium separation by water distillation under vacuum at the 60 deg C level. The values of TUH, mass and heat transfer coefficients as theoretically evaluate and experimentally checked are in agreement with the respective values obtained in separation processes in chemical industry. This is the fact which endorses utilization of the model of multitubular column with wet wall for describing the transfer processes in distillation columns equipped with B7 ordered packing

  13. 17 CFR 240.15b7-3T - Operational capability in a Year 2000 environment.

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Operational capability in a Year 2000 environment. 240.15b7-3T Section 240.15b7-3T Commodity and Securities Exchanges SECURITIES... § 240.15b7-3T Operational capability in a Year 2000 environment. (a) This section applies to every...

  14. Expression of immunosuppresive B7-H3 ligand by hormone-treated prostate cancer tumors and metastases.

    Chavin, Grant; Sheinin, Yuri; Crispen, Paul L; Boorjian, Stephen A; Roth, Timothy J; Rangel, Laureano; Blute, Michael L; Sebo, Thomas J; Tindall, Don J; Kwon, Eugene D; Karnes, R Jeffrey

    2009-03-15

    Prostate cancer cells uniformly express the immune cell inhibitory B7-H3 ligand. Enhanced B7-H3 expression correlates with increased disease progression and cancer-specific death after radical prostatectomy (RP). To further assess whether B7-H3 expression is hormone regulated and persists as a viable target during (or after) androgen-ablative therapy, we examined B7-H3 ligand expression within primary and metastatic cancer lesions in response to neoadjuvant hormone therapy (NHT) or palliative hormone deprivation. Tumor B7-H3 in RP specimens from men treated with >/=3 months of NHT was compared with B7-H3 in tumors from matched patients who received no therapy before RP. Hormone-treated and untreated metastatic lesions involving bone were also compared for levels of B7-H3 expression. Of 165 consecutive RP specimens in each cohort studied, sufficient tissues were available for 148 patients (89.7%) treated with NHT versus 127 patients (77.0%) treated with surgery alone. B7-H3 was expressed in 142 (95.9%) tumors from NHT patients compared with 122 (96.0%) tumors from patients treated with surgery alone (P = 0.91). B7-H3 expression intensity in RP specimens was not affected by NHT (P = 0.12). Bone metastases from 11 (32.4%) untreated and 23 (67.6%) androgen-ablated patients revealed that B7-H3 expression increased in response to hormone therapy (P = 0.04) relative to untreated lesions. Taken together, B7-H3 expression seems to remain stable (or may even increase) in response to hormone therapy. As such, B7-H3 may represent an attractive target to improve treatment of men with high-risk hormone-treated or refractory prostate cancer.

  15. Sandstone Turning by Abrasive Waterjet

    Hlaváček, Petr; Cárach, J.; Hloch, Sergej; Vasilko, K.; Klichová, Dagmar; Klich, Jiří; Lehocká, D.

    2015-01-01

    Roč. 48, č. 6 (2015), s. 2489-2493 ISSN 0723-2632 R&D Projects: GA MŠk ED2.1.00/03.0082; GA MŠk(CZ) LO1406 Institutional support: RVO:68145535 Keywords : turning away from the jet * conventional turning towards the jet * sandstone * abrasive water jet Subject RIV: JQ - Machines ; Tools Impact factor: 2.386, year: 2015 http://www.springerprofessional.de/sandstone-turning-by-abrasive-waterjet/6038028.html

  16. The 10B (7Li, 7Be)10Be charge-exchange reaction

    Etchegoyen, A.

    1987-01-01

    It is analysed the mechanisms: direct charge-exchange through the two-body residual force (Q opt ∼ 0.2 MeV, which is close to the reaction Q-value of - 1,42 MeV); and single-Nucleon Knock-on exchange (SNKE) due to the intereacting nucleons being undistinguishable. These mechanisms are analysed in detail for producing 10 B ( 7 Li, 7 Be) 10 Be reaction. The experience was carried out at the Tandar Laboratory using conventional electronics. The elastic scattering was simultaneously measured in order to obtain an optical model parameter set. (M.C.K.) [pt

  17. The Philosophy of Turning Points

    Turcan, Romeo V.

    2013-01-01

    business and management field, the turning point is seen as a valuable unit of analysis within the research field. It is expected that this paper will encourage a dynamic scholarly conversation about the concept of turning point and how it can aid international business researchers in the development...

  18. Human muscle cells express a B7-related molecule, B7-H1, with strong negative immune regulatory potential: a novel mechanism of counterbalancing the immune attack in idiopathic inflammatory myopathies.

    Wiendl, Heinz; Mitsdoerffer, Meike; Schneider, Dagmar; Chen, Lieping; Lochmüller, Hanns; Melms, Arthur; Weller, Michael

    2003-10-01

    B7-H1 is a novel B7 family protein attributed to costimulatory and immune regulatory functions. Here we report that human myoblasts cultured from control subjects and patients with inflammatory myopathies as well as TE671 muscle rhabdomyosarcoma cells express high levels of B7-H1 after stimulation with the inflammatory cytokine IFN-gamma. Coculture experiments of MHC class I/II-positive myoblasts with CD4 and CD8 T cells in the presence of antigen demonstrated the functional consequences of muscle-related B7-H1 expression: production of inflammatory cytokines, IFN-gamma and IL-2, by CD4 as well CD8 T cells was markedly enhanced in the presence of a neutralizing anti-B7-H1 antibody. This observation was paralleled by an augmented expression of the T cell activation markers CD25, ICOS, and CD69, thus showing B7-H1-mediated inhibition of T cell activation. Further, we investigated 23 muscle biopsy specimens from patients with polymyositis (PM), inclusion body myositis (IBM), dermatomyositis (DM), and nonmyopathic controls for B7-H1 expression by immunohistochemistry: B7-H1 was expressed in PM, IBM, and DM specimens but not in noninflammatory and nonmyopathic controls. Staining was predominantly localized to areas of strong inflammation and to muscle cells as well as mononuclear cells. These data highlight the immune regulatory properties of muscle cells and suggest that B7-H1 expression represents an inhibitory mechanism induced upon inflammatory stimuli and aimed at protecting muscle fibers from immune aggression.

  19. Expression of fusion IL2-B7.1(IgV+C) and effects on T lymphocytes.

    Kong, Linghong; Li, Yaochen; Yang, Ye; Li, Kangsheng

    2007-12-01

    The search for an effective immunotherapeutic treatment for tumors is an important area of cancer research. To prepare a more effective form of the bifunctional fusion protein IL2-B7.1(IgV+C) and analyze its effect on the stimulation of T lymphocyte proliferation, we used DNAStar 5.03 software to predict the structural diversity and biochemical character of IL2-B7.1(IgV+C). We then prepared fusion protein IL2-B7.1(IgV+C) by establishing its prokaryotic expression system, and tested its effect on the stimulation of T lymphocytes in vitro. The results indicated that IL2-B7.1(IgV+C) correctly formed a secondary structure in which both IL2 and B7.1(IgV+C) maintained their original hydrophilicity and epitopes. Western blot analysis revealed that IL2-B7.1(IgV+C) was efficiently expressed. Our analysis of CTLL-2 and T-cell proliferation showed that recombinant human (rh) IL2-B7.1(IgV+C) exerted the combined stimulating effects of both rhIL2 and rh B7.1(IgV+C) on cell proliferation, and that these effects could be blocked by adding either anti-IL2 or anti-B7.1 monoclonal antibodies. A >2-fold increase in [3H]TdR incorporation compared with that of cells treated with recombinant protein IL2, or B7.1(IgV+C) alone, revealed that rhIL2-B7.1(IgV+C) had dose-dependent synergetic effects on T-cell activation in the presence of anti-CD3 monoclonal antibody. We concluded that the augmented potency of rhIL2-B7.1(IgV+C) resulted in a stronger stimulation of T-cell proliferation than either rhB7.1(IgV+C) or rhIL2 alone.

  20. Turning collectors for solar radiation

    Barak, Amitzur Z.

    1976-01-01

    A device is provided for turning a solar collector about the polar axis so that the collector is directed toward the sun as the sun tracks the sky each day. It includes two heat-expansive elements and a shadow plate. In the morning a first expansive element is heated, expands to turn the collector to face the sun, while the second expansive element is shaded by the plate. In the afternoon the second element is heated, expands to turn the collector to face the sun, while the first is shaded by the plate.

  1. The aldo-keto reductase AKR1B7 coexpresses with renin without influencing renin production and secretion.

    Machura, Katharina; Iankilevitch, Elina; Neubauer, Björn; Theuring, Franz; Kurtz, Armin

    2013-03-01

    On the basis of evidence that within the adult kidney, the aldo-keto reductase AKR1B7 (aldo-keto reductase family 1, member 7, also known as mouse vas deferens protein, MVDP) is selectively expressed in renin-producing cells, we aimed to define a possible role of AKR1B7 for the regulation and function of renin cells in the kidney. We could confirm colocalization and corecruitment of renin and of AKR1B7 in wild-type kidneys. Renin cells in AKR1B7-deficient kidneys showed normal morphology, numbers, and intrarenal distribution. Plasma renin concentration (PRC) and renin mRNA levels of AKR1B7-deficient mice were normal at standard chow and were lowered by a high-salt diet directly comparable to wild-type mice. Treatment with a low-salt diet in combination with an angiotensin-converting enzyme inhibitor strongly increased PRC and renin mRNA in a similar fashion both in AKR1B7-deficient and wild-type mice. Under this condition, we also observed a strong retrograde recruitment of renin-expressing cell along the preglomerular vessels, however, without a difference between AKR1B7-deficient and wild-type mice. The isolated perfused mouse kidney model was used to study the acute regulation of renin secretion by ANG II and by perfusion pressure. Regarding these parameters, no differences were observed between AKR1B7-deficient and wild-type kidneys. In summary, our data suggest that AKR1B7 is not of major relevance for the regulation of renin production and secretion in spite of its striking coregulation with renin expression.

  2. Turning around Newton's Second Law

    Goff, John Eric

    2004-01-01

    Conceptual and quantitative difficulties surrounding Newton's second law often arise among introductory physics students. Simply turning around how one expresses Newton's second law may assist students in their understanding of a deceptively simple-looking equation.

  3. What 'empirical turn in bioethics'?

    Hurst, Samia

    2010-10-01

    Uncertainty as to how we should articulate empirical data and normative reasoning seems to underlie most difficulties regarding the 'empirical turn' in bioethics. This article examines three different ways in which we could understand 'empirical turn'. Using real facts in normative reasoning is trivial and would not represent a 'turn'. Becoming an empirical discipline through a shift to the social and neurosciences would be a turn away from normative thinking, which we should not take. Conducting empirical research to inform normative reasoning is the usual meaning given to the term 'empirical turn'. In this sense, however, the turn is incomplete. Bioethics has imported methodological tools from empirical disciplines, but too often it has not imported the standards to which researchers in these disciplines are held. Integrating empirical and normative approaches also represents true added difficulties. Addressing these issues from the standpoint of debates on the fact-value distinction can cloud very real methodological concerns by displacing the debate to a level of abstraction where they need not be apparent. Ideally, empirical research in bioethics should meet standards for empirical and normative validity similar to those used in the source disciplines for these methods, and articulate these aspects clearly and appropriately. More modestly, criteria to ensure that none of these standards are completely left aside would improve the quality of empirical bioethics research and partly clear the air of critiques addressing its theoretical justification, when its rigour in the particularly difficult context of interdisciplinarity is what should be at stake.

  4. Clinical impact of the NKp30/B7-H6 axis in high-risk neuroblastoma patients.

    Semeraro, Michaela; Rusakiewicz, Sylvie; Minard-Colin, Véronique; Delahaye, Nicolas F; Enot, David; Vély, Frédéric; Marabelle, Aurélien; Papoular, Benjamin; Piperoglou, Christelle; Ponzoni, Mirco; Perri, Patrizia; Tchirkov, Andrei; Matta, Jessica; Lapierre, Valérie; Shekarian, Tala; Valsesia-Wittmann, Sandrine; Commo, Frédéric; Prada, Nicole; Poirier-Colame, Vichnou; Bressac, Brigitte; Cotteret, Sophie; Brugieres, Laurence; Farace, Françoise; Chaput, Nathalie; Kroemer, Guido; Valteau-Couanet, Dominique; Zitvogel, Laurence

    2015-04-15

    The immunosurveillance mechanisms governing high-risk neuroblastoma (HR-NB), a major pediatric malignancy, have been elusive. We identify a potential role for natural killer (NK) cells, in particular the interaction between the NK receptor NKp30 and its ligand, B7-H6, in the metastatic progression and survival of HR-NB after myeloablative multimodal chemotherapy and stem cell transplantation. NB cells expressing the NKp30 ligand B7-H6 stimulated NK cells in an NKp30-dependent manner. Serum concentration of soluble B7-H6 correlated with the down-regulation of NKp30, bone marrow metastases, and chemoresistance, and soluble B7-H6 contained in the serum of HR-NB patients inhibited NK cell functions in vitro. The expression of distinct NKp30 isoforms affecting the polarization of NK cell functions correlated with 10-year event-free survival in three independent cohorts of HR-NB in remission from metastases after induction chemotherapy (n = 196, P 18 months. We conclude that the interaction between NKp30 and B7-H6 may contribute to the fate of NB patients and that both the expression of NKp30 isoforms on circulating NK cells and the concentration of soluble B7-H6 in the serum may be clinically useful as biomarkers for risk stratification. Copyright © 2015, American Association for the Advancement of Science.

  5. [The value of B7-H4 and carcinoembryonic antigen in diagnosing the benign and malignant pleural effusion].

    Wei, F; Wei, Y; Li, L F; Li, G L; Wang, G J

    2017-07-23

    Objective: To evaluate the value of combined detection of negative costimulatory molecule B7-H4 and carcinoembryonic antigen (CEA) in diagnosing malignant and benign pleural effusion. Methods: Ninety-seven pleural effusion specimen were collected, 55 of which were diagnosed as malignant pleural effusion and 42 were benign pleural effusion. Enzyme-linked immunosorbent assay(ELISA) was used to examine the concentration of B7-H4 and CEA in pleural effusion. Electro-chemiluminescence immunoassay was used to detect the CEA level in pleural effusion. Receiver operating characteristic (ROC) curve was established to analyze and evaluate the single or combined detection of B7-H4 and CEA in diagnosing malignant and benign pleural effusion. Results: The concentrations of B7-H4 and CEA in malignant pleural effusion (MPE) group were (60.08±35.04) ng/ml and (41.49±37.16) ng/ml, respectively, obviously higher than (27.26±9.55) ng/ml and (2.41±0.94) ng/ml of benign pleural effusion (BPE) group (both P 37.25 ng/ml or CEA>4.18 ng/ml, the sensitivity of diagnosis as MPE was down-regulated to 90.9% and the specificity was elevated to 88.1%. When B7-H4 >37.25 ng/ml and CEA>4.18 ng/ml, the sensitivity of diagnosis as MPE was down-regulated to 78.2% and the specificity was elevated to 97.6%. The sensitivity and specificity of combined detection of B7-H4 and CEA to diagnose MPE were elevated to 90.9% and 97.6%, respectively. The level of B7-H4 in MPE and BPE were both positively correlated with CEA ( r =0.670, P =0.001 in MPE and r =0.002, P =0.001 in BEP). Conclusions: B7-H4 is a potential tumor marker in diagnosing the benign and malignant pleural effusion. Although the diagnostic value of B7-H4 may not precede to CEA, the combined detection of B7-H4 and CEA can improve the diagnostic sensitivity and specificity of MPE.

  6. The electrochemical reduction of biotin (vitamin B7) and conversion into its ester

    Lauw, Sherman J.L.; Ganguly, Rakesh; Webster, Richard D.

    2013-01-01

    Highlights: •Biotin can be reduced electrochemically, by one-electron, at a platinum electrode. •The reduction likely follows a direct discharge mechanism of the carboxyl group. •Electrochemically generated biotin carboxylate was reacted with iodomethane (91%). •ATR–FTIR characterization of biotin, its carboxylate anion, and its methyl ester. -- Abstract: An electrochemical study on biotin (vitamin B7), performed in aprotic solvents and at a platinum electrode, revealed that at approximately E f 0 =−1.6to−1.8 vs. (Fc/Fc + )/V (E f 0 =formal reduction potential and Fc=ferrocene), biotin is reduced by one-electron to form its carboxylate anion and dihydrogen via a direct discharge of the carboxylic acid at the platinum surface. The electrochemical reduction process appeared to be chemically reversible on the time-frame of cyclic voltammetry (CV) (t ≤ s), but not over the extended period of controlled potential electrolysis (CPE) (t ≥ min) where the conversion of biotin into its carboxylate anion was found to be chemically irreversible. A strategy to functionalize biotin's carboxyl group was established by performing a bulk reductive electrolysis, and then reacting the electrochemically generated carboxylate anion with iodomethane to afford biotin methyl ester in excellent yield (91%). Attenuated total reflectance–Fourier transform infrared (ATR–FTIR) spectroscopy was successful in identifying several distinct and characteristic carbonyl absorbance peaks associated with the analogous forms of biotin available before electrolysis, after electrolysis, and after methylation

  7. Human autologous in vitro models of glioma immunogene therapy using B7-2, GM-CSF, and IL12

    Parney, I.F.; Farr-Jones, M.A.; Kane, K.; Chang, L.-J.; Petruk, K.C.

    2002-01-01

    Cancer immunogene therapy is based on vaccination with radiated, autologous tumor cells transduced with immunostimulatory genes. To help determine an optimal glioma immunogene therapy strategy, we stimulated lymphocytes with autologous human glioma cells transduced with B7-2 (CD86), granulocyte-macrophage colony-stimulating factor (GM-CSF), and/or interleukin-12 (IL12). A human glioma-derived cell culture (Ed147.BT) was transduced with B7-2, GM-CSF, and/or IL12 using retroviral vectors. Autologous peripheral blood mononuclear cells (PBMC) were co-cultured with irradiated gene-transduced tumor alone or a combination of radiated wild type and gene-transduced cells. Peripheral blood mononuclear cells proliferation was determined by serial cell counts. Peripheral blood mononuclear cells phenotype was assessed by flow cytometry for CD4, CD8, and CD16. Anti-tumor cytotoxicity was determined by chromium-51 ( 51 Cr) release assay. Peripheral blood mononuclear cells cell numbers all decreased during primary stimulation but tumor cells expressing B7-2 or GM-CSF consistently caused secondary proliferation. Tumors expressing B7-2 and GM-CSF or B7-2,GM-CSF,and IL12 consistently increased PBMC CD8+ (cytotoxic T) and CD16+ (natural killer) percentages. Interestingly, anti-tumor cytotoxicity only exceeded that of PBMC stimulated with wild type tumor alone when peripheral blood mononuclear cells were stimulated with both wild type tumor and B7-2/GM-CSF- (but not IL12) transduced cells. PBMC proliferation and phenotype is altered as expected by exposure to immunostimulatory gene-transduced tumor. However, transduced tumor cells alone do not stimulate greater anti-tumor cytotoxicity than wild type tumor. Only B7-2/GM-CSF-transduced cells combined with wild type produced increased cytotoxicity. This may reflect selection of turnor subclones with limited antigenic spectra during retrovirus-mediated gene transfer. (author)

  8. The IgV domain of human B7-2 (CD86) is sufficient to co-stimulate T lymphocytes and induce cytokine secretion.

    Rennert, P; Furlong, K; Jellis, C; Greenfield, E; Freeman, G J; Ueda, Y; Levine, B; June, C H; Gray, G S

    1997-06-01

    B7-1 (CD80) and B7-2 (CD86) are genetically and structurally related molecules expressed on antigen-presenting cells. Both bind CD28 to co-stimulate T lymphocytes, resulting in proliferation and cytokine production. The extracellular portions of B7-1 and B7-2 which bind to CD28 and CTLA-4 are related to Ig variable (V) and Ig constant (C) domain sequences. Recent reports have described splice variant forms of B7 proteins which occur in vivo and are of unknown function. Here we describe soluble recombinant forms of B7-1 and B7-2 containing either both of the Ig-like extracellular domains or the individual IgV or IgC domains coupled to an Ig Fc tail. Soluble B7-1 and B7-2 bind to CD28 and CTLA-4, and effectively co-stimulate T lymphocytes resulting in their proliferation and the secretion of cytokines. Furthermore, the IgV domain of B7-2 binds CD28 and CTLA-4, competes with B7-1 and B7-2 for binding to these receptors, and co-stimulates T lymphocytes. Cross-linked soluble B7-2v was the most potent co-stimulatory molecule tested and was active at a concentration approximately 100-fold lower than cross-linked soluble B7-1 or B7-2 proteins. When bound to tosyl-activated beads, B7-2v was capable of sustaining multiple rounds of T cell expansion. These data complement the description of naturally occurring variants to suggest that T cell co-stimulation in vivo may be regulated by soluble or truncated forms of B7 proteins.

  9. Turn Management or Impression Management?

    ter Maat, Mark; Heylen, Dirk K.J.; Ruttkay, Z.M.; Kipp, M.; Nijholt, Antinus; Vilhjálmsson, H.H.

    2009-01-01

    We look at how some basic choices in the management of turns influence the impression that people get from an agent. We look at scales concerning personality, emotion and interpersonal stance. We do this by a person perception study, or rather an agent perception study, using simulated conversations

  10. Professional Employees Turn to Unions

    Chamot, Dennis

    1976-01-01

    White-collar and professional employees are increasingly turning to unions to combat their loss of independence as employees of large organizations. Managers should realize that they and professional employees have different viewpoints about job situations and that the current trend toward white-collar unionism is apt to continue. (JG)

  11. Why Does Hair Turn Gray?

    ... out, but people with naturally lighter hair are just as likely to go gray. From the time a person notices a few gray hairs, it may take more than 10 years for all of that person's hair to turn ... really believe that this happens. Just in case, try not to freak out your ...

  12. Phenomenology and the Empirical Turn

    Zwier, Jochem; Blok, Vincent; Lemmens, Pieter

    2016-01-01

    This paper provides a phenomenological analysis of postphenomenological philosophy of technology. While acknowledging that the results of its analyses are to be recognized as original, insightful, and valuable, we will argue that in its execution of the empirical turn, postphenomenology forfeits

  13. Epidermal growth factor receptor and B7-H3 expression in esophageal squamous tissues correlate to patient prognosis

    Song J

    2016-10-01

    Full Text Available Jianxiang Song,1,2,* Woda Shi,1,2,* Yajun Zhang,2 Mingzhong Sun,3 Xiaodong Liang,3,4 Shiying Zheng1 1Department of Cardiothoracic Surgery, The First Affiliated Hospital of Soochow University, Suzhou, Jiangsu Province, People’s Republic of China; 2Department of Cardiothoracic Surgery, 3Department of Clinical Laboratory, 4Department of Pathology, The Third People’s Hospital of Yancheng City, Yancheng, Jiangsu Province, People’s Republic of China *These authors contributed equally to this work Abstract: Biomarkers that can serve as diagnostic and prognostic indicators of esophageal squamous cell carcinoma (ESCC are urgently needed to help improve patient outcomes. Here, the expression of epidermal growth factor receptor (EGFR and costimulatory molecule B7-H3, both of which have been implicated in tumor onset and progression in certain tumors, was investigated in relation to the clinical characteristics and survival outcomes of patients with ESCC. ESCC tissue samples were analyzed for 100 patients. Tumor and patient characteristics were recorded. Tissues were investigated for EGFR and B7-H3 staining by immunohistochemistry. Patients were followed for up to 96 months to determine overall survival (OS and progression-free survival (PFS. High expression for EGFR (68.0% and B7-H3 (66.0% was observed in the majority of cases. High expression of either EGFR or B7-H3 was correlated with tumor invasion depth and clinical stage (P<0.05. Further, high expression of either EGFR or B7-H3 was correlated with worse survival outcomes. The estimated OS (38.1 months and PFS (13.4 months of patients with high expression of EGFR were lower than those of patients with low expression (69.3 and 68.1 months, P<0.05. The estimated OS (31.1 months and PFS (13.1 months of patients with high expression of B7-H3 were also lower than those of patients with low expression (69.3 and 66.6 months, P<0.05. Indeed, Cox multiple regression showed that OS and PFS were

  14. Inhibition effect of B7-H1 gene-modified regulatory dendritic cells on thyroid-associated ophthalmopathy in mice

    Hua-Xin Chen

    2014-10-01

    Full Text Available AIM:To construct adenovirus vector expressing mice B7-H1 gene, transfect dendritic cells(DCs, and to study the therapeutic effect of modified DC on thyroid-associated ophthalmopathy(TAOin mice.METHODS: We designed and constructed B7-H1 gene adenovirus expression vector, and transfected DCs from mouse bone marrow, tested the phenotype and function of modified DCs, identificated its negative regulation to immune responses. The modified DCs were infected the sicked mice. And then the immunotherapeutic effect of modified DCs to TAO were tested. RESULTS: B7-H1 gene adenovirus vector was constructed and transfected DCs from bone marrow. The titer of the recombinant adenovirus was 1.8×109PFU/mL. B7-H1 gene modified DCs characteristics of regulatory DCs, could inhibit positive immune responses. The inhibition proceeding of TAO into mice infected modified DCs, was obviously prior to the control mice. The gene modified DCs, maybe become the new immunotherapy biological agent to thy TAO.CONCLUSION: We constructed the expression of mouse B7-H1 gene adenovirus expressed vector successfully, transfected DCs,by vector have properties of regulatory DCs, inhibiting positive immune response and the occurrence and development of thyroid eye disease. Gene modified DCs, reveal potent to the treatment of thyroid eye disease.

  15. SCN1A, ABCC2 and UGT2B7 gene polymorphisms in association with individualized oxcarbazepine therapy.

    Ma, Chun-Lai; Wu, Xun-Yi; Jiao, Zheng; Hong, Zhen; Wu, Zhi-Yuan; Zhong, Ming-Kang

    2015-01-01

    Associations between the effects of SCN1A, SCN2A, ABCC2 and UGT2B7 genetic polymorphisms and oxcarbazepine (OXC) maintenance doses in Han Chinese epileptic patients were investigated. Genetic polymorphisms were detected in 184 epileptic patients receiving OXC monotherapy by high-resolution melting curve and TaqMan method. Carriers of the SCN1A IVS5-91G>A, UGT2B7 c.802T>C and ABCC2 c.1249G>A variant alleles required significantly higher OXC maintenance doses than noncarriers (p GA > AA. SCN1A, UGT2B7 and ABCC2 genetic polymorphisms are associated with OXC maintenance doses and may be useful for the personalization of OXC therapy in epileptic patients. Further studies are needed. Original submitted 6 June 2014; Revision submitted 5 September 2014.

  16. B7-H4-Ig treatment of normal mice changes lymphocyte homeostasis and increases the potential of regulatory T cells

    Kristensen, Nanna N; Schmidt, Esben G W; Rasmussen, Susanne

    2013-01-01

    Enteroantigens (eAgs) drive tolerogenic and inflammatory immune responses in the gut and are of importance for sustained immune homeostasis in colonic mucosa. Decline of regulatory activity in the gut mucosa might result in chronic colitis. B7-H4 is a co-inhibitory receptor expressed by professio......Enteroantigens (eAgs) drive tolerogenic and inflammatory immune responses in the gut and are of importance for sustained immune homeostasis in colonic mucosa. Decline of regulatory activity in the gut mucosa might result in chronic colitis. B7-H4 is a co-inhibitory receptor expressed...... of severe combined immune-deficient (SCID) mice undergoing T cell transfer colitis did not influence the course of disease probably reflecting the lack of Tregs in this model of chronic colitis. In conclusion, we show that treatment with B7-H4-Ig in vivo changes lymphocyte homeostasis and increases...

  17. Diagnostic value of soluble B7-H4 and carcinoembryonic antigen in distinguishing malignant from benign pleural effusion.

    Jing, Xiaogang; Wei, Fei; Li, Jing; Dai, Lingling; Wang, Xi; Jia, Liuqun; Wang, Huan; An, Lin; Yang, Yuanjian; Zhang, Guojun; Cheng, Zhe

    2018-03-01

    To explore the diagnostic value of joint detection of soluble B7-H4 (sB7-H4) and carcinoembryonic antigen (CEA) in identifying malignant pleural effusion (MPE) from benign pleural effusion (BPE). A total of 97 patients with pleural effusion specimens were enrolled from The First Affiliated Hospital of Zhengzhou University between June 2014 and December 2015. All cases were categorized into malignant pleural effusion group (n = 55) and benign pleural effusion group (n = 42) according to etiologies. Enzyme-linked immunosorbent assay was applied to examine the levels of sB7-H4 in pleural effusion and meanwhile CEA concentrations were detected by electro-chemiluminescence immunoassays. Receiver operating characteristic (ROC) curve was established to assess the diagnostic value of sB7-H4 and CEA in pleural effusion. The correlation between sB7-H4 and CEA levels was analyzed by Pearson's product-moment. The concentrations of sB7-H4 and CEA in MPE exhibited obviously higher than those of BPE ([60.08 ± 35.04] vs. [27.26 ± 9.55] ng/ml, P = .000; [41.49 ± 37.16] vs. [2.41 ± 0.94] ng/ml, P = .000). The AUC area under ROC curve of sB7-H4 and CEA was 0.884 and 0.954, respectively. Two cutoff values by ROC curve analysis of sB7-H4 36.5 ng/ml and CEA 4.18 ng/ml were obtained, with a corresponding sensitivity (81.82%, 87.28%), specificity (90.48%, 95.24%), accuracy (85.57%, 90.72%), positive predictive value (PPV) (91.84%, 96.0%), negative predictive value (NPV) (79.17%, 85.11%), positive likelihood ratio (PLR) (8.614, 18.327), and negative likelihood ratio (NLR) (0.201, 0.134). When sB7-H4 and CEA were combined to detect pleural effusion, it obtained a higher sensitivity 90.91% and specificity 97.62%. Furthermore, correlation analysis result showed that the level of sB7-H4 was correlated with CEA level (r = .770, P = .000). sB7-H4 was a potentially valuable tumor marker in the differentiation between BPE and MPE. The combined detection of sB7-H4 and

  18. Diamond turning machine controller implementation

    Garrard, K.P.; Taylor, L.W.; Knight, B.F.; Fornaro, R.J.

    1988-12-01

    The standard controller for a Pnuemo ASG 2500 Diamond Turning Machine, an Allen Bradley 8200, has been replaced with a custom high-performance design. This controller consists of four major components. Axis position feedback information is provided by a Zygo Axiom 2/20 laser interferometer with 0.1 micro-inch resolution. Hardware interface logic couples the computers digital and analog I/O channels to the diamond turning machine`s analog motor controllers, the laser interferometer, and other machine status and control information. It also provides front panel switches for operator override of the computer controller and implement the emergency stop sequence. The remaining two components, the control computer hardware and software, are discussed in detail below.

  19. Association between UGT2B7 gene polymorphisms and fentanyl sensitivity in patients undergoing painful orthognathic surgery

    Muraoka, Wataru; Nishizawa, Daisuke; Fukuda, Kenichi; Kasai, Shinya; Hasegawa, Junko; Wajima, Koichi; Nakagawa, Taneaki

    2016-01-01

    Background Fentanyl is often used instead of morphine for the treatment of pain because it has fewer side effects. The metabolism of morphine by glucuronidation is known to be influenced by polymorphisms of the UGT2B7 gene. Some metabolic products of fentanyl are reportedly metabolized by glucuronate conjugation. The genes that are involved in the metabolic pathway of fentanyl may also influence fentanyl sensitivity. We analyzed associations between fentanyl sensitivity and polymorphisms of the UGT2B7 gene to clarify the hereditary determinants of individual differences in fentanyl sensitivity. Results This study examined whether single-nucleotide polymorphisms (SNPs) of the UGT2B7 gene affect cold pain sensitivity and the analgesic effects of fentanyl, evaluated by a standardized pain test and fentanyl requirements in healthy Japanese subjects who underwent uniform surgical procedures. The rs7439366 SNP of UGT2B7 is reportedly associated with the metabolism and analgesic effects of morphine. We found that this SNP is also associated with the analgesic effects of fentanyl in the cold pressor-induced pain test. It suggested that the C allele of the rs7439366 SNP may enhance analgesic efficacy. Two SNPs of UGT2B7, rs4587017 and rs1002849, were also found to be novel SNPs that may influence the analgesic effects of fentanyl in the cold pressor-induced pain test. Conclusions Fentanyl sensitivity for cold pressor-induced pain was associated with the rs7439366, rs4587017, and rs1002849 SNPs of the UGT2B7 gene. Our findings may provide valuable information for achieving satisfactory pain control and open to new avenues for personalized pain treatment. PMID:28256933

  20. Diamond turning of thermoplastic polymers

    Smith, E.; Scattergood, R.O.

    1988-12-01

    Single point diamond turning studies were made using a series of thermoplastic polymers with different glass transition temperatures. Variations in surface morphology and surface roughness were observed as a function of cutting speed. Lower glass transition temperatures facilitate smoother surface cuts and better surface finish. This can be attributed to the frictional heating that occurs during machining. Because of the very low glass transition temperatures in polymeric compared to inorganic glasses, the precision machining response can be very speed sensitive.

  1. Turning points in reactor design

    Beckjord, E.S.

    1995-01-01

    This article provides some historical aspects on nuclear reactor design, beginning with PWR development for Naval Propulsion and the first commercial application at Yankee Rowe. Five turning points in reactor design and some safety problems associated with them are reviewed: (1) stability of Dresden-1, (2) ECCS, (3) PRA, (4) TMI-2, and (5) advanced passive LWR designs. While the emphasis is on the thermal-hydraulic aspects, the discussion is also about reactor systems

  2. Turning points in reactor design

    Beckjord, E.S.

    1995-09-01

    This article provides some historical aspects on nuclear reactor design, beginning with PWR development for Naval Propulsion and the first commercial application at Yankee Rowe. Five turning points in reactor design and some safety problems associated with them are reviewed: (1) stability of Dresden-1, (2) ECCS, (3) PRA, (4) TMI-2, and (5) advanced passive LWR designs. While the emphasis is on the thermal-hydraulic aspects, the discussion is also about reactor systems.

  3. Turning for Ulcer Reduction (TURN) Study: An Economic Analysis.

    Paulden, Mike; Bergstrom, Nancy; Horn, Susan D; Rapp, Mary; Stern, Anita; Barrett, Ryan; Watkiss, Michael; Krahn, Murray

    2014-01-01

    The Turning for Ulcer Reduction (TURN) study was a multisite, randomized controlled trial that aimed to determine the optimal frequency of turning nursing facility residents with mobility limitations who are at moderate and high risk for pressure ulcer (PrU) development. Here we present data from the economic analysis. This economic analysis aims to estimate the economic consequences for Ontario of switching from a repositioning schedule of 2-hour intervals to a schedule of 3-hour or 4-hour intervals. Costs considered in the analysis included those associated with nursing staff time spent repositioning residents and with incontinent care supplies, which included briefs, barrier cream, and washcloths. The total economic benefit of switching to 3-hour or 4-hour repositioning is estimated to be $11.05 or $16.74 per day, respectively, for every resident at moderate or high risk of developing PrUs. For a typical facility with 123 residents, 41 (33%) of whom are at moderate or high risk of developing PrUs, the total economic benefit is estimated to be $453 daily for 3-hour or $686 daily for 4-hour repositioning. For Ontario as a whole, assuming that there are 77,933 residents at 634 LTC facilities, 25,927 (33%) of whom are at moderate or high risk of developing PrUs, the total economic benefits of switching to 3-hour or 4-hour repositioning are estimated to be $286,420 or $433,913 daily, respectively, equivalent to $104.5 million or $158.4 million per year. We did not consider the savings the Ontario Ministry of Health and Long-Term Care might incur should less frequent repositioning reduce the incidence of work-related injury among nursing staff, so our findings are potentially conservative. A switch to 3-hour or 4-hour repositioning appears likely to yield substantial economic benefits to Ontario without placing residents at greater risk of developing PrUs.

  4. Synthesis of new dithiacobaltaborane clusters derived from arachno-6,8-S2B7H9

    Kang, S.O.; Sneddon, L.G.

    1988-01-01

    A series of air-stable dithiacobaltaborane clusters has been isolated from either the reaction of the arachno-S 2 B 7 H 8 - anion with cobalt chloride and pentamethylcyclopentadienide or the reaction of neutral arachno-6,8-S 2 B 7 H 9 with cobalt atoms and pentamethylcyclopentadiene. Thus, the reaction of arachno-S 2 B 7 H 8 - with CoCl 2 and C 5 (CH 3 ) 5 - in THF gave, as the major products, the triple-decker compound nido-4,6-η-C 5 (CH 3 ) 52 Co 2 -3,5-S 2 B 2 H 2 (I) and the 11-vertex cluster nido-8,10(η-C 5 (CH 3 ) 5 ) 2 Co 2 -7,9-S 2 B 7 H 7 (III). Also isolated in smaller amounts were a chloride derivative of I, nido-1-Cl-4,6-(η-C 5 (CH 3 ) 5 ) 2 Co 2 -3,5-S 2 B 2 H (II), two isomers of III, nido-3,10-(η-C 5 (CH 3 ) 5 ) 2 Co 2 -7,9-S 2 B 7 H 7 (IV) and nido-3,5-(η-C 5 (CH 3 ) 5 ) 2 Co 2 -7,9-S 2 B 7 H 7 (V), and the eight-boron cluster nido-8-(η-C 5 (CH 3 ) 5 )Co-7,9-S 2 B 8 H 8 (VI). Other trace products of the reaction included the six-boron clusters nido-5,8-(η-C 5 (CH 3 ) 5 ) 2 Co 2 -6,9-S 2 B 6 H 6 (VII) and arachno-7-(η-C 5 (CH 3 ) 5 )Co-6,8-S 2 B 6 H 8 (VIII). Compound III was found to isomerize at 250 degree C to IV, which could then be converted to V at 300 degree C. The reaction of cobalt atoms with arachno-6,8-S 2 B 7 H 9 in the presence of pentamethylcyclopentadiene gave VIII as the major product; however, a number of other clusters including I, V, VI, and [(η-C 5 (CH 3 ) 5 ) 2 Co] + [(SB 10 H 10 ) 2 Co] - were isolated in trace amounts. 16 references, 6 figures, 3 tables

  5. Reverse of Acute and Chronic Morphine Tolerance by Lithocholic Acid via Down-regulating UGT2B7

    Zizhao Yang

    2016-11-01

    Full Text Available Lithocholic acid (LCA deposited in human livers always induces drastic pains which need analgesic drug, like morphine to release. Our research showed that LCA can effectively inhibit uridine 5'-diphospho-glucuronosyltransferase 2B7 (UGT2B7 in morphine tolerance-like human normal liver cells, HL-7702, then increase μ-opioid receptor (MOR and calcium-calmodulin dependent protein kinase IIα (CaMKIIα expression. In vivo assay, UGT2B7 was significantly repressed in the livers of acute or chronic morphine tolerance mice pretreated with LCA (10, 50 and 100 mg/kg, p.o.. To investigate the connections between LCA function performance and changes of UGT2B7 enzymatic activity in mice livers, two morphine metabolites, morphine-3-glucuronide (M3G and morphine-6-glucuronide (M6G were quantified by solid phase extraction (SPE-HPLC-MS/MS. The result indicated no matter in acute or chronic morphine tolerance, the concentrations of M3G and M6G were all decreased, the later one fell even more. Besides that, 50mg/kg of LCA administration can prevent auto-phosphorylation of CaMKIIα at Thr286 in acute or chronic morphine tolerance mice prefrontal cortexes (mPFCs due to synthesis increase of cyclic adenosine monophosphate (cAMP. As a consequence, UGT2B7 depression mediated by LCA can affect its selective catalysis ability to morphine, that may be responsible to acute or chronic morphine tolerance alleviation. These findings might assist to modify antinociception of morphine in clinic.

  6. Effect of UGT2B7*2 and CYP2C8*4 polymorphisms on diclofenac metabolism.

    Lazarska, Katarzyna E; Dekker, Stefan J; Vermeulen, Nico P E; Commandeur, Jan N M

    2018-03-01

    The use of diclofenac is associated with rare but severe drug-induced liver injury (DILI) in a very small number of patients. The factors which predispose susceptible patients to hepatotoxicity of diclofenac are still incompletely understood. Formation of protein-reactive metabolites by UDP-glucuronosyl transferases and cytochromes P450 is commonly considered to play an important role, as indicated by the detection of covalent protein adducts and antibodies in the serum of patients suffering from diclofenac-induced liver injury. Since no associations have been found with HLA-alleles, polymorphisms of genes encoding for proteins involved in the disposition of diclofenac may be important. Previous association studies showed that possession of the UGT2B7*2 and CYP2C8*4 alleles is more common in cases of diclofenac-induced DILI. In the present study, the metabolism of diclofenac by UGT2B7*2 and CYP2C8*4 was compared with their corresponding wild-type enzymes. Enzyme kinetic analysis revealed that recombinant UGT2B7*2 showed an almost 6-fold lower intrinsic clearance of diclofenac glucuronidation compared to UGT2B7*1. The mutant CYP2C8*4 showed approximately 35% reduced activity in the 4'-hydroxylation of diclofenac acyl glucuronide. Therefore, a decreased hepatic exposure to diclofenac acyl glucuronide is expected in patients with the UGT2B7*2 genotype. The increased risk for hepatotoxicity, therefore, might be the result from a shift to oxidative bioactivation to cytotoxic quinoneimines. Copyright © 2017 The Author(s). Published by Elsevier B.V. All rights reserved.

  7. Turning nuclear communications inside out

    Besenyei, Elisabeth; Czibolya, Laszlo

    2002-01-01

    Due to debates on the security of energy supply in the European Union, the international efforts on the implementation of Kyoto protocol and the forthcoming liberalization of the electrical energy market the attention of Hungarian decision-makers was focused on energy related problems. Discussions started on the future role of nuclear power and anti-nuclear environmentalists became more active in their criticism. Changes were needed in the approach and practice of communication on nuclear energy. Previous practice turned to be inefficient in dialogue with different social and influential groups. Public information could not be considered any more as an activity explaining measures to cope with incidents and accidents or giving technical answers to mostly superficial statements on allegedly unsafe features and solutions in nuclear industry. It was time to change the paradigm and to turn the communication into a powerful tool to put forward the arguments, to show the achievements and facts and to explain the efforts in addressing public concerns. The new paradigm turned the previous outside-in approach to a new inside-out type of behavior. Instead of reacting to the attacks coming from outside the new approach means first of all commitment to be open and pro-active in communication and to act in close cooperation with all interested organizations and institutions. The three pillars of the new paradigm, commitment, communication and co-operation are applicable not only for the nuclear industry, but also for the governmental agencies (regulatory bodies, health and emergency authorities etc.) and for the wide range of technical, scientific and civil organizations. Public information should be turned from a burden to a challenge for open, technically valid and honest dialogue. This active communication approach is illustrated by some new initiatives in public information in Hungary. Following the successful Nuclear Academy for Journalists formed new Section of Nuclear

  8. Production and Testing of the VITAMIN-B7 Fine-Group and BUGLE-B7 Broad-Group Coupled Neutron/Gamma Cross-Section Libraries Derived from ENDF/B-VII.0 Nuclear Data

    Risner, J. M. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Wiarda, D. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Dunn, M. E. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Miller, T. M. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Peplow, D. E. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Patton, B. W. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2011-09-30

    New coupled neutron-gamma cross-section libraries have been developed for use in light water reactor (LWR) shielding applications, including pressure vessel dosimetry calculations. The libraries, which were generated using Evaluated Nuclear Data File/B Version VII Release 0 (ENDF/B-VII.0), use the same fine-group and broad-group energy structures as the VITAMIN-B6 and BUGLE-96 libraries. The processing methodology used to generate both libraries is based on the methods used to develop VITAMIN-B6 and BUGLE-96 and is consistent with ANSI/ANS 6.1.2. The ENDF data were first processed into the fine-group pseudo-problem-independent VITAMIN-B7 library and then collapsed into the broad-group BUGLE-B7 library. The VITAMIN-B7 library contains data for 391 nuclides. This represents a significant increase compared to the VITAMIN-B6 library, which contained data for 120 nuclides. The BUGLE-B7 library contains data for the same nuclides as BUGLE-96, and maintains the same numeric IDs for those nuclides. The broad-group data includes nuclides which are infinitely dilute and group collapsed using a concrete weighting spectrum, as well as nuclides which are self-shielded and group collapsed using weighting spectra representative of important regions of LWRs. The verification and validation of the new libraries includes a set of critical benchmark experiments, a set of regression tests that are used to evaluate multigroup crosssection libraries in the SCALE code system, and three pressure vessel dosimetry benchmarks. Results of these tests confirm that the new libraries are appropriate for use in LWR shielding analyses and meet the requirements of Regulatory Guide 1.190.

  9. B7-H4 gene polymorphisms are associated with sporadic breast cancer in a Chinese Han population

    Fu Zhenkun

    2009-11-01

    Full Text Available Abstract Background B7-H4, a co-inhibitory molecule of the B7 family, can restrain T cell proliferation, cytokine secretion and the development of cytotoxicity. B7-H4 is expressed in tumor tissues at a higher level than in normal tissues, and has a potential effect to protect tumors from anti-tumor immune responses. This case-control study was carried out to determine the potential influences of B7-H4 gene polymorphisms on the susceptibility and progression of breast cancer in Han women of Northeast China. Methods We genotyped three B7-H4 variants (rs10754339, rs10801935 and rs3738414 and tagged all common haplotypes (frequency greater than or equal to 1% in a Chinese population consisting of 500 breast cancer cases and 504 control individuals matched for age. Polymerase chain reaction-restriction fragment length polymorphism (PCR-RFLP technique was used to determine the genotypes. Results Our data indicated that, compared with the common genotype and allele of each SNP, the rs10754339 AG genotype and G allele showed a significantly increased risk of breast cancer (OR = 1.455, 95% CI 1.119-1.892; OR = 1.325, 95% CI 1.073-1.637, respectively. The rs10801935 CC genotype, the rs3738414 AA genotype and the rs3738414 A allele were associated with a significantly decreased risk of breast cancer (OR = 0.328, 95% CI 0.145-0.739; OR = 0.412, 95% CI 0.203-0.835; OR = 0.698, 95% CI 0.564-0.864, respectively. Additionally, the rs10754339 GG genotype was significantly associated with lymph node metastasis and PR status, and the G allele and the AG genotype were respectively associated with lymph node metastasis and ER status. In haplotype analysis, we observed that compared with the AAG haplotype, the AAA haplotype showed a significantly decreased risk of breast cancer (OR = 0.689, 95% CI 0.539-0.881, but the GAG haplotype was associated with a significantly increased risk of breast cancer (OR = 1.511, 95% CI 1.125-2.031. And the AAA and the GCG haplotypes

  10. B7-H4 gene polymorphisms are associated with sporadic breast cancer in a Chinese Han population

    Zhang, Jie; Zhang, Mingyan; Jiang, Wei; Wang, Lihong; Fu, Zhenkun; Li, Dalin; Pang, Da; Li, Dianjun

    2009-01-01

    B7-H4, a co-inhibitory molecule of the B7 family, can restrain T cell proliferation, cytokine secretion and the development of cytotoxicity. B7-H4 is expressed in tumor tissues at a higher level than in normal tissues, and has a potential effect to protect tumors from anti-tumor immune responses. This case-control study was carried out to determine the potential influences of B7-H4 gene polymorphisms on the susceptibility and progression of breast cancer in Han women of Northeast China. We genotyped three B7-H4 variants (rs10754339, rs10801935 and rs3738414) and tagged all common haplotypes (frequency greater than or equal to 1%) in a Chinese population consisting of 500 breast cancer cases and 504 control individuals matched for age. Polymerase chain reaction-restriction fragment length polymorphism (PCR-RFLP) technique was used to determine the genotypes. Our data indicated that, compared with the common genotype and allele of each SNP, the rs10754339 AG genotype and G allele showed a significantly increased risk of breast cancer (OR = 1.455, 95% CI 1.119-1.892; OR = 1.325, 95% CI 1.073-1.637, respectively). The rs10801935 CC genotype, the rs3738414 AA genotype and the rs3738414 A allele were associated with a significantly decreased risk of breast cancer (OR = 0.328, 95% CI 0.145-0.739; OR = 0.412, 95% CI 0.203-0.835; OR = 0.698, 95% CI 0.564-0.864, respectively). Additionally, the rs10754339 GG genotype was significantly associated with lymph node metastasis and PR status, and the G allele and the AG genotype were respectively associated with lymph node metastasis and ER status. In haplotype analysis, we observed that compared with the AAG haplotype, the AAA haplotype showed a significantly decreased risk of breast cancer (OR = 0.689, 95% CI 0.539-0.881), but the GAG haplotype was associated with a significantly increased risk of breast cancer (OR = 1.511, 95% CI 1.125-2.031). And the AAA and the GCG haplotypes also respectively have significant influences on

  11. Recombinant human B7.2 IgV-like domain expressed in bacteria maintains its co-stimulatory activity in vitro.

    Yan, Xiaocai; Ma, Jun; Zheng, Jin; Lai, Baochang; Geng, Yiping; Wang, Yili; Si, Lüsheng

    2002-07-01

    To investigate which of the two immunoglobulin (Ig)-like domains, the immunoglobulin variable region homologous domain IgV (hB7.2 IgV) and the immunoglobulin constant region homologous domain IgC (hB7.2 IgC) on the human B7.2 molecule contains receptor binding sites, and to evaluate whether the B7.2 protein expressed in bacteria has biological activity in vitro. Three fragments of hB7.2 IgV,hB7.2 IgC and the complete extracellular region of human B7.2 containing both the IgV and IgC domains,hB7.2 Ig (V+C), were amplified by PCR and subcloned into pGEM-Teasy. Three recombinants,pGEX-4T-3-hB7.2 IgV,pGEX-4T-3-hB7.2 IgC and pGEX-4T-3-hB7.2 Ig (V+C), were generated by cloning the fragments into a prokaryote expression plasmid (pGEX-4T-3) and transformed into the host strain E. coli DH5alpha. The relevant target fusion proteins consisting of GST and hB7.2 IgV,hB7.2 IgC and hB7.2 Ig (V+C), were identified by SDS-PAGE and Western blotting. With the presence of the first signal imitated by anti-CD3 antibody, T cell activation was observed by exposing purified T lymphocytes to each soluble form of the three bacterially-produced human B7.2 fusion proteins by [(3)H]-TdR incorporation. Three recombinant fusion proteins of human B7.2, GST-hB7.2 IgV, GST-hB7.2 IgC and GST-hB7.2 Ig (V+C) were produced and detected in inclusion body form from engineered bacteria. With the first signal present,T lymphocytes proliferated when co-stimulated by bacterially-produced either GST-hB7.2 Ig (V+C) or GST-hB7.2 IgV fusion proteins, but not by GST-hB7.2 IgC. Functional human B7.2 fusion protein can be produced in bacteria. The IgV-like domain of human B7.2 is sufficient for B7.2 to interact with its counter-receptors and co-stimulate T lymphocytes.

  12. Mass and heat transfer on B7 structured packing in the separation of hydrogen isotopes by distillation

    Croitoru, C.; Pop, F.; Titescu, Gh.; Culcer, M.; Iliescu, M.; Stefanescu, I.; Trancota, D.; Peculea, M.

    2002-01-01

    The paper presents theoretical and experimental data concerning mass and heat transfer on B7 ordered packing, at deuterium separation by distillation. The first section of the paper is dedicated to the mass transfer study of hydrogen distillation, while the second section deals with mass and heat transfer in water distillation. A mathematical model was worked out and compared with experimental data, obtained from two laboratory distillation plants for deuterium separation. From the first plant experimental data concerning B7 ordered packing efficiency of hydrogen cryogenic distillation at 250 deg. C level were obtained. Data concerning mass and heat transfer on the same packing in deuterium separation by water vacuum distillation at 60 deg. C level were obtained in the second plant. HUT values, mass and heat transfer coefficients both theoretically evaluated and experimentally determined were found to be comparable with those obtained from chemical industry separation processes. The fact justifies the use of multi-tubular column model for description of transfer processes in distillation columns equipped with B7 structured packing. (authors)

  13. Notes on the Spatial Turn

    Stipe Grgas

    2012-06-01

    Full Text Available On the basis of ever-mounting evidence, amongst which is the “zone” problematic of the Zadar conference that occassioned these notes, it can be concluded that the spatial turn has insinuated itself as an all-pervading heuristic tool throughout the humanities and the social sciences. The extent to which space and spatiality have usurped the central stage in the various branches of reasearch can be gauged by admonishments that what we are witnessing is a new fundamentalism that has simply inverted the terms of the dualism of time and space (May and Thrift 2001: “Introduction”. According to Michael Dear the sway of space is manifested in multifold ways: in the ubiquity of spatial analysis in social theories and practices; in the explosion of publications devoted to the exploration of the interface of the social and the spatial; in the reintegration of human geography into various domains of knowledge; in the focus given to difference and the consequent diversification of theoretical and empirical practices; in a theoretically informed exploration of the relation between geographical knowledge and social action; and, finally, in the unprecedented proliferation of research agendas and publications pertaining to these isuuses (Dear 2001: 24. Two recent collections of papers are indicative of the ubiquity of spatial issues in scholarly work.

  14. Chimeric antigen receptors with human scFvs preferentially induce T cell anti-tumor activity against tumors with high B7H6 expression.

    Gacerez, Albert T; Hua, Casey K; Ackerman, Margaret E; Sentman, Charles L

    2018-05-01

    B7H6 is emerging as a promising tumor antigen that is known to be expressed on a wide array of tumors and is reported to stimulate anti-tumor responses from the immune system. As such, B7H6 presents a good target for tumor-specific immunotherapies. B7H6-specific chimeric antigen receptors (CAR) based on a murine antibody showed successful targeting and elimination of tumors expressing B7H6. However, mouse single chain variable fragments (scFvs) have the potential to induce host anti-CAR responses that may limit efficacy, so human scFvs specific for B7H6 were selected by yeast surface display. In this study, we validate the functionality of these human scFvs when formatted into chimeric antigen receptors. The data indicate that T cells expressing these B7H6-specific human scFvs as CARs induced potent anti-tumor activity in vitro and in vivo against tumors expressing high amounts of B7H6. Importantly, these human scFv-based CARs are sensitive to changes in B7H6 expression which may potentially spare non-tumor cells that express B7H6 and provides the foundation for future clinical development.

