WorldWideScience

Sample records for sequoia sempervirens dawn

  1. Clonal Spread in Second Growth Stands of Coast Redwood, Sequoia sempervirens

    Science.gov (United States)

    Vladimir Douhovnikoff; Richard S. Dodd

    2007-01-01

    Coast redwood (Sequoia sempervirens) is one of the rare conifers to reproduce successfully through clonal spread. The importance of this mode of reproduction in stand development is largely unknown. Understanding the importance of clonal spread and the spatial structure of clones is crucial for stand management strategies that would aim to maximize...

  2. Proteomic profiling of proteins associated with the rejuvenation of Sequoia sempervirens (D. Don Endl

    Directory of Open Access Journals (Sweden)

    Chen Yu-Ting

    2010-12-01

    Full Text Available Abstract Background Restoration of rooting competence is important for rejuvenation in Sequoia sempervirens (D. Don Endl and is achieved by repeatedly grafting Sequoia shoots after 16 and 30 years of cultivation in vitro. Results Mass spectrometry-based proteomic analysis revealed three proteins that differentially accumulated in different rejuvenation stages, including oxygen-evolving enhancer protein 2 (OEE2, glycine-rich RNA-binding protein (RNP, and a thaumatin-like protein. OEE2 was found to be phosphorylated and a phosphopeptide (YEDNFDGNSNVSVMVpTPpTDK was identified. Specifically, the protein levels of OEE2 increased as a result of grafting and displayed a higher abundance in plants during the juvenile and rejuvenated stages. Additionally, SsOEE2 displayed the highest expression levels in Sequoia shoots during the juvenile stage and less expression during the adult stage. The expression levels also steadily increased during grafting. Conclusion Our results indicate a positive correlation between the gene and protein expression patterns of SsOEE2 and the rejuvenation process, suggesting that this gene is involved in the rejuvenation of Sequoia sempervirens.

  3. Produção de painéis compensados fenólicos com lâminas de madeira de Sequoia sempervirens

    Directory of Open Access Journals (Sweden)

    Setsuo Iwakiri

    Full Text Available Esta pesquisa teve como objetivo avaliar a qualidade dos painéis compensados multilaminados produzidos com lâminas de madeira de Sequoia sempervirens. Foram produzidos em laboratório compensados com cinco lâminas de 2,0 mm de espessura, coladas com resina fenol-formaldeído, com duas diferentes formulações: (A FF = 100; E = 5; CC = 5; A = 5, e (B FF = 100; E = 15; CC = 15; A = 15, e duas gramaturas: 280g/m² e 320 g/m². Os painéis foram prensados com pressão específica de 10 kgf/cm², temperatura de 130 ºC e tempo de prensagem de dez minutos. Foram avaliadas as propriedades de resistência da linha de cola aos esforços de cisalhamento e de flexão estática (módulo de elasticidade e módulo de ruptura, paralelo e perpendicular às fibras. De uma forma geral, as diferentes formulações de cola e gramaturas não afetaram significativamente as propriedades dos painéis, o que representa um aspecto importante sob o ponto de vista econômico. A resistência ao cisalhamento e a percentagem de falhas na madeira dos painéis produzidos com a formulação (B atenderam aos requisitos mínimos da norma EN 314-2 (1993 para painéis de uso externo. Os resultados indicam que as lâminas de Sequoia sempervirens podem ser utilizadas para compor o miolo de painéis compensados para uso externo.

  4. Aspen Characteristics - Sequoia National Forest [ds377

    Data.gov (United States)

    California Natural Resource Agency — The database represents point locations and associated stand assessment data collected within aspen stands in the Cannell Meadows Ranger District, Sequoia National...

  5. Aspen Delineation - Sequoia National Forest [ds378

    Data.gov (United States)

    California Natural Resource Agency — The database represents delineations of aspen stands associated with stand assessment data (SEQUOIA_NF_PTS) collected in aspen stands in the Cannell Meadows Ranger...