  15. 32 CFR 636.23 - Turning movements.

    2010-07-01

    ... Defense Department of Defense (Continued) DEPARTMENT OF THE ARMY (CONTINUED) LAW ENFORCEMENT AND CRIMINAL... movements. (a) U-turns are prohibited on all streets in the cantonment area. (b) Right-turns will be made from a position as close to the right edge or right curb of the roadway as possible. (c) Left-turns...

  16. Clinical evaluation of an automated turning bed.

    Melland, H I; Langemo, D; Hanson, D; Olson, B; Hunter, S

    1999-01-01

    The purposes of this study were to assess client comfort and sleep quality, client physiologic response (skin and respiratory status), the effect on the need for caregiver assistance, and cost when using an automated turning bed. Nonexperimental, evaluative study. Twenty-four adult home or long-term care resident subjects who had a degenerative disease, spinal cord injury, stroke, cerebral palsy, or back surgery. Each subject agreed to use the automated turning bed for four weeks. Researchers completed a demographic survey and skin assessment, and assessed each subject for pressure ulcer risk and for the need of assistance of a care giver for turning before and after the four weeks of using the turning bed. Subjects rated the turning bed in terms of comfort and sleep quality. Subjects rated the turning bed as more comfortable than their own bed and expressed satisfaction at the pain relief attained when on the turning bed. While using the turning bed, there was a significant improvement in sleep quality. No skin breakdown or deterioration in respiratory status occurred. Fewer subjects required the assistance of a caregiver for turning when on the turning bed. This automated turning bed shows great promise in meeting a need for patients with limited mobility whether they are homebound or in a residential community. Future studies that further investigate use of the turning bed for postoperative back patients while still in the acute care setting are indicated. Replicative studies with a larger sample size are also indicated.

  17. Cancer cell-associated cytoplasmic B7–H4 is induced by hypoxia through hypoxia-inducible factor-1α and promotes cancer cell proliferation

    Jeon, You-Kyoung [Department of Microbiology and Immunology, Inje University College of Medicine, Busan 614-735 (Korea, Republic of); Advanced Research Center for Multiple Myeloma, Inje University College of Medicine, Busan 614-735 (Korea, Republic of); Park, Sae-Gwang; Choi, Il-Whan [Department of Microbiology and Immunology, Inje University College of Medicine, Busan 614-735 (Korea, Republic of); Lee, Soo-Woong [Advanced Research Center for Multiple Myeloma, Inje University College of Medicine, Busan 614-735 (Korea, Republic of); Lee, Sang Min [Department of Internal Medicine, Division of Hematology/Oncology, Busan Paik Hospital, Inje University, Busan 614-735 (Korea, Republic of); Choi, Inhak, E-mail: miccih@inje.ac.kr [Department of Microbiology and Immunology, Inje University College of Medicine, Busan 614-735 (Korea, Republic of); Advanced Research Center for Multiple Myeloma, Inje University College of Medicine, Busan 614-735 (Korea, Republic of)

    2015-04-03

    Aberrant B7–H4 expression in cancer tissues serves as a novel prognostic biomarker for poor survival in patients with cancer. However, the factor(s) that induce cancer cell-associated B7–H4 remain to be fully elucidated. We herein demonstrate that hypoxia upregulates B7–H4 transcription in primary CD138{sup +} multiple myeloma cells and cancer cell lines. In support of this finding, analysis of the Multiple Myeloma Genomics Portal (MMGP) data set revealed a positive correlation between the mRNA expression levels of B7–H4 and the endogenous hypoxia marker carbonic anhydrogenase 9. Hypoxia-induced B7–H4 expression was detected in the cytoplasm, but not in cancer cell membranes. Chromatin immunoprecipitation analysis demonstrated binding of hypoxia-inducible factor-1α (HIF-1α) to proximal hypoxia-response element (HRE) sites within the B7–H4 promoter. Knockdown of HIF-1α and pharmacological inhibition of HIF-1α diminished B7–H4 expression. Furthermore, knockdown of cytoplasmic B7–H4 in MCF-7 decreased the S-phase cell population under hypoxia. Finally, MMGP analysis revealed a positive correlation between the transcript levels of B7–H4 and proliferation-related genes including MKI67, CCNA1, and Myc in several patients with multiple myeloma. Our results provide insight into the mechanisms underlying B7–H4 upregulation and its role in cancer cell proliferation in a hypoxic tumor microenvironment. - Highlights: • Hypoxia upregulates B7–H4 transcription and protein expression. • Hypoxia-induced B7–H4 is detected in the cytoplasm, but not on membrane. • ChIP assay reveals a binding of HIF-1α to B7–H4 promoter at HRE site. • Knockdown and pharmacological inhibition of HIF-1α reduce B7–H4 expression. • B7–H4 knockdown decrease the number of cells in S-phase of cell cycle.

  18. Depressed levels of prostaglandin F2α in mice lacking Akr1b7 increase basal adiposity and predispose to diet-induced obesity.

    Volat, Fanny E; Pointud, Jean-Christophe; Pastel, Emilie; Morio, Béatrice; Sion, Benoit; Hamard, Ghislaine; Guichardant, Michel; Colas, Romain; Lefrançois-Martinez, Anne-Marie; Martinez, Antoine

    2012-11-01

    Negative regulators of white adipose tissue (WAT) expansion are poorly documented in vivo. Prostaglandin F(2α) (PGF(2α)) is a potent antiadipogenic factor in cultured preadipocytes, but evidence for its involvement in physiological context is lacking. We previously reported that Akr1b7, an aldo-keto reductase enriched in adipose stromal vascular fraction but absent from mature adipocytes, has antiadipogenic properties possibly supported by PGF(2α) synthase activity. To test whether lack of Akr1b7 could influence WAT homeostasis in vivo, we generated Akr1b7(-/-) mice in 129/Sv background. Akr1b7(-/-) mice displayed excessive basal adiposity resulting from adipocyte hyperplasia/hypertrophy and exhibited greater sensitivity to diet-induced obesity. Following adipose enlargement and irrespective of the diet, they developed liver steatosis and progressive insulin resistance. Akr1b7 loss was associated with decreased PGF(2α) WAT contents. Cloprostenol (PGF(2α) agonist) administration to Akr1b7(-/-) mice normalized WAT expansion by affecting both de novo adipocyte differentiation and size. Treatment of 3T3-L1 adipocytes and Akr1b7(-/-) mice with cloprostenol suggested that decreased adipocyte size resulted from inhibition of lipogenic gene expression. Hence, Akr1b7 is a major regulator of WAT development through at least two PGF(2α)-dependent mechanisms: inhibition of adipogenesis and lipogenesis. These findings provide molecular rationale to explore the status of aldo-keto reductases in dysregulations of adipose tissue homeostasis.

  19. 17 CFR 249.822 - Form 19b-7, for electronic filing with respect to proposed rule changes by self-regulatory...

    2010-04-01

    ... filing with respect to proposed rule changes by self-regulatory organizations under Section 19(b)(7)(A... proposed rule changes by self-regulatory organizations under Section 19(b)(7)(A) of the Securities Exchange Act of 1934. This form shall be used by self-regulatory organizations, as defined in section 3(a)(25...

  20. Height determination at the transfer unit in isotopic distillation of hydrogen on type B7 ordered column packing

    Pop, F.; Croitoru, C.; Peculea, M.

    2001-01-01

    Owing to the low pressure drop implied by ordered column packings these are often utilized for vacuum distillations and separation of mixtures in which the important component occurs at a very low concentration, as for instance is the case of water, deuterium or oxygen isotopic distillation. The paper presents a model for determination of the height of transfer unit (HTU) in the hydrogen isotopic distillation installation, equipped with ordered column packing of B7 type. The computed values for HUT based on the analogy between heat, moment and mass transfer, were compared with the experimental data

  1. Increased Expression of Cytotoxic T-Lymphocyte-Associated Protein 4 by T Cells, Induced by B7 in Sera, Reduces Adaptive Immunity in Patients With Acute Liver Failure

    Khamri, Wafa; Abeles, Robin D; Hou, Tie Zheng

    2017-01-01

    , hepatic sinusoidal endothelial cells, and biliary epithelial cells from healthy or diseased liver tissues. We also measured levels of soluble B7 serum samples from patients and controls, and mice with acetaminophen-induced liver injury using enzyme-linked immunosorbent assays. RESULTS: Peripheral blood...... were found to have increased concentrations of soluble B7 compared to sera from controls. Necrotic human primary hepatocytes exposed to acetaminophen, but not hepatic sinusoidal endothelial cells and biliary epithelial cells from patients with ALF, secreted high levels of soluble B7. Sera from mice...... with acetaminophen-induced liver injury contained high levels of soluble B7 compared to sera from mice without liver injury. Plasma exchange reduced circulating levels of soluble B7 in patients with ALF and expression of CTLA4 on T cells. CONCLUSIONS: Peripheral CD4+T cells from patients with ALF have increased...

  2. Realistic page-turning of electronic books

    Fan, Chaoran; Li, Haisheng; Bai, Yannan

    2014-01-01

    The booming electronic books (e-books), as an extension to the paper book, are popular with readers. Recently, many efforts are put into the realistic page-turning simulation o f e-book to improve its reading experience. This paper presents a new 3D page-turning simulation approach, which employs piecewise time-dependent cylindrical surfaces to describe the turning page and constructs smooth transition method between time-dependent cylinders. The page-turning animation is produced by sequentially mapping the turning page into the cylinders with different radii and positions. Compared to the previous approaches, our method is able to imitate various effects efficiently and obtains more natural animation of turning page.

  3. Structure of the fully ferroelectric/fully ferroelastic orthohombic room-temperature phase of cobalt bromine boracite, Co3B7O13Br and nickel chlorine boracite, Ni3B7O13Cl

    Kubel, F.; Mao, S.Y.; Schmid, H.

    1992-01-01

    The X-ray crystal structures of optically controlled single-domain crystals of fully ferroelectric/fully ferroelastic cobalt bromine boracite, Co 3 B 7 O 13 Br (Co-Br) at 298 K [M r = 540.38, orthorhombic, Pca2 1 , a = 8.5614 (2), b = 8.5657 (2), c = 12.1196 (3) A, V = 888.78 (4) A 3 , Z = 4, D x = 4.04 Mg m -3 , λ(Mo Kα) = 0.7107 A, μ = 10.61 mm -1 , F(000) = 1020, R = 7.0, wR = 5.4%, 2824 reflections] and of nickel chlorine boracite, Ni 3 B 7 O 13 Cl (Ni-Cl) at 298 K [M r = 495.25, orthorhombic, Pca2 1 , a = 8.5105 (4), b = 8.4984 (4), c = 12.0324 (5) A, V = 870.25 (7) A 3 , Z = 4, D x = 3.78 Mg m -3 , λ(Mo Kα) = 0.7107 A, μ = 6.8 mm -1 , F(000) = 960, R = 3.5, wR = 3.1%, 2082 reflections] are reported. The metal surroundings of Co-Br and Ni-Cl were analyzed in detail and show two metal sites (Co2, Co3; Ni2, Ni3) with chemically similar environments and one metal site (Co1; Ni1) with a different environment. Six B atoms have a tetrahedral or slightly distorted tetrahedral coordination, whereas one B atom (B4) has triangular surroundings in both compounds. (orig.)

  4. B7h-expressing dendritic cells and plasma B cells mediate distinct outcomes of ICOS costimulation in T cell-dependent antibody responses

    Larimore Kevin

    2012-06-01

    Full Text Available Abstract Background The ICOS-B7h costimulatory receptor-ligand pair is required for germinal center formation, the production of isotype-switched antibodies, and antibody affinity maturation in response to T cell-dependent antigens. However, the potentially distinct roles of regulated B7h expression on B cells and dendritic cells in T cell-dependent antibody responses have not been defined. Results We generated transgenic mice with lineage-restricted B7h expression to assess the cell-type specific roles of B7h expression on B cells and dendritic cells in regulating T cell-dependent antibody responses. Our results show that endogenous B7h expression is reduced on B cells after activation in vitro and is also reduced in vivo on antibody-secreting plasma B cells in comparison to both naïve and germinal center B cells from which they are derived. Increasing the level of B7h expression on activated and plasma B cells in B-B7hTg mice led to an increase in the number of antibody-secreting plasma cells generated after immunization and a corresponding increase in the concentration of antigen-specific high affinity serum IgG antibodies of all isotypes, without affecting the number of responding germinal center B cells. In contrast, ICOS costimulation mediated by dendritic cells in DC-B7hTg mice contributed to germinal center formation and selectively increased IgG2a production without affecting the overall magnitude of antibody responses. Conclusions Using transgenic mice with lineage-restricted B7h expression, we have revealed distinct roles of ICOS costimulation mediated by dendritic cells and B cells in the regulation of T cell-dependent antibody responses.

  5. performance characteristics of a cam turning attachment

    Dr Obe

    ABSTRACT. A modification of a cylindrical turning unit has been done to give a non- cylindrical turning attachment for production of irregular shapes, like cams on the lathe machine. To assess the performance of the attachment, cutting forces have been measured using a 'Sigma' Cutting Tool. Dynamometer. Furthermore ...

  6. Kantian Turning Point in Gadamer's Philosophical Hermeneutics

    Kristína Bosáková

    2016-11-01

    Full Text Available The paper is treating the theme of a Kantian turning-point in the philosophical hermeneutics of H.- G. Gadamer based on of the harmonic relationship between metaphysics and science in Kantian philosophy from the point of view of the philosophical hermeneutics of Gadamer. The philosophical work of Kant had such an influence on Gadamer that without exaggerating we can talk about the Kantian turning-point in Gadamerian hermeneutics. Grondin, a former student of Gadamer, is talking about Kantian turning-point on the field of aesthetics, but in reality Kantian turning-point means much more than a mere change in the reception of the concept of judgement. It is a discovery of harmonical relationship between the beauty and the moral, between the reason and the sensitivity, between the modern sciences and the metaphysical tradition in the Kantian philosophy, made by Gadamer. This is what we call the Kantian turning-point in Gadamerian hermeneutics.

  7. Transmission electron and optical microscopy of the domain structure of Ni3B7O13Br ferroic boracite

    Castellanos-Guzman, A.G.; Trujillo-Torrez, M.; Czank, M.

    2005-01-01

    The study investigated the domain structure of nickel bromine boracite single crystals, by means of polarised-light in conjunction with transmission electron microscopy. Single crystals of Ni 3 B 7 O 13 Br were grown by chemical transport reactions in closed quartz ampoules, in the temperature range of 1130 K and were examined by polarising optical microscopy (PLM), and transmission electron microscopy (TEM). PLM was also used in order to study the behaviour of birefringence as a function of temperature. For TEM the single crystals were crushed and mounted on holey carbon films. Comparative electron microscope images were useful for revealing the domain structure of this fully ferroelectric/fully ferroelastic material previously observed between the crossed polars of an optical microscope. X-ray diffraction analysis of the crystal under study was performed at room temperature

  8. DFT study on the isomerization and tautomerism in vitamins B3 (niacin), B5 (pantothenic acid) and B7 (biotin)

    Valadbeigi, Younes; Farrokhpour, Hossein; Tabrizchi, Mahmoud

    2014-05-01

    Isomerization and tautomerism of the three water soluble vitamins including B3, B5 and B7 were studied applying density functional theory using B3LYP method in gas and aqueous phases. Activation energies (Ea), Gibbs free energies of activation (ΔG#), and imaginary frequencies of the transition state structures were calculated for all the isomerization and tautomerism reactions. Activation energies of the neutral → zwitterion (amine-enamine) tautomerism in vitamin B3 were 310-360 kJ/mol where these values for the keto-enol tautomerism were 100-130 kJ/mol. It was found that water molecule catalyzes the tautomerism and decreases the activation energies about 90-160 kJ/mol.

  9. Increased Expression of Cytotoxic T-Lymphocyte-Associated Protein 4 by T Cells, Induced by B7 in Sera, Reduces Adaptive Immunity in Patients With Acute Liver Failure

    Khamri, Wafa; Abeles, Robin D; Hou, Tie Zheng

    2017-01-01

    , hepatic sinusoidal endothelial cells, and biliary epithelial cells from healthy or diseased liver tissues. We also measured levels of soluble B7 serum samples from patients and controls, and mice with acetaminophen-induced liver injury using enzyme-linked immunosorbent assays. RESULTS: Peripheral blood...... mice with acetaminophen-induced liver injury contained high levels of soluble B7 compared to sera from mice without liver injury. Plasma exchange reduced circulating levels of soluble B7 in patients with ALF and expression of CTLA4 on T cells. CONCLUSIONS: Peripheral CD4+ T cells from patients with ALF......BACKGROUND & AIMS: Patients with acute liver failure (ALF) have defects in innate immune responses to microbes (immune paresis) and are susceptible to sepsis. Cytotoxic T-lymphocyte-associated protein 4 (CTLA4), which interacts with the membrane receptor B7 (also called CD80 and CD86...

  10. METHODICAL MODEL FOR TEACHING BASIC SKI TURN

    Danijela Kuna

    2013-07-01

    Full Text Available With the aim of forming an expert model of the most important operators for basic ski turn teaching in ski schools, an experiment was conducted on a sample of 20 ski experts from different countries (Croatia, Bosnia and Herzegovina and Slovenia. From the group of the most commonly used operators for teaching basic ski turn the experts picked the 6 most important: uphill turn and jumping into snowplough, basic turn with hand sideways, basic turn with clapping, ski poles in front, ski poles on neck, uphill turn with active ski guiding. Afterwards, ranking and selection of the most efficient operators was carried out. Due to the set aim of research, a Chi square test was used, as well as the differences between frequencies of chosen operators, differences between values of the most important operators and differences between experts due to their nationality. Statistically significant differences were noticed between frequencies of chosen operators (c2= 24.61; p=0.01, while differences between values of the most important operators were not obvious (c2= 1.94; p=0.91. Meanwhile, the differences between experts concerning thier nationality were only noticeable in the expert evaluation of ski poles on neck operator (c2=7.83; p=0.02. Results of current research are reflected in obtaining useful information about methodological priciples of learning basic ski turn organization in ski schools.

  11. Silencing of B7-H4 suppresses the tumorigenicity of the MGC-803 human gastric cancer cell line and promotes cell apoptosis via the mitochondrial signaling pathway.

    Zhou, Donghui; Zhou, Yong; Li, Chao; Yang, Lina

    2018-04-01

    B7-H4 is a transmembrane protein which is a member of the B7 superfamily. It is overexpressed in various types of cancer, including gastric cancer. However, the effects of B7-H4 on the tumorigenicity of gastric cancer and the underlying mechanisms have not yet been fully explored. Thus, the aim of this study was to examine the effects of B7-H4 on the tumorigenicity of gastric cancer cells and to elucidate the underlying mechanisms. For this purpose, B7-H4 expression in gastric cancer tissues was detected by immunohistochemical staining. The effects of B7-H4 on the biological behavior of the MGC-803 human gastric cancer cell line were examined by Cell Counting kit-8 (CCK-8) assay, cell cycle analysis, wound healing assay, Annexin V/propidium iodide staining and terminal deoxynucleotidyl transferase dUTP nick-end labeling (TUNEL) assay. Moreover, the expression levels of apoptotic markers, such as cleaved caspase‑3, cleaved caspase‑9, Bcl-2 and Bax were examined by western blot analysis. Immunohistochemical staining revealed that a high expression of B7-H4 was found in about 41.8% of tissues obtained from patients with gastric cancer. Comparative analysis revealed that B7-H4 expression significantly correlated with lymph node metastasis and the TNM stage. The results of CCK-8 assay, cell cycle analysis, wound healing assay, Annexin V/propidium iodide staining assay and TUNEL assay all demonstrated that the silencing of B7-H4 by small interfering RNA decreased cell proliferation, suppressed cell motility, and induced cell cycle arrest and the apoptosis of MGC-803 human gastric cancer cells. Furthermore, the results of western blot analysis indicated that the downregulation of B7-H4 induced the apoptosis of the MGC-803 cells via the mitochondrial signaling pathway through the activation of caspase‑3 and caspase‑9, and by altering the Bax/Bcl-2 ratio in a manner that favored apoptosis. Based on the findings on human gastric cancer cell line MGC-803, the

  12. FOXP3+ Tregs and B7-H1+/PD-1+ T lymphocytes co-infiltrate the tumor tissues of high-risk breast cancer patients: Implication for immunotherapy

    Ghebeh, Hazem; Barhoush, Eman; Tulbah, Asma; Elkum, Naser; Al-Tweigeri, Taher; Dermime, Said

    2008-01-01

    Recent studies have demonstrated a direct involvement of B7-H1, PD-1 and FOXP3 molecules in the immune escape of cancer. B7-H1 is an inhibitory molecule that binds to PD-1 on T lymphocytes, while FOXP3 is a marker for regulatory T cells (T regs ). We have previously demonstrated the association of B7-H1-expressing T infiltrating lymphocytes (TIL) with high-risk breast cancer patients while other studies reported the involvement of FOXP3+ T regs as a bad prognostic factor in breast tumors. Although the co-existence between the two types of cells has been demonstrated in vitro and animal models, their relative infiltration and correlation with the clinicopathological parameters of cancer patients have not been well studied. Therefore, we investigated TIL-expressing the B7-H1, PD-1, and FOXP3 molecules, in the microenvironment of human breast tumors and their possible association with the progression of the disease. Using immunohistochemistry, tumor sections from 62 breast cancer patients were co-stained for B7-H1, PD-1 and FOXP3 molecules and their expression was statistically correlated with factors known to be involved in the progression of the disease. A co-existence of B7-H1 + T lymphocytes and FOXP3 + T regs was evidenced by the highly significant correlation of these molecules (P < .0001) and their expression by different T lymphocyte subsets was clearly demonstrated. Interestingly, concomitant presence of FOXP3 + T regs , B7-H1 + and PD-1 + TIL synergistically correlated with high histological grade (III) (P < .001), estrogen receptor negative status (P = .017), and the presence of severe lymphocytic infiltration (P = .022). Accumulation of TIL-expressing such inhibitory molecules may deteriorate the immunity of high-risk breast cancer patients and this should encourage vigorous combinatorial immunotherapeutic approaches targeting T regs and B7-H1/PD-1 molecules

  13. Study of B7.1 costimulatory molecule neoexpression induced by γ irradiation of different dose in various human tumor cells

    Zhou Jianghua; Su Liaoyuan; Tong Jian; Zhu Minqing; Xue Lian

    2001-01-01

    The relationship between irradiation and B7.1 co-stimulative molecule expression of human tumor cells was studied to explore the reason of enhanced tumor cells immunity. The effect of γ ray irradiation on B7.1 molecule expression in various human tumor cells which were irradiated with 30 Gy, 40 Gy, 50 Gy, 60 Gy γ ray was investigated. At 24 h, 48 h, 72 h and 96 h after irradiation the changes of B7.1 molecule was measured by flow cytometry (FCM) with immunofluorescence technique. The activation of lymphocyte toxin upon tumor target cell after exposure was determined by using radiation release method. The results showed that a few of tumor cells after γ-ray irradiation express B7.1 co-stimulative molecule. Furthermore, B7.1 molecule membrane expression after γ ray irradiation is shown to enhance the activation of lymphocyte toxin. The data could explain the enhanced immunogenicity of tumor cells after irradiation, and could lead to new immunotherapy protocols. The experiments suggested that γ ray irradiation could induce human tumor cells to express B7.1 co-stimulative molecules and enhance tumor cell immunity

  14. Turning university professors into competent learners

    Stefanova, Eliza; Ilieva, Miroslava; Nikolova, Nikolina; Stefanov, Krassen

    2008-01-01

    Stefanova, E., Ilieva, M., Nikolova, N, & Stefanov, K. (2008). Turning university professors into competent learners. In H. W. Sligte & R. Koper (Eds.), Proceedings of the 4th TENCompetence Open Workshop. Empowering Learners for Lifelong Competence Development: pedagogical, organisational and

  15. Turning Technology into Business Using University Patents

    Hartmann, L.

    2014-01-01

    We present an education paradigm that stimulates innovation and entrepreneurship through a master's-level university course: "Turning Technology into Business". The course was specifically designed to connect technological research with education using patented technologies developed at the research

  16. Cellular Reprogramming–Turning the Clock Back

    Home; Journals; Resonance – Journal of Science Education; Volume 18; Issue 6. Cellular Reprogramming - Turning the Clock Back - Nobel Prize in Physiology or Medicine, 2012. Deepa Subramanyam. General Article Volume 18 Issue 6 June 2013 pp 514-521 ...

  17. The PD-1/B7-H1 pathway modulates the natural killer cells versus mouse glioma stem cells.

    Bo Yuan Huang

    Full Text Available Glioblastoma multiforme (GBM is the most malignant primary type of brain tumor in adults. There has been increased focus on the immunotherapies to treat GBM patients, the therapeutic value of natural killer (NK cells is still unknown. Programmed death-1 (PD-1 is a major immunological checkpoint that can negatively regulate the T-cell-mediated immune response. We tested the combination of the inhibiting the PD-1/B7H1 pathway with a NK-cell mediated immune response in an orthotopic mouse model of GBM.Mouse glioma stem cells (GL261GSCs and mouse NK cells were isolated and identified. A lactate dehydrogenase (LDH assay was perfomed to detect the cytotoxicity of NK cells against GL261GSCs. GL261GSCs were intracranially implanted into mice, and the mice were stratified into 3 treatment groups: 1 control, 2 NK cells treatment, and 3 PD-1 inhibited NK cells treatment group. Overall survival was quantified, and animal magnetic resonance imaging (MRI was performed to determine tumor growth. The brains were harvested after the mice were euthanized, and immunohistochemistry against CD45 and PCNA was performed.The mouse NK cells were identified as 90% CD3- NK1.1+CD335+ by flow cytometric analysis. In the LDH assay, the ratios of the damaged GL261GSCs, with the E:T ratios of 2.5:1, 5:1, and 10:1, were as follows: 1 non-inhibited group: 7.42%, 11.31%, and 15.1%, 2 B7H1 inhibited group: 14.75%, 18.25% and 29.1%, 3 PD-1 inhibited group: 15.53%, 19.21% and 29.93%, 4 double inhibited group: 33.24%, 42.86% and 54.91%. In the in vivo experiments, the mice in the PD-1 inhibited NK cells treatment group and IL-2-stimulated-NK cells treatment group displayed a slowest tumor growth (F = 308.5, P<0.01 and a slower tumor growth compared with control group (F = 118.9, P<0.01, respectively. The median survival of the mice in the three groups were as follows: 1 conrol group: 29 days, 2 NK cells treatment group: 35 days (P = 0.0012, 3 PD-1 inhibited NK cells treatment group

  18. Derrida’s Turn to Franciscan Philosophy

    Marko Zlomislic

    2008-12-01

    Full Text Available Contemporary French philosophers such as Levinas, Bataille, and Derrida, along with the existentialists Kierkegaard and Nietzsche have all made use of Franciscan insights in order to safeguard the ipseity that cannot be reduced or totalized. In keeping with the taste that concerns me, this paper will examine Derrida’s turn to the poetry of Gerard Manley Hopkins and how such a turn may place Derrida within a catholic and Franciscan tradition.

  19. The PD-1/B7-H1 pathway modulates the natural killer cells versus mouse glioma stem cells.

    Huang, Bo Yuan; Zhan, Yi Ping; Zong, Wen Jing; Yu, Chun Jiang; Li, Jun Fa; Qu, Yan Ming; Han, Song

    2015-01-01

    Glioblastoma multiforme (GBM) is the most malignant primary type of brain tumor in adults. There has been increased focus on the immunotherapies to treat GBM patients, the therapeutic value of natural killer (NK) cells is still unknown. Programmed death-1 (PD-1) is a major immunological checkpoint that can negatively regulate the T-cell-mediated immune response. We tested the combination of the inhibiting the PD-1/B7H1 pathway with a NK-cell mediated immune response in an orthotopic mouse model of GBM. Mouse glioma stem cells (GL261GSCs) and mouse NK cells were isolated and identified. A lactate dehydrogenase (LDH) assay was perfomed to detect the cytotoxicity of NK cells against GL261GSCs. GL261GSCs were intracranially implanted into mice, and the mice were stratified into 3 treatment groups: 1) control, 2) NK cells treatment, and 3) PD-1 inhibited NK cells treatment group. Overall survival was quantified, and animal magnetic resonance imaging (MRI) was performed to determine tumor growth. The brains were harvested after the mice were euthanized, and immunohistochemistry against CD45 and PCNA was performed. The mouse NK cells were identified as 90% CD3- NK1.1+CD335+ by flow cytometric analysis. In the LDH assay, the ratios of the damaged GL261GSCs, with the E:T ratios of 2.5:1, 5:1, and 10:1, were as follows: 1) non-inhibited group: 7.42%, 11.31%, and 15.1%, 2) B7H1 inhibited group: 14.75%, 18.25% and 29.1%, 3) PD-1 inhibited group: 15.53%, 19.21% and 29.93%, 4) double inhibited group: 33.24%, 42.86% and 54.91%. In the in vivo experiments, the mice in the PD-1 inhibited NK cells treatment group and IL-2-stimulated-NK cells treatment group displayed a slowest tumor growth (F = 308.5, Pmouse NK cells to kill the GL261GSCs, and the PD-1-inhibited NK cells could be a feasible immune therapeutic approach against GBM.

  20. B2, B7 or B10: Which palm-based blend mandate wise to be chosen in Malaysia?

    Applanaidu, Shri-Dewi; Abidin, Norhaslinda Zainal; Ali, Anizah Md.

    2015-12-01

    The diminishing fossil energy resources, coupled with heightened interest in the abatement of greenhouse gas emissions and concerns about energy security have motivated Malaysia to produce palm-based biodiesel and it has been started to be exported since 2006. In line with this issue, the government in Malaysia launched the palm-based biodiesel blending mandate of five percent (B5) in the federal administration of Putrajaya on 1st June 2011. This was then followed by four states: Malacca on July 11, Negeri Sembilan on August 1, Kuala Lumpur on September 1 and Selangor on October 1 of the same year but it is yet to be implemented nationwide. However what is the wise blend mandate to be chosen? Thus, this paper seeks to examine the possible impact of various blend mandates implementation (B2, B7 and B10) on the palm oil industry market variables (stock and price) since the main aim of biodiesel industry in Malaysia is to reduce domestic palm oil stock to below one million tones and provide a floor price to support Crude Palm Oil (CPO) prices at RM2,000 per tonne. A structural econometric model consisting of nine structural equations and three identities was proposed in this study. The model has been estimated by two stage least squares (2SLS) method using annual data for the period 1976-2013. The study indicates that counterfactual simulation of a decrease from B5 to B2 predicts a decrease (11.2 per cent) in CPO domestic consumption for biodiesel usage, 731.02 per cent reduction in CPO stock and an increase of 27.41 percent in domestic price of CPO. However the increase in the blend mandate from B5 to B7 and B10 suggest that domestic consumption of CPO for biodiesel purpose increase 7.40 and 18.55 percent respectively. The interesting findings in this study suggest that no matter whether Malaysian government increase or decrease the blend mandate the increase in the price of CPO are the same with an increase of is 27.41 percent. Hence, this study suggests that the

  1. B2, B7 or B10: Which palm-based blend mandate wise to be chosen in Malaysia?

    Applanaidu, Shri-Dewi; Ali, Anizah Md.; Abidin, Norhaslinda Zainal

    2015-01-01

    The diminishing fossil energy resources, coupled with heightened interest in the abatement of greenhouse gas emissions and concerns about energy security have motivated Malaysia to produce palm-based biodiesel and it has been started to be exported since 2006. In line with this issue, the government in Malaysia launched the palm-based biodiesel blending mandate of five percent (B5) in the federal administration of Putrajaya on 1 st June 2011. This was then followed by four states: Malacca on July 11, Negeri Sembilan on August 1, Kuala Lumpur on September 1 and Selangor on October 1 of the same year but it is yet to be implemented nationwide. However what is the wise blend mandate to be chosen? Thus, this paper seeks to examine the possible impact of various blend mandates implementation (B2, B7 and B10) on the palm oil industry market variables (stock and price) since the main aim of biodiesel industry in Malaysia is to reduce domestic palm oil stock to below one million tones and provide a floor price to support Crude Palm Oil (CPO) prices at RM2,000 per tonne. A structural econometric model consisting of nine structural equations and three identities was proposed in this study. The model has been estimated by two stage least squares (2SLS) method using annual data for the period 1976-2013. The study indicates that counterfactual simulation of a decrease from B5 to B2 predicts a decrease (11.2 per cent) in CPO domestic consumption for biodiesel usage, 731.02 per cent reduction in CPO stock and an increase of 27.41 percent in domestic price of CPO. However the increase in the blend mandate from B5 to B7 and B10 suggest that domestic consumption of CPO for biodiesel purpose increase 7.40 and 18.55 percent respectively. The interesting findings in this study suggest that no matter whether Malaysian government increase or decrease the blend mandate the increase in the price of CPO are the same with an increase of is 27.41 percent. Hence, this study suggests that the

  2. B2, B7 or B10: Which palm-based blend mandate wise to be chosen in Malaysia?

    Applanaidu, Shri-Dewi, E-mail: dewi@uum.edu.my; Ali, Anizah Md., E-mail: anizah@uum.edu.my [Department of Economics and Agribusiness, School of Economics, Finance & Banking, UUM (Malaysia); Abidin, Norhaslinda Zainal, E-mail: nhaslinda@uum.edu.my [Department of Decision Sciences, School of Quantitative Sciences, UUM (Malaysia)

    2015-12-11

    The diminishing fossil energy resources, coupled with heightened interest in the abatement of greenhouse gas emissions and concerns about energy security have motivated Malaysia to produce palm-based biodiesel and it has been started to be exported since 2006. In line with this issue, the government in Malaysia launched the palm-based biodiesel blending mandate of five percent (B5) in the federal administration of Putrajaya on 1{sup st} June 2011. This was then followed by four states: Malacca on July 11, Negeri Sembilan on August 1, Kuala Lumpur on September 1 and Selangor on October 1 of the same year but it is yet to be implemented nationwide. However what is the wise blend mandate to be chosen? Thus, this paper seeks to examine the possible impact of various blend mandates implementation (B2, B7 and B10) on the palm oil industry market variables (stock and price) since the main aim of biodiesel industry in Malaysia is to reduce domestic palm oil stock to below one million tones and provide a floor price to support Crude Palm Oil (CPO) prices at RM2,000 per tonne. A structural econometric model consisting of nine structural equations and three identities was proposed in this study. The model has been estimated by two stage least squares (2SLS) method using annual data for the period 1976-2013. The study indicates that counterfactual simulation of a decrease from B5 to B2 predicts a decrease (11.2 per cent) in CPO domestic consumption for biodiesel usage, 731.02 per cent reduction in CPO stock and an increase of 27.41 percent in domestic price of CPO. However the increase in the blend mandate from B5 to B7 and B10 suggest that domestic consumption of CPO for biodiesel purpose increase 7.40 and 18.55 percent respectively. The interesting findings in this study suggest that no matter whether Malaysian government increase or decrease the blend mandate the increase in the price of CPO are the same with an increase of is 27.41 percent. Hence, this study suggests that

  3. Turning breech babies after 34 weeks: the if, how, & when of turning breech babies.

    Cohain, Judy Slome

    2007-01-01

    Techniques for turning a term breech baby are 1). External cephalic version (ECV) using hands and ultrasound only; 2). Acupuncture point stimulation, by needle or moxibustion; 3). Chiropractic "Webster" technique; 4). Hypnotherapy; and 5). Special exercises. Fifty % of breech fetuses at 34 weeks will turn by themselves to head down by 38 weeks. Therefore, to be considered effective, a technique for turning breech must turn the baby and keep it turned more than 50% of the time. Only ECV with an experienced practitioner has been documented to have a greater than 50% success rate at 37 weeks; in 95% of cases the head stays down. Most women experience the fetus turning by hand as quick but very painful. "Unstable lie" is sometimes used as a baseless excuse for inducing labor after the baby turns from breech to head down. (judyslome@hotmail.com).

  4. Rietveld refinement of the mixed boracite Fe1.59Zn1.41B7O13Br

    Sandra Ulloa-Godínez

    2009-11-01

    Full Text Available The structural characterization of the new iron–zinc heptaborate bromide with composition Fe1.59Zn1.41B7O13Br, prepared by chemical transport is reported. A rigid-body model with constrained generalized coordinates was defined in order to hold the positions of the B atoms at reasonable interatomic distances that typically would reach unacceptable values because of the weak scattering power of boron. There are three independent sites for the B atoms of which two are tetrahedrally coordinated. The bond-valence sum around the third B atom, located on a threefold rotation axis, was calculated considering two cases of coordination of boron with oxygens: trigonal-planar and tetrahedral. The contribution of the fourth O atom to the bond-valence sum was found to be only 0.06 v.u., indicating the presence of a very weak bond in the right position to have a distorted tetrahedral coordination in favour of the trigonal-planar coordination for the third B atom. X-ray fluorescence (XRF was used to determinate the Fe/Zn ratio.

  5. Rietveld refinement of the mixed boracite Fe(1.59)Zn(1.41)B(7)O(13)Br.

    Ulloa-Godínez, Sandra; Rosales, Ivonne; Bucio, Lauro; Farías, Mario H; Campa-Molina, Jorge

    2009-10-31

    The structural characterization of the new iron-zinc hepta-borate bromide with composition Fe(1.59)Zn(1.41)B(7)O(13)Br, prepared by chemical transport is reported. A rigid-body model with constrained generalized coordinates was defined in order to hold the positions of the B atoms at reasonable inter-atomic distances that typically would reach unacceptable values because of the weak scattering power of boron. There are three independent sites for the B atoms of which two are tetra-hedrally coordinated. The bond-valence sum around the third B atom, located on a threefold rotation axis, was calculated considering two cases of coordination of boron with oxygens: trigonal-planar and tetrahedral. The contribution of the fourth O atom to the bond-valence sum was found to be only 0.06 v.u., indicating the presence of a very weak bond in the right position to have a distorted tetra-hedral coordination in favour of the trigonal-planar coordination for the third B atom. X-ray fluorescence (XRF) was used to determinate the Fe/Zn ratio.

  6. Testing of nuclear grade lubricants and their effects on A540 B24 and A193 B7 bolting materials

    Czajkowski, C.J.

    1985-01-01

    An investigation was performed on eleven commonly used lubricants by the nuclear power industry. The investigation included EDS analysis of the lubricants, notched-tensile constant extension rate testing of bolting materials with the lubricants, frictional testing of the lubricants and weight loss testing of a bonded solid film lubricant. The report generally concludes that there is a significant amount of variance in the mechanical properties of common bolting materials; that MoS 2 can hydrolyze to form H 2 S at 100 0 C and cause stress corrosion cracking (SCC) of bolting materials, and that the use of copper-containing lubricants can be potentially detrimental to high strength steels in an aqueous environment. Additionally, the testing of various lubricants disclosed that some lubricants contain potentially detrimental elements (e.g. S, Sb) which can promote SCC of the common bolting materials. One of the most significant findings of this report is the observation that both A193 B7 and A540 B24 bolting materials are susceptible to transgranular stress corrosion cracking in demineralized H 2 O at 280 0 C in notched tensile tests

  7. Herb–drug interaction prediction based on the high specific inhibition of andrographolide derivatives towards UDP-glucuronosyltransferase (UGT) 2B7

    Ma, Hai-Ying [The Fourth Affiliated Hospital of China Medical University, Shenyang 110032 (China); Sun, Dong-Xue [School of Traditional Chinese Medicine, Shenyang Pharmaceutical University, No. 103, Wenhua Road, Shenyang 110016 (China); Cao, Yun-Feng [The First Affiliated Hospital of Liaoning Medical University, Jinzhou 121001 (China); Joint Center for Translational Medicine, Dalian Institute of Chemical Physics, Chinese Academy of Sciences, Zhongshan Road, Dalian 116023 (China); Ai, Chun-Zhi [Joint Center for Translational Medicine, Dalian Institute of Chemical Physics, Chinese Academy of Sciences, Zhongshan Road, Dalian 116023 (China); Qu, Yan-Qing [Thyroid Surgery, Yantaishan Hospital, Yantai, Shandong (China); Hu, Cui-Min [Joint Center for Translational Medicine, Dalian Institute of Chemical Physics, Chinese Academy of Sciences, Zhongshan Road, Dalian 116023 (China); Department of Microbiology and Immunology, Georgetown University Medical Center, Washington, DC 20057 (United States); Jiang, Changtao [Laboratory of Metabolism, Center for Cancer Research, National Cancer Institute, Bethesda, MD 20892 (United States); Dong, Pei-Pei [Academy of Integrative Medicine, Dalian Medical University, Dalian 116044 (China); Sun, Xiao-Yu; Hong, Mo [Joint Center for Translational Medicine, Dalian Institute of Chemical Physics, Chinese Academy of Sciences, Zhongshan Road, Dalian 116023 (China); Tanaka, Naoki; Gonzalez, Frank J. [Laboratory of Metabolism, Center for Cancer Research, National Cancer Institute, Bethesda, MD 20892 (United States); others, and

    2014-05-15

    Herb–drug interaction strongly limits the clinical application of herbs and drugs, and the inhibition of herbal components towards important drug-metabolizing enzymes (DMEs) has been regarded as one of the most important reasons. The present study aims to investigate the inhibition potential of andrographolide derivatives towards one of the most important phase II DMEs UDP-glucuronosyltransferases (UGTs). Recombinant UGT isoforms (except UGT1A4)-catalyzed 4-methylumbelliferone (4-MU) glucuronidation reaction and UGT1A4-catalyzed trifluoperazine (TFP) glucuronidation were employed to firstly screen the andrographolide derivatives' inhibition potential. High specific inhibition of andrographolide derivatives towards UGT2B7 was observed. The inhibition type and parameters (K{sub i}) were determined for the compounds exhibiting strong inhibition capability towards UGT2B7, and human liver microsome (HLMs)-catalyzed zidovudine (AZT) glucuronidation probe reaction was used to furtherly confirm the inhibition behavior. In combination of inhibition parameters (K{sub i}) and in vivo concentration of andrographolide and dehydroandrographolide, the potential in vivo inhibition magnitude was predicted. Additionally, both the in vitro inhibition data and computational modeling results provide important information for the modification of andrographolide derivatives as selective inhibitors of UGT2B7. Taken together, data obtained from the present study indicated the potential herb–drug interaction between Andrographis paniculata and the drugs mainly undergoing UGT2B7-catalyzed metabolic elimination, and the andrographolide derivatives as potential candidates for the selective inhibitors of UGT2B7. - Highlights: • Specific inhibition of andrographolide derivatives towards UGT2B7. • Herb-drug interaction related withAndrographis paniculata. • Guidance for design of UGT2B7 specific inhibitors.

  8. Herb–drug interaction prediction based on the high specific inhibition of andrographolide derivatives towards UDP-glucuronosyltransferase (UGT) 2B7

    Ma, Hai-Ying; Sun, Dong-Xue; Cao, Yun-Feng; Ai, Chun-Zhi; Qu, Yan-Qing; Hu, Cui-Min; Jiang, Changtao; Dong, Pei-Pei; Sun, Xiao-Yu; Hong, Mo; Tanaka, Naoki; Gonzalez, Frank J.

    2014-01-01

    Herb–drug interaction strongly limits the clinical application of herbs and drugs, and the inhibition of herbal components towards important drug-metabolizing enzymes (DMEs) has been regarded as one of the most important reasons. The present study aims to investigate the inhibition potential of andrographolide derivatives towards one of the most important phase II DMEs UDP-glucuronosyltransferases (UGTs). Recombinant UGT isoforms (except UGT1A4)-catalyzed 4-methylumbelliferone (4-MU) glucuronidation reaction and UGT1A4-catalyzed trifluoperazine (TFP) glucuronidation were employed to firstly screen the andrographolide derivatives' inhibition potential. High specific inhibition of andrographolide derivatives towards UGT2B7 was observed. The inhibition type and parameters (K i ) were determined for the compounds exhibiting strong inhibition capability towards UGT2B7, and human liver microsome (HLMs)-catalyzed zidovudine (AZT) glucuronidation probe reaction was used to furtherly confirm the inhibition behavior. In combination of inhibition parameters (K i ) and in vivo concentration of andrographolide and dehydroandrographolide, the potential in vivo inhibition magnitude was predicted. Additionally, both the in vitro inhibition data and computational modeling results provide important information for the modification of andrographolide derivatives as selective inhibitors of UGT2B7. Taken together, data obtained from the present study indicated the potential herb–drug interaction between Andrographis paniculata and the drugs mainly undergoing UGT2B7-catalyzed metabolic elimination, and the andrographolide derivatives as potential candidates for the selective inhibitors of UGT2B7. - Highlights: • Specific inhibition of andrographolide derivatives towards UGT2B7. • Herb-drug interaction related withAndrographis paniculata. • Guidance for design of UGT2B7 specific inhibitors

  9. Herb–drug interaction prediction based on the high specific inhibition of andrographolide derivatives towards UDP-glucuronosyltransferase (UGT) 2B7

    Ma, Hai-Ying, E-mail: cmu4h-mhy@126.com [The Fourth Affiliated Hospital of China Medical University, Shenyang 110032 (China); Sun, Dong-Xue [School of Traditional Chinese Medicine, Shenyang Pharmaceutical University, No. 103, Wenhua Road, Shenyang 110016 (China); Cao, Yun-Feng [The First Affiliated Hospital of Liaoning Medical University, Jinzhou 121001 (China); Joint Center for Translational Medicine, Dalian Institute of Chemical Physics, Chinese Academy of Sciences, Zhongshan Road, Dalian 116023 (China); Ai, Chun-Zhi [Joint Center for Translational Medicine, Dalian Institute of Chemical Physics, Chinese Academy of Sciences, Zhongshan Road, Dalian 116023 (China); Qu, Yan-Qing [Thyroid Surgery, Yantaishan Hospital, Yantai, Shandong (China); Hu, Cui-Min [Joint Center for Translational Medicine, Dalian Institute of Chemical Physics, Chinese Academy of Sciences, Zhongshan Road, Dalian 116023 (China); Department of Microbiology and Immunology, Georgetown University Medical Center, Washington, DC 20057 (United States); Jiang, Changtao [Laboratory of Metabolism, Center for Cancer Research, National Cancer Institute, Bethesda, MD 20892 (United States); Dong, Pei-Pei [Academy of Integrative Medicine, Dalian Medical University, Dalian 116044 (China); Sun, Xiao-Yu; Hong, Mo [Joint Center for Translational Medicine, Dalian Institute of Chemical Physics, Chinese Academy of Sciences, Zhongshan Road, Dalian 116023 (China); Tanaka, Naoki; Gonzalez, Frank J. [Laboratory of Metabolism, Center for Cancer Research, National Cancer Institute, Bethesda, MD 20892 (United States); and others

    2014-05-15

    Herb–drug interaction strongly limits the clinical application of herbs and drugs, and the inhibition of herbal components towards important drug-metabolizing enzymes (DMEs) has been regarded as one of the most important reasons. The present study aims to investigate the inhibition potential of andrographolide derivatives towards one of the most important phase II DMEs UDP-glucuronosyltransferases (UGTs). Recombinant UGT isoforms (except UGT1A4)-catalyzed 4-methylumbelliferone (4-MU) glucuronidation reaction and UGT1A4-catalyzed trifluoperazine (TFP) glucuronidation were employed to firstly screen the andrographolide derivatives' inhibition potential. High specific inhibition of andrographolide derivatives towards UGT2B7 was observed. The inhibition type and parameters (K{sub i}) were determined for the compounds exhibiting strong inhibition capability towards UGT2B7, and human liver microsome (HLMs)-catalyzed zidovudine (AZT) glucuronidation probe reaction was used to furtherly confirm the inhibition behavior. In combination of inhibition parameters (K{sub i}) and in vivo concentration of andrographolide and dehydroandrographolide, the potential in vivo inhibition magnitude was predicted. Additionally, both the in vitro inhibition data and computational modeling results provide important information for the modification of andrographolide derivatives as selective inhibitors of UGT2B7. Taken together, data obtained from the present study indicated the potential herb–drug interaction between Andrographis paniculata and the drugs mainly undergoing UGT2B7-catalyzed metabolic elimination, and the andrographolide derivatives as potential candidates for the selective inhibitors of UGT2B7. - Highlights: • Specific inhibition of andrographolide derivatives towards UGT2B7. • Herb-drug interaction related withAndrographis paniculata. • Guidance for design of UGT2B7 specific inhibitors.

  10. Precision lens assembly with alignment turning system

    Ho, Cheng-Fang; Huang, Chien-Yao; Lin, Yi-Hao; Kuo, Hui-Jean; Kuo, Ching-Hsiang; Hsu, Wei-Yao; Chen, Fong-Zhi

    2017-10-01

    The poker chip assembly with high precision lens barrels is widely applied to ultra-high performance optical system. ITRC applies the poker chip assembly technology to the high numerical aperture objective lenses and lithography projection lenses because of its high efficiency assembly process. In order to achieve high precision lens cell for poker chip assembly, an alignment turning system (ATS) is developed. The ATS includes measurement, alignment and turning modules. The measurement module is equipped with a non-contact displacement sensor (NCDS) and an autocollimator (ACM). The NCDS and ACM are used to measure centration errors of the top and the bottom surface of a lens respectively; then the amount of adjustment of displacement and tilt with respect to the rotational axis of the turning machine for the alignment module can be determined. After measurement, alignment and turning processes on the ATS, the centration error of a lens cell with 200 mm in diameter can be controlled within 10 arcsec. Furthermore, a poker chip assembly lens cell with three sub-cells is demonstrated, each sub-cells are measured and accomplished with alignment and turning processes. The lens assembly test for five times by each three technicians; the average transmission centration error of assembly lens is 12.45 arcsec. The results show that ATS can achieve high assembly efficiency for precision optical systems.

  11. PI3K-delta mediates double-stranded RNA-induced upregulation of B7-H1 in BEAS-2B airway epithelial cells

    Kan-o, Keiko; Matsumoto, Koichiro; Asai-Tajiri, Yukari; Fukuyama, Satoru; Hamano, Saaka; Seki, Nanae; Nakanishi, Yoichi; Inoue, Hiromasa

    2013-01-01

    Highlights: •Double-stranded RNA upregulates B7-H1 on BEAS-2B airway epithelial cells. •The upregulation of B7-H1 is attenuated by inhibition of PI3Kδ isoform. •PI3Kδ-mediated upregulation of B7-H1 is independent of NF-κB activation. •Inhibition of PI3Kδ may prevent persistent viral infection induced by B7-H1. -- Abstract: Airway viral infection disturbs the health-related quality of life. B7-H1 (also known as PD-L1) is a coinhibitory molecule associated with the escape of viruses from the mucosal immunity, leading to persistent infection. Most respiratory viruses generate double-stranded (ds) RNA during replication. The stimulation of cultured airway epithelial cells with an analog of viral dsRNA, polyinosinic-polycytidylic acid (poly IC) upregulates the expression of B7-H1 via activation of the nuclear factor κB(NF-κB). The mechanism of upregulation was investigated in association with phosphatidylinositol 3-kinases (PI3Ks). Poly IC-induced upregulation of B7-H1 was profoundly suppressed by a pan-PI3K inhibitor and partially by an inhibitor or a small interfering (si)RNA for PI3Kδ in BEAS-2B cells. Similar results were observed in the respiratory syncytial virus-infected cells. The expression of p110δ was detected by Western blot and suppressed by pretreatment with PI3Kδ siRNA. The activation of PI3Kδ is typically induced by oxidative stress. The generation of reactive oxygen species was increased by poly IC. Poly IC-induced upregulation of B7-H1 was attenuated by N-acetyl-L-cysteine, an antioxidant, or by oxypurinol, an inhibitor of xanthine oxidase. Poly IC-induced activation of NF-κB was suppressed by a pan-PI3K inhibitor but not by a PI3Kδ inhibitor. These results suggest that PI3Kδ mediates dsRNA-induced upregulation of B7-H1 without affecting the activation of NF-κB

  12. Differential Impact of miR-21 on Pain and Associated Affective and Cognitive Behavior after Spared Nerve Injury in B7-H1 ko Mouse

    Franziska Karl

    2017-07-01

    Full Text Available MicroRNAs (miRNAs are increasingly recognized as regulators of immune and neuronal gene expression and are potential master switches in neuropathic pain pathophysiology. miR-21 is a promising candidate that may link the immune and the pain system. To investigate the pathophysiological role of miR-21 in neuropathic pain, we assessed mice deficient of B7 homolog 1 (B7-H1, a major inhibitor of inflammatory responses. In previous studies, an upregulation of miR-21 had been shown in mouse lymphocytes. Young (8 weeks, middle-aged (6 months, and old (12 months B7-H1 ko mice and wildtype littermates (WT received a spared nerve injury (SNI. We assessed thermal withdrawal latencies and mechanical withdrawal thresholds. Further, we performed tests for anxiety-like and cognitive behavior. Quantitative real time PCR was used to determine miR-21 relative expression in peripheral nerves, and dorsal root ganglia (DRG at distinct time points after SNI. We found mechanical hyposensitivity with increasing age of naïve B7-H1 ko mice. Young and middle-aged B7-H1 ko mice were more sensitive to mechanical stimuli compared to WT mice (young: p < 0.01, middle-aged: p < 0.05. Both genotypes developed mechanical and heat hypersensitivity (p < 0.05 after SNI, without intergroup differences. No relevant differences were found after SNI in three tests for anxiety like behavior in B7-H1 ko and WT mice. Also, SNI had no effect on cognition. B7-H1 ko and WT mice showed a higher miR-21 expression (p < 0.05 and invasion of macrophages and T cells in the injured nerve 7 days after SNI without intergroup differences. Our study reveals that increased miR-21 expression in peripheral nerves after SNI is associated with reduced mechanical and heat withdrawal thresholds. These results point to a role of miR-21 in the pathophysiology of neuropathic pain, while affective behavior and cognition seem to be spared. Contrary to expectations, B7-H1 ko mice did not show higher miR-21

  13. Herb-drug interaction prediction based on the high specific inhibition of andrographolide derivatives towards UDP-glucuronosyltransferase (UGT) 2B7.

    Ma, Hai-Ying; Sun, Dong-Xue; Cao, Yun-Feng; Ai, Chun-Zhi; Qu, Yan-Qing; Hu, Cui-Min; Jiang, Changtao; Dong, Pei-Pei; Sun, Xiao-Yu; Hong, Mo; Tanaka, Naoki; Gonzalez, Frank J; Ma, Xiao-Chi; Fang, Zhong-Ze

    2014-05-15

    Herb-drug interaction strongly limits the clinical application of herbs and drugs, and the inhibition of herbal components towards important drug-metabolizing enzymes (DMEs) has been regarded as one of the most important reasons. The present study aims to investigate the inhibition potential of andrographolide derivatives towards one of the most important phase II DMEs UDP-glucuronosyltransferases (UGTs). Recombinant UGT isoforms (except UGT1A4)-catalyzed 4-methylumbelliferone (4-MU) glucuronidation reaction and UGT1A4-catalyzed trifluoperazine (TFP) glucuronidation were employed to firstly screen the andrographolide derivatives' inhibition potential. High specific inhibition of andrographolide derivatives towards UGT2B7 was observed. The inhibition type and parameters (Ki) were determined for the compounds exhibiting strong inhibition capability towards UGT2B7, and human liver microsome (HLMs)-catalyzed zidovudine (AZT) glucuronidation probe reaction was used to furtherly confirm the inhibition behavior. In combination of inhibition parameters (Ki) and in vivo concentration of andrographolide and dehydroandrographolide, the potential in vivo inhibition magnitude was predicted. Additionally, both the in vitro inhibition data and computational modeling results provide important information for the modification of andrographolide derivatives as selective inhibitors of UGT2B7. Taken together, data obtained from the present study indicated the potential herb-drug interaction between Andrographis paniculata and the drugs mainly undergoing UGT2B7-catalyzed metabolic elimination, and the andrographolide derivatives as potential candidates for the selective inhibitors of UGT2B7. Copyright © 2014 Elsevier Inc. All rights reserved.

  14. First turn around strategy for RHIC

    Milutinovic, J.; Ruggiero, A.G.

    1991-01-01

    The authors present a strategy for achieving the so-called first turn around in RHIC. The strategy is based on the same method proposed to correct a distorted closed orbit in RHIC, i.e. on a generalization of the local three-bump method. They found out that the method is very effective in passing the beam through a non-ideal, insufficiently known, machine. The perturbed lattice was generated by the code PATRIS, which was also adapted to control the newly developed software. In ten distributions of errors the software was capable of passing the beam through in 2-3 injection attempts, at full sextupole strength. It was also determined that once the beam makes the first turn around and all the correctors are energized, it stays in the machine for at least several hundred turns

  15. Turning points in the history of mathematics

    Grant, Hardy

    2015-01-01

    This book explores some of the major turning points in the history of mathematics, ranging from ancient Greece to the present, demonstrating the drama that has often been a part of its evolution. Studying these breakthroughs, transitions, and revolutions, their stumbling-blocks and their triumphs, can help illuminate the importance of the history of mathematics for its teaching, learning, and appreciation. Some of the turning points considered are the rise of the axiomatic method (most famously in Euclid), and the subsequent major changes in it (for example, by David Hilbert); the “wedding,” via analytic geometry, of algebra and geometry; the “taming” of the infinitely small and the infinitely large; the passages from algebra to algebras, from geometry to geometries, and from arithmetic to arithmetics; and the revolutions in the late nineteenth and early twentieth centuries that resulted from Georg Cantor’s creation of transfinite set theory. The origin of each turning point is discussed, along with...

  16. Application of digital lock-in detection to Hefei Light Source turn-by-turn system

    Yang Yongliang; Wang Junhua; Sun Baogen; Chen Yuanbo; Zhou Zeran

    2010-01-01

    This paper introduces the digital lock-in detection theory and discusses its feasibility to obtain the damping rate in turn-by-turn measurement systems. Numerical simulations of this method were carried out with Matlab. Then principle presenting beam experiments were conducted on the Hefei Light Source (HLS) storage ring. The measured beta oscillation growth time is about 0.26 ms and the damping time is about 1.2 ms. Simulation and experimental results show that, the digital lock-in detection method is effective in damping rate measurement in turn-by-turn measurement systems. (authors)

  17. CONNECTION OF TURN AHEAD AND TURN BACK WITH MOTORIC ABILITIES OF THE FIFTH GRADE STUDENTS

    Jovica Petković

    2006-06-01

    Full Text Available The research is done for the purpose of determination and defining of the level of connection between some motoric abilities with success in realization of programmed contents from the area of gymnastics (turn ahead and turn back. The research is done on the sample of fifty one students from the fifth grade of Elementary School, on ten motoric tests and on two specific motoric assignments – turn ahead and turn back. The results of this research clearly point that there exist the multitude of statistically important coefficients of correlation between treated motoric abilities and applied motoric assignments.

  18. Functional Expression of Programmed Death-Ligand 1 (B7-H1 by Immune Cells and Tumor Cells

    Rachel M. Gibbons Johnson

    2017-08-01

    Full Text Available The programmed death-1 (PD-1 and its ligand PD-L1 (B7-H1 signaling pathway has been the focus of much enthusiasm in the fields of tumor immunology and oncology with recent FDA approval of the anti-PD-1 antibodies pembrolizumab and nivolumab and the anti-PD-L1 antibodies durvalumab, atezolimuab, and avelumab. These therapies, referred to here as PD-L1/PD-1 checkpoint blockade therapies, are designed to block the interaction between PD-L1, expressed by tumor cells, and PD-1, expressed by tumor-infiltrating CD8+ T cells, leading to enhanced antitumor CD8+ T cell responses and tumor regression. The influence of PD-L1 expressed by tumor cells on antitumor CD8+ T cell responses is well characterized, but the impact of PD-L1 expressed by immune cells has not been well defined for antitumor CD8+ T cell responses. Although PD-L1 expression by tumor cells has been used as a biomarker in selection of patients for PD-L1/PD-1 checkpoint blockade therapies, patients whose tumor cells lack PD-L1 expression often respond positively to PD-L1/PD-1 checkpoint blockade therapies. This suggests that PD-L1 expressed by non-malignant cells may also contribute to antitumor immunity. Here, we review the functions of PD-L1 expressed by immune cells in the context of CD8+ T cell priming, contraction, and differentiation into memory populations, as well as the role of PD-L1 expressed by tumor cells in regulating antitumor CD8+ T cell responses.

  19. HLA-B7-restricted islet epitopes are differentially recognized in type 1 diabetic children and adults and form weak peptide-HLA complexes

    Scotto, Matthieu; Afonso, Georgia; Østerbye, Thomas

    2012-01-01

    The cartography of β-cell epitopes targeted by CD8(+) T cells in type 1 diabetic (T1D) patients remains largely confined to the common HLA-A2 restriction. We aimed to identify β-cell epitopes restricted by the HLA-B7 (B*07:02) molecule, which is associated with mild T1D protection. Using DNA immu......1D children and adults, and are recognized by IFN-γ(+)TGF-β(+)CD8(+) T cells. These features may explain the T1D-protective effect of HLA-B7. The novel epitopes identified should find valuable applications for immune staging of HLA-B7(+) individuals....

  20. Evaluation of B7-H3 Expression as a Biomarker of Biochemical Recurrence After Salvage Radiation Therapy for Recurrent Prostate Cancer

    Parker, Alexander S.; Heckman, Michael G.; Sheinin, Yuri; Wu, Kevin J.; Hilton, Tracy W.; Diehl, Nancy N.; Pisansky, Thomas M.; Schild, Steven E.; Kwon, Eugene D.; Buskirk, Steven J.

    2011-01-01

    Purpose: The ability to predict which men will experience biochemical recurrence (BCR) after salvage radiation therapy (SRT) for recurrent prostate cancer (PCa) remains less than optimal. Related to this, novel targets for adjuvant therapies are also lacking. Here, we evaluate the association of B7-H3 expression in primary PCa tumors and BCR after SRT. Methods and Materials: We identified 148 patients who received SRT between July 1987 and July 2003. Expression of B7-H3 in primary PCa tumors was detected using a monoclonal antibody. The staining levels were quantified via visual assessment and categorized as weak, moderate, or marked. Relative risks (RRs) and 95% confidence intervals (CIs) from Cox proportional hazards models were used to examine the association between B7-H3 staining and BCR. Results: With a median follow-up of 6.2 years (minimum, 0.6; maximum, 14.7), 78 patients (53%) experienced BCR. In single-variable analysis, there was evidence of an increased risk of BCR for patients with moderate (RR, 2.25; 95% CI, 1.24-4.09, p = 0.008) and marked (RR, 4.40, 95% CI, 2.29-8.43, p < 0.001) B7-H3 staining compared with weak staining. This evidence remained, albeit weaker, after adjustment for additional clinicopathologic covariates (RR, 1.82, p = 0.068 [moderate vs. weak]; RR, 2.87, p = 0.003 [marked vs. weak]). Conclusion: This is the first report that higher tumor B7-H3 staining in primary PCa tumors is associated with increased risk of BCR after SRT. Future studies involving larger numbers of patients are required to validate these results and also to explore possible means of targeting B7-H3 in an adjuvant setting.

  1. A Practice Turn for Teacher Education?

    Reid, Jo-Anne

    2011-01-01

    Within the Research Institute for Professional Practice, Learning and Education (RIPPLE) at Charles Sturt University, teacher education researchers have been quick to respond to the opportunities created by what is known as "the practice turn" that characterises contemporary theory around the globe and across disciplines. We are working,…

  2. The Dynamic Turn in Quantum Logic

    Baltag, A.; Smets, S.

    2012-01-01

    In this paper we show how ideas coming from two areas of research in logic can reinforce each other. The first such line of inquiry concerns the "dynamic turn" in logic and especially the formalisms inspired by Propositional Dynamic Logic (PDL); while the second line concerns research into the

  3. The dynamic turn in quantum logic

    Baltag, Alexandru; Smets, Sonja

    In this paper we show how ideas coming from two areas of research in logic can reinforce each other. The first such line of inquiry concerns the "dynamic turn" in logic and especially the formalisms inspired by Propositional Dynamic Logic (PDL); while the second line concerns research into the

  4. Primordial spectra from sudden turning trajectory

    Noumi, Toshifumi; Yamaguchi, Masahide

    2013-12-01

    Effects of heavy fields on primordial spectra of curvature perturbations are discussed in inflationary models with a sudden turning trajectory. When heavy fields are excited after the sudden turn and oscillate around the bottom of the potential, the following two effects are generically induced: deformation of the inflationary background spacetime and conversion interactions between adiabatic and isocurvature perturbations, both of which can affect the primordial density perturbations. In this paper, we calculate primordial spectra in inflationary models with sudden turning potentials taking into account both of the two effects appropriately. We find that there are some non-trivial correlations between the two effects in the power spectrum and, as a consequence, the primordial scalar power spectrum has a peak around the scale exiting the horizon at the turn. Though both effects can induce parametric resonance amplifications, they are shown to be canceled out for the case with the canonical kinetic terms. The peak feature and the scale dependence of bispectra are also discussed.

  5. Train turn restrictions and line plan performance

    Burggraeve, Sofie; Bull, Simon Henry; Lusby, Richard Martin

    In this paper we study the impact of the `turn conditions' in end stations on the performance of a line plan. If trains have to turn on their platform in an end station, the yoccupy the platform for several minutes. A more preferred option, from a timetabling point of view, would be that a train...... in a exible and large enough shunt. Starting from a given line plan, we compare two timetables, one where trains have to turn on their platform and one where trains can turn in a shunt. We evaluate the impact on the performance of the line plan by its feasibility for timetabling,the minimum overall buffer...... disappears from the platform in its end station after dwelling and only appears again when departing for a subsequent trip. In this case, the train will not interfere with other trains that dwell on the platform during the time between these events. However, this option is only possible if the train can stay...

  6. Business Intelligence: Turning Knowledge into Power

    Endsley, Krista

    2009-01-01

    Today, many school districts are turning to business intelligence tools to retrieve, organize, and share knowledge for faster analysis and more effective, guided decision making. Business intelligence (BI) tools are the technologies and applications that gather and report information to help an organization's leaders make better decisions. BI…

  7. Zigzag turning preference of freely crawling cells.

    Taeseok Daniel Yang

    Full Text Available The coordinated motion of a cell is fundamental to many important biological processes such as development, wound healing, and phagocytosis. For eukaryotic cells, such as amoebae or animal cells, the cell motility is based on crawling and involves a complex set of internal biochemical events. A recent study reported very interesting crawling behavior of single cell amoeba: in the absence of an external cue, free amoebae move randomly with a noisy, yet, discernible sequence of 'run-and-turns' analogous to the 'run-and-tumbles' of swimming bacteria. Interestingly, amoeboid trajectories favor zigzag turns. In other words, the cells bias their crawling by making a turn in the opposite direction to a previous turn. This property enhances the long range directional persistence of the moving trajectories. This study proposes that such a zigzag crawling behavior can be a general property of any crawling cells by demonstrating that 1 microglia, which are the immune cells of the brain, and 2 a simple rule-based model cell, which incorporates the actual biochemistry and mechanics behind cell crawling, both exhibit similar type of crawling behavior. Almost all legged animals walk by alternating their feet. Similarly, all crawling cells appear to move forward by alternating the direction of their movement, even though the regularity and degree of zigzag preference vary from one type to the other.

  8. Strategy in Generative Planning of Turning Processes

    van Houten, Frederikus J.A.M.; Kals, H.J.J.

    1986-01-01

    This paper reports on the process and operations planning system ROUND and the strategies which underlie the decision making processes in the planning of turning operations. At first, an outline is given about the environment for which generative systems like ROUND are being developed. The

  9. Reconceptualizing Autonomy: A Relational Turn in Bioethics.

    Jennings, Bruce

    2016-05-01

    History's judgment on the success of bioethics will not depend solely on the conceptual creativity and innovation in the field at the level of ethical and political theory, but this intellectual work is not insignificant. One important new development is what I shall refer to as the relational turn in bioethics. This development represents a renewed emphasis on the ideographic approach, which interprets the meaning of right and wrong in human actions as they are inscribed in social and cultural practices and in structures of lived meaning and interdependence; in an ideographic approach, the task of bioethics is to bring practice into theory, not the other way around. The relational turn in bioethics may profoundly affect the critical questions that the field asks and the ethical guidance it offers society, politics, and policy. The relational turn provides a way of correcting the excessive atomism of many individualistic perspectives that have been, and continue to be, influential in bioethics. Nonetheless, I would argue that most of the work reflecting the relational turn remains distinctively liberal in its respect for the ethical significance of the human individual. It moves away from individualism, but not from the value of individuality.In this review essay, I shall focus on how the relational turn has manifested itself in work on core concepts in bioethics, especially liberty and autonomy. Following a general review, I conclude with a brief consideration of two important recent books in this area: Jennifer Nedelsky's Law's Relations and Rachel Haliburton's Autonomy and the Situated Self. © 2016 The Hastings Center.

  10. Silicon Carbide Emitter Turn-Off Thyristor

    Jun Wang

    2008-01-01

    Full Text Available A novel MOS-controlled SiC thyristor device, the SiC emitter turn-off thyristor (ETO is a promising technology for future high-voltage switching applications because it integrates the excellent current conduction capability of a SiC thyristor with a simple MOS-control interface. Through unity-gain turn-off, the SiC ETO also achieves excellent Safe Operation Area (SOA and faster switching speeds than silicon ETOs. The world's first 4.5-kV SiC ETO prototype shows a forward voltage drop of 4.26 V at 26.5 A/cm2 current density at room and elevated temperatures. Tested in an inductive circuit with a 2.5 kV DC link voltage and a 9.56-A load current, the SiC ETO shows a fast turn-off time of 1.63 microseconds and a low 9.88 mJ turn-off energy. The low switching loss indicates that the SiC ETO could operate at about 4 kHz if 100 W/cm2 conduction and the 100 W/cm2 turn-off losses can be removed by the thermal management system. This frequency capability is about 4 times higher than 4.5-kV-class silicon power devices. The preliminary demonstration shows that the SiC ETO is a promising candidate for high-frequency, high-voltage power conversion applications, and additional developments to optimize the device for higher voltage (>5 kV and higher frequency (10 kHz are needed.

  11. Research of remote control system in turn by turn timing system

    Zhan Zhifeng; Xiao Yanguo; Ma Kui; Yin Zejie; Wu Xiaoyi

    2003-01-01

    In this paper, we introduce a remote control system which is used in a frequency dividing and time-delay module. This control system is based on client/server architecture, and RS232 serial communication protocol. This control system is used in timing system of NSRL turn by turn beam position monitor

  12. Determination of linear optics functions from turn-by-turn data

    Alexahin, Y; Gianfelice-Wendt, E, E-mail: alexahin@fnal.gov [Fermi National Accelerator Laboratory, P.O. Box 500, Batavia, Illinois 60510 (United States)

    2011-10-15

    A method for evaluation of coupled optics functions, detection of strong perturbing elements, determination of BPM calibration errors and tilts using turn-by-turn (TBT) data is presented as well as the new version of the Hamiltonian perturbation theory of betatron oscillations the method is based upon. An example of application of the considered method to the Tevatron is given.

  13. Electrical Machines: Turn-to-Turn Capacitance in Formed Windings with Rectangular Cross-Section Wire

    Djukic, Nenad; Encica, L.; Paulides, Johan

    2015-01-01

    Calculation of turn-to-turn capacitance (Ctt) in electrical machines (EMs) with formed windings with rectangular cross-section wire is presented. Three calculation methods are used for the calculation of Ctt in case of rectangular conductors – finite element (FE) method and two previously published

  14. Immediate Effects of Clock-Turn Strategy on the Pattern and Performance of Narrow Turning in Persons With Parkinson Disease.

    Yang, Wen-Chieh; Hsu, Wei-Li; Wu, Ruey-Meei; Lin, Kwan-Hwa

    2016-10-01

    Turning difficulty is common in people with Parkinson disease (PD). The clock-turn strategy is a cognitive movement strategy to improve turning performance in people with PD despite its effects are unverified. Therefore, this study aimed to investigate the effects of the clock-turn strategy on the pattern of turning steps, turning performance, and freezing of gait during a narrow turning, and how these effects were influenced by concurrent performance of a cognitive task (dual task). Twenty-five people with PD were randomly assigned to the clock-turn or usual-turn group. Participants performed the Timed Up and Go test with and without concurrent cognitive task during the medication OFF period. The clock-turn group performed the Timed Up and Go test using the clock-turn strategy, whereas participants in the usual-turn group performed in their usual manner. Measurements were taken during the 180° turn of the Timed Up and Go test. The pattern of turning steps was evaluated by step time variability and step time asymmetry. Turning performance was evaluated by turning time and number of turning steps. The number and duration of freezing of gait were calculated by video review. The clock-turn group had lower step time variability and step time asymmetry than the usual-turn group. Furthermore, the clock-turn group turned faster with fewer freezing of gait episodes than the usual-turn group. Dual task increased the step time variability and step time asymmetry in both groups but did not affect turning performance and freezing severity. The clock-turn strategy reduces turning time and freezing of gait during turning, probably by lowering step time variability and asymmetry. Dual task compromises the effects of the clock-turn strategy, suggesting a competition for attentional resources.Video Abstract available for more insights from the authors (see Supplemental Digital Content 1, http://links.lww.com/JNPT/A141).

  15. Crack turning in integrally stiffened aircraft structures

    Pettit, Richard Glen

    Current emphasis in the aircraft industry toward reducing manufacturing cost has created a renewed interest in integrally stiffened structures. Crack turning has been identified as an approach to improve the damage tolerance and fail-safety of this class of structures. A desired behavior is for skin cracks to turn before reaching a stiffener, instead of growing straight through. A crack in a pressurized fuselage encounters high T-stress as it nears the stiffener---a condition favorable to crack turning. Also, the tear resistance of aluminum alloys typically varies with crack orientation, a form of anisotropy that can influence the crack path. The present work addresses these issues with a study of crack turning in two-dimensions, including the effects of both T-stress and fracture anisotropy. Both effects are shown to have relation to the process zone size, an interaction that is central to this study. Following an introduction to the problem, the T-stress effect is studied for a slightly curved semi-infinite crack with a cohesive process zone, yielding a closed form expression for the future crack path in an infinite medium. For a given initial crack tip curvature and tensile T-stress, the crack path instability is found to increase with process zone size. Fracture orthotropy is treated using a simple function to interpolate between the two principal fracture resistance values in two-dimensions. An extension to three-dimensions interpolates between the six principal values of fracture resistance. Also discussed is the transition between mode I and mode II fracture in metals. For isotropic materials, there is evidence that the crack seeks out a direction of either local symmetry (pure mode I) or local asymmetry (pure mode II) growth. For orthotropic materials the favored states are not pure modal, and have mode mixity that is a function of crack orientation. Drawing upon these principles, two crack turning prediction approaches are extended to include fracture

  16. Dicty_cDB: SHD293 [Dicty_cDB

    Full Text Available XXEXFGGAXTFNFTXSILPIPFKSI IEXXGXEXVNQFSKFYKFNDTIKINPFEIKTFXFISN*klkiklinkyknkf*x*...LQFASVIKXGYSLNNNFXISETPFXL XFTTXIDKTFISTNKXAIIXXTIKKAEXGXSFVXXXXEXFGGAXTFNFTXSILPIPFKSI IEXXGXEXVNQFSKFYKFND...TIKINPFEIKTFXFISN*klkiklinkyknkf*x*****f fqnkkkkk**nki Translated Amino Acid sequence (All Frames) Frame A:

  17. Dicty_cDB: SHD731 [Dicty_cDB

    Full Text Available TFISTNKEAIIVDTIKKAEDGTSFVVRVYESFGGATTFNFTSS ILPIPFKSIIECNGLEEVNQSSKSYKFNDTIKINPFEIKTFRFISN*klkiklinky...IIVDTIKKAEDGTSFVVRVYESFGGATTFNFTSS ILPIPFKSIIECNGLEEVNQSSKSYKFNDTIKINPFEIKTFRFISN*klkiklinky

  18. Dicty_cDB: SHD894 [Dicty_cDB

    Full Text Available T--- ---akxxkxxkxxlxxxixkkxqkxskknsrkkkklfvflsniynf*k*k Frame B: nvqlmhvpkkvv*lilqstlmitm...pvqlilvhhqpvfptpqsivmikrpvqlihvqiqlv v*ilqfpvtiiihvllilamt*lvvailqsmlmiiihvpsmpvlnqqvllipqsm*miit nvqlihvpkkvv*lilqsilmitm...lipqsmxmitt nvqlmhvpxkggvlipqsilmitmpvqlihvqkkgxyxilqsilexkkpvp--- ---XNXXKXKNXFX

  19. Dicty_cDB: SHD815 [Dicty_cDB

    Full Text Available GNMIENQYITLKTKLTPT**r*csl*nlgrlccq*sr*ti*nqylcsr ysft*ere*k*tfhslgkr*e*itlmaw**vn*fridclagikncsticsknwlqiw*r...LEGNMIENQYITLKTKLTPT**r*csl*nlgrlccq*sr*ti*nqylcsr ysft*ere*k*tfhslgkr*e*itlmaw**vn*fridclagikncsticsknwlqiw

  20. Dicty_cDB: SHD704 [Dicty_cDB

    Full Text Available tula EST MtBC33D01R1 : T7 end of clone MtBC33D01 of cDNA library MtBC from arbuscular mycorrhiza of cultivar...3D01F1 : T3 end of clone MtBC33D01 of cDNA library MtBC from arbuscular mycorrhiza of cultivar Jemalong of M

  1. Dicty_cDB: SHD666 [Dicty_cDB

    Full Text Available ickrislelfir *f*fhfrefntr*yw*icnlfciingfpskn*sn*tifhrcssnpslfvgkcyikysiq* ng*ktkh...ciingfpskn*sn*tifhrcssnpslfvgkcyikysiq* ng*ktkhxtcif*ixixf Homology vs CSM-cDNA Score E Sequences producing

  2. Dicty_cDB: SHD834 [Dicty_cDB

    Full Text Available reading fra... 76 5e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 76 5e-13 AX88...2278_1( AX882278 |pid:none) Sequence 17183 from Patent EP10746... 76 5e-13 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecoli

  3. Dicty_cDB: SHD615 [Dicty_cDB

    Full Text Available 0.90 3 CX072513 |CX072513.1 UCRCS08_28E10_g Parent Washington Navel Orange Callus cDNA Library UCRCS08-2 Cit...rus sinensis cDNA clone UCRCS08-28E10-J20-1-4.g, mRNA sequence. 46 0.92 1 CX072512 |CX072512.1 UCRCS08_28E10_b Parent

  4. Dicty_cDB: SHD280 [Dicty_cDB

    Full Text Available insert in 3'HPRT insertion targeting and chromosome engineering clone MHPP421e10....ineering clone MHPP186g09. 50 0.14 1 CR023465 |CR023465.1 Forward strand read from ...GRESS *** from clone. 38 0.13 8 CR044130 |CR044130.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome eng

  5. Dicty_cDB: SHD651 [Dicty_cDB

    Full Text Available ead from insert in 3'HPRT insertion targeting and chromosome engineering clone MH...PP142o16. 50 0.13 1 CR044130 |CR044130.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering

  6. Dicty_cDB: SHD671 [Dicty_cDB

    Full Text Available rd strand read from insert in 3'HPRT insertion targeting and chromosome engineering...neering clone MHPP186g09. 50 0.13 1 dna update 2006. 2. 5 Homology vs Protein Score... clone MHPP142o16. 50 0.13 1 CR044130 |CR044130.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engi

  7. Dicty_cDB: SHD353 [Dicty_cDB

    Full Text Available |CR103667.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering clone M...HPP142o16. 50 0.12 1 CR044130 |CR044130.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering...'HPRT insertion targeting and chromosome engineering clone MHPP47e19. 50 0.12 1 d

  8. Dicty_cDB: SHD119 [Dicty_cDB

    Full Text Available snih**ipqkvlvh*dsrtvamevgir*gvcnnspakwt speng*r*qwmvdaqslkeviilltcrka*r*rrslnvnssgvvfsadldgsskyskeft lkaevgk...eatlx xtxxanq*ffxklxigxkxppi**ikkkkysq Frame C: sgpflvsrtgdvg*tkywdktsnih**ipqkvlvh*dsrtvamevgir*gvcnnspakwt

  9. Tumor Therapeutics Work as Stress Inducers to Enhance Tumor Sensitivity to Natural Killer (NK) Cell Cytolysis by Up-regulating NKp30 Ligand B7-H6.

    Cao, Guoshuai; Wang, Jian; Zheng, Xiaodong; Wei, Haiming; Tian, Zhigang; Sun, Rui

    2015-12-11

    Immune cells are believed to participate in initiating anti-tumor effects during regular tumor therapy such as chemotherapy, radiation, hyperthermia, and cytokine injection. One of the mechanisms underlying this process is the expression of so-called stress-inducible immunostimulating ligands. Although the activating receptor NKG2D has been proven to play roles in tumor therapy through targeting its ligands, the role of NKp30, another key activating receptor, is seldom addressed. In this study, we found that the NKp30 ligand B7-H6 was widely expressed in tumor cells and closely correlated to their susceptibility to NK cell lysis. Further studies showed that treatment of tumor cells with almost all standard tumor therapeutics, including chemotherapy (cisplatin, 5-fluorouracil), radiation therapy, non-lethal heat shock, and cytokine therapy (TNF-α), could up-regulate the expression of B7-H6 in tumor cells and enhance tumor sensitivity to NK cell cytolysis. B7-H6 shRNA treatment effectively dampened sensitization of tumor cells to NK-mediated lysis. Our study not only reveals the possibility that tumor therapeutics work as stress inducers to enhance tumor sensitivity to NK cell cytolysis but also suggests that B7-H6 could be a potential target for tumor therapy in the future. © 2015 by The American Society for Biochemistry and Molecular Biology, Inc.

  10. Effects of ABCB1, ABCC2, UGT2B7 and HNF4α genetic polymorphisms on oxcarbazepine concentrations and therapeutic efficacy in patients with epilepsy.

    Shen, Chunhong; Zhang, Bijun; Liu, Zhirong; Tang, Yelei; Zhang, Yinxi; Wang, Shan; Guo, Yi; Ding, Yao; Wang, Shuang; Ding, Meiping

    2017-10-01

    The aim of the study is to investigate the effects of ABCB1, ABCC2, UGT2B7 and HNF4α genetic polymorphisms on plasma oxcarbazepine (OXC) concentrations and therapeutic efficacy in Han Chinese patients with epilepsy. We recruited 116 Han Chinese patients with epilepsy who were receiving OXC monotherapy. Blood samples were taken and OXC levels were measured. The polymorphisms of ABCB1 rs1045642, ABCC2 rs2273697, UGT2B7 rs7439366, and HNF4α rs2071197 were determined. The therapeutic efficacy of OXC at the 1-year time-point was assessed. Data analysis was performed using IBM SPSS Statistics 22.0. The genetic polymorphism of ABCB1 rs1045642 was found to be associated with normalized OXC concentration and therapeutic efficacy in patients with epilepsy (P<0.05). As for UGT2B7 rs7439366, the allele polymorphism exhibited a correlation with treatment outcome, but not OXC concentration. The polymorphisms of ABCC2 rs2273697 and HNF4α rs2071197 was not associated with OXC concentrations and therapeutic efficacy. These results suggested that ABCB1 rs1045642 and UGT2B7 rs7439366 may affect OXC pharmacokinetics and therapeutic efficacy in Han Chinese patients with epilepsy. However, further studies in larger populations and other ethnic groups are required. Copyright © 2017 British Epilepsy Association. Published by Elsevier Ltd. All rights reserved.

  11. Expression of the major histocompatibility antigens HLA-A2 and HLA-B7 by DNA-mediated gene transfer

    Bernabeu, C.; Finlay, D.; van de Rijn, M.; Maziarz, R. T.; Biro, P. A.; Spits, H.; de Vries, J.; Terhorst, C. P.

    1983-01-01

    Genes coding for the heavy chain of the class I antigens HLA-A2 or HLA-B7 of the human major histocompatibility complex have been introduced into mouse LtK- cells by cotransfection with the herpes simplex virus thymidine kinase gene. HAT-resistant colonies were isolated expressing either HLA-A2 or

  12. Selective blockade of B7-H3 enhances antitumour immune activity by reducing immature myeloid cells in head and neck squamous cell carcinoma.

    Mao, Liang; Fan, Teng-Fei; Wu, Lei; Yu, Guang-Tao; Deng, Wei-Wei; Chen, Lei; Bu, Lin-Lin; Ma, Si-Rui; Liu, Bing; Bian, Yansong; Kulkarni, Ashok B; Zhang, Wen-Feng; Sun, Zhi-Jun

    2017-09-01

    Immature myeloid cells including myeloid-derived suppressor cells (MDSCs) and tumour-associated macrophages (TAMs) promote tumour growth and metastasis by facilitating tumour transformation and angiogenesis, as well as by suppressing antitumour effector immune responses. Therefore, strategies designed to reduce MDSCs and TAMs accumulation and their activities are potentially valuable therapeutic goals. In this study, we show that negative immune checkpoint molecule B7-H3 is significantly overexpressed in human head and neck squamous cell carcinoma (HNSCC) specimen as compared with normal oral mucosa. Using immunocompetent transgenic HNSCC models, we observed that targeting inhibition of B7-H3 reduced tumour size. Flow cytometry analysis revealed that targeting inhibition of B7-H3 increases antitumour immune response by decreasing immunosuppressive cells and promoting cytotoxic T cell activation in both tumour microenvironment and macroenvironment. Our study provides direct in vivo evidence for a rationale for B7-H3 blockade as a future therapeutic strategy to treat patients with HNSCC. © 2017 The Authors. Journal of Cellular and Molecular Medicine published by John Wiley & Sons Ltd and Foundation for Cellular and Molecular Medicine.

  13. Towards a Practice Turn in EU Studies

    Adler-Nissen, Rebecca

    2016-01-01

    This article explores how practice theory can be recruited for the study of European integration. New generations of EU researchers are fascinated by the prospect of leaving the armchair and studying the people and artefacts that make the EU on an everyday level. This article surveys key practice......-oriented, anthropological and micro-sociological studies of the EU and European integration and shows how their findings challenge more traditional understandings of the dynamics of European integration. Moving beyond a stock-taking, the article distinguishes between ‘order- ing’ and ‘disordering’ practices and explores...... the potential of a practice turn in EU studies for both theory (overcoming dualism, replacing substantialism with processualism and rethinking power) and methods (including unstructured interviews, fieldwork and participant observation). A practice turn will force us to rethink core assumptions about the EU...

  14. Measurement of tool forces in diamond turning

    Drescher, J.; Dow, T.A.

    1988-12-01

    A dynamometer has been designed and built to measure forces in diamond turning. The design includes a 3-component, piezoelectric transducer. Initial experiments with this dynamometer system included verification of its predicted dynamic characteristics as well as a detailed study of cutting parameters. Many cutting experiments have been conducted on OFHC Copper and 6061-T6 Aluminum. Tests have involved investigation of velocity effects, and the effects of depth and feedrate on tool forces. Velocity has been determined to have negligible effects between 4 and 21 m/s. Forces generally increase with increasing depth of cut. Increasing feedrate does not necessarily lead to higher forces. Results suggest that a simple model may not be sufficient to describe the forces produced in the diamond turning process.

  15. When attempts at robbing prey turn fatal

    Dejean, Alain; Corbara, Bruno; Azémar, Frédéric; Carpenter, James M.

    2012-07-01

    Because group-hunting arboreal ants spread-eagle insect prey for a long time before retrieving them, these prey can be coveted by predatory flying insects. Yet, attempting to rob these prey is risky if the ant species is also an effective predator. Here, we show that trying to rob prey from Azteca andreae workers is a fatal error as 268 out of 276 potential cleptobionts (97.1 %) were captured in turn. The ant workers hunt in a group and use the "Velcro®" principle to cling firmly to the leaves of their host tree, permitting them to capture very large prey. Exceptions were one social wasp, plus some Trigona spp. workers and flies that landed directly on the prey and were able to take off immediately when attacked. We conclude that in this situation, previously captured prey attract potential cleptobionts that are captured in turn in most of the cases.

  16. FCC-hh turn-around cycle

    Alemany Fernandez, Reyes; Bartmann, Wolfgang; Buffat, Xavier; Niemi, Arto; Schulte, Daniel; Solfaroli Camillocci, Matteo; Stoel, Linda

    2016-01-01

    The turn-around cycle time of a collider is defined as the time spent between the end of stable beams and the start of the next stable beams period, and its calculation is of fundamental importance. On one side it is a crucial ingredient for the computation of the optimal time spent in luminosity production, which defines the integrated luminosity per fill or store. On the other side, combined with the availability and reliability of the machine, it allows to perform a detailed breakdown of the operational performance of the collider over an operational season, i.e. percentage of time in stable beams and beam in the machine with respect to down time. This paper presents a preliminary operational cycle definition for the hadron-hadron Future Circular Collider, as a base line for estimating the corresponding turn-around time. The cycle definition is based on the Large Hadron Collider (LHC) operational cycle. Two turn-around times are presented, the theoretical one and a more realistic one based on the LHC exper...

  17. Beam Optics Measurements Through Turn by Turn Beam Position Data in the SLS

    Zisopoulos, P; Streun, A; Ziemann, v

    2013-01-01

    Refined Fourier analysis of turn-by-turn (TBT) transverse position data measurements can be used for determining several beam properties of a ring, such as transverse tunes, optics functions, phases, chromatic properties and coupling. In particular, the Numerical Analysis of Fundamental Frequencies (NAFF) algorithm is used to analyse TBT data from the Swiss Light Source (SLS) storage ring in order to estimate on and off-momentum beam characteristics. Of particular interest is the potential of using the full position information within one turn in order to measure beam optics properties.

  18. First turn around strategy for RHIC

    Milutinovic, J.; Ruggiero, A.G.

    1991-06-01

    We present a strategy for achieving the so-called first turn around in RHIC. The strategy is based on the same method we had proposed to correct a distorted closed orbit in RHIC, i.e., on a generalization of the local three-bump method. We found out that the method is very effective in passing the beam through a non-ideal, insufficiently known, machine. We tested that software on ten different Gaussian distributions of dominant orbit distorting lattice imperfections. The perturbed lattice was generated by the code PATRIS, which was also adapted to control the newly developed software. In all of the ten distributions the software was capable of passing the beam through in 2--3 injection attempts, at full sextupole strength. It was also determined that once the beam makes the first turn around and all the correctors are energized, it stays in the machine for at least several hundred turns that we had checked. The quality of the orbit, that was established in this way, was also found to be very good, i.e., the residual distortions at the places of large beta function were much less than one millimeter. With one or two monitors/correctors broken, the software established a first turn around without any extra difficulties. The quality of such orbit was, of course, somewhat degraded, especially around the broken devices. It was also observed that, in the process of actual closing, the beam develops free betatron oscillations in the amplitude range of 1--5 mm, which can be reduced either by changing the injection conditions to better match the actual closed orbit or by an appropriate damping device. The hardware proposed for RHIC is more than sufficient to meet the demands of the first turn controlling software. The maximum kick angle to be applied to the beam would require less than 2/3 of the corrector's top strength even at the top magnetic rigidity Bρ = 850 T·m, which means that the correctors will be performing an easy task at injection

  19. Lattice modeling and calibration with turn-by-turn orbit data

    Xiaobiao Huang

    2010-11-01

    Full Text Available A new method that explores turn-by-turn beam position monitor (BPM data to calibrate lattice models of accelerators is proposed. The turn-by-turn phase space coordinates at one location of the ring are first established using data from two BPMs separated by a simple section with a known transfer matrix, such as a drift space. The phase space coordinates are then tracked with the model to predict positions at other BPMs, which can be compared to measurements. The model is adjusted to minimize the difference between the measured and predicted orbit data. BPM gains and rolls are included as fitting variables. This technique can be applied to either the entire or a section of the ring. We have tested the method experimentally on a part of the SPEAR3 ring.

  20. Lattice modeling and calibration with turn-by-turn orbit data

    Huang, Xiaobiao; Sebek, Jim; Martin, Don

    2010-11-01

    A new method that explores turn-by-turn beam position monitor (BPM) data to calibrate lattice models of accelerators is proposed. The turn-by-turn phase space coordinates at one location of the ring are first established using data from two BPMs separated by a simple section with a known transfer matrix, such as a drift space. The phase space coordinates are then tracked with the model to predict positions at other BPMs, which can be compared to measurements. The model is adjusted to minimize the difference between the measured and predicted orbit data. BPM gains and rolls are included as fitting variables. This technique can be applied to either the entire or a section of the ring. We have tested the method experimentally on a part of the SPEAR3 ring.

  1. CERN PS Optical Properties Measured with Turn-By-Turn Orbit Data

    Bach, T; Giovannozzi, M; Hernalsteens, C; Lachaize, A; Sterbini, G; Tom´as, R; Wasef, R

    2013-01-01

    The performance of the CERN Proton Synchrotron (PS) has been constantly increasing over the years both in terms of beam parameters (intensity and brightness) and beam manipulations (transverse and longitudinal splitting). This implies a very good knowledge of the linear and non-linear model of the ring. In this paper we report on a detailed campaign of beam measurements based on turn-by-turn orbit data aimed at measuring the optics in several conditions as well as the resonance driving terms.

  2. Hummingbirds control turning velocity using body orientation and turning radius using asymmetrical wingbeat kinematics.

    Read, Tyson J G; Segre, Paolo S; Middleton, Kevin M; Altshuler, Douglas L

    2016-03-01

    Turning in flight requires reorientation of force, which birds, bats and insects accomplish either by shifting body position and total force in concert or by using left-right asymmetries in wingbeat kinematics. Although both mechanisms have been observed in multiple species, it is currently unknown how each is used to control changes in trajectory. We addressed this problem by measuring body and wingbeat kinematics as hummingbirds tracked a revolving feeder, and estimating aerodynamic forces using a quasi-steady model. During arcing turns, hummingbirds symmetrically banked the stroke plane of both wings, and the body, into turns, supporting a body-dependent mechanism. However, several wingbeat asymmetries were present during turning, including a higher and flatter outer wingtip path and a lower more deviated inner wingtip path. A quasi-steady analysis of arcing turns performed with different trajectories revealed that changes in radius were associated with asymmetrical kinematics and forces, and changes in velocity were associated with symmetrical kinematics and forces. Collectively, our results indicate that both body-dependent and -independent force orientation mechanisms are available to hummingbirds, and that these kinematic strategies are used to meet the separate aerodynamic challenges posed by changes in velocity and turning radius. © 2016 The Author(s).

  3. Expression of membrane anchored cytokines and B7-1 alters tumor microenvironment and induces protective antitumor immunity in a murine breast cancer model.

    Bozeman, Erica N; Cimino-Mathews, Ashley; Machiah, Deepa K; Patel, Jaina M; Krishnamoorthy, Arun; Tien, Linda; Shashidharamurthy, Rangaiah; Selvaraj, Periasamy

    2013-05-07

    Many studies have shown that the systemic administration of cytokines or vaccination with cytokine-secreting tumors augments an antitumor immune response that can result in eradication of tumors. However, these approaches are hampered by the risk of systemic toxicity induced by soluble cytokines. In this study, we have evaluated the efficacy of 4TO7, a highly tumorigenic murine mammary tumor cell line, expressing glycosyl phosphatidylinositol (GPI)-anchored form of cytokine molecules alone or in combination with the costimulatory molecule B7-1 as a model for potential cell or membrane-based breast cancer vaccines. We observed that the GPI-anchored cytokines expressed on the surface of tumor cells greatly reduced the overall tumorigenicity of the 4TO7 tumor cells following direct live cell challenge as evidenced by transient tumor growth and complete regression within 30 days post challenge. Tumors co-expressing B7-1 and GPI-IL-12 grew the least and for the shortest duration, suggesting that this combination of immunostimulatory molecules is most potent. Protective immune responses were also observed following secondary tumor challenge. Further, the 4TO7-B7-1/GPI-IL-2 and 4TO7-B7-1/GPI-IL-12 transfectants were capable of inducing regression of a wild-type tumor growing at a distant site in a concomitant tumor challenge model, suggesting the tumor immunity elicited by the transfectants can act systemically and inhibit the tumor growth at a distant site. Additionally, when used as irradiated whole cell vaccines, 4TO7-B7-1/GPI-IL-12 led to a significant inhibition in tumor growth of day 7 established tumors. Lastly, we observed a significant decrease in the prevalence of myeloid-derived suppressor cells and regulatory T-cells in the tumor microenvironment on day 7 post challenge with 4TO7-B7-1/GPI-IL-12 cells, which provides mechanistic insight into antitumor efficacy of the tumor-cell membrane expressed IL-12. These studies have implications in designing membrane

  4. Alchemical inflation: inflaton turns into Higgs

    Nakayama, Kazunori; Takahashi, Fuminobu

    2012-11-01

    We propose a new inflation model in which a gauge singlet inflaton turns into the Higgs condensate after inflation. The inflationary path is characterized by a moduli space of supersymmetric vacua spanned by the inflaton and Higgs field. The inflation energy scale is related to the soft supersymmetry breaking, and the Hubble parameter during inflation is smaller than the gravitino mass. The initial condition for the successful inflation is naturally realized by the pre-inflation in which the Higgs plays a role of the waterfall field.

  5. Alchemical inflation: inflaton turns into Higgs

    Nakayama, Kazunori; Takahashi, Fuminobu

    2012-01-01

    We propose a new inflation model in which a gauge singlet inflaton turns into the Higgs condensate after inflation. The inflationary path is characterized by a moduli space of supersymmetric vacua spanned by the inflaton and Higgs field. The inflation energy scale is related to the soft supersymmetry breaking, and the Hubble parameter during inflation is smaller than the gravitino mass. The initial condition for the successful inflation is naturally realized by the pre-inflation in which the Higgs plays a role of the waterfall field

  6. Nippon Cinema at the digital turning point

    Marek Bochniarz

    2014-01-01

    Full Text Available This article is a review of a book written by Mitsuyo Wada Marciano – Japanese Cinema in the Digital Age. The author of this book examines the recent developments in the Japanese film industry at the turning point in the development of digital technologies. The book seeks to overcome the western approach to the subject, reinterprets classic films and explores new trends in transnational Japanese cinema (the term was proposed by the author to explain the situation of Japanese films in the context of Asian countries.

  7. Turning a page of Agency history

    NONE

    1969-07-01

    Recent developments, and especially the new and critical interest of developing countries, have helped to mark the turning of a page in the Agency's history. If the present situation in the economics of nuclear power does not change there is a danger that developing countries will lag further and further behind the advanced countries in its use. Shortage of resources impose a brake on Agency efforts to promote benefits of nuclear techniques, especially by technical assistance. These were some of the points made by Dr. Sigvard Eklund, the Director General, when he presented the Agency's annual report to the Economic and Social Council (ECOSOC) in July. (author)

  8. An elevator for lifting and turning pipes

    Melnikov, S.P.; Borchenkov, G.I.; Komarov, V.N.; Lebedev, D.A.

    1983-01-01

    An elevator is proposed for lifting and turning pipes, which includes a body and a bushing hinged to it with projections and a shank with a threaded adapter and cams which interact with the projections of the bushing. In order to increase the operational safety of the device through ensuring the capability of eliminating drops in the torque from the shank to the body when raising and extracting drill pipes, the body is equipped with eccentric cams rigidly connected to it, while the shank is equipped with a ring movable connected with it. The eccentric cams are installed between the bushing and the body with the capability of interacting with the shank ring.

  9. Hatchability of chicken eggs as influenced by turning frequency in ...

    An experiment was conducted to determine the influence of turning frequency of chicken eggs on hatchability in hurricane lantern incubator. There were four treatments in which eggs were not turned in treatment one (control), those in treatment two were turned once daily (morning), treatment three turned twice daily ...

  10. Hatchability of chicken eggs as influenced by turning frequency in ...

    STORAGESEVER

    2008-12-03

    Dec 3, 2008 ... Brake (2004) confirmed that absence of turning resulted in presentation of the head in the small end of the egg. Egg turning facilitated the transfer of yolk nutrients to the embryo via the sub-embryonic fluid (Deeming, 1989a). With modern incubators, automatic turning devices allow the eggs to be turned on ...

  11. Diamond Turning Of Infra-Red Components

    Hodgson, B.; Lettington, A. H.; Stillwell, P. F. T. C.

    1986-05-01

    Single point diamond machining of infra-red optical components such as aluminium mirrors, germanium lenses and zinc sulphide domes is potentially the most cost effective method for their manufacture since components may be machined from the blanks to a high surface finish, requiring no subsequent polishing, in a few minutes. Machines for the production of flat surfaces are well established. Diamond turning lathes for curved surfaces however require a high capital investment which can be justified only for research purposes or high volume production. The present paper describes the development of a low cost production machine based on a Bryant Symons diamond turning lathe which is able to machine spherical components to the required form and finish. It employs two horizontal spindles one for the workpiece the other for the tool. The machined radius of curvature is set by the alignment of the axes and the radius of the tool motion, as in conventional generation. The diamond tool is always normal to the workpiece and does not need to be accurately profiled. There are two variants of this basic machine. For machining hemispherical domes the axes are at right angles while for lenses with positive or negative curvature these axes are adjustable. An aspherical machine is under development, based on the all mechanical spherical machine, but in which a ± 2 mm aspherecity may be imposed on the best fit sphere by moving the work spindle under numerical control.

  12. Turning the appliance market around towards A++

    Noergaard, Joergen S.; Guldbrandsen, Tom [Dept. of Civil Engineering, Technical Univ. of Denmark (Denmark); Brange, Birgitte; Karbo, Peter [Elsparefonden (Denmark)

    2007-07-01

    In an effort to exploit better the labelling schemes for appliances the Danish Electricity Saving Trust has run some campaigns on cold appliances. In 1999 focus was on getting people to choose A-rated models, the 2004 campaign focussed on A+, and in 2005 on A++. These campaigns and their results are described in the paper and some conclusions are drawn.The campaigns have consisted of various elements, namely 1) a general information about the campaigns, 2) a subsidy offered temporarily during some months to people buying the A, A+ and A++ models, 3) a website where people can easily find the most energy efficient model within their specification, and 4) in the website are also listed the shops, where consumers can get the appliances at lowest prices. The latter was the most innovative and maybe also the most effective measure in the package.Results showed up as a permanent U-turn of the market in the course of a few years. Where models C, D, E earlier dominated the market, the A, A+ and A++, came to dominate as the standard models in stock. Consequently, their prices dropped significantly. The theory of a rational market behavior is based on some assumptions, one being that full information is available to all actors. The website identifying to the consumers the shops with the lowest priced efficient models was a step in that direction, and the result did not fail to turn up.

  13. Synthesis and structure of a 1,6-hexyldiamine heptaborate, [H3N(CH2)6NH3][B7O10(OH)3

    Yang Sihai; Li Guobao; Tian Shujian; Liao Fuhui; Xiong Ming; Lin Jianhua

    2007-01-01

    A new 1,6-hexyldiamine heptaborate, [H 3 N(CH 2 ) 6 NH 3 ][B 7 O 10 (OH) 3 ] (1), has been solvothermally synthesized and characterized by single-crystal X-ray diffraction, FTIR, elemental analysis, and thermogravimetric analysis. Compound 1 crystallizes in monoclinic system, space group P2 1 /n with a=8.042(2) A, b=20.004(4) A, c=10.103(2) A, and β=90.42(3) deg. The anionic [B 7 O 10 (OH) 3 ] n 2n- layers are interlinked via hydrogen bonding to form a 3D supramolecular network containing large channels, in which the templated [H 3 N(CH 2 ) 6 NH 3 ] 2+ cations are located. - Graphical abstract: A layered 1,6-hexyldiamine heptaborate, [H 3 N(CH 2 ) 6 NH 3 ][B 7 O 10 (OH) 3 ], was solvothermally synthesized at 150 deg. C. It is a layer borate and crystallized in monoclinic space group P2 1 /n with a=8.042(2) A, b=20.004(4) A, c=10.103(2) A, β=90.42(3) deg

  14. The B7-1 cytoplasmic tail enhances intracellular transport and mammalian cell surface display of chimeric proteins in the absence of a linear ER export motif.

    Yi-Chieh Lin

    Full Text Available Membrane-tethered proteins (mammalian surface display are increasingly being used for novel therapeutic and biotechnology applications. Maximizing surface expression of chimeric proteins on mammalian cells is important for these applications. We show that the cytoplasmic domain from the B7-1 antigen, a commonly used element for mammalian surface display, can enhance the intracellular transport and surface display of chimeric proteins in a Sar1 and Rab1 dependent fashion. However, mutational, alanine scanning and deletion analysis demonstrate the absence of linear ER export motifs in the B7 cytoplasmic domain. Rather, efficient intracellular transport correlated with the presence of predicted secondary structure in the cytoplasmic tail. Examination of the cytoplasmic domains of 984 human and 782 mouse type I transmembrane proteins revealed that many previously identified ER export motifs are rarely found in the cytoplasmic tail of type I transmembrane proteins. Our results suggest that efficient intracellular transport of B7 chimeric proteins is associated with the structure rather than to the presence of a linear ER export motif in the cytoplasmic tail, and indicate that short (less than ~ 10-20 amino acids and unstructured cytoplasmic tails should be avoided to express high levels of chimeric proteins on mammalian cells.

  15. A novel and sensitive method for determining vitamin B3 and B7 by pre-column derivatization and high-performance liquid chromatography method with fluorescence detection.

    Baolei Fan

    Full Text Available A new labeling reagent for vitamin analysis, 2-amino-10-ethyl acridine ketone (AEAO, has been synthesized and successfully applied to the analysis of vitamin B3 and vitamin B7 in different tea samples. The reaction of AEAO with vitamins could proceed easily and quickly in the presence of 1-ethyl-3-(3-dimethylaminopropyl-carbodiimide hydrochloride (EDC as condensing reagent within 45 min. The derivatives exhibited excellent fluorescence property with excitation and emission wavelengths of 290 nm and 430 nm, respectively. Response surface methodology (RSM was applied to the optimization of pre-column derivatization. Solid phase extraction with HLB cartridges was used for the extraction and purification of water-soluble vitamins in tea samples. The LODs for vitamin B3 and vitamin B7 were 2.56 and 2.22 ng mL-1, respectively. The proposed method was successfully applied to the analysis of vitamin B3 and vitamin B7 in different tea samples. The study provided a highly sensitive method for accurate analysis of trace vitamins from natural products.

  16. Mycophenolic acid AUC in Thai kidney transplant recipients receiving low dose mycophenolate and its association with UGT2B7 polymorphisms.

    Pithukpakorn, Manop; Tiwawanwong, Tiwat; Lalerd, Yupaporn; Assawamakin, Anunchai; Premasathian, Nalinee; Tasanarong, Adis; Thongnoppakhun, Wanna; Vongwiwatana, Attapong

    2014-01-01

    Despite use of a lower mycophenolate dose in Thai kidney transplant patients, acceptable graft and patient outcomes can be achieved. We therefore examined the pharmacokinetics of mycophenolic acid (MPA) by area under the curve (AUC) and investigated genetic contribution in mycophenolate metabolism in this population. Kidney transplant recipients with stable graft function who were receiving mycophenolate mofetil 1,000 mg/d in combination with either cyclosporine or tacrolimus, and prednisolone were studied. The MPA concentration was measured by fluorescence polarization immunoassay (FPIA), at predose and 1, 1.5, 2, 4, 6, 8, 10, and 12 hours after dosing. Genetic polymorphisms in UGT1A8, UGT1A9, and UGT2B7 were examined by denaturing high-performance liquid chromatography (DHPLC)-based single-base extension (SBE) analysis. A total 138 patients were included in study. The mean AUC was 39.49 mg-h/L (28.39-89.58 mg-h/L), which was in the therapeutic range. The correlation between the predose MPA concentration and AUC was poor. The mean AUC in the tacrolimus group was higher than that in the cyclosporine group. Polymorphisms in UGT2B7 showed significant association with AUC. Most of our patients with reduced mycophenolate dose had the AUC within the therapeutic range. Genetic polymorphisms in UGT2B7 may play a role in MPA metabolism in Thai kidney transplant patients.

  17. TGF-β of lung cancer microenvironment upregulates B7H1 and GITRL expression in dendritic cells and is associated with regulatory T cell generation.

    Ni, Xiao Yan; Sui, Hua Xiu; Liu, Yao; Ke, Shi Zhong; Wang, Yi Nan; Gao, Feng Guang

    2012-08-01

    The effects of TGF-β on dendritic cells (DCs) on the tumor microenvironment are not well understood. We report, here, the establishment of an in vitro lung cancer microenvironment by co-incubation of seminaphtharhodafluor (SNARF) labeled Lewis lung cancer (LLC) cells, carboxyfluorescein succinimidyl ester (CFSE) labeled fibroblasts and 4-chloromethyl-7-hydroxycoumarin (CMHC) labeled DCs. Raw 264.7, EL4 and NCI-H446 cells were able to synthesize TGF-β which was determined by flow cyto-metry and western blotting, respectively. Furthermore, TGF-β efficiently increased regulatory T-cell (Treg) expansion and upregulated DC B7H1 and GITRL expression. TGF-β and the co-incubation of LLC cells, fibroblasts with DCs could augment the expression of B7H1 and GITRL molecules of DCs. The data presented here indicate that the B7H1 and GITRL molecules may play an important role in TGF-β-induced Treg expansion of lung cancer microenvironment.

  18. Turning on gravity with the Higgs mechanism

    Alexander, Stephon; Barrow, John D; Magueijo, João

    2016-01-01

    We investigate how a Higgs mechanism could be responsible for the emergence of gravity in extensions of Einstein theory, with a suitable low energy limit. In this scenario, at high energies, symmetry restoration could ‘turn off’ gravity, with dramatic implications for cosmology and quantum gravity. The sense in which gravity is muted depends on the details of the implementation. In the most extreme case gravity’s dynamical degrees of freedom would only be unleashed after the Higgs field acquires a non-trivial vacuum expectation value, with gravity reduced to a topological field theory in the symmetric phase. We might also identify the Higgs and the Brans–Dicke fields in such a way that in the unbroken phase Newton’s constant vanishes, decoupling matter and gravity. We discuss the broad implications of these scenarios. (letter)

  19. Autism genes keep turning up chromatin.

    Lasalle, Janine M

    2013-06-19

    Autism-spectrum disorders (ASD) are complex genetic disorders collectively characterized by impaired social interactions and language as well as repetitive and restrictive behaviors. Of the hundreds of genes implicated in ASD, those encoding proteins acting at neuronal synapses have been most characterized by candidate gene studies. However, recent unbiased genome-wide analyses have turned up a multitude of novel candidate genes encoding nuclear factors implicated in chromatin remodeling, histone demethylation, histone variants, and the recognition of DNA methylation. Furthermore, the chromatin landscape of the human genome has been shown to influence the location of de novo mutations observed in ASD as well as the landscape of DNA methylation underlying neurodevelopmental and synaptic processes. Understanding the interactions of nuclear chromatin proteins and DNA with signal transduction pathways and environmental influences in the developing brain will be critical to understanding the relevance of these ASD candidate genes and continued uncovering of the "roots" of autism etiology.

  20. Scalets, wavelets and (complex) turning point quantization

    Handy, C. R.; Brooks, H. A.

    2001-05-01

    Despite the many successes of wavelet analysis in image and signal processing, the incorporation of continuous wavelet transform theory within quantum mechanics has lacked a compelling, first principles, motivating analytical framework, until now. For arbitrary one-dimensional rational fraction Hamiltonians, we develop a simple, unified formalism, which clearly underscores the complementary, and mutually interdependent, role played by moment quantization theory (i.e. via scalets, as defined herein) and wavelets. This analysis involves no approximation of the Hamiltonian within the (equivalent) wavelet space, and emphasizes the importance of (complex) multiple turning point contributions in the quantization process. We apply the method to three illustrative examples. These include the (double-well) quartic anharmonic oscillator potential problem, V(x) = Z2x2 + gx4, the quartic potential, V(x) = x4, and the very interesting and significant non-Hermitian potential V(x) = -(ix)3, recently studied by Bender and Boettcher.

  1. Introduction: The Participatory Turn in Urbanism

    Maroš Krivý

    2014-08-01

    Full Text Available This issue of Footprint examines the recent participatory turn in urban planning and urban design. It discusses the co-opting of participatory processes by planning departments, the systematic disregard of inequalities, and the empowering of the market resulting from the ‘anti-statism’ present in many participatory schemes.What is the relationship between the institutionalisation of participation and the practices of autonomy, self-organisation, and inclusion? When and how does genuine empowerment of collectives take place? Does the demand for the empowerment of local organisations and communities strengthen the market forces at the expense of central government?This issue attempts to problematise ‘participation’, to call attentions to some of its shortcomings, deficits, and limitations, not in order to necessarily bypass the demand for the democratisation of the urban, but in order to rectify and strengthen it.

  2. Turning Video Resource Management into Cloud Computing

    Weili Kou

    2016-07-01

    Full Text Available Big data makes cloud computing more and more popular in various fields. Video resources are very useful and important to education, security monitoring, and so on. However, issues of their huge volumes, complex data types, inefficient processing performance, weak security, and long times for loading pose challenges in video resource management. The Hadoop Distributed File System (HDFS is an open-source framework, which can provide cloud-based platforms and presents an opportunity for solving these problems. This paper presents video resource management architecture based on HDFS to provide a uniform framework and a five-layer model for standardizing the current various algorithms and applications. The architecture, basic model, and key algorithms are designed for turning video resources into a cloud computing environment. The design was tested by establishing a simulation system prototype.

  3. Diamond turning on advanced machine tool prototypes

    Arnold, J.B.; Steger, P.J.

    1975-01-01

    Specular-quality metal mirrors are being machined for use in laser optical systems. The fabrication process incorporates special quality diamond tools and specially constructed turning machines. The machines are controlled by advanced control techniques and are housed in an environmentally controlled laboratory to insure ultimate machine stability and positional accuracy. The materials from which these mirrors are primarily produced are the softer face-center-cubic structure metals, such as gold, silver, copper, and aluminum. Mirror manufacturing by the single-point diamond machining process is in an early stage of development, but it is anticipated that this method will become the most economical way for producing high-quality metal mirrors. (U.S.)

  4. The experience turn as ‘bandwagon’

    Fuglsang, Lars; Eide, Dorthe

    2013-01-01

    further central processes, namely appropriation and narrowing the workspace. One Norwegian and one Danish network are studied using a case methodology. They are two rural networks of mainly small tourism firms. The empirical study confirms and illustrates how the bandwagon effect involves these three core......This paper uses the bandwagon metaphor to analyse, in two rural contexts, how small tourism firms become engaged in the idea of the experience economy and how the idea is turned into practice through network formation and innovation. In developing a practice-based approach we use the bandwagon...... metaphor to conceptualize network formation and innovation in terms of a ‘journey’. Following the practice-based literature on bandwagons, the journey starts by labelling an idea that is broad enough to give meaning to, and pull together, a number of diverse supporters. The journey also depends on two...

  5. Turned Back: Mad Men as Intermedial Melodrama

    Monique Rooney

    2012-09-01

    Full Text Available This essay draws on definitions of gesture (Giorgio Agamben and Peter Brooks and catachresis (Peter Brooks, Jacques Derrida to examine the primacy of non-verbal signifiers as communicators of meaning in AMC’s Mad Men. Beginning with an analysis of Mad Men’s credit sequence, it draws attention to Mad Men’s use of gesture and catachresis in relation to melodrama’s privileging of non-verbal and naturalistic expression and its persistence as an intermedial mode that has moved back and forth between various media (theatre, novel, cinema, television and now digital formats. It argues that Mad Men’s melodramatic aesthetic is one that obliquely, and via a gestural and rhetorical ‘turned back’, communicates its relation to the past and the present.

  6. MEDIACRACY TURNS INTO A SYNONYM OF MEDIOCRITY?

    Valentina CHIPER

    2014-11-01

    Full Text Available The link between freedom of speech and democracy is based on ideological legitimacy report. A new phenomenon which is worth noticing is the conversion of the freedom of expression from a freedom seen in certain aspects as a solitary freedom into a communication of the masses. Another challenge is prompted by the change of the traditional communication system at the dawn of technology, Internet and its various applications, as well as of the channels used. A weak point is the change in the values scale. If a journalist or a book is deemed good or valuable in terms of competence and ideas, these values are now unfortunately inspired by what we watch on TV. In this train of thoughts, reliable opinion leaders are no longer the same. Mediacracy turns into a synonym of mediocrity with affectivity and emotion prevailing over reason and instead of the communication of thoughts and opinions.

  7. Turn-by-Turn Imaging of the Transverse Beam Profile in PEP-II

    Fisher, Alan A.; Petree, Mark; /SLAC

    2006-12-18

    During injection or instability, the transverse profile of an individual bunch in a storage ring can change significantly in a few turns. However, most synchrotron-light imaging techniques are not designed for this time scale. We have developed a novel diagnostic that enhances the utility of a fast gated camera by adding, inexpensively, some features of a dual-axis streak camera, in order to watch the turn-by-turn evolution of the transverse profile, in both x and y. The beam's elliptical profile is reshaped using cylindrical lenses to form a tall and narrow ellipse--essentially the projection of the full ellipse onto one transverse axis. We do this projection twice, by splitting the beam into two paths at different heights, and rotating the ellipse by 90{sup o} on one path. A rapidly rotating mirror scans these vertical ''pencils'' of light horizontally across the photocathode of the camera, which is gated for 3 ns on every Nth ring turn. A single readout of the camera captures 100 images, looking like a stroboscopic photograph of a moving object. We have observed the capture of injected charge into a bunch and the rapid change of beam size at the onset of a fast instability.

  8. Assessing lexical, syntactic, and conceptual turn-by-turn alignment in conversations involving conflict and deception

    Duran, Nicholas; Fusaroli, Riccardo; Paxton, Alexandra

    2015-01-01

    -based NLP tools, the procedure begins by taking conversational partners' turns and converting each into a lemmatized sequence of words, assigning part-of-speech tags and computing high-dimensional semantic vectors per each utterance. Words and part-of-speech tags are further sequenced into n-g! rams...

  9. Turning to Ontology in STS? Turning to STS through ‘Ontology’

    van Heur, B.; Leydesdorff, L.; Wyatt, S.

    2012-01-01

    We examine the evidence for the claim of an ‘ontological turn’ in science and technology studies (STS). Despite an increase in references to ‘ontology’ in STS since 1989, we show that there has not so much been an ontological turn as multiple discussions deploying the language of ontology,

  10. Turn me on! Using the “Internet of Things” to turn things on and off

    Butgereit, L

    2011-10-01

    Full Text Available to the Internet. There are many examples of things posting their status on Twitter and allowing uni-directional access. TurnMeOn is an example of allowing bidirectional access between people and things using Internet protocols. Users can query the status of a...

  11. Mimicry by asx- and ST-turns of the four main types of beta-turn in proteins.

    Duddy, William J; Nissink, J Willem M; Allen, Frank H; Milner-White, E James

    2004-11-01

    Hydrogen-bonded beta-turns in proteins occur in four categories: type I (the most common), type II, type II', and type I'. Asx-turns resemble beta-turns, in that both have an NH. . .OC hydrogen bond forming a ring of 10 atoms. Serine and threonine side chains also commonly form hydrogen-bonded turns, here called ST-turns. Asx-turns and ST-turns can be categorized into four classes, based on side chain rotamers and the conformation of the central turn residue, which are geometrically equivalent to the four types of beta-turns. We propose asx- and ST-turns be named using the type I, II, I', and II' beta-turn nomenclature. Using this, the frequency of occurrence of both asx- and ST-turns is: type II' > type I > type II > type I', whereas for beta-turns it is type I > type II > type I' > type II'. Almost all type II asx-turns occur as a recently described three residue feature named an asx-nest.

  12. Predicting turns in proteins with a unified model.

    Qi Song

    Full Text Available MOTIVATION: Turns are a critical element of the structure of a protein; turns play a crucial role in loops, folds, and interactions. Current prediction methods are well developed for the prediction of individual turn types, including α-turn, β-turn, and γ-turn, etc. However, for further protein structure and function prediction it is necessary to develop a uniform model that can accurately predict all types of turns simultaneously. RESULTS: In this study, we present a novel approach, TurnP, which offers the ability to investigate all the turns in a protein based on a unified model. The main characteristics of TurnP are: (i using newly exploited features of structural evolution information (secondary structure and shape string of protein based on structure homologies, (ii considering all types of turns in a unified model, and (iii practical capability of accurate prediction of all turns simultaneously for a query. TurnP utilizes predicted secondary structures and predicted shape strings, both of which have greater accuracy, based on innovative technologies which were both developed by our group. Then, sequence and structural evolution features, which are profile of sequence, profile of secondary structures and profile of shape strings are generated by sequence and structure alignment. When TurnP was validated on a non-redundant dataset (4,107 entries by five-fold cross-validation, we achieved an accuracy of 88.8% and a sensitivity of 71.8%, which exceeded the most state-of-the-art predictors of certain type of turn. Newly determined sequences, the EVA and CASP9 datasets were used as independent tests and the results we achieved were outstanding for turn predictions and confirmed the good performance of TurnP for practical applications.

  13. Diseases that turn African hair silky.

    Ajose, Frances O A

    2012-11-01

    African hair in its natural state poses tenacious grooming challenges; consequently a large portion of the African cosmetic industry is focused on means to relax the tight curls of African hair to make the hair more manageable. In malnourished and hypoproteinemic states, African hair straightens in an uncomplimentary manner. Recently, we observed that in certain diseases African hair changes to a desirable silky wavy texture. To identify the diseases that turn African hair silky and their parameters we examined 5612 dermatology patients at a tertiary hospital in Nigeria. We then studied the clinical and basic laboratory parameters of those patients whose diseases were accompanied by the silky hair change. Silky hair change similar to the hair of the African neonatal child was observed in five diseases, namely AIDS, rheumatoid arthritis, systemic lupus erythematosus, pulmonary tuberculosis with cachexia, and Behçet's disease. Our study identified retrogression of African hair to the neonatal structure in five diseases. Anemia of chronic illness, high erythrocyte sedimentation rate, and mild hypocalcemia were significant laboratory parameters. This is an important observation, which should excite and advance research into the nature and structure of African hair. The causes of structural hair changes should include these five diseases. © 2012 The International Society of Dermatology.

  14. Now, It's Your Turn: How You Can Take Medicine Safely

    ... turn Javascript on. Feature: Taking Medicines Safely Now, It's Your Turn: How You Can Take Medicine Safely ... medicine. The pharmacist has filled the prescription. Now it's up to you to take the medicine safely. ...

  15. Nano and micro reoriented domains and their relation with the crystal structure in the new ferroelectric boracite Zn3B7O13Br

    Campa-Molina, J; Ulloa-Godinez, S; Barrera, A; Bucio, L; Mata, J

    2006-01-01

    A new zinc brome boracite Zn 3 B 7 O 13 Br has been grown by a chemical transport reaction in closed quartz ampoules at 920 K. The crystal structure was characterized by Rietveld refinement. Ferroelectric nano and micro reorientable domains were found in this material using polarizing optical microscopy (PLM), scanning electron microscopy (SEM) and transmission electron microscopy (TEM). Chemical analysis was performed with x-ray energy dispersive spectroscopy (EDX). In the crystal, a new structure transition at 586 K from orthorhombic (Pca 2 1 ) to cubic cell (F4-bar3c) has been found. This transition was corroborated by differential scanning calorimetry (DSC)

  16. Nano and micro reoriented domains and their relation with the crystal structure in the new ferroelectric boracite Zn3B7O13Br

    Campa-Molina, J.; Ulloa-Godínez, S.; Barrera, A.; Bucio, L.; Mata, J.

    2006-05-01

    A new zinc brome boracite Zn3B7O13Br has been grown by a chemical transport reaction in closed quartz ampoules at 920 K. The crystal structure was characterized by Rietveld refinement. Ferroelectric nano and micro reorientable domains were found in this material using polarizing optical microscopy (PLM), scanning electron microscopy (SEM) and transmission electron microscopy (TEM). Chemical analysis was performed with x-ray energy dispersive spectroscopy (EDX). In the crystal, a new structure transition at 586 K from orthorhombic (Pca 21) to cubic cell (F\\overline 4 3c ) has been found. This transition was corroborated by differential scanning calorimetry (DSC).

  17. History of Education in Canada: Historiographic "Turns" and Widening Horizons

    Bruno-Jofré, Rosa

    2014-01-01

    This paper explores major historiographic "turns" in history of education with a focus, although not exclusively, on English-speaking Canada. It addresses the transformative intellectual impact of the turn toward social history on the history of education, the impact of cultural history and the linguistic turn, the reception of Michel…

  18. First turn simulations in the cooler synchrotron COSY

    Dinev, D.

    1991-07-01

    This paper is devoted to the first turn correction and related problems in particle accelerators of synchrotron type. The paper consists of two parts. The first part is a survey of the existing methods for first turn steering. The second part is entirely devoted to the first turn in the cooler synchrotron COSY which is under assembling in KFA-Julich, Germany. (orig.)

  19. Tomographic reconstruction of transverse phase space from turn-by-turn profile data

    Hancock, S; Lindroos, M

    1999-01-01

    Tomographic methods have the potential for useful application in beam diagnostics. The tomographic reconstruction of transverse phase space density from turn-by-turn profile data has been studied with particular attention to the effects of dispersion and chromaticity. It is shown that the modified Algebraic Reconstruction Technique (ART) that deals successfully with the problem of non-linear motion in the longitudinal plane cannot, in general, be extended to cover the transverse case. Instead, an approach is proposed in which the effect of dispersion is deconvoluted from the measured profiles before the phase space picture is reconstructed using either the modified ART algorithm or the inverse Radon Transform. This requires an accurate knowledge of the momentum distribution of the beam and the modified ART reconstruction of longitudinal phase space density yields just such information. The method has been tested extensively with simulated data.

  20. Model-independent analysis of the Fermilab Tevatron turn-by-turn beam position monitor measurements

    Petrenko, A. V.; Valishev, A. A.; Lebedev, V. A.

    2011-09-01

    Coherent transverse beam oscillations in the Tevatron were analyzed with the model-independent analysis (MIA) technique. This allowed one to obtain the model-independent values of coupled betatron amplitudes, phase advances, and dispersion function around the ring from a single dipole kick measurement. In order to solve the MIA mode mixing problem which limits the accuracy of determination of the optical functions, we have developed a new technique of rotational MIA mode untangling. The basic idea is to treat each beam position monitor (BPM) as two BPMs separated in a ring by exactly one turn. This leads to a simple criterion of MIA mode separation: the betatron phase advance between any BPM and its counterpart shifted by one turn should be equal to the betatron tune and therefore should not depend on the BPM position in the ring. Furthermore, we describe a MIA-based technique to locate vibrating magnets in a storage ring.

  1. Model-independent analysis of the Fermilab Tevatron turn-by-turn beam position monitor measurements

    A. V. Petrenko

    2011-09-01

    Full Text Available Coherent transverse beam oscillations in the Tevatron were analyzed with the model-independent analysis (MIA technique. This allowed one to obtain the model-independent values of coupled betatron amplitudes, phase advances, and dispersion function around the ring from a single dipole kick measurement. In order to solve the MIA mode mixing problem which limits the accuracy of determination of the optical functions, we have developed a new technique of rotational MIA mode untangling. The basic idea is to treat each beam position monitor (BPM as two BPMs separated in a ring by exactly one turn. This leads to a simple criterion of MIA mode separation: the betatron phase advance between any BPM and its counterpart shifted by one turn should be equal to the betatron tune and therefore should not depend on the BPM position in the ring. Furthermore, we describe a MIA-based technique to locate vibrating magnets in a storage ring.

  2. Breaking New Ground with High Resolution Turn-By-Turn BPMs at the ESRF

    Farvacque, L; Scheidt, K

    2001-01-01

    This High-Resolution, Turn-by-Turn BPM system is a low-cost extension to the existing BPM system, based on the RF-multiplexing concept, used for slow Closed-Orbit measurements. With this extension Beam Position measurements in both planes, at all (224) BPMs in the 844 m ESRF Storage Ring, for up to 2048 Orbit Turns with 1 μm resolution are performed. The data acquisition is synchronised to a single, flat 1 μs, transverse deflection kick to the 1μs beamfill in the 2.8μs revolution period. The high quality of this synchronisation, together with the good reproducibility of the deflection kick and the overall stability of the Closed Orbit beam allows to repeat the kick and acquisition in many cycles. The subsequent averaging of the data obtained in these cycles yields the 1um resolution. The latter allows lattice measurements with high precision such as the localisation of very small focussing errors and modulation in Beta values and phase advances. It also finds an unique ...

  3. Turn-Based War Chess Model and Its Search Algorithm per Turn

    Hai Nan

    2016-01-01

    Full Text Available War chess gaming has so far received insufficient attention but is a significant component of turn-based strategy games (TBS and is studied in this paper. First, a common game model is proposed through various existing war chess types. Based on the model, we propose a theory frame involving combinational optimization on the one hand and game tree search on the other hand. We also discuss a key problem, namely, that the number of the branching factors of each turn in the game tree is huge. Then, we propose two algorithms for searching in one turn to solve the problem: (1 enumeration by order; (2 enumeration by recursion. The main difference between these two is the permutation method used: the former uses the dictionary sequence method, while the latter uses the recursive permutation method. Finally, we prove that both of these algorithms are optimal, and we analyze the difference between their efficiencies. An important factor is the total time taken for the unit to expand until it achieves its reachable position. The factor, which is the total number of expansions that each unit makes in its reachable position, is set. The conclusion proposed is in terms of this factor: Enumeration by recursion is better than enumeration by order in all situations.

  4. and γγ-turns in proteins revisited: A new set of amino acid turn-type de

    cent Protein Data Bank has nearly doubled and the number of γ-turns in a representative set of 320 proteins has in- creased over seven times since the previous analysis. β-turns (7153) and γ-turns (911) extracted from these proteins were used to derive a revised set of type-dependent amino acid positional preferences and ...

  5. and γγ-turns in proteins revisited: A new set of amino acid turn-type de

    mine, valine, glutamic acid and alanine has decreased for β-turns. Certain new amino acid preferences were observed for both turn types and individual amino acids showed turn-type dependent positional preferences. The rationale for new amino acid preferences are discussed in the light of hydrogen bonds and other.

  6. The role of CD154-CD40 versus CD28-B7 costimulatory pathways in regulating allogeneic Th1 and Th2 responses in vivo

    Kishimoto, K; Dong, V M; Issazadeh-Navikas, Shohreh

    2000-01-01

    We used signal transducer and activator of transcription 4 (STAT4) and STAT6 gene knockout (-/-) mice as recipients of fully mismatched cardiac allografts to study the role of T-cell costimulatory pathways in regulating allogeneic T-helper 1 (Th1) versus Th2 responses in vivo. STAT4(-/-) mice have...... impaired Th1 responses, whereas STAT6(-/-) mice do not generate normal Th2 responses. Cardiac allografts from C57BL/6 mice were transplanted into normal wild-type (WT), STAT4(-/-), and STAT6(-/-) BALB/c recipients. STAT4(-/-) and STAT6(-/-) mice rejected their grafts with the same tempo as untreated WT....... Furthermore, there was a similar differential effect of CD28-B7 versus CD154-CD40 blockade in inhibiting immune responses in animals immunized with ovalbumin and complete Freund's adjuvant. These novel data indicate that Th1 and Th2 cells are differentially regulated by CD28-B7 versus CD154-CD40 costimulation...

  7. B7.1 expression on tumor cells circumvents the need of professional antigen presentation for in vitro propagation of cytotoxic T cell lines.

    Iezzi, G; Protti, M P; Rugarli, C; Bellone, M

    1996-01-01

    In vitro propagation of tumor-specific CTLs, to be used for identification of tumor antigens (Ag) and/or adoptive immunotherapy, is hampered by the need of large amounts of professional antigen-presenting cells (APC) used for periodical cycles of restimulation. We evaluated whether RMA T lymphoma cells, stably transfected with the cDNA encoding for the B7.1 costimulatory molecule, provided the activation signals to CD8+ T lymphocytes in the absence of professional APC and CD4+ helper cells. We demonstrate here that long-term CD8+ cell lines can be efficiently propagated in vitro by repeated cycles of stimulation with tumor cells stably expressing B7.1. Professional APC and CD4+ helper cells are not required as far as interleukin 2 is exogenously provided. Furthermore, CD8+ blasts needed both signal 1 (Ag in the contest of the MHC molecule) and signal 2 (interaction of costimulatory molecules) for restimulation. T cell blasts in the presence of signal 1 or 2 only still retained their effector potential but did not undergo clonal expansion. These results are very promising for further applications of specific immunotherapies in humans.

  8. Increased antigen presentation but impaired T cells priming after upregulation of interferon-beta induced by lipopolysaccharides is mediated by upregulation of B7H1 and GITRL.

    Fang Wang

    Full Text Available Dendritic cells are able to present Ag-derived peptides on MHC class I and II molecules and induce T cells priming. Lipopolysaccharides (LPS, an activator of Toll-like 4 receptor (TLR4 signaling, has been demonstrated to facilitate Ag-presentation, up-regulate surface molecules expression but impair T cells priming. In this study, we investigated the effect of LPS on nicotine-enhanced DCs-dependent T cells priming and the mechanisms of LPS orchestrating the immunosuppressive program. We could demonstrate that the treatment with LPS resulted in increased surface molecules expression, enhanced Ag-presentation, up-regulated release of TGF-beta, TNF-alpha, IL-6, and IFN-beta. Concomititantly, the upregulation of IFN-beta in DCs induces the up-regulation of coinhibitory molecules B7H1 and GITRL, which cause an impaired activation of naïve Ag-specific T cells and the induction of T cell tolerance by enhancing B7H1-PD-1 interactions and promoting GITRL-GITL facilitated Treg generation, respectively. These data provide a mechanistic basis for the immunomodulatory action of IFN-beta which might open new possibilities in the development of therapeutic approaches aimed at the control of excessive immune response and persistent infection.

  9. No evidence for dualism in function and receptors: PD-L2/B7-DC is an inhibitory regulator of human T cell activation.

    Pfistershammer, Katharina; Klauser, Christoph; Pickl, Winfried F; Stöckl, Johannes; Leitner, Judith; Zlabinger, Gerhard; Majdic, Otto; Steinberger, Peter

    2006-05-01

    The B7 family member programmed-death-1-ligand 2 (PD-L2/B7-DC) is a ligand for programmed-death-receptor 1 (PD-1), a receptor involved in negative regulation of T cell activation. Several independent studies have reported that PD-L2, however, can also potently costimulate murine T cells via an additional yet unidentified receptor. In this study, we evaluated the contribution of PD-L2 to the activation of human T cells using a novel system of engineered T cell stimulators that expresses membrane-bound anti-CD3 antibodies. Analyzing early activation markers, cytokine production and proliferation, we found PD-L2 to consistently inhibit T cell activation. PD-L2 inhibition affected CD4+ and CD8+ T cells and was not abrogated by costimulation via CD28. Blocking PD-1 reverted the inhibitory effect of PD-L2, demonstrating involvement of this pathway. In human T cells, we found no evidence for any of the costimulatory effects described for PD-L2 in murine systems. In line with our functional data that do not point to stimulatory PD-L2-ligands, we show that binding of PD-L2-immunoglobulin to activated human T cells is abrogated by PD-1 antibodies. Our results demonstrate that PD-L2 negatively regulates human T cell activation and thus might be a candidate molecule for immunotherapeutic approaches aimed to attenuate pathological immune responses.

  10. Wittgenstein and the linguistic turn in social theory

    Hermansen, Jens Christian

    of Winch in social theory, the wider and more recent influence of Wittgenstein in areas such as technology and science studies, social theory, feminist and gender studies and conversation and discourse analysis is also considered. Historically, the readings of Wittgenstein in the social sciences have taken...... of the linguistic turn in social theory, the linguistic turn is a double-edged sword of both profound insights and limits; the claim is that the limits of the linguistic turn are the strengths of functionalist, structuralist and materialist approaches to the social sciences. The approach of the critical turn...... is to develop a more comprehensive social theory that is sensitive to these strengths and thus supersedes the limits of the linguistic turn. This paper suggests a different approach. Against the critical turn, the paper argues that the limits of the linguistic turn are identical with the very assumptions...

  11. German Atomic Energy Act turns fifty

    Schneider, Horst

    2009-01-01

    The German Atomic Energy Act entered into force on January 1, 1960. It turns fifty at the beginning of 2010. Is this a reason to celebrate or rather the opposite? Lawyers, in principle, can view old pieces of legislation from 2 perspectives: On the one hand, aged laws are treated in a spirit of veneration and are celebrated as proven. On the other hand, an anniversary of this kind can be a welcome reason for demands to abolish or, at least, fundamentally renew that law. Over the past half century, the German Atomic Energy Act went through stormy and varied phases both of a legal and a political character. Its 50 th anniversary is likely to spark off very conflicting evaluations as well. A review of legal history shows that the German or, rather, the Federal German Atomic Energy Act (AtG) was not a first-of-its-kind piece of legislation but stemmed from the 1957 EURATOM Treaty, in a way representing a latecomer of that treaty. The Atomic Energy Act experienced a number of important developments throughout its history: - In 1975, compulsory licensing of fuel element factories was introduced. - The back end of the fuel cycle, especially final storage, were incorporated in the Atomic Energy Act comprehensively first in 1976. - In 1985, legislators decided in favor of unlimited nuclear liability. - In 1994 and 1998, only some innovations in special items were introduced under the headings of environmental impact assessment and suitability for repository storage because the controversy about nuclear power did not permit a fundamental alignment towards a more comprehensive modern safety law. - The decision to opt out of the peaceful uses of nuclear power in 2002 drew the final line so far of decisions about directions of nuclear law in a major amendment. In parallel, the decisions by the Federal Constitutional Court and the Federal Administrative Court in the late 1970s and, above all, the 1980s provided important assistance which has remained valid to this day. What is

  12. K1B7 METAR

    National Oceanic and Atmospheric Administration, Department of Commerce — METAR is a routine scheduled observation and is the primary observation code used in the United States to satisfy requirements for reporting surface meteorological...

  13. Transparent lattice characterization with gated turn-by-turn data of diagnostic bunch train

    Li, Yongjun; Cheng, Weixing; Ha, Kiman; Rainer, Robert

    2017-11-01

    Methods of characterization of a storage ring's lattice have traditionally been intrusive to routine operations. More importantly, the lattice seen by particles can drift with the beam current due to collective effects. To circumvent this, we have developed a novel approach for dynamically characterizing a storage ring's lattice that is transparent to operations. Our approach adopts a dedicated filling pattern which has a short, separate diagnostic bunch train (DBT). Through the use of a bunch-by-bunch feedback system, the DBT can be selectively excited on demand. Gated functionality of a beam position monitor system is capable of collecting turn-by-turn data of the DBT, from which the lattice can then be characterized after excitation. As the DBT comprises only about one percent of the total operational bunches, the effects of its excitation are negligible to users. This approach allows us to localize the distributed quadrupolar wakefields generated in the storage ring vacuum chamber during beam accumulation. While effectively transparent to operations, our approach enables us to dynamically control the beta beat and phase beat, and unobtrusively optimize performance of the National Synchrotron Light Source-II accelerator during routine operations.

  14. Prediction of beta-turns with learning machines.

    Cai, Yu-Dong; Liu, Xiao-Jun; Li, Yi-Xue; Xu, Xue-biao; Chou, Kuo-Chen

    2003-05-01

    The support vector machine approach was introduced to predict the beta-turns in proteins. The overall self-consistency rate by the re-substitution test for the training or learning dataset reached 100%. Both the training dataset and independent testing dataset were taken from Chou [J. Pept. Res. 49 (1997) 120]. The success prediction rates by the jackknife test for the beta-turn subset of 455 tetrapeptides and non-beta-turn subset of 3807 tetrapeptides in the training dataset were 58.1 and 98.4%, respectively. The success rates with the independent dataset test for the beta-turn subset of 110 tetrapeptides and non-beta-turn subset of 30,231 tetrapeptides were 69.1 and 97.3%, respectively. The results obtained from this study support the conclusion that the residue-coupled effect along a tetrapeptide is important for the formation of a beta-turn.

  15. Magnetoimpedance of stress and/or field annealed Fe73.5Cu1Nb3Si15.5B7 amorphous and nanocrystalline ribbon

    Miguel, C.; Zhukov, A.P.; Gonzalez, J.

    2003-01-01

    Magnetoimpedance (MI) response of as-cast and annealed Fe 73.5 Cu 1 Nb 3 Si 15.5 B 7 amorphous alloy ribbon has been investigated. The thermal treatments were performed by current annealing technique (density 45 A/mm 2 during 1-120 min) under the action of a tensile stress of 500 MPa and/or an axial magnetic field of 750 A/m. For short annealing time (less than 5 min), the three kinds of treatment induced an uniaxial magnetic anisotropy in the amorphous state with a maximum of MI of 15%, while for long annealing the nanocrystallization process occurs with larger MI effect of around 22%. This MI behaviour is explained taking into account the role of the induced magnetic anisotropy and the microstructural changes owing to the thermal treatments

  16. Characterization of Vadose Zone Sediment: Borehole C3103 Located in the 216-B-7A Crib Near the B Tank Farm

    Lindenmeier, Clark W.; Serne, R JEFFREY.; Bjornstad, Bruce N.; Last, George V.; Lanigan, David C.; Lindberg, Michael J.; Clayton, Ray E.; Legore, Virginia L.; Kutnyakov, Igor V.; Baum, Steven R.; Geiszler, Keith N.; Valenta, Michelle M.; Vickerman, Tanya S.

    2002-12-01

    This report summarizes data collected from samples in borehole C3103. Borehole C3103 was completed to further characterize the nature and extent of vadose zone contaminants supplied by intentional liquid discharges into the crib 216-B7A/7B between 1954 and 1967. These cribs received dilute waste streams from the bismuth phosphate fuel reprocessing program in the 1950's and decontamination waste in the 1960's. Elevated concentrations of several constituents were primarily measured at different depth intervals. The primary radionuclides present in this borehole are cesium-137 and uranium near the top of the borehole. Chemical characteristics attributed to wastewater-soil interaction at different locations within this zone are elevated pH, sodium, fluoride, carbonate nitrate, and sulphate

  17. Anticipation in turn-taking: mechanisms and information sources.

    Riest, Carina; Jorschick, Annett B; de Ruiter, Jan P

    2015-01-01

    During conversations participants alternate smoothly between speaker and hearer roles with only brief pauses and overlaps. There are two competing types of accounts about how conversationalists accomplish this: (a) the signaling approach and (b) the anticipatory ('projection') approach. We wanted to investigate, first, the relative merits of these two accounts, and second, the relative contribution of semantic and syntactic information to the timing of next turn initiation. We performed three button-press experiments using turn fragments taken from natural conversations to address the following questions: (a) Is turn-taking predominantly based on anticipation or on reaction, and (b) what is the relative contribution of semantic and syntactic information to accurate turn-taking. In our first experiment we gradually manipulated the information available for anticipation of the turn end (providing information about the turn end in advance to completely removing linguistic information). The results of our first experiment show that the distribution of the participants' estimation of turn-endings for natural turns is very similar to the distribution for pure anticipation. We conclude that listeners are indeed able to anticipate a turn-end and that this strategy is predominantly used in turn-taking. In Experiment 2 we collected purely reacted responses. We used the distributions from Experiments 1 and 2 together to estimate a new dependent variable called Reaction Anticipation Proportion. We used this variable in our third experiment where we manipulated the presence vs. absence of semantic and syntactic information by low-pass filtering open-class and closed class words in the turn. The results suggest that for turn-end anticipation, both semantic and syntactic information are needed, but that the semantic information is a more important anticipation cue than syntactic information.

  18. [Study of beta-turns in globular proteins].

    Amirova, S R; Milchevskiĭ, Iu V; Filatov, I V; Esipova, N G; Tumanian, V G

    2005-01-01

    The formation of beta-turns in globular proteins has been studied by the method of molecular mechanics. Statistical method of discriminant analysis was applied to calculate energy components and sequences of oligopeptide segments, and after this prediction of I type beta-turns has been drawn. The accuracy of true positive prediction is 65%. Components of conformational energy considerably affecting beta-turn formation were delineated. There are torsional energy, energy of hydrogen bonds, and van der Waals energy.

  19. Laterality of the lower limbs and carving turns

    F Vaverka

    2010-06-01

    Full Text Available The aim of this study is to discover whether the lateral preference of the lower limbs influences the execution of successive carving turns or not. Six skilled skiers (men, right lower limb preference, age 26.5±1.61 years old, height 1.80±0.04 m, body weight 78.83±5.46 kg executed 30 (18 left, 12 right symmetrical carving turns. Kinetic analysis of the final vertical component of reaction force FZ(t measured dynamometrically provided the information about the time of initiation and steering phases of the turn and the maximum force, average force and force impulse. Differences between right and left turns are not statistically significant. Factual analyses of the magnitude of measured variables confirmed that left turns were found to have a longer duration, a shorter initiation and longer steering phase, and higher level of produced force and force impulse in comparison with right turns. Based on the results it can be concluded that the turns where the outer leg is the preferred limb are preferentially used to regulate the speed of the ride. The study of laterality in symmetrical carving turns has proven that lateral preference of lower extremities influences the execution of the turn also by expert skiers.

  20. The Effect of a Textured Insole on Symmetry of Turning

    Etem Curuk

    2018-01-01

    Full Text Available Turning while walking is a common daily activity. Individuals with unilateral impairment frequently perform turns asymmetrically. The purpose of the study was to investigate the effect of a discomfort-inducing textured insole on symmetry of turning. Nine healthy individuals performed turns to the right while walking with no insole, immediately after the insole was inserted in the right shoe, and after walking for six minutes with the insole. The duration of turning, displacements of pelvic markers, and perceived level of discomfort were evaluated. Utilizing the insole was associated with the increased level of perceived discomfort (p<0.05. Moreover, using the insole was linked to changes in the displacement of two pelvic markers and larger asymmetry index while turning immediately after the insole was inserted in the right shoe as compared to no insole condition (p<0.05. The duration of right turning increased immediately after the insole was inserted (p<0.05 and after walking with the insole for six minutes. The results indicate that the textured insole creates asymmetry of turning in healthy individuals. The outcome provides a background for future studies focused on using a textured insole to minimize the asymmetry of turning commonly seen in individuals with unilateral impairment.

  1. CONNECTION OF TURN AHEAD AND TURN BACK WITH MOTORIC ABILITIES OF THE FOURTH GRADE OF HIGH SCHOOL

    Jovica Petković

    2008-08-01

    Full Text Available The research is done for the purpose of determination and defining of the level of connection between some motoric abilities with success in realization of programmed contents from the area of gymnastics (turn ahead and turn back. The research is done on the sample of fifty students from the fourth grade of High School, on ten motoric tests and on two specific motoric assignments – turn ahead and turn back. The results of this research clearly point that there exist the multitude of statistically important coefficients of correlation between treated motoric abilities and applied motoric assignments.

  2. Turn-taking cue delays in human-robot communication

    Cuijpers, R. H.; Van Den Goor, V. J.P.

    2017-01-01

    Fluent communication between a human and a robot relies on the use of effective turn-taking cues. In human speech staying silent after a sequence of utterances is usually accompanied by an explicit turnyielding cue to signal the end of a turn. Here we study the effect of the timing of four

  3. Synthesis of conformationally restricted beta-turn mimics

    IJsselstijn, M.

    2006-01-01

    This thesis aims at developing methods for introducing conformational restriction in Beta-turns, the turn elements present in Beta-sheets. A conformationally restricted peptide might either be formed via incorporation of a bridging diamino acids in a growing peptide chain, or via covalent bond

  4. A Cognitive Analysis of Truck Drivers’ Right-hand Turns

    Sieker, Tobias Grønborg; G. Skulason, Thorgeir; Sletting, Kristian

    2015-01-01

    This paper presents an investigation of truck drivers’ performance during right-hand turns performed in intersections with traffic lights in order to elicit the truck drivers’ domain, decision-making processes, and the strategies used while executing the turn. To gain knowledge about this, a truc...

  5. Fast Turn-off Mine Transient Electromagnetic Transmitter System

    ZHENG Xiao-Liang

    2014-05-01

    Full Text Available For solving problems such as short turn-off time, high linear degree of falling edge, measurement of turn-off time and influence of primary signals for transient electromagnetic transmitter, and restrictions because of the environmental conditions of underground coal mine, this thesis aims at designing a new transient electromagnetic transmitter system suitable for coal mine. Supported by damping absorption circuit, such system applies small volume, sectional transmitting coil, with features of short turn-off time, high linear degree of current falling edge. It uses the transmitter monitoring circuit, which accurately measures turn-off time and simultaneously records the current value changes after turn-off, thus to eliminate the influence of primary field as well as to restore earlier secondary field signals for reference and finally to improve the ability to detect the shallow structure. It turns out that the new system has a shorter turn-off time, a higher linear degree of current falling and more accurate data record of turn-off current.

  6. Cutting forces during turning with variable depth of cut

    M. Sadílek

    2016-03-01

    The proposed research for the paper is an experimental work – measuring cutting forces and monitoring of the tool wear on the cutting edge. It compares the turning where standard roughing cycle is used and the turning where the proposed roughing cycle with variable depth of cut is applied.

  7. Density of Plutonium Turnings Generated from Machining Activities

    Gonzales, John Robert [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Vigil, Duane M. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Jachimowski, Thomas A. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Archuleta, Alonso [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Arellano, Gerald Joseph [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Melton, Vince Lee [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-10-20

    The purpose of this project was to determine the density of plutonium (Pu) turnings generated from the range of machining activities, using both surrogate material and machined Pu turnings. Verify that 500 grams (g) of plutonium will fit in a one quart container using a surrogate equivalent volume and that 100 grams of Pu will fit in a one quart Savy container.

  8. Human Rights Education and the Post Secular Turn

    Bowie, Bob

    2012-01-01

    This article questions whether human rights education (HRE) scholarship is responding adequately to the post secular turn in thinking about the place and nature of religion in society. Here the post secular turn is used to describe the discrediting of secularisation theory, the recognition of religion as an enduring and pervasive global cultural…

  9. Turn over management and optimization of Shangdong nuclear power plant

    Zheng Tong

    2014-01-01

    After the equipments' installation is completed, the system will carry out commissioning tests. After commissioning work is completed, the system will be transferred to temporary operation. The plant buildings and structures will be transferred to operation for management and maintenance after civil work. The turn over work is an important part of the transfer from construction to operation. The article describes the significance of the nuclear power plant turn over work, turn over organization and management mode, the workflow of system turn over from construction to commissioning (TOP), turn over form commissioning to operation (TOTO), house hand over (HHO), building hand over (BHO) of Shandong Haiyang nuclear power plant, and analyze the current lack and future improvements of turn over work. Shandong Haiyang nuclear power plant will usher in the peak period of turn over work in 2013, fully aware of the importance of the turn over work, will play a key role in the long-term stable operation of the unit. (author)

  10. An expert machine tools selection system for turning operation

    Tan, C.F.; Khalil, S.N.; Karjanto, J.; Wahidin, L.S.; Chen, W.; Rauterberg, G.W.M.

    2015-01-01

    The turning machining process is an important process in the manufacturing industry. It is important to select the right tool for the turning process so that the manufacturing cost will be decreased. The main objective of this research is to select the most suitable machine tools with respect to

  11. Head turning as a prominent motor symptom in status epilepticus.

    Bauer, Gerhard; Broessner, Gregor; Unterberger, Iris; Walser, Gerald; Pfausler, Bettina; Trinka, Eugen

    2008-06-01

    Head and eye turning is frequently observed during seizures. Versions with tonic and/or clonic symptoms can be differentiated from smooth head deviations. Head turning as a prominent symptom of status epilepticus has not previously been reported. We present eight case reports, (7 women/1 man, mean age 41 years, median 41.5, range 10 to 74), of status epilepticus (SE), with head turning as a prominent motor symptom. Six were accompanied by continuous frontal, occipital and temporal ictal epileptiform discharges. Furthermore, two patients had absence status with rhythmic and clonic head versions. While the localizing significance of head turnings in SE is low, in our cases, the direction was away from the discharging hemisphere in all cases of focal SE regardless of whether the turning was classified as version (three cases) or deviation (three cases). In this small series of SE, the classical observation of a patient looking away from the discharging hemisphere is still valid.

  12. Experience sharing, emotional reciprocity, and turn-taking

    Melisa eStevanovic

    2015-04-01

    Full Text Available In this perspective article, we consider the relationship between experience sharing and turn-taking. There is much evidence suggesting that human social interaction is permeated by two temporal organizations: (1 the sequential framework of turn-taking and (2 the concurrent framework of emotional reciprocity. From this perspective, we introduce two alternative hypotheses about how the relationship between experience sharing and turn-taking could be viewed. According to the first hypothesis, the home environment of experience sharing is in the concurrent framework of emotional reciprocity, while the motivation to share experiences is in tension with the sequential framework of turn-taking. According to the second hypothesis, then again, people’s inclination to coordinate their actions in terms of turn-taking is motivated precisely by their propensity to share experiences. We consider theoretical and empirical ideas in favor of both of these hypotheses and discuss their implications for future research.

  13. Turn-by-Turn and Bunch-by-Bunch Transverse Profiles of a Single Bunch in a Full Ring

    Kraus, R.; Fisher, A.S.

    2005-01-01

    The apparatus described in this paper can image the evolution of the transverse profile of a single bunch, isolated from a full PEP-II ring of 1500 bunches. Using this apparatus there are two methods of single bunch imaging; bunch-by-bunch beam profiling can image every bunch in the ring a single bunch at a time with the images of sequential bunches being in order, allowing one to see variations in beam size along a train. Turn-by-turn beam profiling images a single bunch on each successive turn it makes around the ring. This method will be useful in determining the effect that an injected bunch has on a stable bunch as the oscillations of the injected bunch damp out. Turn-by-turn imaging of the synchrotron light uses a system of lenses and mirrors to image many turns of both the major and minor axis of a single bunch across the photocathode of a gateable camera. The bunch-by-bunch method is simpler: because of a focusing mirror used in porting the light from the ring, the synchrotron light from the orbiting electrons becomes an image at a certain distance from the mirror; and since the camera does not use a lens, the photocathode is set exactly at this image distance. Bunch-by-bunch profiling has shown that in the Low Energy Ring (LER) horizontal bunch size decreases along a train. Turn-by-turn profiling has been able to image 100 turns of a single bunch on one exposure of the camera. The turn-by-turn setup has also been able to image 50 turns of the minor axis showing part of the damping process of an oscillating injected charge during a LER fill. The goal is to image the damping of oscillations of injected charge for 100 turns of both the major and minor axis throughout the damping process during trickle injection. With some changes to the apparatus this goal is within reach and will make turn-by-turn imaging a very useful tool in beam diagnostics

  14. Development process and data management of TurnSTEP, a STEP-compliant CNC system for turning

    Choi, I.; Suh, S.-H; Kim, K.; Song, M.S.; Jang, M.; Lee, B.-E.

    2006-01-01

    TurnSTEP is one of the earliest STEP-compliant CNC systems for turning. Based on the STEP-NC data model formalized as ISO 14649-12 and 121, it is designed to support intelligent and autonomous control of NC machines for e-manufacturing. The present paper introduces the development process and data

  15. Recent developments in turning hardened steels - A review

    Sivaraman, V.; Prakash, S.

    2017-05-01

    Hard materials ranging from HRC 45 - 68 such as hardened AISI H13, AISI 4340, AISI 52100, D2 STL, D3 STEEL Steel etc., need super hard tool materials to machine. Turning of these hard materials is termed as hard turning. Hard turning makes possible direct machining of the hard materials and also eliminates the lubricant requirement and thus favoring dry machining. Hard turning is a finish turning process and hence conventional grinding is not required. Development of the new advanced super hard tool materials such as ceramic inserts, Cubic Boron Nitride, Polycrystalline Cubic Boron Nitride etc. enabled the turning of these materials. PVD and CVD methods of coating have made easier the production of single and multi layered coated tool inserts. Coatings of TiN, TiAlN, TiC, Al2O3, AlCrN over cemented carbide inserts has lead to the machining of difficult to machine materials. Advancement in the process of hard machining paved way for better surface finish, long tool life, reduced tool wear, cutting force and cutting temperatures. Micro and Nano coated carbide inserts, nanocomposite coated PCBN inserts, micro and nano CBN coated carbide inserts and similar developments have made machining of hardened steels much easier and economical. In this paper, broad literature review on turning of hardened steels including optimizing process parameters, cooling requirements, different tool materials etc., are done.

  16. Turn stability in beta-hairpin peptides: Investigation of peptides containing 3:5 type I G1 bulge turns.

    Blandl, Tamas; Cochran, Andrea G; Skelton, Nicholas J

    2003-02-01

    The turn-forming ability of a series of three-residue sequences was investigated by substituting them into a well-characterized beta-hairpin peptide. The starting scaffold, bhpW, is a disulfide-cyclized 10-residue peptide that folds into a stable beta-hairpin with two antiparallel strands connected by a two-residue reverse turn. Substitution of the central two residues with the three-residue test sequences leads to less stable hairpins, as judged by thiol-disulfide equilibrium measurements. However, analysis of NMR parameters indicated that each molecule retains a significant folded population, and that the type of turn adopted by the three-residue sequence is the same in all cases. The solution structure of a selected peptide with a PDG turn contained an antiparallel beta-hairpin with a 3:5 type I + G1 bulge turn. Analysis of the energetic contributions of individual turn residues in the series of peptides indicates that substitution effects have significant context dependence, limiting the predictive power of individual amino acid propensities for turn formation. The most stable and least stable sequences were also substituted into a more stable disulfide-cyclized scaffold and a linear beta-hairpin scaffold. The relative stabilities remained the same, suggesting that experimental measurements in the bhpW context are a useful way to evaluate turn stability for use in protein design projects. Moreover, these scaffolds are capable of displaying a diverse set of turns, which can be exploited for the mimicry of protein loops or for generating libraries of reverse turns.

  17. Increasing protein stability by improving beta-turns.

    Fu, Hailong; Grimsley, Gerald R; Razvi, Abbas; Scholtz, J Martin; Pace, C Nick

    2009-11-15

    Our goal was to gain a better understanding of how protein stability can be increased by improving beta-turns. We studied 22 beta-turns in nine proteins with 66-370 residues by replacing other residues with proline and glycine and measuring the stability. These two residues are statistically preferred in some beta-turn positions. We studied: Cold shock protein B (CspB), Histidine-containing phosphocarrier protein, Ubiquitin, Ribonucleases Sa2, Sa3, T1, and HI, Tryptophan synthetase alpha-subunit, and Maltose binding protein. Of the 15 single proline mutations, 11 increased stability (Average = 0.8 +/- 0.3; Range = 0.3-1.5 kcal/mol), and the stabilizing effect of double proline mutants was additive. On the basis of this and our previous work, we conclude that proteins can generally be stabilized by replacing nonproline residues with proline residues at the i + 1 position of Type I and II beta-turns and at the i position in Type II beta-turns. Other turn positions can sometimes be used if the phi angle is near -60 degrees for the residue replaced. It is important that the side chain of the residue replaced is less than 50% buried. Identical substitutions in beta-turns in related proteins give similar results. Proline substitutions increase stability mainly by decreasing the entropy of the denatured state. In contrast, the large, diverse group of proteins considered here had almost no residues in beta-turns that could be replaced by Gly to increase protein stability. Improving beta-turns by substituting Pro residues is a generally useful way of increasing protein stability. 2009 Wiley-Liss, Inc.

  18. Structural Transformation in Fe73.5Nb3Cu1Si15.5B7 Amorphous Alloy Induced by Laser Heating

    Nykyruy, Yu. S.; Mudry, S. I.; Kulyk, Yu. O.; Zhovneruk, S. V.

    2018-03-01

    The effect of continuous laser irradiation (λ = 1.06 μm) with laser power of 45 W on the structure of Fe73.5Nb3Cu1Si15.5B7 amorphous alloy has been studied using X-ray diffraction and SEM methods. The sample of the ribbon has been placed at a distance from the focal plane of the lens, so a laser beam has been defocused and the diameter of laser spot on the ribbon surface has been about 10 mm. An exposure time τ varied within interval 0.25-0.70 s. Under such conditions structural transformation processes, which depend on the exposure time, have occurred in an irradiated zone. Crystallization process has started at τ = 0.35 s with the formation of α-Fe(Si) nanocrystalline phase, while complete crystallization has occurred at τ = 0.55 s with formation of two nanocrystalline phases: α-Fe(Si) and a hexagonal H-phase.

  19. Oligomerization as a strategy for cold adaptation: Structure and dynamics of the GH1 β-glucosidase from Exiguobacterium antarcticum B7

    Zanphorlin, Leticia Maria; de Giuseppe, Priscila Oliveira; Honorato, Rodrigo Vargas; Tonoli, Celisa Caldana Costa; Fattori, Juliana; Crespim, Elaine; de Oliveira, Paulo Sergio Lopes; Ruller, Roberto; Murakami, Mario Tyago

    2016-03-01

    Psychrophilic enzymes evolved from a plethora of structural scaffolds via multiple molecular pathways. Elucidating their adaptive strategies is instrumental to understand how life can thrive in cold ecosystems and to tailor enzymes for biotechnological applications at low temperatures. In this work, we used X-ray crystallography, in solution studies and molecular dynamics simulations to reveal the structural basis for cold adaptation of the GH1 β-glucosidase from Exiguobacterium antarcticum B7. We discovered that the selective pressure of low temperatures favored mutations that redesigned the protein surface, reduced the number of salt bridges, exposed more hydrophobic regions to the solvent and gave rise to a tetrameric arrangement not found in mesophilic and thermophilic homologues. As a result, some solvent-exposed regions became more flexible in the cold-adapted tetramer, likely contributing to enhance enzymatic activity at cold environments. The tetramer stabilizes the native conformation of the enzyme, leading to a 10-fold higher activity compared to the disassembled monomers. According to phylogenetic analysis, diverse adaptive strategies to cold environments emerged in the GH1 family, being tetramerization an alternative, not a rule. These findings reveal a novel strategy for enzyme cold adaptation and provide a framework for the semi-rational engineering of β-glucosidases aiming at cold industrial processes.

  20. Methadone inhibits CYP2D6 and UGT2B7/2B4 in vivo: a study using codeine in methadone- and buprenorphine-maintained subjects

    Gelston, Eloise A; Coller, Janet K; Lopatko, Olga V; James, Heather M; Schmidt, Helmut; White, Jason M; Somogyi, Andrew A

    2012-01-01

    AIMS To compare the O-demethylation (CYP2D6-mediated), N-demethylation (CYP3A4-mediated) and 6-glucuronidation (UGT2B4/7-mediated) metabolism of codeine between methadone- and buprenorphine-maintained CYP2D6 extensive metabolizer subjects. METHODS Ten methadone- and eight buprenorphine-maintained subjects received a single 60 mg dose of codeine phosphate. Blood was collected at 3 h and urine over 6 h and assayed for codeine, norcodeine, morphine, morphine-3- and -6-glucuronides and codeine-6-glucuronide. RESULTS The urinary metabolic ratio for O-demethylation was significantly higher (P = 0.0044) in the subjects taking methadone (mean ± SD, 2.8 ± 3.1) compared with those taking buprenorphine (0.60 ± 0.43), likewise for 6-glucuronide formation (0.31 ± 0.24 vs. 0.053 ± 0.027; P D6 and UGTs 2B4 and 2B7 reactions in vivo, even though it is not a substrate for these enzymes. Plasma morphine was not altered, owing to the opposing effects of inhibition of both formation and elimination; however, morphine-6-glucuronide (analgesically active) concentrations were substantially reduced. Drug interactions with methadone are likely to include drugs metabolized by various UGTs and CYP2D6. PMID:22092298

  1. Beam polarization during a Siberian snake turn-on

    Anferov, Vladimir A.

    1999-01-01

    Installing Siberian snakes in a circular proton accelerator allows one to overcome all spin depolarizing resonances even at very high energies. However, Siberian snake application at low energies is technically rather difficult. Turning snake on at some energy during acceleration would allow using Siberian snakes even in rings with low injection energies. It is shown that the beam polarization would be preserved during the snake ramp, provided that the snake is turned on in more than ten turns, and the energy is set near a half-integer Gγ

  2. Observation of diamond turned OFHC copper using Scanning Tunneling Microscopy

    Grigg, D.A.; Russell, P.E.; Dow, T.A.

    1988-12-01

    Diamond turned OFHC copper samples have been observed within the past few months using the Scanning Tunneling Microscope. Initial results have shown evidence of artifacts which may be used to better understand the diamond turning process. The STM`s high resolution capability and three dimensional data representation allows observation and study of surface features unobtainable with conventional profilometry systems. Also, the STM offers a better quantitative means by which to analyze surface structures than the SEM. This paper discusses findings on several diamond turned OFHC copper samples having different cutting conditions. Each sample has been cross referenced using STM and SEM.

  3. Diamond turning of Si and Ge single crystals

    Blake, P.; Scattergood, R.O.

    1988-12-01

    Single-point diamond turning studies have been completed on Si and Ge crystals. A new process model was developed for diamond turning which is based on a critical depth of cut for plastic flow-to-brittle fracture transitions. This concept, when combined with the actual machining geometry for single-point turning, predicts that {open_quotes}ductile{close_quotes} machining is a combined action of plasticity and fracture. Interrupted cutting experiments also provide a meant to directly measure the critical depth parameter for given machining conditions.

  4. The ontological turn meets the certainty of death.

    McDonald, Maryon

    2017-08-01

    The 'ontological turn' involves some anthropological points of long standing but the approaches recently coordinated into this turn have been presented as a 'call to arms', as shaking up 'mono-realist singularities' and as inherently political. This fighting talk has no doubt made important contributions to anthropology and insights from the ontological turn can help in anthropological understandings of medical practices. However, this paper contends that this helpfulness is also limited and that a call to arms may be inappropriate. This point is made through an ethnographic understanding of medical concern about the diagnosis of death.

  5. Remaking "Nature". the Ecological Turn in Dutch Water Management

    Disco, Nil/Cornelis

    2002-01-01

    The ecological turn in water management has usually been interpreted as a political andcultural rather than technical and professional accomplishment. The dynamics of theuptake of ecological expertise into hydraulic engineering bureaucracies have not beenwell described. Focusing on the controversy

  6. ANALYSIS OF CHIP FORMATION DURING HARD TURNING THROUGH ACOUSTIC EMISSION

    Miroslav Neslušan

    2012-01-01

    Full Text Available The paper deals with analysis of chip formation and related aspects of the chip formation during turning hardened steel 100Cr6. The paper draws a comparison of some aspects of the chip formation between turning annealed and hardened roll bearing steel. The results of the analysis show that there is the formation of a segmented chip in the case of hard turning. Frequency of segmentation is very high. A conventional piezoelectric dynamometer limits the frequency response to about 3.5 kHz. On the other hand, the frequency of process fluctuation may by obtained by using accelerometers or acoustic emission. This paper reports about the dynamic character of cutting process when hard turning and correlation among the calculated segmentation frequencies and the experimental analysis.

  7. Models and Algorithms for Tracking Target with Coordinated Turn Motion

    Xianghui Yuan

    2014-01-01

    Full Text Available Tracking target with coordinated turn (CT motion is highly dependent on the models and algorithms. First, the widely used models are compared in this paper—coordinated turn (CT model with known turn rate, augmented coordinated turn (ACT model with Cartesian velocity, ACT model with polar velocity, CT model using a kinematic constraint, and maneuver centered circular motion model. Then, in the single model tracking framework, the tracking algorithms for the last four models are compared and the suggestions on the choice of models for different practical target tracking problems are given. Finally, in the multiple models (MM framework, the algorithm based on expectation maximization (EM algorithm is derived, including both the batch form and the recursive form. Compared with the widely used interacting multiple model (IMM algorithm, the EM algorithm shows its effectiveness.

  8. Experimentation and Prediction of Temperature Rise in Turning ...

    Experimentation and Prediction of Temperature Rise in Turning Process using Response Surface Methodology. ... Science, Technology and Arts Research Journal. Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue ...

  9. Treatment of uranium turning with the controllable oxidizing process

    Shen Bingyi; Zhang Yonggang; Zhen Huikuan

    1989-02-01

    The concept, procedure and safety measures of the controllable oxidizing for uranium turning is described. The feasibility study on technological process has been made. The process provided several advantages such as: simplicity of operation, no pollution environment, safety, high efficiency and low energy consumption. The process can yield nuclear pure uranium dioxide under making no use of a great number of chemical reagent. It may supply raw material for fluoration and provide a simply method of treatment for safe store of uranium turning

  10. Learning, Teaching, and Turn Taking in the Repeated Assignment Game

    Timothy N. Cason; Sau-Him Paul Lau; Vai-Lam Mui

    2011-01-01

    History-dependent strategies are often used to support cooperation in repeated game models. Using the indefinitely repeated common-pool resource assignment game and a perfect stranger experimental design, this paper reports novel evidence that players who have successfully used an efficiency-enhancing turn-taking strategy will teach other players in subsequent supergames to adopt this strategy. We find that subjects engage in turn taking frequently in both the Low Conflict and the High Confli...

  11. Ignition experiment in a single-turn-coil tokamak

    Carrera, R.; Driga, M.; Gully, J.H.

    1989-01-01

    A novel concept for a fusion ignition experiment, IGNITEX proposed along the lines of previous ideas for a compact thermonuclear device is analyzed. A single-turn-coil tokamak is analyzed. A single-turn-coil tokamak supplied by homopolar generators can ohmically heat a DT plasma to ignition conditions and maintain a thermally stable ignited phase for about ten energy confinement times. The IGNITEX experiment can provide a simple and relatively inexpensive way to produce and control ignited plasmas for scientific study

  12. Extended phenotype: nematodes turn ants into bird-dispersed fruits

    Hughes, D P; Kronauer, D J C; Boomsma, J J

    2008-01-01

    A recent study has discovered a novel extended phenotype of a nematode which alters its ant host to resemble ripe fruit. The infected ants are in turn eaten by frugivorous birds that disperse the nematode's eggs.......A recent study has discovered a novel extended phenotype of a nematode which alters its ant host to resemble ripe fruit. The infected ants are in turn eaten by frugivorous birds that disperse the nematode's eggs....

  13. 3D characterisation of tool wear whilst diamond turning silicon

    Durazo-Cardenas, Isidro Sergio; Shore, Paul; Luo, X.; Jacklin, T.; Impey, S. A.; Cox, A.

    2006-01-01

    Nanometrically smooth infrared silicon optics can be manufactured by the diamond turning process. Due to its relatively low density, silicon is an ideal optical material for weight sensitive infrared (IR) applications. However, rapid diamond tool edge degradation and the effect on the achieved surface have prevented significant exploitation. With the aim of developing a process model to optimise the diamond turning of silicon optics, a series of experimental trials were devi...

  14. Development of a Low Cost MQL Setup for Turning Operations

    Islam Sumaiya; Khandoker Noman; Izham Mohamad; Azizi Tengku; Debnath Sujan

    2017-01-01

    In this study, the effect of MQL application on the tool wear, surface roughness and chip formation in turning Aluminum alloy 6061 is investigated. Experiments were carried out by plain turning of an Aluminum bar with varying depth of cut, cutting speeds (spindle speed) and cutting environments (Dry, Wet and MQL). A newly designed, cost efficient and portable MQL setup was developed for this study. For each experimental trial, five passes were carried out in order to promote the formation of ...

  15. Compensations for increased rotational inertia during human cutting turns.

    Qiao, Mu; Brown, Brian; Jindrich, Devin L

    2014-02-01

    Locomotion in a complex environment is often not steady state, but unsteady locomotion (stability and maneuverability) is not well understood. We investigated the strategies used by humans to perform sidestep cutting turns when running. Previous studies have argued that because humans have small yaw rotational moments of inertia relative to body mass, deceleratory forces in the initial velocity direction that occur during the turning step, or 'braking' forces, could function to prevent body over-rotation during turns. We tested this hypothesis by increasing body rotational inertia and testing whether braking forces during stance decreased. We recorded ground reaction force and body kinematics from seven participants performing 45 deg sidestep cutting turns and straight running at five levels of body rotational inertia, with increases up to fourfold. Contrary to our prediction, braking forces remained consistent at different rotational inertias, facilitated by anticipatory changes to body rotational speed. Increasing inertia revealed that the opposing effects of several turning parameters, including rotation due to symmetrical anterior-posterior forces, result in a system that can compensate for fourfold changes in rotational inertia with less than 50% changes to rotational velocity. These results suggest that in submaximal effort turning, legged systems may be robust to changes in morphological parameters, and that compensations can involve relatively minor adjustments between steps to change initial stance conditions.

  16. Effect of stern hull shape on turning circle of ships

    Jaswar, Maimun, A.; Wahid, M. A.; Priyanto, A.; Zamani, Pauzi, Saman

    2012-06-01

    Many factors such as: stern hull shape, length, draught, trim, propulsion system and external forces affecting the drift angle influence rate of turn and size of turning circle of ships. This paper discusses turning circle characteristics of U and V stern hull shape of Very Large Crude Oil Carrier (VLCC) ships. The ships have same principal dimension such as length, beam, and draught. The turning circle characteristics of the VLCC ships are simulated at 35 degree of rudder angle. In the analysis, firstly, turning circle performance of U-type VLCC ship is simulated. In the simulation, initial ship speed is determined using given power and rpm. Hydrodynamic derivatives coefficients are determined by including effect of fullness of aft run. Using the obtained, speed and hydrodynamic coefficients, force and moment acting on hull, force and moment induced by propeller, force and moment induced by rudder are determined. Finally, ship trajectory, ratio of speed, yaw angle and drift angle are determined. Results of simulation results of the VLCC ship are compared with the experimental one as validation. Using the same method, V-type VLCC is simulated and the simulation results are compared with U-type VLCC ship. Results shows the turning circle of U-type is larger than V-type due to effect stern hul results of simulation are.

  17. Intrinsic renal cells induce lymphocytosis of Th22 cells from IgA nephropathy patients through B7-CTLA-4 and CCL-CCR pathways.

    Gan, Lu; Zhou, Qiaoling; Li, Xiaozhao; Chen, Chen; Meng, Ting; Pu, Jiaxi; Zhu, Mengyuan; Xiao, Chenggen

    2018-04-01

    IgA nephropathy (IgAN), the most common glomerulonephritis, has an unclear pathogenesis. The role of Th22 cells, which are intimately related to proteinuria and progression in IgAN, in mediating infection-related IgAN is unclear. This study aimed to characterize the association between intrinsic renal cells (tubular epithelial cells and mesangial cells) and Th22 cells in immune regulation of infection-related IgAN and to elucidate the impact of Th22 lymphocytosis; the proinflammatory cytokines IL-1, IL-6, and TNF-α; and CCL chemokines on kidney fibrosis. Hemolytic streptococcus infection induced an increase in IL-1, IL-6, and TNF-α, resulting in Th22 cell differentiation from T lymphocytes obtained from patients with IgAN, and the CCL20-CCR6, CCL22-CCR4, and/or CCL27-CCR10 axes facilitated Th22 cell chemotaxis. The increased amount of Th22 cells caused an increase in TGF-β1 levels, and anti-CD80, anti-CD86, and CTLA-4Ig treatment reduced TGF-β1 levels by inhibiting Th22 lymphocytosis and secretion of cytokines and chemokines, thus potentially relieving kidney fibrosis. Our data suggest that Th22 cells might be recruited into the kidneys via the CCL20-CCR6, CCL22-CCR4, and/or CCL27-CCR10 axes by mesangial cells and tubular epithelial cells in infection-related IgAN. Th22 cell overrepresentation was attributed to stimulation of the B7-CTLA-4Ig antigen-presenting pathway and IL-1, IL-6, and TNF-α.

  18. MicroRNA-187, down-regulated in clear cell renal cell carcinoma and associated with lower survival, inhibits cell growth and migration though targeting B7-H3

    Zhao, Jun [Foshan Maternal and Child Health Care Hospital, Foshan (China); Lei, Ting [Zhongshan People’s Hospital, Zhongshan (China); Xu, Congjie [Department of Urology, Pepole’s Hospital of Hainan Province, Haikou (China); Li, Huan; Ma, Wenmin; Yang, Yunxia; Fan, Shuming [Foshan Maternal and Child Health Care Hospital, Foshan (China); Liu, Yuchen, E-mail: s_ycliu1@stu.edu.cn [Anhui Medical University, Hefei (China)

    2013-08-23

    Highlights: •miR-187 is down-regulated in clear cell renal cell carcinoma (ccRCC). •Down-regulation of miR-187 is associated with poor outcomes in patients with ccRCC. •miR-187 inhibits cell growth and migration though targeting B7-H3 in ccRCC. -- Abstract: Aberrantly expressed microRNAs (miRNAs) are frequently associated with the aggressive malignant behavior of human cancers, including clear cell renal cell carcinoma (ccRCC). Based on the preliminary deep sequencing data, we hypothesized that miR-187 may play an important role in ccRCC development. In this study, we found that miR-187 was down-regulated in both tumor tissue and plasma of ccRCC patients. Lower miR-187 expression levels were associated with higher tumor grade and stage. All patients with high miR-187 expression survived 5 years, while with low miR-187 expression, only 42% survived. Suppressed in vitro proliferation, inhibited in vivo tumor growth, and decreased motility were observed in cells treated with the miR-187 expression vector. Further studies showed that B7 homolog 3 (B7-H3) is a direct target of miR-187. Over-expression of miR-187 decreased B7-H3 mRNA level and repressed B7-H3-3′-UTR reporter activity. Knockdown of B7-H3 using siRNA resulted in similar phenotype changes as that observed for overexpression of miR-187. Our data suggest that miR-187 is emerging as a novel player in the disease state of ccRCC. miR-187 plays a tumor suppressor role in ccRCC.

  19. MicroRNA-187, down-regulated in clear cell renal cell carcinoma and associated with lower survival, inhibits cell growth and migration though targeting B7-H3

    Zhao, Jun; Lei, Ting; Xu, Congjie; Li, Huan; Ma, Wenmin; Yang, Yunxia; Fan, Shuming; Liu, Yuchen

    2013-01-01

    Highlights: •miR-187 is down-regulated in clear cell renal cell carcinoma (ccRCC). •Down-regulation of miR-187 is associated with poor outcomes in patients with ccRCC. •miR-187 inhibits cell growth and migration though targeting B7-H3 in ccRCC. -- Abstract: Aberrantly expressed microRNAs (miRNAs) are frequently associated with the aggressive malignant behavior of human cancers, including clear cell renal cell carcinoma (ccRCC). Based on the preliminary deep sequencing data, we hypothesized that miR-187 may play an important role in ccRCC development. In this study, we found that miR-187 was down-regulated in both tumor tissue and plasma of ccRCC patients. Lower miR-187 expression levels were associated with higher tumor grade and stage. All patients with high miR-187 expression survived 5 years, while with low miR-187 expression, only 42% survived. Suppressed in vitro proliferation, inhibited in vivo tumor growth, and decreased motility were observed in cells treated with the miR-187 expression vector. Further studies showed that B7 homolog 3 (B7-H3) is a direct target of miR-187. Over-expression of miR-187 decreased B7-H3 mRNA level and repressed B7-H3-3′-UTR reporter activity. Knockdown of B7-H3 using siRNA resulted in similar phenotype changes as that observed for overexpression of miR-187. Our data suggest that miR-187 is emerging as a novel player in the disease state of ccRCC. miR-187 plays a tumor suppressor role in ccRCC

  20. Semiautomatic machine for turning inside out industrial leather gloves

    Aragón-Gonzalez, G; Cano-Blanco, M; León-Galicia, A; Medrano-Sierra, L F; Morales-Gómez, J R

    2015-01-01

    The last step in the industrial leather gloves manufacturing is to turn the inside out so that the sewing be in the inside of the glove. This work presents the design and testing of a machine for that purpose. In order to quantify the relevant variables, testing was performed with a prototype glove. The employed devices and the testing proceeding were developed experimentally. The obtained information was used to build the turning inside out machine. This machine works with pneumatic power to carry the inside out turning by means of double effect lineal actuators. It has two independent work stations that could be operated simultaneously by two persons, one in each station or in single mode operating one station by one person. The turning inside out cycle is started by means of directional control valves operated with pedals. The velocity and developed force by the actuators is controlled with typical pneumatic resources. The geometrical dimensions of the machine are: 1.15 m length; 0.71 m width and 2.15 m high. Its approximated weight is 120 kg. The air consumption is 5.4 fps by each working station with 60 psig work pressure. The turning inside out operation is 40 s for each industrial leather glove

  1. Postural hemodynamic changes after turning to prone position

    Микола Віталійович Лизогуб

    2015-03-01

    Full Text Available Background of study. Prone position is one of the most complex positions for anesthesiologist as it is accompanied by several physiological changes that can lead to specific complications. Hemodynamic changes are most controversial.Aim of study was to establish hemodynamic changes in non-anaesthetized patients in prone position depending on body mass index.Material and methods. We examined central hemodynamics in 40 patients the day before surgery using thoracic rheography in supine position, in prone position 5 min after turning and in prone position 20 min after turning. Patients were divided into 2 groups according to body mass index (18-25 and 26-35.Results. Patients with normal body weight did not have any hemodynamic changes after turning to prone position. Patients with increased body weight had higher cardiac index. After turning to prone position obese patients’ cardiac output and cardiac index reduced 22% comparing with supine position. After 20 min in prone position these hemodynamic parameters were found to be reduced to the same level.Conclusion. Significant hemodynamic changes after turning from supine to prone position were revealed only in patients with increased body mass index. In these patients cardiac index in prone position was reduced by 22% comparing to supine position

  2. [Abnormal head turn in a patient with Brown's syndrome].

    van Waveren, M; Krzizok, T; Besch, D

    2008-08-01

    We report on an eight-year-old boy, who was presented in our clinic because of head turn. The cause of the tortecollis (ocular or general) in this case was and still cannot be explained. Only by applying extensive prism adaptation tests it was possible to prove the ocular character of the head turn. An eight-year-old boy with Brown's syndrome was referred to us because of a head tilt to the left side. Six months previously surgery on the M. obl. superior of the right eye was performed in another clinic. No improvement of the head tilt could be observed after the operation. In addition, an exotropia became decompensated. Under a 3-day occlusion of one eye, no change of the head turn and the squint could be measured. No other cause of the head turn could be found by an orthopaedist and a paediatrist. Under a prism of 20 cm/m basis in and 10 cm/m basis against the positive vertical deviation, the head tilt decreased, so that we decided to do a second surgery. The head tilting had not resumed at one year after the surgery. Although the initial diagnostic findings ruled out an ocular cause, it was possible to lessen the head tilting with the aid of the prism adaptation test. This case study emphasises the usefulness of a prism adaptation test of several days duration in order to validate an ocular cause of head turn and to determine an adequate indication for surgery.

  3. Modeling of residual stress state in turning of 304L

    Valiorgue, F.; Rech, J.; Bergheau, J.M.

    2010-01-01

    Research presented in this paper aims to link machining parameters to residual stress state and helps understanding mechanisms responsible of machined surface properties modifications. The first presented works are based on an experimental campaign. They reproduce the finishing turning operation of 304L and allow observing the residual stress state evolution at the work piece surface and for an affected depth of 0.2 mm for such processes. Then, the finishing turning operation is simulated numerically in order to realize the same sensitivity study to cutting parameters. This simulation is based on an hybrid approach mixing experimental data and numerical simulation. This method allows getting round the classical difficulties of turning simulation by applying equivalent thermo mechanical loadings onto the work piece surface without modeling the material separation phenomena. Moreover the numerical model uses an hardening law taking into account dynamic recrystallization phenomena. (authors)

  4. Negotiating behavioural change: therapists' proposal turns in Cognitive Behavioural Therapy.

    Ekberg, Katie; Lecouteur, Amanda

    2012-01-01

    Cognitive behavioural therapy (CBT) is an internationally recognised method for treating depression. However, many of the techniques involved in CBT are accomplished within the therapy interaction in diverse ways, and with varying consequences for the trajectory of therapy session. This paper uses conversation analysis to examine some standard ways in which therapists propose suggestions for behavioural change to clients attending CBT sessions for depression in Australia. Therapists' proposal turns displayed their subordinate epistemic authority over the matter at hand, and emphasised a high degree of optionality on behalf of the client in accepting their suggestions. This practice was routinely accomplished via three standard proposal turns: (1) hedged recommendations; (2) interrogatives; and (3) information-giving. These proposal turns will be examined in relation to the negotiation of behavioural change, and the implications for CBT interactions between therapist and client will be discussed.

  5. Conformational interconversions in peptide beta-turns: analysis of turns in proteins and computational estimates of barriers.

    Gunasekaran, K; Gomathi, L; Ramakrishnan, C; Chandrasekhar, J; Balaram, P

    1998-12-18

    The two most important beta-turn features in peptides and proteins are the type I and type II turns, which differ mainly in the orientation of the central peptide unit. Facile conformational interconversion is possible, in principle, by a flip of the central peptide unit. Homologous crystal structures afford an opportunity to structurally characterize both possible conformational states, thus allowing identification of sites that are potentially stereochemically mobile. A representative data set of 250 high-resolution (turns that are assigned different conformational types (type I/type II) in related structures. A total of 55 examples of beta-turns were identified as possible candidates for a stereochemically mobile site. Of the 55 examples, 45 could be classified as a potential site for interconversion between type I and type II beta-turns, while ten correspond to flips from type I' to type II' structures. As a further check, the temperature factors of the central peptide unit carbonyl oxygen atom of the 55 examples were examined. The analysis reveals that the turn assignments are indeed reliable. Examination of the secondary structures at the flanking positions of the flippable beta-turns reveals that seven examples occur in the loop region of beta-hairpins, indicating that the formation of ordered secondary structures on either side of the beta-turn does not preclude local conformational variations. In these beta-turns, Pro (11 examples), Lys (nine examples) and Ser (seven examples) were most often found at the i+1 position. Glycine was found to occur overwhelmingly at position i+2 (28 examples), while Ser (seven examples) and Asn (six examples) were amongst the most frequent residues. Activation energy barriers for the interconversion between type I and type II beta-turns were computed using the peptide models Ac-Pro-Aib-NHMe and Ac-Pro-Gly-NHMe within the framework of the AM1 semi-empirical molecular orbital procedure. In order to have a uniform basis for

  6. A survey report for the turning of biped locomotion robot

    Kato, Ichiro; Takanishi, Atsuo; Kume, Etsuo.

    1992-12-01

    A mechanical design study of biped locomotion robots is going on at JAERI within the scope of the Human Acts Simulation Program (HASP). The design study at JAERI is of an arbitrarily mobile robot for inspection of nuclear facilities. A survey has been performed for collecting useful information from already existing biped locomotion robots. This is a survey report for the turning of biped locomotion robot: the WL-10R designed and developed at Waseda University. This report includes the control method of turning, machine model and control system. (author)

  7. The turning points of world history : financial and methodological interpretations

    Kukliński, Antoni (ed.); Pawłowski, Krzysztof (ed.); Swianiewicz, Jan (ed.)

    2012-01-01

    Volumes VI and VII of the REUPUS Series “The Atlantic Community. The Titanic of the XXI Century?” and “The Turning Points of World History” can be seen as twin volumes trying to find new empirical observations, new methodological approaches and new value judgements to face the enigma of the XXI Century. Those volumes try to present some new interpretations of one of the greatest turning points of human history which is the essential feature of our times... Volume VII is the ...

  8. Spatial turn and animation practices inspired by cultural anthropology

    Agnieszka Wieszaczewska

    2016-09-01

    Full Text Available Spatial turn is one of the cultural turns, which have recently occurred in the humanities. It stresses the importance of issues such as space and place and can be successfully used as a theoretical perspective gaining use in thought over issues such as globalisation, transnationality, mapping but also education. In the discourses of pedagogical science space and place are considered through their multidimensional impact on education and learning. As significant concepts rooting pedagogy or pedagogy of borderland. The pedagogical reflection on space could be also used in the field of animation practices, especially in activities, which are related to place somehow colonised.

  9. Abolishment of Spontaneous Flight Turns in Visually Responsive Drosophila.

    Ferris, Bennett Drew; Green, Jonathan; Maimon, Gaby

    2018-01-22

    Animals react rapidly to external stimuli, such as an approaching predator, but in other circumstances, they seem to act spontaneously, without any obvious external trigger. How do the neural processes mediating the execution of reflexive and spontaneous actions differ? We studied this question in tethered, flying Drosophila. We found that silencing a large but genetically defined set of non-motor neurons virtually eliminates spontaneous flight turns while preserving the tethered flies' ability to perform two types of visually evoked turns, demonstrating that, at least in flies, these two modes of action are almost completely dissociable. Copyright © 2017 Elsevier Ltd. All rights reserved.

  10. Evaluation of cutting force uncertainty components in turning

    Axinte, Dragos Aurelian; Belluco, Walter; De Chiffre, Leonardo

    2000-01-01

    A procedure is proposed for the evaluation of those uncertainty components of a single cutting force measurement in turning that are related to the contributions of the dynamometer calibration and the cutting process itself. Based on an empirical model including errors form both sources......, the uncertainty for a single measurement of cutting force is presented, and expressions for the expected uncertainty vs. cutting parameters are proposed. This approach gives the possibility of evaluating cutting force uncertainty components in turning, for a defined range of cutting parameters, based on few...

  11. Solid-State Synthesis and Structure of the Enigmatic Ammonium Octaborate: (NH4)2[B7O9(OH)5]·3/4B(OH)3·5/4H2O.

    Neiner, Doinita; Sevryugina, Yulia V; Schubert, David M

    2016-09-06

    The compound known since the 19th century as ammonium octaborate was structurally characterized revealing the ammonium salt of the ribbon isomer of the heptaborate anion, [B7O9(OH)5](2-), with boric acid and water molecules. Of composition (NH4)2B7.75O12.63·4.88H2O, it approximates the classical ammonium octaborate composition (NH4)2B8O13·6H2O and has the structural formula {(NH4)2[B7O9(OH)5]}4·3B(OH)3·5H2O. It spontaneously forms at room temperature in solid-state mixtures of ammonium tetraborate and ammonium pentaborate. It crystallizes in the monoclinic space group P21/c with a = 11.4137(2) Å, b = 11.8877(2) Å, c = 23.4459(3) Å, β = 90.092(1)°, V = 3181.19(8) Å(3), and Z = 2 and contains well-ordered ammonium cations and [B7O9(OH)5](2-) anions and disordered B(OH)3 and H2O molecules linked by extensive H bonding. Expeditious solid-state formation of the heptaborate anion under ambient conditions has important implications for development of practical syntheses of industrially useful borates.

  12. OpenTURNS, an open source uncertainty engineering software

    Popelin, A.L.; Dufoy, A.

    2013-01-01

    The needs to assess robust performances for complex systems have lead to the emergence of a new industrial simulation challenge: to take into account uncertainties when dealing with complex numerical simulation frameworks. EDF has taken part in the development of an Open Source software platform dedicated to uncertainty propagation by probabilistic methods, named OpenTURNS for Open source Treatment of Uncertainty, Risk and Statistics. OpenTURNS includes a large variety of qualified algorithms in order to manage uncertainties in industrial studies, from the uncertainty quantification step (with possibilities to model stochastic dependence thanks to the copula theory and stochastic processes), to the uncertainty propagation step (with some innovative simulation algorithms as the ziggurat method for normal variables) and the sensitivity analysis one (with some sensitivity index based on the evaluation of means conditioned to the realization of a particular event). It also enables to build some response surfaces that can include the stochastic modeling (with the chaos polynomial method for example). Generic wrappers to link OpenTURNS to the modeling software are proposed. At last, OpenTURNS is largely documented to provide rules to help use and contribution

  13. Understanding the Linguistic Turn and the Quest for Meaning ...

    Apart from Dilthey the linguistic turn penetrated also the thought of thinkers such as Freud, Wittgenstein, Frankl, Heidegger, Habermas, Dooyeweerd and Gadamer, all of them (implicitly or explicitly) elaborated the initial criticism raised by Herder, Jacobi, Hamann, Heidegger and Gadamer against Kant's Critique of Pure ...

  14. Performances of cutting fluids in turning. Mineral oil - RM

    Axinte, Dragos Aurelian; Belluco, Walter

    1999-01-01

    Scope of the present measurement campaign is the evaluation of the cutting fluid performance. The report presents the standard routine and the results obtained when turning stainless steel and brass with a commercial vegetable based oil called RM. The methods were developed to be applicable...

  15. Performances of cutting fluids in turning. Vegetable based oil - RV

    Axinte, Dragos Aurelian; Belluco, Walter

    1999-01-01

    Scope of the present measurement campaign is the evaluation of the cutting fluid performance. The report presents the standard routine and the results obtained when turning stainless steel and brass with a commercial vegetable based oil called RV. The methods were developed to be applicable...

  16. Turn me on 100 easy ways to use solar energy

    Kodis, Michelle

    2009-01-01

    HERE COMES THE SUN! With page after page of creative and innovative ideas for using this limitless form of energy, as well as thoughtfully compiled lists of useful resources, Turn Me On is an introductory guide to understanding the exciting advances in a progressing technology that harnesses the boundless power of the sun to bring us clean, renewable energy.

  17. A Rhetoric of Turns: Signs and Symbols in Education

    Rutten, Kris; Soetaert, Ronald

    2014-01-01

    In our research and teaching we explore the value and the place of rhetoric in education. From a theoretical perspective we situate our work in different disciplines, inspired by major "turns": linguistic, cultural, anthropological/ethnographic, interpretive, semiotic, narrative, literary, rhetorical etc. In this article we engage in the…

  18. Turning of materials with high-speed abrasive waterjet

    Sitek, Libor; Hlaváček, Petr

    -, October 2016 (2016), s. 1160-1165 ISSN 1805-0476 R&D Projects: GA MŠk ED2.1.00/03.0082; GA MŠk(CZ) LO1406 Institutional support: RVO:68145535 Keywords : abrasive water jet machining * turning * steel * rock * wood Subject RIV: JQ - Machines ; Tools http://www.mmscience.eu/content/file/archives/MM_Science_201692.pdf

  19. Using Facebook Data to Turn Introductory Statistics Students into Consultants

    Childers, Adam F.

    2017-01-01

    Facebook provides businesses and organizations with copious data that describe how users are interacting with their page. This data affords an excellent opportunity to turn introductory statistics students into consultants to analyze the Facebook data using descriptive and inferential statistics. This paper details a semester-long project that…

  20. Characterization of jellyfish turning using 3D-PTV

    Xu, Nicole; Dabiri, John

    2017-11-01

    Aurelia aurita are oblate, radially symmetric jellyfish that consist of a gelatinous bell and subumbrellar muscle ring, which contracts to provide motive force. Swimming is typically modeled as a purely vertical motion; however, asymmetric activations of swim pacemakers (sensory organs that innervate the muscle at eight locations around the bell margin) result in turning and more complicated swim behaviors. More recent studies have examined flow fields around turning jellyfish, but the input/output relationship between locomotive controls and swim trajectories is unclear. To address this, bell kinematics for both straight swimming and turning are obtained using 3D particle tracking velocimetry (3D-PTV) by injecting biocompatible elastomer tags into the bell, illuminating the tank with ultraviolet light, and tracking the resulting fluorescent particles in a multi-camera setup. By understanding these kinematics in both natural and externally controlled free-swimming animals, we can connect neuromuscular control mechanisms to existing flow measurements of jellyfish turning for applications in designing more energy efficient biohybrid robots and underwater vehicles. NSF GRFP.

  1. Supply and demand of timber for wood turning in Maine

    Eric H. Wharton; Robert L., Jr. Nevel; Douglas S. Powell; Douglas S. Powell

    1987-01-01

    An analytical report on the volume of wood used by the wood-turning industry in Maine, and the volume of timber from the state's timberlands that may be suitable for turnstock. Findings are based on the third forest resource survey of Maine timberlands, and an industry canvass of primary manufacturing mills using wood from Maine timberlands, both conducted in 1982...

  2. Online Memorials 2.0: When Mourning Turns Social

    Gotved, Stine

    This paper investigates the turn from individual to social online mourning rituals and introduces a research project that follows a new memorial platform where the best from both sides are sought combined. The Danish online memorial site from 2000, mindet.dk, is about to launch in a version 2...

  3. Diamond turning and polishing tests on new RSP aluminium alloys

    Horst, R. ter; Haan, M. de; Gubbels, G.P.H.; Senden, R.; Venrooy, B.W.H. van; Hoogstrate, A.M.

    2012-01-01

    For years now conventional aluminium 6061 T6 has widely been used for mirrors in astronomical instruments, being diamond turned or since a few years also being optically polished. This allows the development of optical systems that can be tested and operated at any temperature, without being

  4. Student Wellbeing and the Therapeutic Turn in Education

    Wright, Katie

    2014-01-01

    This article considers current concerns with promoting student mental health and wellbeing against the backdrop of critiques of the "therapeutic turn" in education. It begins by situating accounts of "therapeutic education" within broader theorisation of therapeutic culture. In doing so, the importance of this work is…

  5. Universals and cultural variation in turn-taking in conversation

    Stivers, Tanya; Enfield, N. J.; Brown, Penelope; Englert, Christina; Hayashi, Makoto; Heinemann, Trine; Hoymann, Gertie; Rossano, Federico; de Ruiter, Jan Peter; Yoon, Kyung-Eun; Levinson, Stephen C.

    2009-01-01

    Informal verbal interaction is the core matrix for human social life. A mechanism for coordinating this basic mode of interaction is a system of turn-taking that regulates who is to speak and when. Yet relatively little is known about how this system varies across cultures. The anthropological

  6. CNC Turning Technician. A Competency-Based Instructional System.

    Sloan, Kelly; Hilley, Robert

    This competency-based curriculum guide for instructing students in using computer numerically controlled (CNC) turning machines is one of a series of instructional guides for the machinist field developed in Oklahoma. Although developed jointly with Baxter Technologies Corporation and oriented toward the Baxter Vo-Tec 2000 Future Builder CNC…

  7. Turning shopping habits of young consumers into green

    Bialkova, Svetlana; van 't Erve, Sanne; van Hoof, Joris Jasper; Pruyn, Adriaan T.H.; Bigné, Enrique

    2014-01-01

    Consumers have strong shopping habits, and although being aware of sustainable issues, they hardly do green shopping. Therefore, a challenging question is: how to break the old shopping habits and turn those into green? The current study addresses this question looking at barriers and potential

  8. Postcolonial turn : re-imagining anthropology and Africa

    Devisch, R.; Nyamnjoh, F.

    2011-01-01

    This book is a reflection on the mental decolonization of the postcolonialist turn in Africanist scholarship and is simultaneously a tribute to the late Professor Archibald Mafeje. A number of the articles, including the Introduction by A. Olukoshi and F. Nyamnjoh, are reprinted from the Codesria

  9. Diplomas Count 2013: Second Chances--Turning Dropouts into Graduates

    Education Week, 2013

    2013-01-01

    The 2013 edition of "Diplomas Count," entitled "Second Chances: Turning Dropouts into Graduates," examines dropout recovery and innovative strategies for returning to the educational fold the 1 million students who leave school without a diploma each year. "Education Week's" journalists investigate interventions that…

  10. Beyond 100 Tesla: Scientific experiments using single-turn coils

    Portugall, Oliver; Solane, Pierre Yves; Plochocka, Paulina; Maude, Duncan K.; Nicholas, Robin J.

    2013-01-01

    Current opportunities and recent examples for research in magnetic fields well above 100 T using single-turn coils are discussed. After a general introduction into basic principles and technical constraints associated with the generation of Megagauss fields we discuss data obtained at the LNCMI Toulouse, where such fields are routinely used for scientific applications.

  11. The turning of the wind in the atmospheric boundary layer

    Pena Diaz, Alfredo; Gryning, Sven-Erik; Floors, Rogier Ralph

    2014-01-01

    Here we use accurate observations of the wind speed vector to analyze the behavior with height of the wind direction. The observations are a combination of tall meteorological mast and long-range wind lidar measurements covering the entire atmospheric boundary layer. The observations were performed...... winds underpredict the turning of the wind and the boundary-layer winds in general....

  12. Turning value chains into social gains in Southeast Asia | CRDI ...

    Turning value chains into social gains in Southeast Asia. Global value chains, which now form the largest share of the world's trade, involve producers and enterprises that produce goods as inputs for other producers. In Southeast Asian countries, these industries employ large numbers of low-skilled workers, particularly ...

  13. Investing in Training and Development. Turning Interest into Capital.

    Pont, Tony

    This book, which is intended for individuals responsible for human resource development (HRD) programs, examines a number of issues in turning investments in training and development into human capital and examines ways of making the workplace an arena for development. The following topics are discussed: the nature and role of training and…

  14. Turning Sunlight into Electricity-Inorganic Solar Cells and Beyond

    Home; Journals; Resonance – Journal of Science Education; Volume 16; Issue 12. Turning Sunlight into Electricity - Inorganic Solar Cells and Beyond. A K Shukla. Volume 16 Issue 12 December 2011 pp 1294-1302. Fulltext. Click here to view fulltext PDF. Permanent link:

  15. Novel β-amyloid aggregation inhibitors possessing a turn mimic.

    Hamada, Yoshio; Miyamoto, Naoko; Kiso, Yoshiaki

    2015-04-01

    Amyloid β peptide, the main component of senile plaques found in the brain of Alzheimer disease (AD) patients, is a molecular target for AD therapeutic intervention. A number of potential AD therapeutics have been reported, including inhibitors of β-secretase, γ-secretase, and Aβ aggregation, and anti-amyloid agents, such as neprilysin, insulin degrading enzyme (IDE), and Aβ antibodies. Recently, we reported potent small-sized β-secretase (BACE1) inhibitors, which could serve as anti-AD drugs. However AD is a progressive disorder, where dementia symptoms gradually worsen over several decades, and therefore may require many years to get cured. One possible way to achieve a greater therapeutic effect is through simultaneous administration of multiple drugs, similar to those used in Highly Active Anti-Retroviral Therapy (HAART) used to treat AIDS. In order to overcome AD, we took a drug discovery approach to evaluate, novel β-amyloid aggregation inhibitors. Previously, we reported that a tong-type compound possessing a turn mimic as the inhibitor of HIV-1 protease dimerization. Oligomerized amyloid β peptides contain a turn structure within the molecule. Here, we designed and synthesized novel β-amyloid aggregation inhibitors with a turn-mimic template, based on the turn conformer of the oligomerized amyloid β peptides. Copyright © 2015 Elsevier Ltd. All rights reserved.

  16. Social and Emotional Turn Taking for Embodied Conversational Agents

    Bruijnes, Merijn

    2012-01-01

    In this doctoral consortium paper I describe the theme of my research, the model-based generation of consistent emotional turn taking behavior in virtual human conversations and the evaluation of this behavior. My goal is to investigate and generate convincing social behavior in embodied

  17. The Digital Turn. How the internet transforms our existence

    Westera, Wim

    2014-01-01

    The presentation is based on my book The Dital Turn. The swift virtualisation of the world implies a radical change of the conditions of life. We have to cope with the fact that our experiences of the world will largely be mediated experiences, fuelled by data, cameras, sensors, indicators and

  18. The 'Turn to Parenting': Paradigm shift or work in progress?

    Hopman, M.; Knijn, G.C.M.

    In the field of child and youth support, preventive and parent-oriented support programs are currently emphasized. This is understood as a new paradigm of parenting support, which is sometimes referred to as “the turn to parenting.” Using Campbell’s (Annual Review of Sociology, 28:21–38, 2002),

  19. Causal Role of Motor Simulation in Turn-Taking Behavior.

    Hadley, Lauren V; Novembre, Giacomo; Keller, Peter E; Pickering, Martin J

    2015-12-16

    Overlap between sensory and motor representations has been documented for a range of human actions, from grasping (Rizzolatti et al., 1996b) to playing a musical instrument (Novembre and Keller, 2014). Such overlap suggests that individuals use motor simulation to predict the outcome of observed actions (Wolpert, 1997). Here we investigate motor simulation as a basis of human communication. Using a musical turn-taking task, we show that pianists call on motor representations of their partner's part to predict when to come in for their own turn. Pianists played alternating solos with a videoed partner, and double-pulse transcranial magnetic stimulation was applied around the turn-switch to temporarily disrupt processing in two cortical regions implicated previously in different forms of motor simulation: (1) the dorsal premotor cortex (dPMC), associated with automatic motor resonance during passive observation of hand actions, especially when the actions are familiar (Lahav et al., 2007); and (2) the supplementary motor area (SMA), involved in active motor imagery, especially when the actions are familiar (Baumann et al., 2007). Stimulation of the right dPMC decreased the temporal accuracy of pianists' (right-hand) entries relative to sham when the partner's (left-hand) part had been rehearsed previously. This effect did not occur for dPMC stimulation without rehearsal or for SMA stimulation. These findings support the role of the dPMC in predicting the time course of observed actions via resonance-based motor simulation during turn-taking. Because turn-taking spans multiple modes of human interaction, we suggest that simulation is a foundational mechanism underlying the temporal dynamics of joint action. Even during passive observation, seeing or hearing somebody execute an action from within our repertoire activates motor cortices of our brain. But what is the functional relevance of such "motor simulation"? By combining a musical duet task with a real

  20. Beta-and gamma-turns in proteins revisited: a new set of amino acid turn-type dependent positional preferences and potentials.

    Guruprasad, K; Rajkumar, S

    2000-06-01

    The number of beta-turns in a representative set of 426 protein three-dimensional crystal structures selected from the recent Protein Data Bank has nearly doubled and the number of gamma-turns in a representative set of 320 proteins has increased over seven times since the previous analysis. Beta-turns (7153) and gamma-turns (911) extracted from these proteins were used to derive a revised set of type-dependent amino acid positional preferences and potentials. Compared with previous results, the preference for proline, methionine and tryptophan has increased and the preference for glutamine, valine, glutamic acid and alanine has decreased for beta-turns. Certain new amino acid preferences were observed for both turn types and individual amino acids showed turn-type dependent positional preferences. The rationale for new amino acid preferences are discussed in the light of hydrogen bonds and other interactions involving the turns. Where main-chain hydrogen bonds of the type NH(i + 3) --> CO(i) were not observed for some beta-turns, other main-chain hydrogen bonds or solvent interactions were observed that possibly stabilize such beta-turns. A number of unexpected isolated beta-turns with proline at i + 2 position were also observed. The NH(i + 2) --> CO(i) hydrogen bond was observed for almost all gamma-turns. Nearly 20% classic gamma-turns and 43% inverse gamma-turns are isolated turns.

  1. Isochronous 180 degree turns for the SLC positron system

    Helm, R.H.; Clendenin, J.E.; Ecklund, S.D.; Kulikov, A.V.; Pitthan, R.

    1991-05-01

    The design of the compact, achromatic, second order isochronous 180 degrees turn for the SLC positron transport system will be described. Design criteria require an energy range of 200±20 MeV, energy acceptance of ±5%, transverse admittance of 25π mm-mr, and minimal lengthening of the 3 to 4 mm (rms) positron bunch. The devices had to fit within a maximum height or width of about 10 ft. Optics specifications and theoretical performance are presented and compared to experimental results based on streak camera measurements of bunch length immediately after the first isochronous turn (200 MeV) and positron beam energy spread after S-band acceleration to 1.15 GeV. 5 refs., 7 figs

  2. A Turn-Projected State-Based Conflict Resolution Algorithm

    Butler, Ricky W.; Lewis, Timothy A.

    2013-01-01

    State-based conflict detection and resolution (CD&R) algorithms detect conflicts and resolve them on the basis on current state information without the use of additional intent information from aircraft flight plans. Therefore, the prediction of the trajectory of aircraft is based solely upon the position and velocity vectors of the traffic aircraft. Most CD&R algorithms project the traffic state using only the current state vectors. However, the past state vectors can be used to make a better prediction of the future trajectory of the traffic aircraft. This paper explores the idea of using past state vectors to detect traffic turns and resolve conflicts caused by these turns using a non-linear projection of the traffic state. A new algorithm based on this idea is presented and validated using a fast-time simulator developed for this study.

  3. A proposed residual stress model for oblique turning

    Elkhabeery, M. M.

    2001-01-01

    A proposed mathematical model is presented for predicting the residual stresses caused by turning. Effects of change in tool free length, cutting speed, feed rate, and the tensile strength of work piece material on the maximum residual stress are investigated. The residual stress distribution in the surface region due to turning under unlubricated condition is determined using a deflection etching technique. To reduce the number of experiments required and build the mathematical model for these variables, Response Surface Methodology (RSM) is used. In addition, variance analysis and an experimental check are conducted to determine the prominent parameters and the adequacy of the model. The results show that the tensile stress of the work piece material, cutting speed, and feed rate have significant effects on the maximum residual stresses. The proposed model, that offering good correlation between the experimental and predicted results, is useful in selecting suitable cutting parameters for the machining of different materials. (author)

  4. Memory boosts turn taking in evolutionary dilemma games.

    Wang, Tao; Chen, Zhigang; Yang, Lei; Zou, You; Luo, Juan

    2015-05-01

    Spontaneous turn taking phenomenon can be observed in many self-organized systems, and the mechanism is unclear. This paper tries to model it by evolutionary dilemma games with memory mechanism. Prisoner's dilemma, Snowdrift (including Leader and Hero) and Stag-hunt games are unified on an extended S-T plane. Agents play game with all the others and make decision by the last game histories. The experiments find that when agents remember last 2-step histories or more, a kind of cooperative turn taking (CAD) bursts at the area of Snowdrift game with restriction of S + T > 2R and S ≠ T, while the consistent strategy (DorC) gathers on the line of S + T > 2R and S = T. We also find that the system's fitness ratio greatly improved with 2-step memory. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

  5. Turn-key SRF accelerators to drive subcritical reactors

    Johnson, Rolland P.

    2011-01-01

    Large particle accelerator projects, both accomplished and proposed, have been used to engage US industry through contracts and grants to develop efficient capabilities to design, develop, produce, and deliver entire accelerator systems or any needed subsystems. Staffed in many cases by experienced scientists and engineers from National Laboratories and Universities, existing companies could extend their portfolios to offer turn-key accelerators with parameters to match the needs of ADS. If the reactors were based on molten salt fuel such that trip rate requirements were relaxed, the developments needed for a multi-MW proton accelerator for ADS would be minimal. Turn-key SRF proton linacs for ADS operation can be ordered now to enable GW-level power generation from natural thorium, natural uranium, or nuclear waste from conventional reactors. (author)

  6. Optimization of cutting parameters for machining time in turning process

    Mavliutov, A. R.; Zlotnikov, E. G.

    2018-03-01

    This paper describes the most effective methods for nonlinear constraint optimization of cutting parameters in the turning process. Among them are Linearization Programming Method with Dual-Simplex algorithm, Interior Point method, and Augmented Lagrangian Genetic Algorithm (ALGA). Every each of them is tested on an actual example – the minimization of production rate in turning process. The computation was conducted in the MATLAB environment. The comparative results obtained from the application of these methods show: The optimal value of the linearized objective and the original function are the same. ALGA gives sufficiently accurate values, however, when the algorithm uses the Hybrid function with Interior Point algorithm, the resulted values have the maximal accuracy.

  7. Magnetostrictive actuator-based micropositioner and its application in turning

    Kanizar, William L.; Liu, Dongming; Moon, Kee S.; Sutherland, John W.

    1996-05-01

    The surface finish of a turned part is primarily generated from process parameters such as feed, tool geometry, and cutting speed. A micropositioner system utilizing a magnetostrictive material, Terfenol-D, as a linear motor is presented as a means to actively control the process. The system has an actuator clamped in a flexor that is rigid in the feed and main cutting force directions, yet is flexible in the radial direction. Using control algorithms implemented on a digital computer, the system can provide a means to compensate for deleterious vibrations. The system has also been used to manipulate the tool position in the radial direction so that non-circular turning can be accomplished.

  8. Morphing of Building Footprints Using a Turning Angle Function

    Jingzhong Li

    2017-06-01

    Full Text Available We study the problem of morphing two polygons of building footprints at two different scales. This problem frequently occurs during the continuous zooming of interactive maps. The ground plan of a building footprint on a map has orthogonal characteristics, but traditional morphing methods cannot preserve these geographic characteristics at intermediate scales. We attempt to address this issue by presenting a turning angle function-based morphing model (TAFBM that can generate polygons at an intermediate scale with an identical turning angle for each side. Thus, the orthogonal characteristics can be preserved during the entire interpolation. A case study demonstrates that the model yields good results when applied to data from a building map at various scales. During the continuous generalization, the orthogonal characteristics and their relationships with the spatial direction and topology are well preserved.

  9. Measurements of diamond-turned copper mirrors at glancing incidence

    Kimura, W.D.; Saito, T.T.

    1987-01-01

    The results of glancing incidence absorptance measurements performed on diamond-turned copper mirrors are presented. A photoacoustic calorimetry technique is used in which the output from a low power, chopped cw Nd:YAG laser (1.06 μm) is incident upon the mirror at angles of incidence from 0 to 87 0 , for both s and p-polarizations. Measurements are obtained as a function of the diamond turning groove orientation with respect to the plane of incidence. Minimum absorptance, at high angles of incidence, is achieved with s-polarized light and with the grooves aligned parallel to the plane of incidence. The affects on the absorptance of a large scratch at glancing incidence are also described

  10. Measurements of diamond turned copper mirrors at glancing incidence

    Kimura, W.D.; Saito, T.T.

    1987-01-01

    The results of glancing incidence absorptance measurements performed on diamond turned copper mirrors are presented. A photoacoustic calorimetry technique is used in which the output from a low power, chopped cw Nd:YAG laser (1.06 μm) is incident upon the mirror at angles of incidence from 0 to 87 0 , for both s and p-polarizations. Measurements are obtained as a function of the diamond turning groove orientation with respect to the plane of incidence. Minimum absorptance at high angles of incidence is achieved with s-polarized light and with the grooves aligned parallel to the plane of incidence. The effects on the absorptance of a large scratch at glancing incidence are also described

  11. Effect of transmitter turn-off time on transient soundings

    Fitterman, D.V.; Anderson, W.L.

    1987-01-01

    A general procedure for computing the effect of non-zero turn-off time on the transient electromagnetic response is presented which can be applied to forward and inverse calculation methods for any transmitter-receiver configuration. We consider in detail the case of a large transmitter loop which has a receiver coil located at the center of the loop (central induction or in-loop array). For a linear turn-off ramp of width t0, the voltage response is shown to be the voltage due to an ideal step turn-off averaged over windows of width t0. Thus the effect is similar to that obtained by using averaging windows in the receiver. In general when time zero is taken to be the end of the ramp, the apparent resistivity increases for a homogeneous half-space over a limited time range. For time zero taken to be the start of the ramp the apparent resistivity is affected in the opposite direction. The effect of the ramp increases with increasing t0 and first-layer resistivity, is largest during the intermediate stage, and decreases with increasing time. It is shown that for a ramp turn-off, there is no effect in the early and late stages. For two-layered models with a resistive first layer (??1>??2), the apparent resistivity is increased in the intermediate stage. When the first layer is more conductive than the second layer (??1interpretation as shown by field examples; the influence is the greatest on near-surface layer parameters. ?? 1987.

  12. GA based CNC turning center exploitation process parameters optimization

    Z. Car

    2009-01-01

    Full Text Available This paper presents machining parameters (turning process optimization based on the use of artificial intelligence. To obtain greater efficiency and productivity of the machine tool, optimal cutting parameters have to be obtained. In order to find optimal cutting parameters, the genetic algorithm (GA has been used as an optimal solution finder. Optimization has to yield minimum machining time and minimum production cost, while considering technological and material constrains.

  13. Turning the tide : tidal power in the UK

    Sustainable Development Commission

    2007-01-01

    Contents: Turning the tide : tidal power in the UK -- Executive summary -- Tidal power in the UK : research report 1 : UK tidal resource assessment -- Tidal power in the UK : research report 2 : tidal technologies overview -- Tidal power in the UK : research report 3 : Severn barrage proposals -- Tidal power in the UK : research report 4 : Severn non-barrage options -- Tidal power in the UK : research report 5 : UK case studies. Summarised in the Welsh language version of the executive ...

  14. Analysis of the influence of tool dynamics in diamond turning

    Fawcett, S.C.; Luttrell, D.E.; Keltie, R.F.

    1988-12-01

    This report describes the progress in defining the role of machine and interface dynamics on the surface finish in diamond turning. It contains a review of literature from conventional and diamond machining processes relating tool dynamics, material interactions and tool wear to surface finish. Data from experimental measurements of tool/work piece interface dynamics are presented as well as machine dynamics for the DTM at the Center.

  15. Enhanced ultrasonically assisted turning of a β-titanium alloy.

    Maurotto, Agostino; Muhammad, Riaz; Roy, Anish; Silberschmidt, Vadim V

    2013-09-01

    Although titanium alloys have outstanding mechanical properties such as high hot hardness, a good strength-to-weight ratio and high corrosion resistance; their low thermal conductivity, high chemical affinity to tool materials severely impair their machinability. Ultrasonically assisted machining (UAM) is an advanced machining technique, which has been shown to improve machinability of a β-titanium alloy, namely, Ti-15-3-3-3, when compared to conventional turning processes. Copyright © 2013 Elsevier B.V. All rights reserved.

  16. Fuzzy Linguistic Optimization on Surface Roughness for CNC Turning

    Lan, Tian-Syung

    2010-01-01

    Surface roughness is often considered the main purpose in contemporary computer numerical controlled (CNC) machining industry. Most existing optimization researches for CNC finish turning were either accomplished within certain manufacturing circumstances or achieved through numerous equipment operations. Therefore, a general deduction optimization scheme is deemed to be necessary for the industry. In this paper, the cutting depth, feed rate, speed, and tool nose runoff with low, medium, and...

  17. Computational modeling of turn-taking dynamics in spoken conversations

    Chowdhury, Shammur Absar

    2017-01-01

    The study of human interaction dynamics has been at the center for multiple research disciplines in- cluding computer and social sciences, conversational analysis and psychology, for over decades. Recent interest has been shown with the aim of designing computational models to improve human-machine interaction system as well as support humans in their decision-making process. Turn-taking is one of the key aspects of conversational dynamics in dyadic conversations and is an integral part of hu...

  18. Exploring interaction between a non-speaking boy using aided AAC and his everyday communication partners: features of turn organizing and turn design

    Pilesjö, Maja Sigurd; Rasmussen, Gitte

    2011-01-01

    -at-action is suggested. The analyses demonstrate that the boy’s turn-at-actions are oriented to as a co-constructed and thus interactionally achieved unit: the boy points at a bliss symbol which is given voice by the speaking co-participant. In and through the relevant made voicing of the turn-at-action, a turn...... AAC, bliss symbolics. The analysis indicates that the participants can collaborately create and orient to units in interaction equivalent to turns in interaction although they differ dramatically from ordinary turns-at-talk. In order to capture the nature of the described units, the category turn...

  19. Surface Corrosion Resistance in Turning of Titanium Alloy

    Rui Zhang

    2015-01-01

    Full Text Available This work addresses the issues associated with implant surface modification. We propose a method to form the oxide film on implant surfaces by dry turning to generate heat and injecting oxygen-rich gas at the turning-tool flank. The morphology, roughness, composition, and thickness of the oxide films in an oxygen-rich atmosphere were characterized using scanning electron microscopy, optical profiling, and Auger electron spectroscopy. Electrochemical methods were used to study the corrosion resistance of the modified surfaces. The corrosion resistance trends, analyzed relative to the oxide film thickness, indicate that the oxide film thickness is the major factor affecting the corrosion resistance of titanium alloys in a simulated body fluid (SBF. Turning in an oxygen-rich atmosphere can form a thick oxide film on the implant surface. The thickness of surface oxide films processed at an oxygen concentration of 80% was improved to 4.6 times that of films processed at an oxygen concentration of 21%; the free corrosion potential shifted positively by 0.357 V, which significantly improved the corrosion resistance of titanium alloys in the SBF. Therefore, the proposed method may (partially replace the subsequent surface oxidation. This method is significant for biomedical development because it shortens the process flow, improves the efficiency, and lowers the cost.

  20. Leibniz, Lefebvre and the spatial turn in law

    Isolde de Villiers

    2016-11-01

    Full Text Available This contribution takes as its point of departure the spatial turn in law and the notion of spatial justice. It traces the term ‘spatial justice’ as introduced through the Spatial Planning and Land Use Management Act and it looks at the underlying view of space that has influenced the spatial turn in law. It furthermore investigates the ways in which the spatial turn in law has been influenced by the thinking of Henri Lefebvre, who relies on a Leibnizian conception of space. Lastly the link between Leibniz and legal positivism is considered in order to reach the final conclusion in the form of a caution against merely adding the language of spatial justice to an approach to space that remains caught up in abstract space. This will only further entrench existing fault lines in society. For this conclusion the work of Roger Berkowitz is central. Berkowitz argues convincingly that the work of Leibniz was central in the development of legal positivism, despite Leibniz in general being considered as a natural law thinker. The same applies to spatial justice theory, where the work of Leibniz is central: it may present the possibilities of another law – the law as it ought to be. The law conceptualised as ‘ought’ instead of ‘is’ would promote reconciliation. Alternatively, spatial justice can simply present the law as it ‘is’ and reconfirm and deepen the chasms in our world.

  1. Heading Estimation of Robot Combine Harvesters during Turning Maneuveres

    Md Mostafizar Rahman

    2018-05-01

    Full Text Available Absolute heading is an important parameter for a robot combine harvester or a robot tracked combine harvester, especially while it is turning, but due to the rapid turning of robot combine harvesters, its inertial measurement unit gives a gyro measurement bias that causes heading drift. Our research goal is to estimate the absolute heading of robot combine harvesters by compensating this gyro measurement bias during non-linear turning maneuvers. A sensor fusion method like the extended Kalman filter combined with the tracked combine harvester dynamic model and sensor measurements was used to estimate the absolute heading of a robot combine harvester. Circular, sinusoidal and concave shapes were used to evaluate the estimated heading produced by the sensor fusion method. The results indicate that the estimated heading is better than measured heading which was calculated from the integration of yaw rate gyro measurements, and the root mean square errors (RMSEs for estimated headings are smaller than the measured headings. In practics, the target of this paper is thus the estimation of a heading or absolute heading that is bias compensated, and can be further used to calculate the exact crop periphery for automatic path planning of robot combine harvesters.

  2. Heading Estimation of Robot Combine Harvesters during Turning Maneuveres.

    Rahman, Md Mostafizar; Ishii, Kazunobu

    2018-05-01

    Absolute heading is an important parameter for a robot combine harvester or a robot tracked combine harvester, especially while it is turning, but due to the rapid turning of robot combine harvesters, its inertial measurement unit gives a gyro measurement bias that causes heading drift. Our research goal is to estimate the absolute heading of robot combine harvesters by compensating this gyro measurement bias during non-linear turning maneuvers. A sensor fusion method like the extended Kalman filter combined with the tracked combine harvester dynamic model and sensor measurements was used to estimate the absolute heading of a robot combine harvester. Circular, sinusoidal and concave shapes were used to evaluate the estimated heading produced by the sensor fusion method. The results indicate that the estimated heading is better than measured heading which was calculated from the integration of yaw rate gyro measurements, and the root mean square errors (RMSEs) for estimated headings are smaller than the measured headings. In practics, the target of this paper is thus the estimation of a heading or absolute heading that is bias compensated, and can be further used to calculate the exact crop periphery for automatic path planning of robot combine harvesters.

  3. An oscillator model of the timing of turn-taking.

    Wilson, Margaret; Wilson, Thomas P

    2005-12-01

    When humans talk without conventionalized arrangements, they engage in conversation--that is, a continuous and largely nonsimultaneous exchange in which speakers take turns. Turn-taking is ubiquitous in conversation and is the normal case against which alternatives, such as interruptions, are treated as violations that warrant repair. Furthermore, turn-taking involves highly coordinated timing, including a cyclic rise and fall in the probability of initiating speech during brief silences, and involves the notable rarity, especially in two-party conversations, of two speakers' breaking a silence at once. These phenomena, reported by conversation analysts, have been neglected by cognitive psychologists, and to date there has been no adequate cognitive explanation. Here, we propose that, during conversation, endogenous oscillators in the brains of the speaker and the listeners become mutually entrained, on the basis of the speaker's rate of syllable production. This entrained cyclic pattern governs the potential for initiating speech at any given instant for the speaker and also for the listeners (as potential next speakers). Furthermore, the readiness functions of the listeners are counterphased with that of the speaker, minimizing the likelihood of simultaneous starts by a listener and the previous speaker. This mutual entrainment continues for a brief period when the speech stream ceases, accounting for the cyclic property of silences. This model not only captures the timing phenomena observed inthe literature on conversation analysis, but also converges with findings from the literatures on phoneme timing, syllable organization, and interpersonal coordination.

  4. Fuzzy Linguistic Optimization on Surface Roughness for CNC Turning

    Tian-Syung Lan

    2010-01-01

    Full Text Available Surface roughness is often considered the main purpose in contemporary computer numerical controlled (CNC machining industry. Most existing optimization researches for CNC finish turning were either accomplished within certain manufacturing circumstances or achieved through numerous equipment operations. Therefore, a general deduction optimization scheme is deemed to be necessary for the industry. In this paper, the cutting depth, feed rate, speed, and tool nose runoff with low, medium, and high level are considered to optimize the surface roughness for finish turning based on L9(34 orthogonal array. Additionally, nine fuzzy control rules using triangle membership function with respective to five linguistic grades for surface roughness are constructed. Considering four input and twenty output intervals, the defuzzification using center of gravity is then completed. Thus, the optimum general fuzzy linguistic parameters can then be received. The confirmation experiment result showed that the surface roughness from the fuzzy linguistic optimization parameters is significantly advanced compared to that from the benchmark. This paper certainly proposes a general optimization scheme using orthogonal array fuzzy linguistic approach to the surface roughness for CNC turning with profound insight.

  5. Nanostructural Evolution of Hard Turning Layers in Carburized Steel

    Bedekar, Vikram

    The mechanisms of failure for components subjected to contact fatigue are sensitive to the structure and properties of the material surface. Although, the bulk material properties are determined by the steel making, forming and the heat treatment; the near surface material properties are altered during final material removal processes such as hard turning or grinding. Therefore, the ability to optimize, modulate and predict the near surface properties during final metal removal operations would be extremely useful in the enhancement of service life of a component. Hard machining is known to induce severely deformed layers causing dramatic microstructural transformations. These transformations occur via grain refinement or thermal phenomena depending upon cutting conditions. The aim of this work is to engineer the near surface nanoscale structure and properties during hard turning by altering strain, strain rate, temperature and incoming microstructure. The near surface material transformations due to hard turning were studied on carburized SAE 8620 bearing steel. Variations in parent material microstructures were introduced by altering the retained austenite content. The strain, strain rate and temperature achieved during final metal cutting were altered by varying insert geometry, insert wear and cutting speed. The subsurface evolution was quantified by a series of advanced characterization techniques such as transmission electron microscopy (TEM), glancing angle X-ray diffraction (GAXRD), X-ray stress evaluation and nanoindentation which were coupled with numerical modeling. Results showed that the grain size of the nanocrystalline near surface microstructure can be effectively controlled by altering the insert geometry, insert wear, cutting speed and the incoming microstructure. It was also evident that the near surface retained austenite decreased at lower cutting speed indicating transformation due to plastic deformation, while it increased at higher cutting

  6. Simulation of turn-by-turn passage of protons through the H-minus stripping foil in booster

    Gardner, C. [Brookhaven National Lab. (BNL), Upton, NY (United States)

    2017-07-06

    Equations for transverse emittance growth due to multiple passes of circulating proton beam through the H-minus stripping foil in Booster were developed in [1]. These were based on simple principles of statistics and simple assumptions about the initial distribution of particles incident on the foil. It was assumed there that the foil dimensions and position of the incoming beam are such that all particles hit the foil on every turn around the machine. In the present note we assume only that all incoming H-minus ions from Linac hit the foil and are stripped of their electrons. The resulting protons circulate indefinitely around the machine. Setups in which the foil width is reduced so that not all protons hit the foil on every turn are studied here by simulation. The aim is to determine the effectiveness of such setups in reducing the emittance growth of circulating proton beam during the injection of H-minus beam. The simulations also serve as a check of the equations developed in [1], and vice versa. The particulars of the simulation setup are given in Sections 1 through 11. Figures 1 through 12 show simulation results for the case in which all particles hit the foil on every turn. The results are in good agreement with those obtained from the equations of reference [1]. Figures 13 through 19 show simulation results for various setups in which the foil width is reduced. These results are summarized in Section 12. In all gures the horizontal axis gives the turn number. The unit of the vertical axis is micrometers ( m) in all plots of emittance.

  7. Medium dependent dual turn on/turn off fluorescence sensing for Cu2 + ions using AMI/SDS assemblies

    Gujar, Varsha B.; Ottoor, Divya

    2017-02-01

    Behavior of Amiloride (AMI) as a metal ion sensor in anionic surfactant assemblies of varying concentrations at different pH is depicted in this work. From a non-sensor fluorophore, AMI has been transformed in to a tunable fluorosensor for Cu2 + ions in various SDS concentrations. At premicellar concentration of SDS, ion-pair complex is expected to be formed between AMI and SDS due to electrostatic interactions between them. However at CMC concentrations of SDS, fluorescence intensity of AMI is greatly enhanced with red shift in emission, due to the incorporation of AMI molecule in the hydrophobic micellar interface. The behavior of metal sensing by AMI-SDS assemblies gives rise to several interesting observations. Micellation of SDS has been greatly enhanced by increasing copper ion concentrations, as these counter ions screens the charge on monomers of SDS which lead to the aggregation at premicellar concentrations only. Concentrations and pH dependent discrete trends of interactions between SDS-AMI and SDS-Cu2 + ions, have given tunable fluorescence responses (fluorescence turn on/turn off) of AMI for added Cu2 + ions. The electrostatic interaction between the metal cations and the anionic surfactants is the driving force for bringing the metal ions near to the vicinity of micelle where AMI resides. Thus, a comprehensive understanding of the mechanism related to the 'turn on-turn off' fluorescence response of AMI with respect to pH and SDS concentration for effective Cu2 + ion sensing is illustrated in this work.

  8. A falling of the veils: turning points and momentous turning points in leadership and the creation of CSR

    Hemingway, C.; Starkey, Kenneth

    2017-01-01

    This article uses the life stories approach to leadership and leadership development. Using exploratory, qualitative data from a Forbes Global 2000 and FTSE 100 company, we discuss the role of the turning point (TP) as an important antecedent of leadership in corporate social responsibility. We argue that TPs are causally efficacious, linking them to the development of life narratives concerned with an evolving sense of personal identity. Using both a multi-disciplinary perspective and a mult...

  9. Expanding the peptide beta-turn in alphagamma hybrid sequences: 12 atom hydrogen bonded helical and hairpin turns.

    Chatterjee, Sunanda; Vasudev, Prema G; Raghothama, Srinivasarao; Ramakrishnan, Chandrasekharan; Shamala, Narayanaswamy; Balaram, Padmanabhan

    2009-04-29

    Hybrid peptide segments containing contiguous alpha and gamma amino acid residues can form C(12) hydrogen bonded turns which may be considered as backbone expanded analogues of C(10) (beta-turns) found in alphaalpha segments. Exploration of the regular hydrogen bonded conformations accessible for hybrid alphagamma sequences is facilitated by the use of a stereochemically constrained gamma amino acid residue gabapentin (1-aminomethylcyclohexaneacetic acid, Gpn), in which the two torsion angles about C(gamma)-C(beta) (theta(1)) and C(beta)-C(alpha) (theta(2)) are predominantly restricted to gauche conformations. The crystal structures of the octapeptides Boc-Gpn-Aib-Gpn-Aib-Gpn-Aib-Gpn-Aib-OMe (1) and Boc-Leu-Phe-Val-Aib-Gpn-Leu-Phe-Val-OMe (2) reveal two distinct conformations for the Aib-Gpn segment. Peptide 1 forms a continuous helix over the Aib(2)-Aib(6) segment, while the peptide 2 forms a beta-hairpin structure stabilized by four cross-strand hydrogen bonds with the Aib-Gpn segment forming a nonhelical C(12) turn. The robustness of the helix in peptide 1 in solution is demonstrated by NMR methods. Peptide 2 is conformationally fragile in solution with evidence of beta-hairpin conformations being obtained in methanol. Theoretical calculations permit delineation of the various C(12) hydrogen bonded structures which are energetically feasible in alphagamma and gammaalpha sequences.

  10. The development of alignment turning system for precision len cells

    Huang, Chien-Yao; Ho, Cheng-Fang; Wang, Jung-Hsing; Chung, Chien-Kai; Chen, Jun-Cheng; Chang, Keng-Shou; Kuo, Ching-Hsiang; Hsu, Wei-Yao; Chen, Fong-Zhi

    2017-08-01

    In general, the drop-in and cell-mounted assembly are used for standard and high performance optical system respectively. The optical performance is limited by the residual centration error and position accuracy of the conventional assembly. Recently, the poker chip assembly with high precision lens barrels that can overcome the limitation of conventional assembly is widely applied to ultra-high performance optical system. ITRC also develops the poker chip assembly solution for high numerical aperture objective lenses and lithography projection lenses. In order to achieve high precision lens cell for poker chip assembly, an alignment turning system (ATS) is developed. The ATS includes measurement, alignment and turning modules. The measurement module including a non-contact displacement sensor and an autocollimator can measure centration errors of the top and the bottom surface of a lens respectively. The alignment module comprising tilt and translation stages can align the optical axis of the lens to the rotating axis of the vertical lathe. The key specifications of the ATS are maximum lens diameter, 400mm, and radial and axial runout of the rotary table < 2 μm. The cutting performances of the ATS are surface roughness Ra < 1 μm, flatness < 2 μm, and parallelism < 5 μm. After measurement, alignment and turning processes on our ATS, the centration error of a lens cell with 200mm in diameter can be controlled in 10 arcsec. This paper also presents the thermal expansion of the hydrostatic rotating table. A poker chip assembly lens cell with three sub-cells is accomplished with average transmission centration error in 12.45 arcsec by fresh technicians. The results show that ATS can achieve high assembly efficiency for precision optical systems.

  11. Migration and Western europe: the old world turning new.

    Therborn, G

    1987-09-04

    The 1960s meant a historical turn of Western Europe, becoming an immigration area. Net immigration has been concentrated to some of the prosperous Western European countries and has been mainly determined by the demand of their particular national labor regimes. The size of alien employment has been very differently affected by the 1973 crisis, but a multiethnical society will remain a novel feature of most Western European countries. Political abdication from full employment and technological change makes a ghetto of un(der)employment a likely prospect of a large part of the second generation of recent immigrants into Western Europe.

  12. Serials cataloging at the turn of the century

    Williams, James W

    2014-01-01

    An overview of the research topics and trends that have appeared over the last five years, Serials Cataloging at the Turn of the Century doesn't just tell you that there has been a lot of change--that the information environment is something of a chameleon, always beguiling and slipping out of grasp. Instead, it gives you the plain facts on the specific challenges serials catalogers have been facing and how they're meeting adversity head-on, ready to gain the advantage in the rumble with proliferating information and formats.Comprehensive, resource-packed, and easy-to-digest, Serials Catalogin

  13. Big data analytics turning big data into big money

    Ohlhorst, Frank J

    2012-01-01

    Unique insights to implement big data analytics and reap big returns to your bottom line Focusing on the business and financial value of big data analytics, respected technology journalist Frank J. Ohlhorst shares his insights on the newly emerging field of big data analytics in Big Data Analytics. This breakthrough book demonstrates the importance of analytics, defines the processes, highlights the tangible and intangible values and discusses how you can turn a business liability into actionable material that can be used to redefine markets, improve profits and identify new business opportuni

  14. An adaptation framework for turning real life events into games

    Therkildsen, Sacha Kjærhus; Bunkenborg, Nanna Cassøe; Larsen, Lasse Juel

    2017-01-01

    Many games are inspired by real life events. The presented adaptation framework is based on the design of a board game with a companion app that addresses the Syrian refugee crisis. The aim of the game is to allow players to simulate the experience of being a Syrian refugee traveling through Europe....... We applied an agile development method and participatory design to achieve our ambition. In conclusion we found that turning real life events into board games can be advanced by the following game design adaptation framework, which balances four interrelated layers: (1) real life events (game fiction...

  15. The embodied turn in research on language and social interaction

    Nevile, Maurice

    2015-01-01

    I use the term the embodied turn to mean the point when interest in the body became established among researchers on language and social interaction, exploiting the greater ease of video-recording. This review paper tracks the growth of "embodiment" in over 400 papers published in Research...... on Language and Social Interaction from 1987-2013. I consider closely two areas where analysts have confronted challenges, and how they have responded: settling on precise and analytically helpful terminology for the body; and transcribing and representing the body, particularly its temporality and manner....

  16. The civic integrationist turn in Danish and Swedish school politics

    Fernández, Christian; Jensen, Kristian Kriegbaum

    2017-01-01

    , yet with different styles and content. Citizenship education in Denmark concentrates on reproducing a historically derived core of cultural values and knowledge to which minorities are expected to assimilate, while the Swedish model subscribes to a pluralist view that stresses mutual adaptation...... it follow the pattern of residence and citizenship? This article addresses these questions through a comparative study of the EU’s allegedly strictest and most liberal immigration regimes, Denmark and Sweden, respectively. The analysis shows a growing concern with citizenship education in both countries...... and intercultural tolerance. Despite claims to the contrary, the analysis shows that Sweden too has experienced a civic turn....

  17. Tool life of ceramic wedges during precise turning of tungsten

    Legutko Stanislaw

    2017-01-01

    Full Text Available Properties, application and machinability of tungsten and its alloys have been demonstrated. The comparison of the tool life and wear of the wedges made of SiAlON and whisker ceramics during the precise turning at different cutting parameters have been presented. The CNC lathe DMG CTX 310 Ecoline and tungsten of 99.7 % purity were used during the experiments. Only the wedge of whisker ceramics has proved to be sufficiently suitable and only for relatively low cutting speeds.

  18. Turning a Poor Ion Channel into a Good Pump

    Astumian, Dean

    2003-05-01

    We consider a membrane protein that can exist in two configurations, either one of which acts as a poor ion channel, allowing ions to slowly leak across the membrane from high to low elctrochemical potential. We show that random external fluctuations can provide the energy to turn this poor channel into a good pump that drives ion transport from low to high electrochemical potential. We discuss this result in terms of a gambling analogy, and point to possible implications for fields as far ranging as population biology, economics, and actuarial science.

  19. Dynamic characterization of the cutting conditions in dry turning

    Serra, R [ENI Val de Loire, Universite Francois Rabelais de Tours, Laboratoire de Mecanique et Rheologie, E.A. 2640, B.P. 3410, 41034 Blois Cedex (France); Chibane, H [Universite Francois Rabelais, Laboratoire de Mecanique et Rheologie, E.A. 2640, B.P. 3410, 41034 Blois Cedex (France); Leroy, R, E-mail: roger.serra@univ-tours.f [Universite Francois Rabelais, Polytech' Tours, Laboratoire de Mecanique et Rheologie, E.A. 2640, 7 Avenue Marcel Dassault, 37200 Tours (France)

    2009-08-01

    Machining instability in the form of violent vibrations or chatter is a physical process characterized by extreme cutting force at the cutting point. The process has very negative impact on machine integrity, tool life, surface quality and dimensional accuracy. Thus it could significantly compromise productivity and manufacturing quality. In the present paper, the importance of characterization and identification of dynamic instability in dry turning operation are shown. The stability behaviour of machine vibration or chatter has been examined and the various relevant parameters are studied and discuted. For chatter detection and identification of the transition between stable and unstable states, different methods are used. Results obtained proof the accuracy of these methods.

  20. Why nature doesn't turn off neurosis.

    Badalamenti, Anthony F

    2013-03-01

    This paper develops an integration of psychoanalytic and wisdom tradition concepts to answer the question as to why nature does not turn off neurosis, The proposed answer is that nature wants a person to exploit the neurosis for two gains, one being the increase in adaptive capacity resulting from releasing it and the second involving the difficulty in the release itself, the latter related to gains proffered by the world's wisdom traditions. These see a movement from the psyche's creation by passive, unconscious means of finite promise rooted in parental love to creation by active, consciously chosen means of unlimited promise involving a direct relationship with nature and the Cosmos.

  1. Turn and jump: how time & place fell apart

    Mansfield, Howard

    2013-01-01

    Before Thomas Edison, light and fire were thought to be one and the same. Turns out, they were separate things altogether. This book takes a similar relationship, that of time and place, and shows how they, too, were once inseparable. Time keeping was once a local affair, when small towns set their own pace according to the rising and setting of the sun. Then, in 1883, the expanding railroads necessitated the creation of Standard Time zones, and communities became linked by a universal time. Here Howard Mansfield explores how our sudden interconnectedness, both physically, as through the railroad, and through inventions like the telegraph, changed our concept of time and place forever.

  2. Wofford-Thornburgh: a turning point for health reform.

    Tokarski, C

    1992-01-01

    The November 5 special election in Pennsylvania pitting appointed Senator Harris Wofford against former U.S. Attorney General Richard Thornburgh was a turning point in the national debate over health reform. Under the glare of media spotlights, Wofford mounted a come-from-behind victory over the heavily favored Thornburgh by trumpeting "national health insurance." Since Wofford's victory, President Bush has rethought his previous indifference to health reform and promised to announce a comprehensive plan in January, more than a year ahead of schedule.

  3. Alternative Fuels Data Center: Central Ohio Turns Trash Into Natural Gas

    Central Ohio Turns Trash Into Natural Gas to someone by E-mail Share Alternative Fuels Data Center : Central Ohio Turns Trash Into Natural Gas on Facebook Tweet about Alternative Fuels Data Center: Central Ohio Turns Trash Into Natural Gas on Twitter Bookmark Alternative Fuels Data Center: Central Ohio Turns

  4. Ultra-precision turning of complex spiral optical delay line

    Zhang, Xiaodong; Li, Po; Fang, Fengzhou; Wang, Qichang

    2011-11-01

    Optical delay line (ODL) implements the vertical or depth scanning of optical coherence tomography, which is the most important factor affecting the scanning resolution and speed. The spinning spiral mirror is found as an excellent optical delay device because of the high-speed and high-repetition-rate. However, it is one difficult task to machine the mirror due to the special shape and precision requirement. In this paper, the spiral mirror with titled parabolic generatrix is proposed, and the ultra-precision turning method is studied for its machining using the spiral mathematic model. Another type of ODL with the segmental shape is also introduced and machined to make rotation balance for the mass equalization when scanning. The efficiency improvement is considered in details, including the rough cutting with the 5- axis milling machine, the machining coordinates unification, and the selection of layer direction in turning. The onmachine measuring method based on stylus gauge is designed to analyze the shape deviation. The air bearing is used as the measuring staff and the laser interferometer sensor as the position sensor, whose repeatability accuracy is proved up to 10nm and the stable feature keeps well. With this method developed, the complex mirror with nanometric finish of 10.7nm in Ra and the form error within 1um are achieved.

  5. Geomediations in the Anthropocene: Fictions of the Geologic Turn

    Alla Ivanchikova

    2018-02-01

    Full Text Available In both literature and philosophy, geologic matter has been imagined as a vector of extending perception and analysis into the territory of not only the nonhuman, but also the non-living, challenging the very distinctions between life and non-life, agile and inert matter. Recently, the debates over the concept of the Anthropocene amplified our fascination with the geologic, bringing into view the inescapable bond of human and Earth’s history. The article probes the possibilities of the geologic turn through two short stories published in the era of the Anthropocene debates—Margaret Atwood’s ‘Stone Mattress’ (2013 and A.S. Byatt’s ‘A Stone Woman’ (2003. The stories’ interest in a geologic setting, their staging of human-mineral intimacies, and their geologically-infused aesthetics position these two stories as fictions of the geologic turn. I examine how these writers—through reconfiguring the relations between bios and geos, human and nonhuman—forge alternatives to an extractive relation to the geos, as well as refuse to accept the figure of Earth as either an inert object or a victim. In this reframing, they also exemplify feminist critique of the imagined unity of ‘Anthropos’ that is named by the Anthropocene thinkers.

  6. Surface roughness when diamond turning RSA 905 optical aluminium

    Otieno, T.; Abou-El-Hossein, K.; Hsu, W. Y.; Cheng, Y. C.; Mkoko, Z.

    2015-08-01

    Ultra-high precision machining is used intensively in the photonics industry for the production of various optical components. Aluminium alloys have proven to be advantageous and are most commonly used over other materials to make various optical components. Recently, the increasing demand from optical systems for optical aluminium with consistent material properties has led to the development of newly modified grades of aluminium alloys produced by rapid solidification in the foundry process. These new aluminium grades are characterised by their finer microstructures and refined mechanical and physical properties. However the machining database of these new optical aluminium grades is limited and more research is still required to investigate their machinability performance when they are diamond turned in ultrahigh precision manufacturing environment. This work investigates the machinability of rapidly solidified aluminium RSA 905 by varying a number of diamond-turning cutting parameters and measuring the surface roughness over a cutting distance of 4 km. The machining parameters varied in this study were the cutting speed, feed rate and depth of cut. The results showed a common trend of decrease in surface roughness with increasing cutting distance. The lowest surface roughness Ra result obtained after 4 km in this study was 3.2 nm. This roughness values was achieved using a cutting speed of 1750 rpm, feed rate of 5 mm/min and depth of cut equal to 25 μm.

  7. Beyond Cultural History? The Material Turn, Praxiography, and Body History

    Iris Clever

    2014-10-01

    Full Text Available The body came to be taken seriously as a topic of cultural history during the “corporeal” or “bodily” turn in the 1980s and 1990s. Soon, however, critique was raised against these studies’ conceptualization of the body as discursively shaped and socially disciplined: individual bodily agency and feeling were felt to be absent in the idea of the material body. This article critically analyzes new approaches in the field of body history, particularly the so-called “material turn”. It argues that the material turn, especially in the guise of praxiography, has a lot to offer historians of the body, such as more attention to material practices, to different kinds of actors and a more open eye to encounters. Potential problems of praxiographical analyses of the body in history include the complicated relationship between discourses and practices and the neglect of the political and feminist potential of deconstructive discourse analyses. However, a focus on the relationship between practices of knowledge production and the representation of the body may also provide new ways of opening up historical power relations.

  8. Improved Turn-on Characteristics of Fast High Current Thyristors

    Ducimetière, L; Vossenberg, Eugène B

    1999-01-01

    The beam dumping system of CERN's Large Hadron Collider (LHC) is equipped with fast solid state closing switches, designed for a hold-off voltage of 30 kV and a quasi half sine wave current of 20 kA, with 3 ms rise time, a maximum di/dt of 12 kA/ms and 2 ms fall time. The design repetition rate is 20 s. The switch is composed of ten Fast High Current Thyristors (FHCT’s), which are modified symmetric 4.5 kV GTO thyristors of WESTCODE. Recent studies aiming at improving the turn-on delay, switching speed and at decreasing the switch losses, have led to test an asymmetric not fully optimised GTO thyristor of WESTCODE and an optimised device of GEC PLESSEY Semiconductor (GPS), GB. The GPS FHCT, which gave the best results, is a non irradiated device of 64 mm diameter with a hold-off voltage of 4.5 kV like the symmetric FHCT. Tests results of the GPS FHCT show a reduction in turn-on delay of 40 % and in switching losses of almost 50 % with respect to the symmetric FHCT of WESTCODE. The GPS device can sustain an i...

  9. Energy-Based Analysis of Ultrasonically Assisted Turning

    G.A. Volkov

    2011-01-01

    Full Text Available The process of ultrasonically-assisted turning (UAT is a superposition of vibration of a cutting tool on its standard movement in conventional turning (CT. The former technique has several advantages compared with the latter, one of the main being a significant decrease in the level of cutting forces. In this paper the effects observed in UAT are analysed employing ideas of dynamic fracture mechanics. The active stage of loading duration depends heavily on ultrasonic frequency and the cutting speed; he application of the fracture criterion based on the notion of incubation time makes it possible to calculate a dependence of this duration on its threshold amplitude. An estimation of energy, necessary to create a threshold pulse in the material, is made by solving the contact Hertz problem. The obtained time dependence of energy has a marked minimum. Thus, the existence of energy-efficient loading duration is demonstrated. This explains the decrease in the cutting force resulting from superimposed ultrasonic vibration. The obtained results are in agreement with experiments on ultrasonic assisted machining of aluminium and Inconel 718 alloy.

  10. Ductile-regime turning of germanium and silicon

    Blake, Peter N.; Scattergood, Ronald O.

    1989-01-01

    Single-point diamond turning of silicon and germanium was investigated in order to clarify the role of cutting depth in coaxing a ductile chip formation in normally brittle substances. Experiments based on the rapid withdrawal of the tool from the workpiece have shown that microfracture damage is a function of the effective depth of cut (as opposed to the nominal cutting depth). In essence, damage created by the leading edge of the tool is removed several revolutions later by lower sections of the tool edge, where the effective cutting depth is less. It appears that a truly ductile cutting response can be achieved only when the effective cutting depth, or critical chip thickness, is less than about 20 nm. Factors such as tool rake angle are significant in that they will affect the actual value of the critical chip thickness for transition from brittle to ductile response. It is concluded that the critical chip thickness is an excellent parameter for measuring the effects of machining conditions on the ductility of the cut and for designing tool-workpiece geometry in both turning and grinding.

  11. Development of a Low Cost MQL Setup for Turning Operations

    Islam Sumaiya

    2017-01-01

    Full Text Available In this study, the effect of MQL application on the tool wear, surface roughness and chip formation in turning Aluminum alloy 6061 is investigated. Experiments were carried out by plain turning of an Aluminum bar with varying depth of cut, cutting speeds (spindle speed and cutting environments (Dry, Wet and MQL. A newly designed, cost efficient and portable MQL setup was developed for this study. For each experimental trial, five passes were carried out in order to promote the formation of tool wear. After each pass, the tool surface was examined under a microscope and the surface roughness was measured using a stylus based surface tester. The extent of tool wear from each pass is measured by using ImageJ software. Chips were collected after the five passes and were physically examined. The newly designed MQL delivery system was successful in delivering a fine mist of lubricant at the cutting point. MQL lubrication provided lower surface roughness and tool wear values compared to wet and dry conditions due to effective temperature reduction and improved lubrication penetration of cutting zones, as well as better chip flushing. Chip formed under MQL conditions had reduced chip thickness due to reduced temperatures. MQL was found to have the greatest positive impact on tool wear and surface roughness parameters based on ANOVA results.

  12. NetTurnP – Neural Network Prediction of Beta-turns by Use of Evolutionary Information and Predicted Protein Sequence Features

    Petersen, Bent; Lundegaard, Claus; Petersen, Thomas Nordahl

    2010-01-01

    is the highest reported performance on a two-class prediction of β-turn and not-β-turn. Furthermore NetTurnP shows improved performance on some of the specific β-turn types. In the present work, neural network methods have been trained to predict β-turn or not and individual β-turn types from the primary amino......β-turns are the most common type of non-repetitive structures, and constitute on average 25% of the amino acids in proteins. The formation of β-turns plays an important role in protein folding, protein stability and molecular recognition processes. In this work we present the neural network method...... NetTurnP, for prediction of two-class β-turns and prediction of the individual β-turn types, by use of evolutionary information and predicted protein sequence features. It has been evaluated against a commonly used dataset BT426, and achieves a Matthews correlation coefficient of 0.50, which...

  13. NetTurnP--neural network prediction of beta-turns by use of evolutionary information and predicted protein sequence features.

    Bent Petersen

    Full Text Available UNLABELLED: β-turns are the most common type of non-repetitive structures, and constitute on average 25% of the amino acids in proteins. The formation of β-turns plays an important role in protein folding, protein stability and molecular recognition processes. In this work we present the neural network method NetTurnP, for prediction of two-class β-turns and prediction of the individual β-turn types, by use of evolutionary information and predicted protein sequence features. It has been evaluated against a commonly used dataset BT426, and achieves a Matthews correlation coefficient of 0.50, which is the highest reported performance on a two-class prediction of β-turn and not-β-turn. Furthermore NetTurnP shows improved performance on some of the specific β-turn types. In the present work, neural network methods have been trained to predict β-turn or not and individual β-turn types from the primary amino acid sequence. The individual β-turn types I, I', II, II', VIII, VIa1, VIa2, VIba and IV have been predicted based on classifications by PROMOTIF, and the two-class prediction of β-turn or not is a superset comprised of all β-turn types. The performance is evaluated using a golden set of non-homologous sequences known as BT426. Our two-class prediction method achieves a performance of: MCC=0.50, Qtotal=82.1%, sensitivity=75.6%, PPV=68.8% and AUC=0.864. We have compared our performance to eleven other prediction methods that obtain Matthews correlation coefficients in the range of 0.17-0.47. For the type specific β-turn predictions, only type I and II can be predicted with reasonable Matthews correlation coefficients, where we obtain performance values of 0.36 and 0.31, respectively. CONCLUSION: The NetTurnP method has been implemented as a webserver, which is freely available at http://www.cbs.dtu.dk/services/NetTurnP/. NetTurnP is the only available webserver that allows submission of multiple sequences.

  14. NetTurnP – Neural Network Prediction of Beta-turns by Use of Evolutionary Information and Predicted Protein Sequence Features

    Petersen, Bent; Lundegaard, Claus; Petersen, Thomas Nordahl

    2010-01-01

    β-turns are the most common type of non-repetitive structures, and constitute on average 25% of the amino acids in proteins. The formation of β-turns plays an important role in protein folding, protein stability and molecular recognition processes. In this work we present the neural network method NetTurnP, for prediction of two-class β-turns and prediction of the individual β-turn types, by use of evolutionary information and predicted protein sequence features. It has been evaluated against a commonly used dataset BT426, and achieves a Matthews correlation coefficient of 0.50, which is the highest reported performance on a two-class prediction of β-turn and not-β-turn. Furthermore NetTurnP shows improved performance on some of the specific β-turn types. In the present work, neural network methods have been trained to predict β-turn or not and individual β-turn types from the primary amino acid sequence. The individual β-turn types I, I', II, II', VIII, VIa1, VIa2, VIba and IV have been predicted based on classifications by PROMOTIF, and the two-class prediction of β-turn or not is a superset comprised of all β-turn types. The performance is evaluated using a golden set of non-homologous sequences known as BT426. Our two-class prediction method achieves a performance of: MCC  = 0.50, Qtotal = 82.1%, sensitivity  = 75.6%, PPV  = 68.8% and AUC  = 0.864. We have compared our performance to eleven other prediction methods that obtain Matthews correlation coefficients in the range of 0.17 – 0.47. For the type specific β-turn predictions, only type I and II can be predicted with reasonable Matthews correlation coefficients, where we obtain performance values of 0.36 and 0.31, respectively. Conclusion The NetTurnP method has been implemented as a webserver, which is freely available at http://www.cbs.dtu.dk/services/NetTurnP/. NetTurnP is the only available webserver that allows submission of multiple sequences. PMID:21152409

  15. NetTurnP--neural network prediction of beta-turns by use of evolutionary information and predicted protein sequence features.

    Petersen, Bent; Lundegaard, Claus; Petersen, Thomas Nordahl

    2010-11-30

    β-turns are the most common type of non-repetitive structures, and constitute on average 25% of the amino acids in proteins. The formation of β-turns plays an important role in protein folding, protein stability and molecular recognition processes. In this work we present the neural network method NetTurnP, for prediction of two-class β-turns and prediction of the individual β-turn types, by use of evolutionary information and predicted protein sequence features. It has been evaluated against a commonly used dataset BT426, and achieves a Matthews correlation coefficient of 0.50, which is the highest reported performance on a two-class prediction of β-turn and not-β-turn. Furthermore NetTurnP shows improved performance on some of the specific β-turn types. In the present work, neural network methods have been trained to predict β-turn or not and individual β-turn types from the primary amino acid sequence. The individual β-turn types I, I', II, II', VIII, VIa1, VIa2, VIba and IV have been predicted based on classifications by PROMOTIF, and the two-class prediction of β-turn or not is a superset comprised of all β-turn types. The performance is evaluated using a golden set of non-homologous sequences known as BT426. Our two-class prediction method achieves a performance of: MCC=0.50, Qtotal=82.1%, sensitivity=75.6%, PPV=68.8% and AUC=0.864. We have compared our performance to eleven other prediction methods that obtain Matthews correlation coefficients in the range of 0.17-0.47. For the type specific β-turn predictions, only type I and II can be predicted with reasonable Matthews correlation coefficients, where we obtain performance values of 0.36 and 0.31, respectively. The NetTurnP method has been implemented as a webserver, which is freely available at http://www.cbs.dtu.dk/services/NetTurnP/. NetTurnP is the only available webserver that allows submission of multiple sequences.

  16. The Digital Turn in the French Audiovisual Model

    Olivier Alexandre

    2016-07-01

    Full Text Available This article deals with the digital turn in the French audiovisual model. An organizational and legal system has evolved with changing technology and economic forces over the past thirty years. The high-income television industry served as the key element during the 1980s to compensate for a shifting value economy from movie theaters to domestic screens and personal devices. However, the growing competition in the TV sector and the rise of tech companies have initiated a disruption process. A challenged French conception copyright, the weakened position of TV channels and the scaling of content market all now call into question the sustainability of the French model in a digital era.

  17. Mapping the Glocal Turn: Literature Streams, Scholarship Clusters and Debates

    Victor Roudometof

    2015-12-01

    Full Text Available Based on a bibliographical survey, this article presents evidence of a silent glocal turn in 21st century academia. Several terms compete for describing the newfound situations of hybridity and fusion in the world, and glocalization is a new term that offers a high level of precision in comparison to other contenders. Three specific clusters of inter-disciplinary scholarship are identified as cutting edge areas of research: the study of consumer culture, the field of urban studies and the study of management and/or organizations. Within these areas, glocalization is employed in varied and often contested ways according to specific research agendas. Glocalization thus has become a contested term. The article identifies and describes three debates that involve contrasting appropriations of glocalization. First, there is a contrast between geographical and social interpretations of glocalization, which in turn are based on contrasting definitions of space (geographical versus social. Second, there is a debate over the extent to which glocalization is sufficiently incorporated into global studies, or whether glocal studies should be defined separately from global studies. Third, there is a contrast between homogenization versus hybridization advocates in cross-cultural management and the social sciences. Although often cast as a conflict between proponents of globalization versus proponents of glocalization, this particular debate might be transcended in favor of more inclusive perspectives that suggest a “both/end” solution over an “either/or” interpretation of the opposing views. Glocalization is a recent addition to the vocabulary of 21st century humanities and social sciences. Its employment is also part of a broader wave of interest in the glocal that is not contained within these fields but, rather, extends further into information-communication technology (ICT, medicine and environmental science. To mention one such example, it is not

  18. A Biologically Derived Pectoral Fin for Yaw Turn Manoeuvres

    Jonah R. Gottlieb

    2010-01-01

    Full Text Available A bio-robotic fin has been developed that models the pectoral fin of the bluegill sunfish as the fish turned to avoid an obstacle. This work involved biological studies of the sunfish fin, the development of kinematic models of the motions of the fin's rays, CFD based predictions of the 3D forces and flows created by the fin, and the implementation of simplified models of the fin's kinematics and mechanical properties in a physical model. The resulting robotic fin produced the forces and flows that drove the manoeuvre and had a sufficiently high number of degrees of freedom to create a variety of non-biologically derived motions. The results indicate that for robotic fins to produce a level of performance on par with biological fins, both the kinematics and the mechanical properties of the biological fin must be modelled well.

  19. On the relaxation of magnetospheric convection when Bz turns northward

    M. C. Kelley

    2012-06-01

    Full Text Available The solar wind inputs considerable energy into the upper atmosphere, particularly when the interplanetary magnetic field (IMF is southward. According to Poynting's theorem (Kelley, 2009, this energy becomes stored as magnetic fields and then is dissipated by Joule heat and by energizing the plasmasheet plasma. If the IMF turns suddenly northward, very little energy is transferred into the system while Joule dissipation continues. In this process, the polar cap potential (PCP decreases. Experimentally, it was shown many years ago that the energy stored in the magnetosphere begins to decay with a time constant of two hours. Here we use Poynting's theorem to calculate this time constant and find a result that is consistent with the data.

  20. What turns assistive into restorative brain-machine interfaces?

    Alireza Gharabaghi

    2016-10-01

    Full Text Available Brain-machine interfaces (BMI may support motor impaired patients during activities of daily living by controlling external devices such as prostheses (assistive BMI. Moreover, BMIs are applied in conjunction with robotic orthoses for rehabilitation of lost motor function via neurofeedback training (restorative BMI. Using assistive BMI in a rehabilitation context does not automatically turn them into restorative devices. This perspective article suggests key features of restorative BMI and provides the supporting evidence:In summary, BMI may be referred to as restorative tools when demonstrating subsequently (i operant learning and progressive evolution of specific brain states/dynamics, (ii correlated modulations of functional networks related to the therapeutic goal, (iii subsequent improvement in a specific task, and (iv an explicit correlation between the modulated brain dynamics and the achieved behavioral gains. Such findings would provide the rationale for translating BMI-based interventions into clinical settings for reinforcement learning and motor rehabilitation following stroke.

  1. Mobility Turn in Contemporary Society as an Educational Challenge

    Denys Svyrydenko

    2016-07-01

    Full Text Available The main idea of the research is to uncover the series of challenges produced by the social dynamics with one’s mobile nature. Using methodological potential of social philosophy author attempts to demonstrate the essence and logics of mobility turn as a metaphor of contemporary society development. Author shows the radical changes at social-cultural dynamics which are also concieved by the modern social sciences (sociology of mobilities, series of postmodern concepts such as nomad etc. Using methodological approaches of philosophy of education author formulates “order of the day” of the mobility challenges at higher education sphere. Author shows that educational sphere also becomes mobile transforming the character of one’s vital activity, but also actualizing some special phenomena such as academic mobility. Formulating “order of the day” of mobility challenges to modern higher education, author demonstrates the horizon of future researches due to complex nature of researched problem

  2. Two Shared Rapid Turn Taking Sound Interfaces for Novices

    Hansen, Anne-Marie; Andersen, Hans Jørgen; Raudaskoski, Pirkko Liisa

    2012-01-01

    in an interleaved fashion: Systems A and B used a fuzzy logic algorithm and pattern recognition to respond with modifications of a background rhythms. In an experiment with a pen tablet interface as the music instrument, users aged 10-13 were to tap tones and continue each other’s melody. The sound systems rewarded......This paper presents the results of user interaction with two explorative music environments (sound system A and B) that were inspired from the Banda Linda music tradition in two different ways. The sound systems adapted to how a team of two players improvised and made a melody together...... users sonically, if they managed to add tones to their mutual melody in a rapid turn taking manner with rhythmical patterns. Videos of experiment sessions show that user teams contributed to a melody in ways that resemble conversation. Interaction data show that each sound system made player teams play...

  3. STABILITY ANALYSIS OF RADIAL TURNING PROCESS FOR SUPERALLOYS

    Alberto JIMÉNEZ

    2017-07-01

    Full Text Available Stability detection in machining processes is an essential component for the design of efficient machining processes. Automatic methods are able to determine when instability is happening and prevent possible machine failures. In this work a variety of methods are proposed for detecting stability anomalies based on the measured forces in the radial turning process of superalloys. Two different methods are proposed to determine instabilities. Each one is tested on real data obtained in the machining of Waspalloy, Haynes 282 and Inconel 718. Experimental data, in both Conventional and High Pressure Coolant (HPC environments, are set in four different states depending on materials grain size and Hard-ness (LGA, LGS, SGA and SGS. Results reveal that PCA method is useful for visualization of the process and detection of anomalies in online processes.

  4. O turning point da grande reportagem multimídia

    Longhi, Raquel Ritter; Universidade Federal de Santa Catarina / Campus Reitor João David Ferreira Lima. Florianópolis, Santa Catarina. Brasil. CEP: 88049-900 Tel: (48) 3721.9000

    2015-01-01

    Este artigo analisa o estado da arte da grande reportagem multimídia no jornalismo online, atentando para um momento que se pode definir como “turning point”, ou ponto de virada desse tipo de formato noticioso. A partir de uma sistematização da evolução dos formatos expressivos multimidiáticos da notícia no jornalismo digital, o artigo identifica três momentos principais dessa trajetória: o slide-show noticioso, no início dos anos 2000; os especiais multimídia, de meados de 2000 a 2011 e a gr...

  5. The Turn to Precarity in Twenty-First Century Fiction

    Morrison Jago

    2014-01-01

    Full Text Available Recent years have seen several attempts by writers and critics to understand the changed sensibility in post-9/11 fiction through a variety of new -isms. This essay explores this cultural shift in a different way, finding a ‘turn to precarity’ in twenty-first century fiction characterised by a renewal of interest in the flow and foreclosure of affect, the resurgence of questions about vulnerability and our relationships to the other, and a heightened awareness of the social dynamics of seeing. The essay draws these tendencies together via the work of Judith Butler in Frames of War, in an analysis of Trezza Azzopardi’s quasi-biographical study of precarious life, Remember Me.

  6. EXPERIMENTAL VALIDATION OF CUMULATIVE SURFACE LOCATION ERROR FOR TURNING PROCESSES

    Adam K. Kiss

    2016-02-01

    Full Text Available The aim of this study is to create a mechanical model which is suitable to investigate the surface quality in turning processes, based on the Cumulative Surface Location Error (CSLE, which describes the series of the consecutive Surface Location Errors (SLE in roughing operations. In the established model, the investigated CSLE depends on the currently and the previously resulted SLE by means of the variation of the width of cut. The phenomenon of the system can be described as an implicit discrete map. The stationary Surface Location Error and its bifurcations were analysed and flip-type bifurcation was observed for CSLE. Experimental verification of the theoretical results was carried out.

  7. Forecasting Macedonian Business Cycle Turning Points Using Qual Var Model

    Petrovska Magdalena

    2016-09-01

    Full Text Available This paper aims at assessing the usefulness of leading indicators in business cycle research and forecast. Initially we test the predictive power of the economic sentiment indicator (ESI within a static probit model as a leading indicator, commonly perceived to be able to provide a reliable summary of the current economic conditions. We further proceed analyzing how well an extended set of indicators performs in forecasting turning points of the Macedonian business cycle by employing the Qual VAR approach of Dueker (2005. In continuation, we evaluate the quality of the selected indicators in pseudo-out-of-sample context. The results show that the use of survey-based indicators as a complement to macroeconomic data work satisfactory well in capturing the business cycle developments in Macedonia.

  8. Turning the Ship: The Transformation of DESY, 1993-2009

    Heinze, Thomas; Hallonsten, Olof; Heinecke, Steffi

    2017-12-01

    This article chronicles the most recent history of the Deutsches Elektronen-Synchrotron (DESY) located in Hamburg, Germany, with particular emphasis on how this national laboratory founded for accelerator-based particle physics shifted its research program toward multi-disciplinary photon science. Synchrotron radiation became DESY's central experimental research program through a series of changes in its organizational, scientific, and infrastructural setup and the science policy context. Furthermore, the turn toward photon science is part of a broader transformation in the late twentieth century in which nuclear and particle physics, once the dominating fields in national and international science budgets, gave way to increasing investment in the materials sciences and life sciences. Synchrotron radiation research took a lead position on the experimental side of these growing fields and became a new form of big science, generously funded by governments and with user communities expanding across both academia and industry.

  9. Hole Feature on Conical Face Recognition for Turning Part Model

    Zubair, A. F.; Abu Mansor, M. S.

    2018-03-01

    Computer Aided Process Planning (CAPP) is the bridge between CAD and CAM and pre-processing of the CAD data in the CAPP system is essential. For CNC turning part, conical faces of part model is inevitable to be recognised beside cylindrical and planar faces. As the sinus cosines of the cone radius structure differ according to different models, face identification in automatic feature recognition of the part model need special intention. This paper intends to focus hole on feature on conical faces that can be detected by CAD solid modeller ACIS via. SAT file. Detection algorithm of face topology were generated and compared. The study shows different faces setup for similar conical part models with different hole type features. Three types of holes were compared and different between merge faces and unmerge faces were studied.

  10. Reducing surface roughness by optimising the turning parameters

    Senthil Kumar, K.

    2013-08-01

    Full Text Available Modern manufacturers worldwide look for the cheapest quality-manufactured machined components to compete in the market. Good surface quality is desired for the proper functioning of the parts produced. The surface quality is influenced by the cutting speed, feed rate, depth of cut, and many other parameters. In this paper, the Taguchi method a powerful tool to design optimisation for quality is used to find the optimal machining parameters for the turning operation. An orthogonal array, the signal-to-noise (S/N ratio, and the analysis of variance (ANOVA are employed to investigate the machining characteristics of super duplex stainless steel bars using uncoated carbide cutting tools. The effect of machining parameters on surface roughness was discovered. Confirmation tests were conducted at optimal conditions to compare the experimental results with the predicted values.

  11. Turning the tide of public opinion on nuclear power

    Cohen, B.L.

    1997-01-01

    Until the early 1970s, the tide of public opinion in the United States was strongly in favor of nuclear power. New power plants were coming on line frequently, and in 1973-74, there were close to 40 new orders per year for new reactors in the United States. Official government projections estimated 1000 operating reactors by the year 2000. Fuel reprocessing, plutonium recycle, and breeder reactor development were also proceeding smoothly and rapidly. But, in the mid-1970s, the tide suddenly turned against the nuclear industry. How did this come about? In the late 1960s, energetic and idealistic young people who had never experienced economic insecurity or World Wars came of age. Environmentalism was an attractive outlet for their activity in most of the Western world. In the United States, opposition to the Vietnam War, in which these young people had a personal stake, was even more popular at first, but by the early 1970s, Vietnam was winding down, and they turned also to Environmentalism. Numerous environmental groups started up, aided heavily by the favorable connotation of the very word open-quotes environmentalistclose quotes in the public mind. Their organizational experience, political savvy, and media connections gained from their antiwar protests were powerful assets. But the groups needed specific targets to attack, and they soon found that nuclear power was well-suited for that purpose. Here was a new technology, coming on at a very rapid pace. To the public, radiation was highly mysterious, and people were well aware that it could be dangerous. And, the word danger had taken on a new meaning. Previous generations were well acquainted with death and were much less averse to risk-taking than the generation of the 1970s

  12. Turned versus anodised dental implants: a meta-analysis.

    Chrcanovic, B R; Albrektsson, T; Wennerberg, A

    2016-09-01

    The aim of this meta-analysis was to test the null hypothesis of no difference in the implant failure rates, marginal bone loss (MBL)and post-operative infection for patients being rehabilitated by turned versus anodised-surface implants, against the alternative hypothesis of a difference. An electronic search without time or language restrictions was undertaken in November 2015. Eligibility criteria included clinical human studies, either randomised or not. Thirty-eight publications were included. The results suggest a risk ratio of 2·82 (95% CI 1·95-4·06, P implants, when compared to anodised-surface implants. Sensitivity analyses showed similar results when only the studies inserting implants in maxillae or mandibles were pooled. There were no statistically significant effects of turned implants on the MBL (mean difference-MD 0·02, 95%CI -0·16-0·20; P = 0·82) in comparison to anodised implants. The results of a meta-regression considering the follow-up period as a covariate suggested an increase of the MD with the increase in the follow-up time (MD increase 0·012 mm year(-1) ), however, without a statistical significance (P = 0·813). Due to lack of satisfactory information, meta-analysis for the outcome 'post-operative infection' was not performed. The results have to be interpreted with caution due to the presence of several confounding factors in the included studies. © 2016 John Wiley & Sons Ltd.

  13. Support vector machines for prediction and analysis of beta and gamma-turns in proteins.

    Pham, Tho Hoan; Satou, Kenji; Ho, Tu Bao

    2005-04-01

    Tight turns have long been recognized as one of the three important features of proteins, together with alpha-helix and beta-sheet. Tight turns play an important role in globular proteins from both the structural and functional points of view. More than 90% tight turns are beta-turns and most of the rest are gamma-turns. Analysis and prediction of beta-turns and gamma-turns is very useful for design of new molecules such as drugs, pesticides, and antigens. In this paper we investigated two aspects of applying support vector machine (SVM), a promising machine learning method for bioinformatics, to prediction and analysis of beta-turns and gamma-turns. First, we developed two SVM-based methods, called BTSVM and GTSVM, which predict beta-turns and gamma-turns in a protein from its sequence. When compared with other methods, BTSVM has a superior performance and GTSVM is competitive. Second, we used SVMs with a linear kernel to estimate the support of amino acids for the formation of beta-turns and gamma-turns depending on their position in a protein. Our analysis results are more comprehensive and easier to use than the previous results in designing turns in proteins.

  14. Pilot study: Assessing the effect of continual position monitoring technology on compliance with patient turning protocols

    Schutt, Suann Cirigliano; Tarver, Christine; Pezzani, Michelle

    2017-01-01

    Abstract Aim The study aim was to evaluate if continual patient position monitoring, taking into account self‐turns and clinician‐assisted turns, would increase the percentage of time a patient's position changed at least every 2 hr. Background While patient turning has clinical benefits, current models to help staff remember to turn patients, such as “turn clocks” and timers, have not resulted in high compliance with turning protocols. In addition, reminders are based on arbitrary 2‐hr windo...

  15. Structural and sequence features of two residue turns in beta-hairpins.

    Madan, Bharat; Seo, Sung Yong; Lee, Sun-Gu

    2014-09-01

    Beta-turns in beta-hairpins have been implicated as important sites in protein folding. In particular, two residue β-turns, the most abundant connecting elements in beta-hairpins, have been a major target for engineering protein stability and folding. In this study, we attempted to investigate and update the structural and sequence properties of two residue turns in beta-hairpins with a large data set. For this, 3977 beta-turns were extracted from 2394 nonhomologous protein chains and analyzed. First, the distribution, dihedral angles and twists of two residue turn types were determined, and compared with previous data. The trend of turn type occurrence and most structural features of the turn types were similar to previous results, but for the first time Type II turns in beta-hairpins were identified. Second, sequence motifs for the turn types were devised based on amino acid positional potentials of two-residue turns, and their distributions were examined. From this study, we could identify code-like sequence motifs for the two residue beta-turn types. Finally, structural and sequence properties of beta-strands in the beta-hairpins were analyzed, which revealed that the beta-strands showed no specific sequence and structural patterns for turn types. The analytical results in this study are expected to be a reference in the engineering or design of beta-hairpin turn structures and sequences. © 2014 Wiley Periodicals, Inc.

  16. Effects of dual task on turning ability in stroke survivors and older adults.

    Hollands, K L; Agnihotri, D; Tyson, S F

    2014-09-01

    Turning is an integral component of independent mobility in which stroke survivors frequently fall. This study sought to measure the effects of competing cognitive demands on the stepping patterns of stroke survivors, compared to healthy age-match adults, during turning as a putative mechanism for falls. Walking and turning (90°) was assessed under single (walking and turning alone) and dual task (subtracting serial 3s while walking and turning) conditions using an electronic, pressure-sensitive walkway. Dependent measures were time to turn, variability in time to turn, step length, step width and single support time during three steps of the turn. Turning ability in single and dual task conditions was compared between stroke survivors (n=17, mean ± SD: 59 ± 113 months post-stroke, 64 ± 10 years of age) and age-matched healthy counterparts (n=15). Both groups took longer, were more variable, tended to widen the second step and, crucially, increased single support time on the inside leg of the turn while turning and distracted. Increased single support time during turning may represent biomechanical mechanism, within stepping patterns of turning under distraction, for increased risk of falls for both stroke survivors and older adults. Crown Copyright © 2014. Published by Elsevier B.V. All rights reserved.

  17. Therapeutic efficacy of PD-L1 blockade in a breast cancer model is enhanced by cellular vaccines expressing B7-1 and glycolipid-anchored IL-12.

    Bozeman, Erica N; He, Sara; Shafizadeh, Yalda; Selvaraj, Periasamy

    2016-01-01

    Immunotherapeutic approaches have emerged as promising strategies to treat various cancers, including breast cancer. A single approach, however, is unlikely to effectively combat the complex, immune evasive strategies found within the tumor microenvironment, thus novel, effective combination treatments must be explored. In this study, we investigated the efficacy of a combination therapy consisting of PD-L1 immune checkpoint blockade and whole cell vaccination in a HER-2 positive mouse model of breast cancer. We demonstrate that tumorigenicity is completely abrogated when adjuvanted with immune stimulatory molecules (ISMs) B7-1 and a cell-surface anchored (GPI) form of IL-12 or GM-CSF. Irradiated cellular vaccines expressing the combination of adjuvants B7-1 and GPI-IL-12 completely inhibited tumor formation which was correlative with robust HER-2 specific CTL activity. However, in a therapeutic setting, both cellular vaccination and PD-L1 blockade induced only 10-20% tumor regression when administered alone but resulted in 50% tumor regression as a combination therapy. This protection was significantly hindered following CD4 or CD8 depletion indicating the essential role played by cellular immunity. Collectively, these pre-clinical studies provide a strong rationale for further investigation into the efficacy of combination therapy with tumor cell vaccines adjuvanted with membrane-anchored ISMs along with PD-L1 blockade for the treatment of breast cancer.

  18. Turning the corner : taking action to fight climate change

    2008-03-01

    Climate change is an international problem that necessitates global solutions. Previous governments in Canada had established ambitious goals for reducing greenhouse gases, yet emissions continued to increase. Canada's greenhouse gas emissions are significantly higher than they were in 1990, and also significantly above its Kyoto target. The Canadian government is committed to stopping the increase of Canada's greenhouse gas emissions and drastically reducing them through a high-level framework entitled 'Turning the Corner: action plan for reducing emissions'. This brochure outlined the Canadian government's action plan to ensure Canada is on a responsible path to reduce greenhouse gas emissions and to address the global threat of climate change. The brochure discussed how Canada is getting tough on industry's emissions and discussed regulations that will apply to 16 sectors. Actions to lower emissions from vehicles and buildings were also presented, including mandatory renewable fuel content in gasoline, diesel and heating oil; tough new fuel consumption standards for cars, light trucks, and sport utility vehicles; and implementing new national performance standards that will ban inefficient incandescent lightbulbs. 3 figs

  19. [Adult health problems and coping at life turning points].

    Lee, Sheuan; Lu, Ying-Chi; Yen, Wen-Jiuan; Lin, Shu-Chin

    2004-02-01

    At important life turning points, middle-aged adults face many physiological changes (e.g., aging, changes in hormone levels) and alterations in family structure (e.g., children growing up and leaving home). In addition to facing these changes and their impacts, adults must also take on challenges in terms of self-concept, body image, life goals, and life meaning. Illnesses that commonly occur during this life stage include menopausal depression, substance abuse, and anxiety. Traditional treatment models are medical-oriented, but curative effects are limited and hospital visits still occur at high frequencies, resulting in increased medical expenses and disruptions in family life. The authors review the current literature on curative models in this area, and discuss the potential of a combination of physical therapy, cognitive, and existential-humanistic therapy to improve patients' physical strength, self-concept, self-esteem, and self-confidence in an effort to overcome physio-psycho-social disorders and to increase vitality.

  20. Turning goals into results: the power of catalytic mechanisms.

    Collins, J

    1999-01-01

    Most executives have a big, hairy, audacious goal. They write vision statements, formalize procedures, and develop complicated incentive programs--all in pursuit of that goal. In other words, with the best of intentions, they install layers of stultifying bureaucracy. But it doesn't have to be that way. In this article, Jim Collins introduces the catalytic mechanism, a simple yet powerful managerial tool that helps translate lofty aspirations into concrete reality. Catalytic mechanisms are the crucial link between objectives and performance; they are a galvanizing, nonbureaucratic means to turn one into the other. What's the difference between catalytic mechanisms and most traditional managerial controls? Catalytic mechanisms share five characteristics. First, they produce desired results in unpredictable ways. Second, they distribute power for the benefit of the overall system, often to the discomfort of those who traditionally hold power. Third, catalytic mechanisms have teeth. Fourth, they eject "viruses"--those people who don't share the company's core values. Finally, they produce an ongoing effect. Catalytic mechanisms are just as effective for reaching individual goals as they are for corporate ones. To illustrate how catalytic mechanisms work, the author draws on examples of individuals and organizations that have relied on such mechanisms to achieve their goals. The same catalytic mechanism that works in one organization, however, will not necessarily work in another. Catalytic mechanisms must be tailored to specific goals and situations. To help readers get started, the author offers some general principles that support the process of building catalytic mechanisms effectively.

  1. 3D FEM Simulation of Flank Wear in Turning

    Attanasio, Aldo; Ceretti, Elisabetta; Giardini, Claudio

    2011-05-01

    This work deals with tool wear simulation. Studying the influence of tool wear on tool life, tool substitution policy and influence on final part quality, surface integrity, cutting forces and power consumption it is important to reduce the global process costs. Adhesion, abrasion, erosion, diffusion, corrosion and fracture are some of the phenomena responsible of the tool wear depending on the selected cutting parameters: cutting velocity, feed rate, depth of cut, …. In some cases these wear mechanisms are described by analytical models as a function of process variables (temperature, pressure and sliding velocity along the cutting surface). These analytical models are suitable to be implemented in FEM codes and they can be utilized to simulate the tool wear. In the present paper a commercial 3D FEM software has been customized to simulate the tool wear during turning operations when cutting AISI 1045 carbon steel with uncoated tungsten carbide tip. The FEM software was improved by means of a suitable subroutine able to modify the tool geometry on the basis of the estimated tool wear as the simulation goes on. Since for the considered couple of tool-workpiece material the main phenomena generating wear are the abrasive and the diffusive ones, the tool wear model implemented into the subroutine was obtained as combination between the Usui's and the Takeyama and Murata's models. A comparison between experimental and simulated flank tool wear curves is reported demonstrating that it is possible to simulate the tool wear development.

  2. Swine manure composting by means of experimental turning equipment.

    Chiumenti, A; Da Borso, F; Rodar, T; Chiumenti, R

    2007-01-01

    The purpose of research was to test the effectiveness of a prototype of a turning machine and to evaluate the feasability of a farm-scale composting process of the solid fraction of swine manure. A qualitative evaluation of the process and final product was made by monitoring the following parameters: process temperature, oxygen concentration inside the biomass, gaseous emissions (CH4, CO2, NH3, N2O), respiration index, humification index, total and volatile solids, carbon and nitrogen, pH and microbial load. The prototype proved to be very effective from a technical-operational point of view. The composting process exhibited a typical time-history, characterised by a thermophilic phase followed by a curing phase [Chiumenti, A., Chiumenti, R., Diaz, L.F., Savage, G.M., Eggerth, L.L., Goldstein, N., 2005. Modern Composting Technologies. BioCycle-JG Press, Emmaus, PA, USA]. Gas emissions from compost the windrow were more intense during the active phase of the process and showed a decreasing trend from the thermophilic to the curing phase. The final compost was characterized by good qualitative characteristics, a significant level of humification [Rossi, L., Piccinini, S., 1999. La qualità agronomica dei compost derivanti da liquami suinicoli. (Agronomic quality of swine manure compost). L'informatore Agrario 38, 29-31] and no odor emissions. This method of managing manure represents an effective, low cost approach that could be an interesting opportunity for swine farms.

  3. Q methodology for post-social-turn research in SLA

    Kay Irie

    2014-01-01

    Full Text Available Q methodology, an approach to inquiry on the subjective views about a complex phenomenon/issue which has been increasingly employed in a wide range of social science fields has not yet been applied in language learning and teaching research. It is a unique approach that has characteristics of both qualitative and quantitative research methods. The purpose of the present paper is to introduce Q methodology as an alternative approach and demonstrate its potential to respond to the needs of the field that has been expanding in its epistemological diversity since the social turn (Block, 2003; Ortega, 2012. The relevance of the methodology for SLA research will be discussed with a particular focus on the parallels between the development of the methodology in the 1930s and current criticisms towards the traditional cognitive approach in SLA. Using a published study (Irie & Ryan, 2014, the author explains how the focus on the holistic understanding of subjectivity is built into the procedure. Suggestions for possible areas of research and teaching in which Q methodology could be applied are discussed.

  4. Optimization of turning process through the analytic flank wear modelling

    Del Prete, A.; Franchi, R.; De Lorenzis, D.

    2018-05-01

    In the present work, the approach used for the optimization of the process capabilities for Oil&Gas components machining will be described. These components are machined by turning of stainless steel castings workpieces. For this purpose, a proper Design Of Experiments (DOE) plan has been designed and executed: as output of the experimentation, data about tool wear have been collected. The DOE has been designed starting from the cutting speed and feed values recommended by the tools manufacturer; the depth of cut parameter has been maintained as a constant. Wear data has been obtained by means the observation of the tool flank wear under an optical microscope: the data acquisition has been carried out at regular intervals of working times. Through a statistical data and regression analysis, analytical models of the flank wear and the tool life have been obtained. The optimization approach used is a multi-objective optimization, which minimizes the production time and the number of cutting tools used, under the constraint on a defined flank wear level. The technique used to solve the optimization problem is a Multi Objective Particle Swarm Optimization (MOPS). The optimization results, validated by the execution of a further experimental campaign, highlighted the reliability of the work and confirmed the usability of the optimized process parameters and the potential benefit for the company.

  5. Turning Perspective in Photoelectrocatalytic Cells for Solar Fuels.

    Perathoner, Siglinda; Centi, Gabriele; Su, Dangsheng

    2016-02-19

    The development of new devices for the use and storage of solar energy is a key step to enable a new sustainable energy scenario. The route for direct solar-to-chemical energy transformation, especially to produce liquid fuels, represents a necessary element to realize transition from the actual energy infrastructure. Photoelectrocatalytic (PECa) devices for the production of solar fuels are a key element to enable this sustainable scenario. The development of PECa devices and related materials is of increasing scientific and applied interest. This concept paper introduces the need to turn the viewpoint of research in terms of PECa cell design and related materials with respect to mainstream activities in the field of artificial photosynthesis and leaves. As an example of a new possible direction, the concept of electrolyte-less cell design for PECa cells to produce solar fuels by reduction of CO2 is presented. The fundamental and applied development of new materials and electrodes for these cells should proceed fully integrated with PECa cell design and systematic analysis. A new possible approach to develop semiconductors with improved performances by using visible light is also shortly presented. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  6. The German energetic turning point: year n+2

    Cruciani, Michel

    2013-07-01

    This publication proposes an analysis of the evolution of the German energy sector, two years after the adoption of a new energy policy. It notably aims at identifying the consequences of this important turning point which was characterised by the decision to phase out nuclear while keeping on reducing energy consumption and greenhouse gas emissions, and developing renewable energies. In a first part, the author comments the objectives associated with the present evolution in terms of reducing the primary energy consumption, reducing raw electric power consumption, energy consumption in transports, CO_2 emissions, of increasing the share of renewable energies and power production from renewable sources, and of complying with European objectives. The second part discusses technical aspects of the development of power generation from renewable sources by addressing the following issues: prospective, grid extension and strengthening, intermittency management, industrial orientation. The third part addresses economic aspects of this development: promotion of electricity production from renewable sources, relationship between power generation from renewable sources and electricity price, public debate on electricity price, employment and economic benefits, financing the energy transition, and the European dimension. In conclusion, the author discusses whether the German energy shift is a model or a counter-example

  7. AE Monitoring of Diamond Turned Rapidly Soldified Aluminium 443

    Onwuka, G; Abou-El-Hossein, K; Mkoko, Z

    2017-01-01

    The fast replacement of conventional aluminium with rapidly solidified aluminium alloys has become a noticeable trend in the current manufacturing industries involved in the production of optics and optical molding inserts. This is as a result of the improved performance and durability of rapidly solidified aluminium alloys when compared to conventional aluminium. Melt spinning process is vital for manufacturing rapidly solidified aluminium alloys like RSA 905, RSA 6061 and RSA 443 which are common in the industries today. RSA 443 is a newly developed alloy with few research findings and huge research potential. There is no available literature focused on monitoring the machining of RSA 443 alloys. In this research, Acoustic Emission sensing technique was applied to monitor the single point diamond turning of RSA 443 on an ultrahigh precision lathe machine. The machining process was carried out after careful selection of feed, speed and depths of cut. The monitoring process was achieved with a high sampling data acquisition system using different tools while concurrent measurement of the surface roughness and tool wear were initiated after covering a total feed distance of 13km. An increasing trend of raw AE spikes and peak to peak signal were observed with an increase in the surface roughness and tool wear values. Hence, acoustic emission sensing technique proves to be an effective monitoring method for the machining of RSA 443 alloy. (paper)

  8. Effects of turning and through lane sharing on traffic performance at intersections

    Li, Xiang; Sun, Jian-Qiao

    2016-02-01

    Turning vehicles strongly influence traffic flows at intersections. Effective regulation of turning vehicles is important to achieve better traffic performance. This paper studies the impact of lane sharing and turning signals on traffic performance at intersections by using cellular automata. Both right-turn and left-turn lane sharing are studied. Interactions between vehicles and pedestrians are considered. The transportation efficiency, road safety and energy economy are the traffic performance metrics. Extensive simulations are carried out to study the traffic performance indices. It is observed that shared turning lanes and permissive left-turn signal improve the transportation efficiency and reduce the fuel consumption in most cases, but the safety is usually sacrificed. It is not always beneficial for the through vehicles when they are allowed to be in the turning lanes.

  9. Right-­turn traffic volume adjustment in traffic signal warrant analysis : final report.

    2016-05-06

    This report was based on the research project, Right-Turn Traffic Volume Adjustment in Traffic Signal Warrants, sponsored by the Nevada Department of Transportation (NDOT) and SOLARIS. Right-turn traffic does not affect intersection performance in th...

  10. Turn-on delay of QD and QW laser diodes: What is the difference?

    Sokolovskii, G S; Dudelev, V V; Kolykhalova, E D; Deryagin, A G; Maximov, M V; Nadtochiy, A M; Kuchinskii, V I; Mikhrin, S S; Livshits, D A; Viktorov, E A; Erneux, T

    2013-01-01

    Turn-on delay of laser diodes with quantum-sized active media is investigated both theoretically and experimentally. In this research we show the striking difference in turn-on delay of quantum dot and quantum well laser diodes: With quantum-well lasers turn on delay tends to zero in the limit of high pumping, while with quantum dot lasers turn-on delay has the non-vanishing component which is independent of pumping

  11. Study on Turn-to-turn Short Circuit On一line Monitoring System for Dry一type Ai r一core Reactor

    GAO Zi-wei

    2017-04-01

    Full Text Available The change of current value caused by turn-to-turn short circuit of dry-type air-core reactor is so little that failure detection is difficult to be carried out. In order to solve this problem,a new on-line monitoring system based on impedance variation of turn-to-turn short circuit is proposed. The numerical method is applied to analyze the variation of equivalent resistance and equivalent reactance when dry-type air-core reactor winding short circuit happens in different places,and the monitoring method based on harmonic analysis method and quasi- synchronization sampling method is analyzed by theory. The hardware system,which takes single-chip microcomputer as the core of data processing and logic control,completes data acquisition of voltage signal and current signal of the reactor. In the respect of software design,the impedance variation will be uploaded to the PC after it has been calculated by using the above monitoring method,and then monitoring of turn-to-turn short circuit fault will be realized. Finally,the design of on-line monitoring system is studied by testing. The research result shows that,the equivalent resistance increases and the equivalent reactance decreases when turn-to-turn short circuit occurs,and the variation of equivalent resistance is more obvious than equivalent reactance. The experiment results prove that this monitoring method is true and the on-line monitoring system is feasible.

  12. What can be seen beyond the turning points?

    Morita, Koji

    1997-01-01

    LNG markets in Asia has faced turning points in 1990s. There is sluggish growth of Japanese demand, rapid demand growth of Korea and Taiwan, and increase of dependency on the Middle East. Will these situation continue after 2000? In Japan, energy demand will grow steadily, and development of nuclear power stations will not proceed without difficulty. Considering the emission of carbon dioxide, LNG demand will expand more than the Government outlook of 68 ∼ 60 mil. tons in 2010. IEEJ (Institute of Energy Economics Japan) forecasts that it will come to 58 mil. tons in 2010, including 1 ∼ 2 mil. tons of indigenous production. Korea secured two LNG projects newly, Ras Laffan (Qatar) and Oman. Considering the secured volume, LNG consumption will continue to expand even after 2000. But thinking of the lesser population of 21 mil. and warm climate of Taiwan, the extent of LNG demand expansion may not be so large. Big unknown factors exist in Asia: China and India. Their large population can give a great influence on LNG market in Asia. Several gas-fired power projects by IPP are already being planned. According to the Indian Government, as annual production capacity of natural gas is limited, more than 40 bil. m 3 must be fulfilled by import in 2005. Some indicators of China, GDP, energy consumption and so on, are saying that Shanghai and some cities may have already prepared conditions to introduce LNG. They may begin to utilize LNG by taking surplus of existing LNG projects in the later half of 2000s. (LN)

  13. Housing the "Other" Half: American Studies' Global Urban Turn

    David Faflik

    2010-03-01

    Full Text Available

    Over the course of its short lifetime, the discipline of American studies has utilized a series of self-defining metaphors. With each successive paradigm shift in the field, each of these disciplinary figures, in turn, has been found wanting, and so replaced. American studies’ current, if not consensual, metaphor—the “border”—resembles not a few of its predecessors in that it is spatial in nature and effectively doubles as a figuration of the greater nation. The premise of this paper is that the “border,” like the figures that came before it, has outlived its serviceable purpose for a discipline that continues to evolve.

    This essay proposes the global city, or, more accurately, the global slum, as a post-“border” metaphor peculiarly adapted to the principled transnationalism that now defines American studies for many subscribing students and professionals. On the one hand, the urban has become a prevailing demographic fact in this, the new century. Thus, the multiethnic, multinational world metropolis recommends itself as a more-than-metaphor for the dynamic cultural contact that typifies ascendant hemispheric conceptions of the Americas. On the other hand, the figure of the peripheral city similarly, and spatially, evokes the majority “center” and minority “margin” model of American studies that critics would claim inhibits total global integration among the discipline’s geoculturally diverse practitioners, many of whom reside outside the continental United States. This essay conceptually deploys the world city to explore beyond these professional/territorial “borders.” Its three condensed case studies—first, of Gilded Age Manhattan, second, of the modern Turkish metropolis, and third, of a reunified Germany’s ethnic ghetto—constitute a brisk figurative exercise in “marginal” urban migration, wherein resides an alternate model, and metaphor, of American studies praxis today.

  14. Project U-Turn: increasing active transportation in Jackson, Michigan.

    TenBrink, David S; McMunn, Randall; Panken, Sarah

    2009-12-01

    Jackson, Michigan, is a medium-sized city suffering from a bad economy and obesity-related health issues. Nearly 20% of the 36,000 residents live below the poverty line. It is a relatively young city (median age of 30 years) with a mixed ethnicity (20% black, 73% white, 4% Hispanic). The city offers many structured, active recreational opportunities, but has not integrated physical activity into daily life. Project U-Turn aimed to increase active transportation (e.g., biking, walking, and transit use) through an integrated approach to Active Living by Design's community action model and the Michigan Safe Routes to School model. Resources were focused on active living promotions and programs; partnership meetings were the source of changes in policy and physical projects. Each initiative was designed to introduce each of the 5Ps (preparation, promotion, programs, policy, and physical projects) to build support for the partnership's overall work. The partnership collected snapshot data of community walking and biking behavior, percentage of students walking to school, participation in events and programs, and new physical projects. Jackson saw a vast improvement in physical infrastructure and policy and a related increase in walking and biking in the community. The project engaged in purposeful partnership building to implement effective programs and promotions that built support for policy and physical projects. Limited resources were best used by encouraging partners to contribute and coordinate activities using existing staff, funding, and resources. Jackson has seen a shift toward awareness of the benefits of active living on community health, economic development, and environmental awareness.

  15. Experimental Investigation of White Layer formation in Hard Turning

    Umbrello, D.; Rotella, G.; Crea, F.

    2011-05-01

    Hard turning with super hard cutting tools, like PCBN or Ceramics inserts, represents an interesting advance in the manufacturing industry, regarding the finishing of hardened steels. This innovative machining technique is considered an attractive alternative to traditional finish grinding operations because of the high flexibility, the ability to achieve higher metal removal rates, the possibility to operate without the use of coolants, and the capability to achieve comparable workpiece quality. However, the surface integrity effects of hard machining need to be taken into account due to their influence on the life of machined components. In particular, the formation of a usually undesirable white layer at the surface needs further investigation. Three different mechanisms have been proposed as main responsible of the white layer genesis: (i) microstructural phase transformation due to a rapid heating and quenching, (ii) severe plastic deformation resulting in a homogenous structure and/or a very fine grain size microstructure; (iii) surface reaction with the environment. In this research, an experimental campaign was carried out and several experimental techniques were used in order to analyzed the machined surface and to understand which of the above mentioned theories is the main cause of the white layer formation when AISI 52100 hardened steel is machined by PCBN inserts. In particular, the topography characterization has obtained by means of optical and scanning electron microscope (SEM) while microstructural phase composition and chemical characterization have been respectively detected using X-ray Diffraction (XRD) and Energy-dispersive X-ray spectroscopy (EDS) techniques. The results prove that the white layer is the result of microstructural alteration, i.e. the generation of a martensitic structure.

  16. The Timed 180° Turn Test for Assessing People with Hemiplegia from Chronic Stroke

    Regan L. Robinson

    2018-01-01

    Full Text Available Background. Turning is ubiquitous in activities of daily living. For people with hemiplegia, persistent impairments in strength, balance, and coordination will affect their ability to turn safely. Consequently, turning retraining should be addressed in rehabilitation programs. To measure turning for these individuals, a reliable clinical tool is required. Objective. To investigate (i the intrarater, interrater, and test-retest reliability of the timed 180° turn test; (ii the correlation of the timed 180° turn test with other measures of stroke-specific impairments; and (iii the cut-off time that best discriminates individuals with hemiplegia from chronic stroke and healthy older adults. Methods. 33 individuals with hemiplegia due to chronic stroke and 32 healthy elderly individuals participated in this cross-sectional study. The timed 180° turn test was administered along with other measures of stroke-specific impairment. Results. The timed 180° turn test demonstrated excellent intrarater, interrater, and test-retest reliability in individuals with hemiplegia from chronic stroke. The timed 180° turn test (times significantly correlated with the Fugl-Meyer Assessment of the Lower Extremities (FMA-LE, affected ankle plantar flexion strength, the 5-Times-Sit-To-Stand test, the Berg Balance Scale (BBS, and the Timed Up and Go (TUG test. Conclusion. The timed 180° turn test is a reliable clinical tool to assess the turning ability of subjects with hemiplegia from chronic stroke.

  17. Using support vector machine to predict beta- and gamma-turns in proteins.

    Hu, Xiuzhen; Li, Qianzhong

    2008-09-01

    By using the composite vector with increment of diversity, position conservation scoring function, and predictive secondary structures to express the information of sequence, a support vector machine (SVM) algorithm for predicting beta- and gamma-turns in the proteins is proposed. The 426 and 320 nonhomologous protein chains described by Guruprasad and Rajkumar (Guruprasad and Rajkumar J. Biosci 2000, 25,143) are used for training and testing the predictive model of the beta- and gamma-turns, respectively. The overall prediction accuracy and the Matthews correlation coefficient in 7-fold cross-validation are 79.8% and 0.47, respectively, for the beta-turns. The overall prediction accuracy in 5-fold cross-validation is 61.0% for the gamma-turns. These results are significantly higher than the other algorithms in the prediction of beta- and gamma-turns using the same datasets. In addition, the 547 and 823 nonhomologous protein chains described by Fuchs and Alix (Fuchs and Alix Proteins: Struct Funct Bioinform 2005, 59, 828) are used for training and testing the predictive model of the beta- and gamma-turns, and better results are obtained. This algorithm may be helpful to improve the performance of protein turns' prediction. To ensure the ability of the SVM method to correctly classify beta-turn and non-beta-turn (gamma-turn and non-gamma-turn), the receiver operating characteristic threshold independent measure curves are provided. (c) 2008 Wiley Periodicals, Inc.

  18. Analyses of quenching process during turn-off of plasma electrolytic carburizing on carbon steel

    Wu, Jie; Liu, Run; Xue, Wenbin; Wang, Bin; Jin, Xiaoyue; Du, Jiancheng

    2014-01-01

    Highlights: • Cooling rate of carburized steel at the end of PEC treatment is measured. • The quench hardening in the fast or slow turn-off mode hardly takes place. • Decrease of the surface roughness during slow turn-off process is found. • A slow turn-off mode is recommended to replace the conventional turn-off mode. - Abstract: Plasma electrolytic carburizing (PEC) under different turn-off modes was employed to fabricate a hardening layer on carbon steel in glycerol solution without stirring at 380 V for 3 min. The quenching process in fast turn-off mode or slow turn-off mode of power supply was discussed. The temperature in the interior of steel and electron temperature in plasma discharge envelope during the quenching process were evaluated. It was found that the cooling rates of PEC samples in both turn-off modes were below 20 °C/s, because the vapor film boiling around the steel sample reduced the cooling rate greatly in terms of Leidenfrost effect. Thus the quench hardening hardly took place, though the slow turn-off mode slightly decreased the surface roughness of PEC steel. At the end of PEC treatment, the fast turn-off mode used widely at present cannot enhance the surface hardness by quench hardening, and the slow turn-off mode was recommended in order to protect the electronic devices against a large current surge

  19. Who is turning the patients? A survey study.

    Voz, Anita; Williams, Carol; Wilson, Marian

    2011-01-01

    This study sought to establish if nurses at a community hospital could correctly identify patients at high risk for skin breakdown and determine whether the resources needed to reposition high-risk patients per protocol were available. The sample comprised 101 registered nurses from 8 acute care units in a 246-bed community-owned district Magnet® hospital. The study facility serves patients from a wide geographic area in the "panhandle" of Idaho with a largely rural population. Face-to-face interviews were conducted on all shifts for 4 days. The instrument consisted of demographic questions and patient assignment questions including which patients the nurse identified at high risk for skin breakdown, which patients the nurse received information on about skin risks at change of shift, whether the nurse knew the Norton Pressure Ulcer Scale scores for their patients, whether patients were repositioned, who performed the repositioning, and how many times that shift. Surveyors obtained patients' Norton scores from computer records and recorded whether the nurse correctly identified patients at high-risk for skin breakdown. Most nurses (73%) stated they did not know their patients' Norton scores. About 60% of nurses reported turning their high-risk patients every 2 to 4 hours. The repositioning was completed most often by RNs alone (39%), RN and CNA (36%), and by patients themselves (35%). Reasons for not repositioning included the following: allowed to sleep, off unit, patient refused, not enough time, family refused, pain, not enough help, and patient receiving end-of-life care. Assessment of patient's skin risk status was correct in 232 out of 348 patients (66%). Nurses predicted high risk when the Norton score indicated low risk in 35.9% of patients and low risk when the Norton scale indicated high risk in 35.1%. Nurses reported receiving information about skin risk in 33% of their assigned patients. Nurses reported adequate resources to reposition patients. Most

  20. High speed turning of compacted graphite iron using controlled modulation

    Stalbaum, Tyler Paul

    class of industrial machining applications. This study's approach is by series of high speed turning tests of CGI with CBN tools, comparing conventional machining to MAM for similar parameters otherwise, by tool wear measurements and machinability observations.

  1. Characteristics of turn signal use at intersections in baseline naturalistic driving.

    Sullivan, John M; Bao, Shan; Goudy, Roy; Konet, Heather

    2015-01-01

    The purpose of this study was to determine whether a driver's use of turn signals is sufficiently reliable to forecast a vehicle's future path around an intersection, when detailed information about the intersection is unavailable. Naturalistic observations of turn signal use among 108 drivers on surface streets were extracted from the baseline portion of a field operational test of a safety system. Left and right turns that resulted in heading changes of between 70 and 110° and turn radii between 18 and 90 m were selected from the dataset. The odds that a driver would signal a turn were modeled as a function of road type, turn direction, presence of a forward vehicle, whether the vehicle stopped before the turn, and driver age and gender. Overall, 25 percent of left turns and 29 percent of right turns were not signaled. Road type, turn direction, and presence of a forward vehicle were found to influence the odds that a turn is signaled, while gender and age of the driver did not. The results suggest that situational factors like road type and turn direction are more powerful predictors of whether a turn will be signaled than either age or gender. Signaling on major and minor surface roads was about 5 times more likely than on local roads and 1.5 times more likely when a forward vehicle was present, suggesting a possible effect of traffic volume. It was concluded that turn signal activation alone may be insufficiently reliable to forecast a driver's path. Copyright © 2014 Elsevier Ltd. All rights reserved.

  2. In silico platform for predicting and initiating β-turns in a protein at desired locations.

    Singh, Harinder; Singh, Sandeep; Raghava, Gajendra P S

    2015-05-01

    Numerous studies have been performed for analysis and prediction of β-turns in a protein. This study focuses on analyzing, predicting, and designing of β-turns to understand the preference of amino acids in β-turn formation. We analyzed around 20,000 PDB chains to understand the preference of residues or pair of residues at different positions in β-turns. Based on the results, a propensity-based method has been developed for predicting β-turns with an accuracy of 82%. We introduced a new approach entitled "Turn level prediction method," which predicts the complete β-turn rather than focusing on the residues in a β-turn. Finally, we developed BetaTPred3, a Random forest based method for predicting β-turns by utilizing various features of four residues present in β-turns. The BetaTPred3 achieved an accuracy of 79% with 0.51 MCC that is comparable or better than existing methods on BT426 dataset. Additionally, models were developed to predict β-turn types with better performance than other methods available in the literature. In order to improve the quality of prediction of turns, we developed prediction models on a large and latest dataset of 6376 nonredundant protein chains. Based on this study, a web server has been developed for prediction of β-turns and their types in proteins. This web server also predicts minimum number of mutations required to initiate or break a β-turn in a protein at specified location of a protein. © 2015 Wiley Periodicals, Inc.

  3. Biomechanical Evaluation of a Bed Feature to Assist in Turning and Laterally Repositioning Patients.

    Wiggermann, Neal

    2016-08-01

    This study investigated the effects of hospital bed features on the biomechanical stresses experienced by nurses when turning and laterally repositioning patients. Turn Assist, a common feature in ICU beds that helps to rotate patients, and side rail orientation were evaluated. Manual patient handling is a risk factor for musculoskeletal injury, and turning patients is one of the most common patient handling activities. No known studies have evaluated bed attributes such as the Turn Assist feature and side rail orientation that may affect the stresses experienced by the nurse. Nine female nurses laterally repositioned and turned a 63-kg and 123-kg subject on an ICU bed while motion capture, ground reaction forces, and hand force data were recorded. Loading of the spine and shoulder was modeled using 3D Static Strength Prediction Program (3DSSPP). Spine compression and shear forces did not exceed recommended limits when turning or laterally repositioning. However, the mean pull forces required to manually laterally reposition even the 63-kg subject was 340 Newtons, more than 50% greater than limits established in psychophysical testing. Turn Assist considerably reduced spine loading and pull forces for both turning and laterally repositioning. Lowering side rails reduced spinal compression by 11% when turning patients. Laterally repositioning patients as part of turning may pose an injury risk to caregivers. Turn Assist reduces physical loading on nurses when turning and repositioning patients. Caregivers should consider using Turn Assist and other aids such as mechanical lifts or sliding sheets especially when turning patients requires lateral repositioning. © 2015, Human Factors and Ergonomics Society.

  4. ω-Turn: a novel β-turn mimic in globular proteins stabilized by main-chain to side-chain C−H···O interaction.

    Dhar, Jesmita; Chakrabarti, Pinak; Saini, Harpreet; Raghava, Gajendra Pal Singh; Kishore, Raghuvansh

    2015-02-01

    Mimicry of structural motifs is a common feature in proteins. The 10-membered hydrogen-bonded ring involving the main-chain C − O in a β-turn can be formed using a side-chain carbonyl group leading to Asx-turn. We show that the N − H component of hydrogen bond can be replaced by a C(γ) -H group in the side chain, culminating in a nonconventional C − H···O interaction. Because of its shape this β-turn mimic is designated as ω-turn, which is found to occur ∼ three times per 100 residues. Three residues (i to i + 2) constitute the turn with the C − H···O interaction occurring between the terminal residues, constraining the torsion angles ϕi + 1, ψi + 1, ϕi + 2 and χ'1(i + 2) (using the interacting C(γ) atom). Based on these angles there are two types of ω-turns, each of which can be further divided into two groups. C(β) -branched side-chains, and Met and Gln have high propensities to occur at i + 2; for the last two residues the carbonyl oxygen may participate in an additional interaction involving the S and amino group, respectively. With Cys occupying the i + 1 position, such turns are found in the metal-binding sites. N-linked glycosylation occurs at the consensus pattern Asn-Xaa-Ser/Thr; with Thr at i + 2, the sequence can adopt the secondary structure of a ω-turn, which may be the recognition site for protein modification. Location between two β-strands is the most common occurrence in protein tertiary structure, and being generally exposed ω-turn may constitute the antigenic determinant site. It is a stable scaffold and may be used in protein engineering and peptide design. © 2014 Wiley Periodicals, Inc.

  5. pi-Turns: types, systematics and the context of their occurrence in protein structures.

    Dasgupta, Bhaskar; Chakrabarti, Pinak

    2008-09-22

    For a proper understanding of protein structure and folding it is important to know if a polypeptide segment adopts a conformation inherent in the sequence or it depends on the context of its flanking secondary structures. Turns of various lengths have been studied and characterized starting from three-residue gamma-turn to six-residue pi-turn. The Schellman motif occurring at the C-terminal end of alpha-helices is a classical example of hydrogen bonded pi-turn involving residues at (i) and (i+5) positions. Hydrogen bonded and non-hydrogen bonded beta- and alpha-turns have been identified previously; likewise, a systematic characterization of pi-turns would provide valuable insight into turn structures. An analysis of protein structures indicates that at least 20% of pi-turns occur independent of the Schellman motif. The two categories of pi-turns, designated as pi-HB and SCH, have been further classified on the basis of backbone conformation and both have AAAa as the major class. They differ in the residue usage at position (i+1), the former having a large preference for Pro that is absent in the latter. As in the case of shorter length beta- and alpha-turns, pi-turns have also been identified not only on the basis of the existence of hydrogen bond, but also using the distance between terminal C alpha-atoms, and this resulted in a comparable number of non-hydrogen-bonded pi-turns (pi-NHB). The presence of shorter beta- and alpha-turns within all categories of pi-turns, the subtle variations in backbone torsion angles along the turn residues, the location of the turns in the context of tertiary structures have been studied. pi-turns have been characterized, first using hydrogen bond and the distance between C alpha atoms of the terminal residues, and then using backbone torsion angles. While the Schellman motif has a structural role in helix termination, many of the pi-HB turns, being located on surface cavities, have functional role and there is also sequence

  6. The "symmetrical turn" in the study of colective action

    Israel Rodríguez Giralt

    2008-11-01

    Full Text Available Conceptualising and understanding forms of collective action is one of the historic preoccupations of social thought. Good evidence of this can be found in the long line of disputes and polemics that runs through the history of thought about these social phenomena. It shows the difficulty social sciences have faced, and continue to face, when it comes to defining, explaining and delineating a phenomena as ephemeral and liminal as this one.In this context, I propose that a discussion of the implications an STS focus could have for the analysis of contemporary collective action. The main hypothesis I develop states that the conceptual and methodological baggage that goes with the Actor-Network theory (ANT, and its shaping into what has been called the 'symmetrical turn' in the social sciences, become a fundamental resource for renewing and enriching the analysis of collective action. For this, I will bring together two main contributions: its alternative understanding of social action (to explain the social it is necessary to  leave the exclusive concern with social relations aside and take into account the non-human actors, such as the technical procedures in which they are involved; and its original definition of the “collective” (the collective is basically an aggregate of humans and non-humans, without predefined borders, it is just the relational product created by the constant and precarious commitment between heterogeneous elements. Both contributions, I affirm, allow the opening of an interesting discussion about agency and the possibility of articulating a new theory of collective action that differs from the dominant traditions in that it considers and assumes the heterogeneous and relational character of all social actors, and, as such, it also assumes that all social action is the emergent effect, the interactive product of those hybrid collectives in action. To give an example of the fertility of this approach, I focus on an

  7. Prediction and analysis of beta-turns in proteins by support vector machine.

    Pham, Tho Hoan; Satou, Kenji; Ho, Tu Bao

    2003-01-01

    Tight turn has long been recognized as one of the three important features of proteins after the alpha-helix and beta-sheet. Tight turns play an important role in globular proteins from both the structural and functional points of view. More than 90% tight turns are beta-turns. Analysis and prediction of beta-turns in particular and tight turns in general are very useful for the design of new molecules such as drugs, pesticides, and antigens. In this paper, we introduce a support vector machine (SVM) approach to prediction and analysis of beta-turns. We have investigated two aspects of applying SVM to the prediction and analysis of beta-turns. First, we developed a new SVM method, called BTSVM, which predicts beta-turns of a protein from its sequence. The prediction results on the dataset of 426 non-homologous protein chains by sevenfold cross-validation technique showed that our method is superior to the other previous methods. Second, we analyzed how amino acid positions support (or prevent) the formation of beta-turns based on the "multivariable" classification model of a linear SVM. This model is more general than the other ones of previous statistical methods. Our analysis results are more comprehensive and easier to use than previously published analysis results.

  8. Pilot study: Assessing the effect of continual position monitoring technology on compliance with patient turning protocols.

    Schutt, Suann Cirigliano; Tarver, Christine; Pezzani, Michelle

    2018-01-01

    The study aim was to evaluate if continual patient position monitoring, taking into account self-turns and clinician-assisted turns, would increase the percentage of time a patient's position changed at least every 2 hr. While patient turning has clinical benefits, current models to help staff remember to turn patients, such as "turn clocks" and timers, have not resulted in high compliance with turning protocols. In addition, reminders are based on arbitrary 2-hr windows (such as turning on "even" hours) rather than on individual patient activity, including self-turns. This is a first inpatient, non-randomized, pre-/postintervention study. Data collection occurred from May 2013-February 2014 on a 39-bed medical unit in a community hospital. Baseline patient turning data were recorded by a sensor; however, the patient data were not displayed at the nurses' station to establish compliance with the hospital's turning protocol. Postintervention, patient position information was wirelessly displayed on nurses' station computer monitors in real time. A Student t test was used to compare baseline to postintervention "mean time in compliance." Data from 138 patients ( N  =   7,854 hr of monitoring) were collected. The baseline phase yielded 4,322 hr of position monitoring data and the postintervention phase yielded 3,532 hr of data. Statistically significant improvement was demonstrated in the percentage of time a patient's position changed at least every 2 hr from baseline to postintervention.

  9. Egg turning behavior and incubation temperature in Forster’s terns in relation to mercury contamination

    Taylor, Gregory T.; Ackerman, Joshua T.; Shaffer, Scott A.

    2018-01-01

    Egg turning behavior is an important determinant of egg hatchability, but it remains relatively understudied. Here, we examined egg turning rates and egg temperatures in Forster’s terns (Sterna forsteri). We used artificial eggs containing a data logger with a 3-D accelerometer, a magnetometer, and a temperature thermistor to monitor parental incubation behavior of 131 tern nests. Overall, adults turned their eggs an average (±SD) of 3.8 ± 0.8 turns h-1, which is nearly two times higher than that of other seabirds. Egg turning rates increased with nest initiation date. We also examined egg turning rates and egg temperatures in relation to egg mercury contamination. Mercury contamination has been shown to be associated with reduced egg hatchability, and we hypothesized that mercury may decrease egg hatchability via altered egg turning behavior by parents. Despite the high variability in egg turning rates among individuals, the rate of egg turning was not related to mercury concentrations in sibling eggs. These findings highlight the need for further study concerning the potential determinants of egg turning behavior.

  10. Stepping in Place While Voluntarily Turning Around Produces a Long-Lasting Posteffect Consisting in Inadvertent Turning While Stepping Eyes Closed

    Stefania Sozzi

    2016-01-01

    Full Text Available Training subjects to step in place on a rotating platform while maintaining a fixed body orientation in space produces a posteffect consisting in inadvertent turning around while stepping in place eyes closed (podokinetic after-rotation, PKAR. We tested the hypothesis that voluntary turning around while stepping in place also produces a posteffect similar to PKAR. Sixteen subjects performed 12 min of voluntary turning while stepping around their vertical axis eyes closed and 12 min of stepping in place eyes open on the center of a platform rotating at 60°/s (pretests. Then, subjects continued stepping in place eyes closed for at least 10 min (posteffect. We recorded the positions of markers fixed to head, shoulder, and feet. The posteffect of voluntary turning shared all features of PKAR. Time decay of angular velocity, stepping cadence, head acceleration, and ratio of angular velocity after to angular velocity before were similar between both protocols. Both postrotations took place inadvertently. The posteffects are possibly dependent on the repeated voluntary contraction of leg and foot intrarotating pelvic muscles that rotate the trunk over the stance foot, a synergy common to both protocols. We propose that stepping in place and voluntary turning can be a scheme ancillary to the rotating platform for training body segment coordination in patients with impairment of turning synergies of various origin.

  11. Minimum-fuel turning climbout and descent guidance of transport jets

    Neuman, F.; Kreindler, E.

    1983-01-01

    The complete flightpath optimization problem for minimum fuel consumption from takeoff to landing including the initial and final turns from and to the runway heading is solved. However, only the initial and final segments which contain the turns are treated, since the straight-line climbout, cruise, and descent problems have already been solved. The paths are derived by generating fields of extremals, using the necessary conditions of optimal control together with singular arcs and state constraints. Results show that the speed profiles for straight flight and turning flight are essentially identical except for the final horizontal accelerating or decelerating turns. The optimal turns require no abrupt maneuvers, and an approximation of the optimal turns could be easily integrated with present straight-line climb-cruise-descent fuel-optimization algorithms. Climbout at the optimal IAS rather than the 250-knot terminal-area speed limit would save 36 lb of fuel for the 727-100 aircraft.

  12. Plant breeding in the turn of the millennium

    Aluízio Borém

    1998-01-01

    Full Text Available The transition from hunting and gathering to farming happened about 10,000 years ago, independently and diffusely in several places in the world. Plant breeders were responsible for genetic progress in a number of crop species. It included hybrids, the introgression of wild species genes and also the Green Revolution, which started in the 1960's with the cereals. The varieties developed by breeding, along with the use of new crop technology (fertilization, soil tillage, etc. changed the status of some countries from importers to exporters of food. In the turn of the millennium,, plant breeding, faces new challenges in a globalized world, but it has new tools to deal with them. Notwithstanding the present contributions of plant breeding and crop management, its future contributions may be even greater. The partnership being developed between plant breeding and biotechnology will assure a more consistent and predictable genetic progress. Current contributions of biotechnology have arrived for many crops in different places of the world. Varieties developed by transformation are grown in large acreage in some countries. Some concerns have also arisen from the use of GMOs. For example, the introgression of a gene for insect resistance 4 into many different species could result in an undesirable endemic risk, here called interespecific biotechnological vulnerability. Another concern is that biotechnology race may create yield plateaus in programs using genes pyramiding for all new traits made available by biotechnology, resulting in what is called genetic gridlock. Nevertheless, the benefits of using biotechnology will substantially enhance the contributions of plant breeding to human lifeA transição da fase de coleta e caça para a agricultura ocorreu há cerca de dez mil anos independentemente e em vários locais no mundo. Naquela época iniciou-se a domesticação da maioria das espécies cultivadas, dando início às atividades agrícolas. Os

  13. Emotions and Social Sciences in 20th century: The Prequel of Affective Turn

    Giazú Enciso Domínguez; Alí Lara

    2014-01-01

    The Affective Turn is an innovative movement that is transforming the production of knowledge based on the study of affect and emotion. To understand the current role of emotions, we proposed a 'prequel. Telling what happened with emotions within the social sciences before the Affective Turn, and before the twentieth century. In this work we explain the present from the past, we tell the story before The History, we pay a debt to a previous work: The Affective Turn. We articulate the prequel ...

  14. Prediction of the location and type of beta-turns in proteins using neural networks.

    Shepherd, A. J.; Gorse, D.; Thornton, J. M.

    1999-01-01

    A neural network has been used to predict both the location and the type of beta-turns in a set of 300 nonhomologous protein domains. A substantial improvement in prediction accuracy compared with previous methods has been achieved by incorporating secondary structure information in the input data. The total percentage of residues correctly classified as beta-turn or not-beta-turn is around 75% with predicted secondary structure information. More significantly, the method gives a Matthews cor...

  15. Topological side-chain classification of beta-turns: ideal motifs for peptidomimetic development.

    Tran, Tran Trung; McKie, Jim; Meutermans, Wim D F; Bourne, Gregory T; Andrews, Peter R; Smythe, Mark L

    2005-08-01

    Beta-turns are important topological motifs for biological recognition of proteins and peptides. Organic molecules that sample the side chain positions of beta-turns have shown broad binding capacity to multiple different receptors, for example benzodiazepines. Beta-turns have traditionally been classified into various types based on the backbone dihedral angles (phi2, psi2, phi3 and psi3). Indeed, 57-68% of beta-turns are currently classified into 8 different backbone families (Type I, Type II, Type I', Type II', Type VIII, Type VIa1, Type VIa2 and Type VIb and Type IV which represents unclassified beta-turns). Although this classification of beta-turns has been useful, the resulting beta-turn types are not ideal for the design of beta-turn mimetics as they do not reflect topological features of the recognition elements, the side chains. To overcome this, we have extracted beta-turns from a data set of non-homologous and high-resolution protein crystal structures. The side chain positions, as defined by C(alpha)-C(beta) vectors, of these turns have been clustered using the kth nearest neighbor clustering and filtered nearest centroid sorting algorithms. Nine clusters were obtained that cluster 90% of the data, and the average intra-cluster RMSD of the four C(alpha)-C(beta) vectors is 0.36. The nine clusters therefore represent the topology of the side chain scaffold architecture of the vast majority of beta-turns. The mean structures of the nine clusters are useful for the development of beta-turn mimetics and as biological descriptors for focusing combinatorial chemistry towards biologically relevant topological space.

  16. Turn-Taking Based on Information Flow for Fluent Human-Robot Interaction

    Thomaz, Andrea L.; Chao, Crystal

    2011-01-01

    Turn-taking is a fundamental part of human communication. Our goal is to devise a turn-taking framework for human-robot interaction that, like the human skill, represents something fundamental about interaction, generic to context or domain. We propose a model of turn-taking, and conduct an experiment with human subjects to inform this model. Our findings from this study suggest that information flow is an integral part of human floor-passing behavior. Following this, we implement autonomous ...

  17. Required coefficient of friction in the anteroposterior and mediolateral direction during turning at different walking speeds.

    Yamaguchi, Takeshi; Suzuki, Akito; Hokkirigawa, Kazuo

    2017-01-01

    This study investigated the required coefficient of friction (RCOF) and the tangent of center of mass (COM)-center of pressure (COP) angle in the mediolateral (ML) and anteroposterior (AP) directions during turning at different walking speeds. Sixteen healthy young adults (8 males and 8 females) participated in this study. The participants were instructed to conduct trials of straight walking and 90° step and spin turns to the right at each of three self-selected speeds (slow, normal, and fast). The ML and AP directions during turning gait were defined using the orientation of the pelvis to construct a body-fixed reference frame. The RCOF values and COM-COP angle tangent in the ML direction during turning at weight acceptance phase were higher than those during straight walking, and those values increased with increasing walking speed. The ML component of the RCOF and COM-COP tangent values during weight acceptance for step turns were higher than those for spin turns. The mean centripetal force during turning tended to increase with an increase in walking speed and had a strong positive correlation with the RCOF values in the ML direction (R = 0.97 during the weight acceptance phase; R = 0.95 during the push-off phase). Therefore, turning, particularly step turn, is likely to cause lateral slip at weight acceptance because of the increased centripetal force compared with straight walking. Future work should test at-risk population and compare with the present results.

  18. Roles of beta-turns in protein folding: from peptide models to protein engineering.

    Marcelino, Anna Marie C; Gierasch, Lila M

    2008-05-01

    Reverse turns are a major class of protein secondary structure; they represent sites of chain reversal and thus sites where the globular character of a protein is created. It has been speculated for many years that turns may nucleate the formation of structure in protein folding, as their propensity to occur will favor the approximation of their flanking regions and their general tendency to be hydrophilic will favor their disposition at the solvent-accessible surface. Reverse turns are local features, and it is therefore not surprising that their structural properties have been extensively studied using peptide models. In this article, we review research on peptide models of turns to test the hypothesis that the propensities of turns to form in short peptides will relate to the roles of corresponding sequences in protein folding. Turns with significant stability as isolated entities should actively promote the folding of a protein, and by contrast, turn sequences that merely allow the chain to adopt conformations required for chain reversal are predicted to be passive in the folding mechanism. We discuss results of protein engineering studies of the roles of turn residues in folding mechanisms. Factors that correlate with the importance of turns in folding indeed include their intrinsic stability, as well as their topological context and their participation in hydrophobic networks within the protein's structure.

  19. Required coefficient of friction in the anteroposterior and mediolateral direction during turning at different walking speeds.

    Takeshi Yamaguchi

    Full Text Available This study investigated the required coefficient of friction (RCOF and the tangent of center of mass (COM-center of pressure (COP angle in the mediolateral (ML and anteroposterior (AP directions during turning at different walking speeds. Sixteen healthy young adults (8 males and 8 females participated in this study. The participants were instructed to conduct trials of straight walking and 90° step and spin turns to the right at each of three self-selected speeds (slow, normal, and fast. The ML and AP directions during turning gait were defined using the orientation of the pelvis to construct a body-fixed reference frame. The RCOF values and COM-COP angle tangent in the ML direction during turning at weight acceptance phase were higher than those during straight walking, and those values increased with increasing walking speed. The ML component of the RCOF and COM-COP tangent values during weight acceptance for step turns were higher than those for spin turns. The mean centripetal force during turning tended to increase with an increase in walking speed and had a strong positive correlation with the RCOF values in the ML direction (R = 0.97 during the weight acceptance phase; R = 0.95 during the push-off phase. Therefore, turning, particularly step turn, is likely to cause lateral slip at weight acceptance because of the increased centripetal force compared with straight walking. Future work should test at-risk population and compare with the present results.

  20. Turn-taking in Human Communication--Origins and Implications for Language Processing.

    Levinson, Stephen C

    2016-01-01

    Most language usage is interactive, involving rapid turn-taking. The turn-taking system has a number of striking properties: turns are short and responses are remarkably rapid, but turns are of varying length and often of very complex construction such that the underlying cognitive processing is highly compressed. Although neglected in cognitive science, the system has deep implications for language processing and acquisition that are only now becoming clear. Appearing earlier in ontogeny than linguistic competence, it is also found across all the major primate clades. This suggests a possible phylogenetic continuity, which may provide key insights into language evolution. Copyright © 2015 Elsevier Ltd. All rights reserved.

  1. An empirical assessment of near-source strong ground motion for a 6.6 m{sub b} (7.5 M{sub S}) earthquake in the Eastern United States

    Campbell, Kenneth W

    1984-06-01

    To help assess the impact of the current U.S. Geological Survey position on the seismic safety of nuclear power plants in the Eastern United States (EUS), several techniques for estimating near-source strong ground motion for a Charleston size earthquake were evaluated. The techniques for estimating the near-source strong ground motion for a 6.6 m{sub b} (7.5 M{sub S}) in the Eastern United States which were assessed are methods based on site specific analyses, semi-theoretical scaling techniques, and intensity-based estimates. The first involves the statistical analysis of ground motion records from earthquakes and recording stations having the same general characteristics (earthquakes with magnitudes of 7.5 M{sub S} or larger, epicentral distances of 25 km or less, and sites of either soil or rock). Some recommendations for source and characterization scaling of the bias resulting primarily from an inadequate sample of near-source recordings from earthquakes of large magnitude are discussed. The second technique evaluated requires that semi-theoretical estimates of peak ground motion parameters for a 6.6 m{sub b} (7.5 M{sub S}) earthquake be obtained from scaling relations. Each relation uses a theoretical expression between peak acceleration magnitude and distance together with available strong motion data (majority coming from California) to develop a scaling relation appropriate for the Eastern United States. None of the existing ground motion models for the EUS include the potential effects of source or site characteristics. Adjustments to account for fault mechanisms, site topography, site geology, and the size and embedment of buildings are discussed. The final approach used relations between strong ground motion parameters and Modified Mercalli Intensity in conjunction with two methods to estimate peak parameters for a 6.6 m{sub s} (7.5 M{sub S}) earthquake. As with other techniques, adjustment of peak acceleration estimates are discussed. Each method

  2. Kinematical Comparison of the 200 m Backstroke Turns between National and Regional Level Swimmers

    Veiga, Santiago; Cala, Antonio; Frutos, Pablo González; Navarro, Enrique

    2013-01-01

    The aims of this investigation were to determine the evolution of selected turn variables during competitive backstroke races and to compare these kinematic variables between two different levels of swimmers. Sixteen national and regional level male swimmers participant in the 200 m backstroke event at the Spanish Swimming Championships in short course (25 m) were selected to analyze their turn performances. The individual distances method with two-dimensional Direct Linear Transformation (2D-DLT) algorithms was used to perform race analyses. National level swimmers presented a shorter “turn time”, a longer “distance in”, a faster “underwater velocity” and “normalized underwater velocity”, and a faster “stroking velocity” than regional level swimmers, whereas no significant differences were detected between levels for the “underwater distance”. National level swimmers maintained similar “turn times” over the event and increased “underwater velocity” and “normalized underwater velocity” in the last (seventh) turn segment, whereas regional level swimmers increased “turn time” in the last half of the race. For both national and regional level swimmers, turn “underwater distance” during the last three turns of the race was significantly shorter while no significant differences in distance into the wall occurred throughout the race. The skill level of the swimmers has an impact on the competitive backstroke turn segments. In a 200 m event, the underwater velocity should be maximized to maintain turn proficiency, whereas turn distance must be subordinated to the average velocity. Key Points The underwater turn velocity is as a critical variable related to the swimmers’ level of skill in a 200 m backstroke event. Best swimmers perform faster but no longer turn segments during a 200 m backstroke event. Best swimmers maintain their turn performance throughout the 200 m backstroke event by increasing the underwater velocity

  3. Kinematical Comparison of the 200 m Backstroke Turns between National and Regional Level Swimmers

    Santiago Veiga

    2013-12-01

    Full Text Available The aims of this investigation were to determine the evolution of selected turn variables during competitive backstroke races and to compare these kinematic variables between two different levels of swimmers. Sixteen national and regional level male swimmers participant in the 200 m backstroke event at the Spanish Swimming Championships in short course (25 m were selected to analyze their turn performances. The individual distances method with two-dimensional Direct Linear Transformation (2D-DLT algorithms was used to perform race analyses. National level swimmers presented a shorter “turn time”, a longer “distance in”, a faster “underwater velocity” and “normalized underwater velocity”, and a faster “stroking velocity” than regional level swimmers, whereas no significant differences were detected between levels for the “underwater distance”. National level swimmers maintained similar “turn times” over the event and increased “underwater velocity” and “normalized underwater velocity” in the last (seventh turn segment, whereas regional level swimmers increased “turn time” in the last half of the race. For both national and regional level swimmers, turn “underwater distance” during the last three turns of the race was significantly shorter while no significant differences in distance into the wall occurred throughout the race. The skill level of the swimmers has an impact on the competitive backstroke turn segments. In a 200 m event, the underwater velocity should be maximized to maintain turn proficiency, whereas turn distance must be subordinated to the average velocity.

  4. Predictors and use of nonpharmacologic interventions for procedural pain associated with turning among hospitalized adults.

    Faigeles, Bonnie; Howie-Esquivel, Jill; Miaskowski, Christine; Stanik-Hutt, Julie; Thompson, Carol; White, Cheri; Wild, Lorie Rietman; Puntillo, Kathleen

    2013-06-01

    Many hospitalized adults cannot reposition themselves in their beds. Therefore, they are regularly turned by their nurses, primarily to prevent pressure ulcer formation. Earlier research indicates that turning is painful and that patients are rarely premedicated with analgesics. Nonpharmacologic interventions may be used to help with this painful procedure. However, no published research was found on the use of nonpharmacologic interventions for turning of hospitalized patients. The objectives of this study were: 1) to describe patient pain characteristics during turning and their association with patient demographic and clinical characteristics; 2) to determine the frequency of use of various nonpharmacologic interventions for hospitalized adult patients undergoing the painful procedure of turning; and 3) to identify factors that predict the use of specific nonpharmacologic interventions for pain associated with turning. Hospitalized adult patients who experienced turning, the nurses caring for them, and others who were present at the time of turning were asked if they used various nonpharmacologic interventions to manage pain during the turning. Out of 1,395 patients, 92.5% received at least one nonpharmacologic intervention. Most frequently used were calming voice (65.7%), information (60.6%), and deep breathing (37.9%). Critical-care patients were more likely to receive a calming voice (odds ratio [OR] 1.66, p patients. Those reporting higher pain were consistently more likely to receive each of the three interventions (OR 1.01, p turning procedure. The specific interventions used most often are ones that can be initiated spontaneously. Our data suggest that patients, nurses, and family members respond to patients' turning-related pain by using nonpharmacologic interventions. Copyright © 2013 American Society for Pain Management Nursing. Published by Elsevier Inc. All rights reserved.

  5. How changes in top water bother big turning packs of up-going wet air

    Wood, K.

    2017-12-01

    Big turning packs of up-going wet air form near areas of warm water at the top of big bodies of water. After these turning packs form, they usually get stronger if the top water stays warm. If the top water becomes less warm, the turning packs usually get less strong. Other things can change how strong a turning pack gets, like how wet the air around it is and if that air moves faster higher up than lower down. When these turning packs hit land, their rain and winds can hurt people and the stuff they own, especially if the turning pack is really strong. But it's hard to know how much stronger or less strong it will become before it hits land. Warm top water gives a turning pack of up-going wet air a lot of power, but cool top water doesn't, so we need to know how warm the top water is. Because I can't go into every turning pack myself, flying computers in outer space tell me what the top water is doing. I look at the top water near turning packs that get strong and see how it's different from the top water near those that get less strong. Top water that changes from warm to cool in a small area bothers a turning pack of up-going wet air, which then gets less strong. If we see these top water changes ahead of time, that might help us know what a turning pack will do before it gets close to land.

  6. Factors influencing turning and its relationship with falls in individuals with Parkinson's disease.

    Fang-Yu Cheng

    Full Text Available BACKGROUND: Falls are a major problem for people with Parkinson's disease (PD. Many studies indicate that more than 50% of people with PD have difficulty in turning that may lead to falls during daily activities. The aims of this study were to identify the relationship between turning performance and falls, and to determine the factors that influence turning performance. METHODS: This study examined 45 patients with idiopathic PD (Hoehn and Yahr stage 1-3 using a battery of tests, including 180° turn time, balance, and muscle strength. The levels of disease severity and freezing of gait were also measured. The number of falls in the past 6 months was recorded. RESULTS: Sixteen out of forty-five participants experienced falls in the past 6 months. A receiver operating characteristic curve showed that turn time was highly related to falls [more affected side: sensitivity = 0.81, specificity = 0.79, area under the curve (AUC = 0.83; less affected side: sensitivity = 0.88, specificity = 0.76, AUC = 0.83]. The most important factor influencing turn time was balance ability (both sides: p = 0.000 according to the regression model. Correlations between turn time and dynamic balance were further established with reaction time, movement velocity, endpoint excursion, and maximal excursion of the LOS (limits of stability test. CONCLUSION: The time needed to complete a 180° turn during the SQT (step/quick turn test is a good index to differentiate fallers from non-fallers in persons with PD. Turn time is most influenced by balance. Furthermore, balance control, especially in an anterior or sideways direction, is important for turning performance.

  7. Validation of the BUGJEFF311.BOLIB, BUGENDF70.BOLIB and BUGLE-B7 broad-group libraries on the PCA-Replica (H2O/Fe neutron shielding benchmark experiment

    Pescarini Massimo

    2016-01-01

    Full Text Available The PCA-Replica 12/13 (H2O/Fe neutron shielding benchmark experiment was analysed using the TORT-3.2 3D SN code. PCA-Replica reproduces a PWR ex-core radial geometry with alternate layers of water and steel including a pressure vessel simulator. Three broad-group coupled neutron/photon working cross section libraries in FIDO-ANISN format with the same energy group structure (47 n + 20 γ and based on different nuclear data were alternatively used: the ENEA BUGJEFF311.BOLIB (JEFF-3.1.1 and UGENDF70.BOLIB (ENDF/B-VII.0 libraries and the ORNL BUGLE-B7 (ENDF/B-VII.0 library. Dosimeter cross sections derived from the IAEA IRDF-2002 dosimetry file were employed. The calculated reaction rates for the Rh-103(n,n′Rh-103m, In-115(n,n′In-115m and S-32(n,pP-32 threshold activation dosimeters and the calculated neutron spectra are compared with the corresponding experimental results.

  8. Validation of the BUGJEFF311.BOLIB, BUGENDF70.BOLIB and BUGLE-B7 broad-group libraries on the PCA-Replica (H2O/Fe) neutron shielding benchmark experiment

    Pescarini, Massimo; Orsi, Roberto; Frisoni, Manuela

    2016-03-01

    The PCA-Replica 12/13 (H2O/Fe) neutron shielding benchmark experiment was analysed using the TORT-3.2 3D SN code. PCA-Replica reproduces a PWR ex-core radial geometry with alternate layers of water and steel including a pressure vessel simulator. Three broad-group coupled neutron/photon working cross section libraries in FIDO-ANISN format with the same energy group structure (47 n + 20 γ) and based on different nuclear data were alternatively used: the ENEA BUGJEFF311.BOLIB (JEFF-3.1.1) and UGENDF70.BOLIB (ENDF/B-VII.0) libraries and the ORNL BUGLE-B7 (ENDF/B-VII.0) library. Dosimeter cross sections derived from the IAEA IRDF-2002 dosimetry file were employed. The calculated reaction rates for the Rh-103(n,n')Rh-103m, In-115(n,n')In-115m and S-32(n,p)P-32 threshold activation dosimeters and the calculated neutron spectra are compared with the corresponding experimental results.

  9. Prediction of beta-turns and beta-turn types by a novel bidirectional Elman-type recurrent neural network with multiple output layers (MOLEBRNN).

    Kirschner, Andreas; Frishman, Dmitrij

    2008-10-01

    Prediction of beta-turns from amino acid sequences has long been recognized as an important problem in structural bioinformatics due to their frequent occurrence as well as their structural and functional significance. Because various structural features of proteins are intercorrelated, secondary structure information has been often employed as an additional input for machine learning algorithms while predicting beta-turns. Here we present a novel bidirectional Elman-type recurrent neural network with multiple output layers (MOLEBRNN) capable of predicting multiple mutually dependent structural motifs and demonstrate its efficiency in recognizing three aspects of protein structure: beta-turns, beta-turn types, and secondary structure. The advantage of our method compared to other predictors is that it does not require any external input except for sequence profiles because interdependencies between different structural features are taken into account implicitly during the learning process. In a sevenfold cross-validation experiment on a standard test dataset our method exhibits the total prediction accuracy of 77.9% and the Mathew's Correlation Coefficient of 0.45, the highest performance reported so far. It also outperforms other known methods in delineating individual turn types. We demonstrate how simultaneous prediction of multiple targets influences prediction performance on single targets. The MOLEBRNN presented here is a generic method applicable in a variety of research fields where multiple mutually depending target classes need to be predicted. http://webclu.bio.wzw.tum.de/predator-web/.

  10. Theoretical tool movement required to diamond turn an off-axis paraboloid on axis

    Thompson, D.C.

    1976-01-01

    Current techniques for manufacturing off-axis paraboloids are both expensive and insufficiently accurate. An alternative method, turning the workpiece about its axis on a diamond-turning machine, is presented, and the equations describing the necessary tool movement are derived. A discussion of a particular case suggests that the proposed technique is feasible

  11. Measurement of signal use and vehicle turns as indication of driver cognition.

    Wallace, Bruce; Goubran, Rafik; Knoefel, Frank

    2014-01-01

    This paper uses data analytics to provide a method for the measurement of a key driving task, turn signal usage as a measure of an automatic over-learned cognitive function drivers. The paper augments previously reported more complex executive function cognition measures by proposing an algorithm that analyzes dashboard video to detect turn indicator use with 100% accuracy without any false positives. The paper proposes two algorithms that determine the actual turns made on a trip. The first through analysis of GPS location traces for the vehicle, locating 73% of the turns made with a very low false positive rate of 3%. A second algorithm uses GIS tools to retroactively create turn by turn directions. Fusion of GIS and GPS information raises performance to 77%. The paper presents the algorithm required to measure signal use for actual turns by realigning the 0.2Hz GPS data, 30fps video and GIS turn events. The result is a measure that can be tracked over time and changes in the driver's performance can result in alerts to the driver, caregivers or clinicians as indication of cognitive change. A lack of decline can also be shared as reassurance.

  12. Differences of Ballet Turns ("Pirouette") Performance between Experienced and Novice Ballet Dancers

    Lin, Chia-Wei; Chen, Shing-Jye; Su, Fong-Chin; Wu, Hong-Wen; Lin, Cheng-Feng

    2014-01-01

    Purpose: This study investigated the different postural control strategies exhibited by experienced and novice dancers in ballet turns ("pirouettes"). Method: Thirteen novice and 13 experienced dancers performed ballet turns with dominant-leg support. The peak push force was measured in the double-leg support phase. The inclination…

  13. Buoyancy frequency profiles and internal semidiurnal tide turning depths in the oceans

    King, B.; Stone, M.; Zhang, H.P.; Gerkema, T.; Marder, M.; Scott, R.B.; Swinney, H.L.

    2012-01-01

    We examine the possible existence of internal gravity wave "turning depths," depths below which the local buoyancy frequency N(z) becomes smaller than the wave frequency. At a turning depth, incident gravity waves reflect rather than reaching the ocean bottom as is generally assumed. Here we

  14. Mechanism for activation of the growth factor-activated AGC kinases by turn motif phosphorylation

    Hauge, Camilla; Antal, Torben L; Hirschberg, Daniel

    2007-01-01

    investigated the role of the third, so-called turn motif phosphate, also located in the tail, in the AGC kinases PKB, S6K, RSK, MSK, PRK and PKC. We report cooperative action of the HM phosphate and the turn motif phosphate, because it binds a phosphoSer/Thr-binding site above the glycine-rich loop within...

  15. The Contribution of the Ontological Turn in Education: Some Methodological and Political Implications

    Zembylas, Michalinos

    2017-01-01

    This paper follows recent debates on the ontological turn in the social sciences and humanities to exemplify how this turn creates important openings of methodological and political potential in education. In particular, the paper makes an attempt to show two things: first, the new questions and possibilities that are opened from explicitly…

  16. A prospective observational study of ICU patient position and frequency of turning.

    Goldhill, D R; Badacsonyi, A; Goldhill, A A; Waldmann, C

    2008-05-01

    Positioning and turning critically ill patients may be beneficial but there are little data on current practice. We prospectively recorded patient position every hour over two separate days in 40 British intensive care units and analysed 393 sets of observation. Five patients were prone at any time and 3.8% (day 1) and 5% (day 2) were on rotating beds. Patients were on their back for 46.1% of observations, turned left for 28.4% and right for 25.5%, and head up for 97.4%. A turn was defined as a change between on back, turned left or turned right. The average time (SD) between turns was 4.85 (3.3) h. There was no significant association between the average time between turns and age, weight, height, gender, respiratory diagnosis, intubated and ventilated, sedation score, day of week or nurse:patient ratio. There was a significant difference between hospitals in the frequency with which patients were turned.

  17. Vicious vs. Virtuous Cycles of Turn Negotiation in Video-Mediated Telecollaboration: Interactional Sociolinguistics Perspective

    Akiyama, Yuka

    2016-01-01

    To examine how participants' different eTandem experiences could be attributed to the way they co-constructed turns, this study analyzed turn negotiation practices of one dyad who engaged in video-mediated interaction between Japan and America. This dyad was chosen for analysis because they expressed the greatest frustration and required a…

  18. How turn-taking strategies influence users’ impressions of an agent

    ter Maat, Mark; Truong, Khiet Phuong; Heylen, Dirk K.J.; Allbeck, Jan; Badler, Norman; Bickmore, Timothy; Pelachaud, Catherine; Safonova, Alla

    Different turn-taking strategies of an agent influence the impression that people have of it. We recorded conversations of a human with an interviewing agent, controlled by a wizard and using a particular turn-taking strategy. A questionnaire with 27 semantic differential scales concerning

  19. Family matters: Directionality of turning bias while kissing is modulated by context.

    Sedgewick, Jennifer R; Elias, Lorin J

    2016-01-28

    When leaning forward to kiss to a romantic partner, individuals tend to direct their kiss to the right more often than the left. Studies have consistently demonstrated this kissing asymmetry, although other factors known to influence lateral biases, such as sex or situational context, had yet to be explored. The primary purpose of our study was to investigate if turning direction was consistent between a romantic (parent-parent) and parental (parent-child) kissing context, and secondly, to examine if sex differences influenced turning bias between parent-child kissing partners. An archival analysis coded the direction of turning bias for 161 images of romantic kissing (mothers kissing fathers) and 529 images of parental kissing (mothers or fathers kissing sons or daughters). The results indicated that the direction of turning bias differed between kissing contexts. As expected, a right-turn bias was observed for romantic kissing; however, a left-turn bias was exhibited for parental kissing. There was no significant difference of turning bias between any parent-child kissing partners. Interpretations for the left-turn bias discuss parental kissing as a learned lateral behaviour.

  20. 77 FR 4989 - Turning Point Solar LLC: Notice of Availability of an Environmental Assessment

    2012-02-01

    ... monocrystalline photovoltaic panels mounted on fixed solar racking equipment and the construction of access roads... DEPARTMENT OF AGRICULTURE Rural Utilities Service Turning Point Solar LLC: Notice of Availability... possible financial assistance for a proposal by Turning Point Solar LCC (TPS). The proposal consists of...

  1. CNC Turning Center Advanced Operations. Computer Numerical Control Operator/Programmer. 444-332.

    Skowronski, Steven D.; Tatum, Kenneth

    This student guide provides materials for a course designed to introduce the student to the operations and functions of a two-axis computer numerical control (CNC) turning center. The course consists of seven units. Unit 1 presents course expectations and syllabus, covers safety precautions, and describes the CNC turning center components, CNC…

  2. The Narrative Turn and the Poetics of Resistance: Towards a New Language for Critical Educational Studies

    Peters, Michael A.; Besley, Tina

    2012-01-01

    This article argues for the adoption of a new language in critical educational studies through the "narrative turn", a turn that politicizes knowledge by drawing attention to questions concerning the meaning, construction and authorship of narratives. In the authors' interpretation going back to the poetics of early narrative forms they…

  3. 1.06 μm 150 psec laser damage study of diamond turned, diamond turned/polished and polished metal mirrors

    Saito, T.T.; Milam, D.; Baker, P.; Murphy, G.

    1975-01-01

    Using a well characterized 1.06 μm 150 ps glass laser pulse the damage characteristics for diamond turned, diamond turned/ polished, and polished copper and silver mirrors less than 5 cm diameter were studied. Although most samples were tested with a normal angle of incidence, some were tested at 45 0 with different linear polarization showing an increase in damage threshold for S polarization. Different damage mechanisms observed will be discussed. Laser damage is related to residual surface influences of the fabrication process. First attempts to polish diamond turned surfaces resulted in a significant decrease in laser damage threshold. The importance of including the heat of fusion in the one dimensional heat analysis of the theoretical damage threshold and how close the samples came to the theoretical damage threshold is discussed. (auth)

  4. Computation of the Coupling Resonance Driving term f1001 and the coupling coefficient C from turn-by-turn single-BPM data.

    Franchi, A; Vanbavinkhove, G; CERN. Geneva. BE Department

    2010-01-01

    In this note we show how to compute the Resonance Driving Term (RDT) f1001, the local resonance term chi 1010 and the coupling coefficient C from the spectrum of turn-by-turn single-BPM data. The harmonic analysis of real coordinate x(y) is model independent, conversely to the the analysis of the complex Courant-Snyder coordinate hx,- = x-ipx. From the computation of f1001 along the ring is closely related to the global coupling coefficient C, but it is affected by an intrinsic error, discussed in this note.

  5. Characterization of beta-turn and Asx-turns mimicry in a model peptide: stabilization via C--H . . . O interaction.

    Thakur, A K; Kishore, R

    2006-04-15

    The chemical synthesis and single-crystal X-ray diffraction analysis of a model peptide, Boc-Thr-Thr-NH2 (1) comprised of proteinogenic residues bearing an amphiphilic Cbeta -stereogenic center, has been described. Interestingly, the analysis of its molecular structure revealed the existence of a distinct conformation that mimics a typical beta-turn and Asx-turns, i.e., the two Thr residues occupy the left- and right-corner positions. The main-chain torsion angles of the N- and C-terminal residues i.e., semiextended: phi = -68.9 degrees , psi = 128.6 degrees ; semifolded: phi = -138.1 degrees , psi = 2.5 degrees conformations, respectively, in conjunction with a gauche- disposition of the obligatory C-terminus Thr CgammaH3 group, characterize the occurrence of the newly described beta-turn- and Asx-turns-like topology. The preferred molecular structure is suggested to be stabilized by an effective nonconventional main-chain to side-chain Ci=O . . . H--Cgamma(i+2)-type intraturn hydrogen bond. Noteworthy, the observed topology of the resulting 10-membered hydrogen-bonded ring is essentially similar to the one perceived for a classical beta-turn and the Asx-turns, stabilized by a conventional intraturn hydrogen bond. Considering the signs as well as magnitudes of the backbone torsion angles and the orientation of the central peptide bond, the overall mimicked topology resembles the type II beta-turn or type II Asx-turns. An analysis of Xaa-Thr sequences in high-resolution X-ray elucidated protein structures revealed the novel topology prevalence in functional proteins (unpublished). In view of indubitable structural as well as functional importance of nonconventional interactions in bioorganic and biomacromolecules, we intend to highlight the participation of Thr CgammaH in the creation of a short-range C=O . . . H--Cgamma -type interaction in peptides and proteins. Copyright 2006 Wiley Periodicals, Inc.

  6. A method for simultaneous linear optics and coupling correction for storage rings with turn-by-turn beam position monitor data

    Yang, Xi [Brookhaven National Laboratory, Upton, Long Island, NY 11973 (United States); Huang, Xiaobiao, E-mail: xiahuang@slac.stanford.edu [SLAC National Accelerator Laboratory, 2575 Sand Hill Road, Menlo Park, CA 94025 (United States)

    2016-08-21

    We propose a method to simultaneously correct linear optics errors and linear coupling for storage rings using turn-by-turn (TbT) beam position monitor (BPM) data. The independent component analysis (ICA) method is used to isolate the betatron normal modes from the measured TbT BPM data. The betatron amplitudes and phase advances of the projections of the normal modes on the horizontal and vertical planes are then extracted, which, combined with dispersion measurement, are used to fit the lattice model. The fitting results are used for lattice correction. The method has been successfully demonstrated on the NSLS-II storage ring.

  7. A method for simultaneous linear optics and coupling correction for storage rings with turn-by-turn beam position monitor data

    Yang, Xi [Brookhaven National Lab. (BNL), Upton, NY (United States); Huang, Xiaobiao [SLAC National Accelerator Lab., Menlo Park, CA (United States)

    2016-08-01

    We propose a method to simultaneously correct linear optics errors and linear coupling for storage rings using turn-by-turn (TbT) beam position monitor (BPM) data. The independent component analysis (ICA) method is used to isolate the betatron normal modes from the measured TbT BPM data. The betatron amplitudes and phase advances of the projections of the normal modes on the horizontal and vertical planes are then extracted, which, combined with dispersion measurement, are used to fit the lattice model. Furthermore, the fitting results are used for lattice correction. Our method has been successfully demonstrated on the NSLS-II storage ring.

  8. Targeting B7x and B7 H3 as New Immunotherapies for Prostate Cancer

    2015-09-01

    well of 2% BSA/TBS for 1 h at 37 °C. Sera from unimmunized or immunized mice were serially diluted into 96 well plates in triplicate, and incubated...then added to each well, and the plates were incubated 1 h at 25 °C before absorbance at 405 nmwasmeasured in an ELISA reader. Serial dilutions and...CD4 helper T cells over CD8 killer T was significantly higher in older p27T187A/T187Amice compared with olderWTmice (Fig. 7B). This finding suggests

  9. Virtual reality training improves turning capacity and functional reach in stroke patients

    Malik, A.N.; Masood, T.

    2017-01-01

    Objective: To determine the added effects of virtual reality training on turning capacity, gait parameters and functional reach capacity of stroke patients compared to task oriented training alone. Methodology: A randomized control trial was conducted from February 2016 to July 2106 at Physical Rehabilitation Department Pakistan Railway Hospital, Rawalpindi, Pakistan. Twenty stroke patients were selected through purposive sampling. The patients were randomly assigned through sealed envelope method into two groups; Task Oriented Training (TOT) and Virtual Reality Training (VRT) Group. The standardized tools were used for assessment. The TOT was provided for 4 days per week for 6 weeks while VRT group received additional exer-gaming training during sessions. Results: Significant improvement was observed in both groups regarding reaching forward, turning 360, gait pivot turn (p a 0.01) and FRT (p a 0.001). The two groups were statistically different from each other in terms of turning capacity, reaching forward, gait pivot turn and functional reach after 6 weeks of intervention (p a 0.05) Conclusion: Addition of virtual reality training further improves the significant improvement caused by task oriented training on turning capacity, reaching forward, gait pivot turn and functional reach in stroke patients. (author)

  10. Optical spectroscopic elucidation of beta-turns in disulfide bridged cyclic tetrapeptides.

    Borics, Attila; Murphy, Richard F; Lovas, Sándor

    2007-01-01

    Vibrational circular dichroism (VCD) spectroscopic features of type II beta-turns were characterized previously, but, criteria for differentiation between beta-turn types had not been established yet. Model tetrapeptides, cyclized through a disulfide bridge, were designed on the basis of previous experimental results and the observed incidence of amino acid residues in the i + 1 and i + 2 positions in beta-turns, to determine the features of VCD spectra of type I and II beta-turns. The results were correlated with electronic circular dichroism (ECD) spectra and VCD spectra calculated from conformational data obtained by molecular dynamics (MD) simulations. All cyclic tetrapeptides yielded VCD signals with a higher frequency negative and a lower frequency positive couplet with negative lobes overlapping. MD simulations confirmed the conformational homogeneity of these peptides in solution. Comparison with ECD spectroscopy, MD, and quantum chemical calculation results suggested that the low frequency component of VCD spectra originating from the tertiary amide vibrations could be used to distinguish between types of beta-turn structures. On the basis of this observation, VCD spectroscopic features of type II and VIII beta-turns and ECD spectroscopic properties of a type VIII beta-turn were suggested. The need for independent experimental as well as theoretical investigations to obtain decisive conformational information was recognized. Copyright 2006 Wiley Periodicals, Inc.

  11. BetaTPred: prediction of beta-TURNS in a protein using statistical algorithms.

    Kaur, Harpreet; Raghava, G P S

    2002-03-01

    beta-turns play an important role from a structural and functional point of view. beta-turns are the most common type of non-repetitive structures in proteins and comprise on average, 25% of the residues. In the past numerous methods have been developed to predict beta-turns in a protein. Most of these prediction methods are based on statistical approaches. In order to utilize the full potential of these methods, there is a need to develop a web server. This paper describes a web server called BetaTPred, developed for predicting beta-TURNS in a protein from its amino acid sequence. BetaTPred allows the user to predict turns in a protein using existing statistical algorithms. It also allows to predict different types of beta-TURNS e.g. type I, I', II, II', VI, VIII and non-specific. This server assists the users in predicting the consensus beta-TURNS in a protein. The server is accessible from http://imtech.res.in/raghava/betatpred/

  12. As the Egg Turns: Monitoring Egg Attendance Behavior in Wild Birds Using Novel Data Logging Technology

    Shaffer, Scott A.; Clatterbuck, Corey A.; Kelsey, Emma C.; Naiman, Alex D.; Young, Lindsay C.; VanderWerf, Eric A.; Warzybok, Pete; Bradley, Russell; Jahncke, Jaime; Bower, Geoff C.

    2014-01-01

    Egg turning is unique to birds and critical for embryonic development in most avian species. Technology that can measure changes in egg orientation and temperature at fine temporal scales (1 Hz) was neither readily available nor small enough to fit into artificial eggs until recently. Here we show the utility of novel miniature data loggers equipped with 3-axis (i.e., triaxial) accelerometers, magnetometers, and a temperature thermistor to study egg turning behavior in free-ranging birds. Artificial eggs containing egg loggers were deployed in the nests of three seabird species for 1–7 days of continuous monitoring. These species (1) turned their eggs more frequently (up to 6.5 turns h−1) than previously reported for other species, but angular changes were often small (1–10° most common), (2) displayed similar mean turning rates (ca. 2 turns h−1) despite major differences in reproductive ecology, and (3) demonstrated distinct diurnal cycling in egg temperatures that varied between 1.4 and 2.4°C. These novel egg loggers revealed high-resolution, three-dimensional egg turning behavior heretofore never measured in wild birds. This new form of biotechnology has broad applicability for addressing fundamental questions in avian breeding ecology, life history, and development, and can be used as a tool to monitor birds that are sensitive to disturbance while breeding. PMID:24887441

  13. Effect of surface integrity of hard turned AISI 52100 steel on fatigue performance

    Smith, Stephen; Melkote, Shreyes N.; Lara-Curzio, Edgar; Watkins, Thomas R.; Allard, Larry; Riester, Laura

    2007-01-01

    This paper addresses the relationship between surface integrity and fatigue life of hard turned AISI 52100 steel (60-62 HRC), with grinding as a benchmark. The impact of superfinishing on the fatigue performance of hard turned and ground surfaces is also discussed. Specifically, the surface integrity and fatigue life of the following five distinct surface conditions are examined: hard turned with continuous white layer, hard turned with no white layer, ground, and superfinished hard turned and ground specimens. Surface integrity of the specimens is characterized via surface topography measurement, metallography, residual stress measurements, transmission electron microscopy (TEM), and nano-indentation tests. High cycle tension-tension fatigue tests show that the presence of white layer does not adversely affect fatigue life and that, on average, the hard turned surface performs as well or better than the ground surface. The effect of superfinishing is to exaggerate these differences in performance. The results obtained from this study suggest that the effect of residual stress on fatigue life is more significant than the effect of white layer. For the hard turned surfaces, the fatigue life is found to be directly proportional to both the surface compressive residual stress and the maximum compressive residual stress. Possible explanations for the observed effects are discussed

  14. Incorporating beta-turns and a turn mimetic out of context in loop 1 of the WW domain affords cooperatively folded beta-sheets.

    Kaul, R; Angeles, A R; Jäger, M; Powers, E T; Kelly, J W

    2001-06-06

    To probe the conformational requirements of loop 1 in the Pin1 WW domain, the residues at the i + 2 and i + 3 positions of a beta-turn within this loop were replaced by dPro-Gly and Asn-Gly, which are known to prefer the conformations required at the i + 1 and i + 2 positions of type II' and type I' beta-turns. Conformational specificity or lack thereof was further examined by incorporating into the i + 2 and i + 3 positions a non-alpha-amino acid-based beta-turn mimetic (4-(2'-aminoethyl)-6-dibenzofuran propionic acid residue, 1), which was designed to replace the i + 1 and i + 2 positions of beta-turns. All these Pin WW variants are monomeric and folded as discerned by analytical ultracentrifugation, NMR, and CD. They exhibit cooperative two-state transitions and display thermodynamic stability within 0.5 kcal/mol of the wild-type WW domain, demonstrating that the acquisition of native structure and stability does not require a specific sequence and, by extension, conformation within loop 1. However, it could be that these loop 1 mutations alter the kinetics of antiparallel beta-sheet folding, which will be addressed by subsequent kinetic studies.

  15. The Third Turn toward the Social: Nancy Welch's "Living Room," Tony Scott's "Dangerous Writing," and Rhetoric and Composition's Turn toward Grassroots Political Activism

    Kinney, Kelly; Girshin, Thomas; Bowlin, Barrett

    2013-01-01

    This review essay examines recent texts by Nancy Welch and Tony Scott, both of which use embodied activism as a starting point for their inquiries. Taken together, these works point to a distinct shift in composition studies' turn toward the social, one that calls on workers both within and outside the academy to actively engage in grassroots…

  16. Part-turn gearboxes for electric actuators; Schwenkgetriebe fuer elektrische Stellantriebe

    Herbstritt, M. [Riester (W.) GmbH und Co. KG, Muellheim (Germany)

    2002-09-01

    Different types of gearboxes provide a useful complement to the electric actuator type ranges. The gearboxes can be combined with the actuators in many ways. Multi-turn actuators, for example, can be turned into part-turn actuators. When using a modular system, a suitable solution for almost any automation task in the field of industrial valves can be found. (orig.) [German] Sinnvoll ergaenzt werden elektrische Stellantriebe fuer Armaturen durch verschiedene Arten von Getrieben. Die Getriebe sind in vielfaeltiger Weise mit den Stellantrieben kombinierbar. So werden beispielsweise aus Drehantrieben Schwenkantriebe. Mit einem Baukasten-System laesst sich so fuer nahezu jede Automatisierungsaufgabe im Bereich der Industriearmaturen eine passende Loesung finden. (orig.)

  17. A gate drive circuit for gate-turn-off (GTO) devices in series stack

    Despe, O.

    1999-01-01

    A gate-turn-off (GTO) switch is under development at the Advanced Photon Source as a replacement for a thyratron switch in high power pulsed application. The high voltage in the application requires multiple GTOs connected in series. One component that is critical to the success of GTO operation is the gate drive circuit. The gate drive circuit has to provide fast high-current pulses to the GTO gate for fast turn-on and turn-off. It also has to be able to operate while floating at high voltage. This paper describes a gate drive circuit that meets these requirements

  18. Novel T-Z source inverter with high voltage gain and reduced transformer turn ratio

    Mostaan, Ali; Sharifi Malfejani, Saeed; Soltani, Mohsen

    2015-01-01

    Novel voltage source inverter based on the Z source inverter structure is introduced in this paper. In this new inverter, two inductors of the impedance network in conventional Z source inverter are replaced with two transformers or coupled inductors, but unlike the T-Z source inverter that it......'s voltage gain is raised with increasing the transformers turn ratio, the voltage gain in the proposed inverter is raised with lowering the transformer turn ratio. Therefore, transformers with lower turn ratio are required in the proposed inverter in compare with T- Z source inverter that can lead to lower...

  19. Efficiency analysis of the speed turns in the crawl stroke swimming.

    Savchenko M.I.

    2011-02-01

    Full Text Available Contemporary approaches to improving technique of the speed in the crawl stroke swimming, namely roll-forward turn were considered in the paper. The performance efficiency is defined by the time covering 15 meter distance. The students of the sports mastering group aged 16-20 took part in the experiment. The video recordings of the Ukrainian, European and World Championships and Deflympic Games, and also chronometration during the department trainings served as the experimental data. The research showed that white improving the technical level of turns performance, the attention should be paid to the exact performance of all the elements of the turns.

  20. Composting of tobacco plant waste by manual turning and forced aeration system

    Nonglak Saithep

    2009-01-01

    The efficiency of tobacco plant waste composting, by the manual turning and the forced aeration system, was compared. Tobacco plant waste, cow manure, urea fertiliser, and a compost inoculum mixture at a 100:10:0.2:0.01 ratio respectively, with 60% (w/v) moisture content, were set up in piling forms. The piles of the manual turning system were provided with turning aeration by hand at intervals of 7 days during the composting process. For the forced aeration system, each pile was aerated by a...

  1. The Lewisian turning point and international migration: the case of Japan.

    Watanabe, S

    1994-01-01

    "This article critically examines the Lewisian turning point [concerning the availability of unlimited manpower resources] in light of Japan's experience since the mid-1800s. Japan reached its Lewisian turning point around 1960. Contrary to the assumptions of the theory however, the findings for Japan indicate that political factors have been more determinative of the rate of migration than purely economic ones. Prior to its turning point in 1960, international relations, war and forced repatriation were the decisive factors. Recently, though the inflow of foreign workers to fill labor shortages has increased, so also has the outflow of Japanese to accompany direct foreign investment." excerpt

  2. A novel method for calculating the energy cost of turning during running

    Hatamoto Y

    2013-05-01

    Full Text Available Yoichi Hatamoto,1 Yosuke Yamada,2 Tatsuya Fujii,3 Yasuki Higaki,3 Akira Kiyonaga,3 Hiroaki Tanaka31Graduate School of Sports and Health Science, Fukuoka University, Nanakuma Jonan-ku Fukuoka, Japan; 2The Fukuoka University Institute for Physical Activity, Nanakuma Jonan-ku Fukuoka, Japan; 3Faculty of Sports and Health Science, Fukuoka University, Nanakuma Jonan-ku Fukuoka, JapanAbstract: Although changes of direction are one of the essential locomotor patterns in ball sports, the physiological demand of turning during running has not been previously investigated. We proposed a novel approach by which to evaluate the physiological demand of turning. The purposes of this study were to establish a method of measuring the energy expenditure (EE of a 180° turn during running and to investigate the effect of two different running speeds on the EE of a 180° turn. Eleven young, male participants performed measurement sessions at two different running speeds (4.3 and 5.4 km/hour. Each measurement session consisted of five trials, and each trial had a different frequency of turns. At both running speeds, as the turn frequency increased the gross oxygen consumption (V · O2 also increased linearly (4.3 km/hour, r = 0.973; 5.4 km/hour, r = 0.996. The V · O2 of a turn at 5.4 km/hour (0.55 [SD 0.09] mL/kg was higher than at 4.3 km/hour (0.34 [SD 0.13] mL/kg (P < 0.001. We conclude that the gross V · O2 of running at a fixed speed with turns is proportional to turn frequency and that the EE of a turn is different at different running speeds. The Different Frequency Accumulation Method is a useful tool for assessing the physiological demands of complex locomotor activity.Keywords: energy expenditure, turning, turn frequency, running speed, V · O2, heart rate

  3. Tight turns

    Anaïs Schaeffer

    2012-01-01

    The Italian National Institute for Nuclear Physics (INFN) has successfully tested the first model of a new fast-ramping curved dipole magnet. This is great news for CERN, which sees the advance as holding potential for the future of the SPS.   The first model of a new fast-ramping curved dipole magnet being prepared for cryogenic testing at the LASA laboratory (INFN Milano, Italy). On 16 July INFN introduced an innovative dipole magnet. With a length of some 4 metres, it can produce a 4.5 Tesla magnetic field and achieve a tighter bend than ever before (the bending radius has been squeezed to a remarkable 66.7 metres). This new magnet was designed in the first instance for GSI’s SIS300 synchrotron (in Germany), which will require 60 dipoles of this type. "Achieving such a tight bend demanded a major R&D effort," stressed Pasquale Fabbricatore, the spokesman of the INFN collaboration responsible for the magnet’s development. "We had to not o...

  4. Required coefficient of friction during turning at self-selected slow, normal, and fast walking speeds.

    Fino, Peter; Lockhart, Thurmon E

    2014-04-11

    This study investigated the relationship of required coefficient of friction to gait speed, obstacle height, and turning strategy as participants walked around obstacles of various heights. Ten healthy, young adults performed 90° turns around corner pylons of four different heights at their self selected normal, slow, and fast walking speeds using both step and spin turning strategies. Kinetic data was captured using force plates. Results showed peak required coefficient of friction (RCOF) at push off increased with increased speed (slow μ=0.38, normal μ=0.45, and fast μ=0.54). Obstacle height had no effect on RCOF values. The average peak RCOF for fast turning exceeded the OSHA safety guideline for static COF of μ>0.50, suggesting further research is needed into the minimum static COF to prevent slips and falls, especially around corners. Copyright © 2014 Elsevier Ltd. All rights reserved.

  5. Improved Safety and Efficiency of Protected/Permitted Right-Turns in Oregon

    2018-05-01

    This research aimed to develop an understanding of the safety and operational implications of using the flashing yellow arrow (FYA) in permitted and protected/permitted right turn (PPRT) operations to maximize safety and efficiency. This report inclu...

  6. A turn-on fluorescent sensor for the discrimination of cystein from homocystein and glutathione.

    Niu, Li-Ya; Guan, Ying-Shi; Chen, Yu-Zhe; Wu, Li-Zhu; Tung, Chen-Ho; Yang, Qing-Zheng

    2013-02-14

    We report a turn-on fluorescent sensor based on nitrothiophenolate boron dipyrromethene (BODIPY) derivatives for the discrimination of cystein (Cys) from homocystein (Hcy) and glutathione (GSH). The sensor was applied for detection of Cys in living cells.

  7. Quench analysis of pancake wound REBCO coils with low resistance between turns

    Markiewicz, W Denis; Jaroszynski, Jan J; Abraimov, Dymtro V; Joyner, Rachel E; Khan, Amanatullah

    2016-01-01

    Quench in a pancake wound REBCO superconducting coil with low resistance (LR) between turns is examined by numerical analysis. In these calculations it is generally observed that once established, quench propagates rapidly in LR coils. Large transients are induced in the azimuthal solenoid current, allowed by the LR between turns, and become self-propagating. The transition from an initial state characterized by thermal diffusion to the dynamic inductive state of quench propagation is observed. The analysis is applied to the inner coil of a 30 T magnet where the quench performance is studied as a function of the value of resistance between turns. Rapid propagation of quench is seen in calculations for resistance between turns significantly greater than the resistance reported for no-insulation coils. The influence on quench of both steel co-wind and the amount of copper in the conductor is examined through calculation of the maximum temperature and the quench propagation velocity. (paper)

  8. Aerodynamics in arbitrarily accelerating frames: application to high-g turns

    Gledhill, Irvy MA

    2010-09-01

    Full Text Available Fifth-generation missiles accelerate up to 100 g in turns, and higher accelerations are expected as agility increases. The auhtors have developed the theory of aerodynamics for arbitrary accelerations, and have validated modelling in a Computational...

  9. Aerodynamics in arbitrarily accelerating frames: application to high-g turns

    Gledhill, Irvy MA

    2010-09-01

    Full Text Available Fifth-generation missilies accelerate up to 100 g in turns, and higher accelerations are expected as agility increases. The authors have developed the theory of aerodynamics for arbitrary accelerations, and have validated modelling in a...

  10. Right-Turn Traffic Volume Adjustments in Traffic Signal Warrant Analysis

    2015-01-01

    To accomplish this research, a comprehensive literature review of existing guidelines and findings based on national and local studies was conducted. Ultimately, guidelines for consistent application for adjusting right-turn traffic volumes were deve...

  11. Analytical and Empirical Modeling of Wear and Forces of CBN Tool in Hard Turning - A Review

    Patel, Vallabh Dahyabhai; Gandhi, Anishkumar Hasmukhlal

    2017-08-01

    Machining of steel material having hardness above 45 HRC (Hardness-Rockwell C) is referred as a hard turning. There are numerous models which should be scrutinized and implemented to gain optimum performance of hard turning. Various models in hard turning by cubic boron nitride tool have been reviewed, in attempt to utilize appropriate empirical and analytical models. Validation of steady state flank and crater wear model, Usui's wear model, forces due to oblique cutting theory, extended Lee and Shaffer's force model, chip formation and progressive flank wear have been depicted in this review paper. Effort has been made to understand the relationship between tool wear and tool force based on the different cutting conditions and tool geometries so that appropriate model can be used according to user requirement in hard turning.

  12. Vehicle kinematics in turns and the role of cornering lamps in driver vision.

    2010-11-01

    "SAE Recommended Practice J852 and ECE Regulations 119 and 48 for cornering lamps : were compared. Photometric points described in each specification were then compared : to naturalistic low-speed turn trajectories produced by 87 drivers. Future loca...

  13. Emotions and Social Sciences in 20th century: The Prequel of Affective Turn

    Giazú Enciso Domínguez

    2014-02-01

    Full Text Available The Affective Turn is an innovative movement that is transforming the production of knowledge based on the study of affect and emotion. To understand the current role of emotions, we proposed a 'prequel. Telling what happened with emotions within the social sciences before the Affective Turn, and before the twentieth century. In this work we explain the present from the past, we tell the story before The History, we pay a debt to a previous work: The Affective Turn. We articulate the prequel through seven approaches: Socialconstructionism, Discursive Social Psychology, Cultural Studies of Emotions, Emocionologies, Interpretative Sociology, Sociolinguistic of Emotions and Feminist Studies of emotions. We review the interests of each approach, their schools, their past, and give hints about not only the present but the future(s of the Affective Turn, in social science and academy as well.

  14. EPA Region 8, Memo on Desktop Printer Ink Cartridges Policy & Voluntary Printer Turn-in

    This memo requests EPA Region 8 users to voluntarily turn-in their desktop printers and notifies users of the Region 8 policy to not provide maintenance or ink and toner cartridges for desktop printers.

  15. Polymer Brush Coatings Regulating Cell Behavior: Passive Interfaces Turn Into Active

    Moroni, Lorenzo; Klein Gunnewiek, Michel; Benetti, Edmondo Maria

    2014-01-01

    Material technology platforms able to modulate the communication with cells at the interface of biomaterials are being increasingly experimented on. Progress in the fabrication of supports is simultaneously introducing new surface modification strategies aimed at turning these supports from passive

  16. Very High Load Capacity Air Bearing Spindle for Large Diamond Turning Machines, Phase I

    National Aeronautics and Space Administration — Diamond turning is able to produce highly aspheric visible quality optics which can be easily aligned. Very large optical systems such as OWL and EUSO are impossible...

  17. State-of-the-art literature review on permissive/protected left-turn control.

    2013-06-01

    In spring 2010, the Illinois Department of Transportation initiated an areawide implementation to integrate the : flashing yellow arrow as the display for the left-turn permissive interval at more than 100 intersections operating : with protected/per...

  18. Buoyancy frequency profiles and internal semidiurnal tide turning depths in the oceans

    King, B.; Stone, M.; Zhang, H.P.; Gerkema, T.; Marder, M.; Scott, R.B.; Swinney, H.L.

    2012-01-01

    We examine the possible existence of internal gravity wave "turning depths," depths below which the local buoyancy frequency N(z) becomes smaller than the wave frequency. At a turning depth, incident gravity waves reflect rather than reaching the ocean bottom as is generally assumed. Here we consider internal gravity waves at the lunar semidiurnal (M-2) tidal frequency, omega(M2). Profiles of N-2(z) (the quantity in the equations of motion) are computed using conductivity, temperature, and de...

  19. Improving the safety of patient turning and repositioning tasks for caregivers.

    Fragala, Guy; Fragala, Maren

    2014-07-01

    Current evidence demonstrates why turning and positioning patients in bed presents a serious occupational risk of musculoskeletal disorders for caregivers. Results of the laboratory study investigating a new method of turning and positioning patients in bed are presented. The study was designed to evaluate how this new method reduced the risk of occupational musculoskeletal disorders to caregivers and may improve outcomes for patients. Copyright 2014, SLACK Incorporated.

  20. Bodies with noncircular cross sections and bank-to-turn missiles

    Jackson, C. M., Jr.; Sawyer, W. C.

    1992-01-01

    A development status evaluation is presented for the aerodynamics of missile configurations with noncircular cross-sections and bank-to-turn maneuvering systems, giving attention to cases with elliptical and square cross-sections, as well as bodies with variable cross-sections. The assessment of bank-to-turn missile performance notes inherent stability/control problems. A summary and index are provided for aerodynamic data on monoplanar configurations, including those which incorporate airbreathing propulsion systems.