  6. Air pollution effects on giant sequoia ecosystems.

    Science.gov (United States)

    P.R. Miller; Nancy Grulke; K.W. Stolte

    1994-01-01

    Giant sequoia [Sequoiadendron giganteum (Lindl.) Buchholz] groves are found entirely within the Sierra Nevada mixed-conifer type. Several of its companion tree species, mainly ponderosa pine (Pinus ponderosa Dougl. ex Laws.) and Jeffrey pine (P. jeffreyi Grev. & Balf.), show foliar injury after...

  7. Dawn of Science

    Indian Academy of Sciences (India)

    identification has made several historians doubt whether Imhotep really existed; probably he is no more real than Viswakarma of. Indian epics. But the man who designed the pyramids does deserve a mention while describing the dawn of science. Moving lightly over a thousand years, we come across the next milestone ...

  8. Dawn of Science

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 17; Issue 4. Dawn of Science - All was Light - 11. T Padmanabhan. Series Article Volume 17 Issue 4 April 2012 pp 324-329. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/017/04/0324-0329. Keywords.

  9. Dawn of Science

    Indian Academy of Sciences (India)

    Dawn of Science - The Healing Art. T Padmanabhan. Series Article Volume 15 Issue 10 October 2010 pp 870-874. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/015/10/0870-0874. Keywords. Surgery; Charaka Samhita; Hippocrates; acupuncture; Galen. Author Affiliations.

  10. Dawn of Science

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 16; Issue 7. Dawn of Science-The Galilean World. T Padmanabhan. Series Article Volume 16 Issue 7 July 2011 pp 663-669. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/016/07/0663-0669. Keywords.

  11. Homeopathic Doses of Gelsemium sempervirens Improve the Behavior of Mice in Response to Novel Environments

    Directory of Open Access Journals (Sweden)

    Paolo Bellavite

    2011-01-01

    Full Text Available Gelsemium sempervirens is used in homeopathy for treating patients with anxiety related symptoms, however there have been few experimental studies evaluating its pharmacological activity. We have investigated the effects of homeopathic doses of G. sempervirens on mice, using validated behavioral models. Centesimal (CH dilutions/dynamizations of G. sempervirens, the reference drug diazepam (1 mg/kg body weight or a placebo (solvent vehicle were intraperitoneally delivered to groups of mice of CD1 strain during 8 days, then the effects were assessed by the Light-Dark (LD choice test and by the Open-Field (OF exploration test, in a fully blind manner. In the LD test, the mean time spent in the illuminated area by control and placebo-treated animals was 15.98%, for mice treated with diazepam it increased to 19.91% (P = .047, while with G. sempervirens 5 CH it was 18.11% (P = .341, non-significant. The number of transitions between the two compartments increased with diazepam from 6.19 to 9.64 (P < .001 but not with G. Sempervirens. In the OF test, G. sempervirens 5 CH significantly increased the time spent and the distance traveled in the central zone (P = .009 and P = .003, resp., while diazepam had no effect on these OF test parameters. In a subsequent series of experiments, G. sempervirens 7 and 30 CH also significantly improved the behavioral responses of mice in the OF test (P < .01 for all tested variables. Neither dilutions of G. sempervirens affected the total distance traveled, indicating that the behavioral effect was not due to unspecific changes in locomotor activity. In conclusion, homeopathic doses of G. sempervirens influence the emotional responses of mice to novel environments, suggesting an improvement in exploratory behavior and a diminution of thigmotaxis or neophobia.

  12. A natural resource condition assessment for Sequoia and Kings Canyon National Parks: Appendix 11a: giant sequoias

    Science.gov (United States)

    York, Robert A.; Stephenson, Nathan L.; Meyer, Marc; Hanna, Steve; Tadashi, Moody; Caprio, Anthony C.; Battles, John J.

    2013-01-01

    For natural resource managers in the southern Sierra Nevada, giant sequoia requires very little introduction. It receives great attention as an icon of western forests and as a common namesake with the areas where it occurs. While it is a single component of a very complex system, its attention in this assessment and in general is well deserved. Giant sequoia is one of the few "destination species" that attracts a wide swath of the public by nature of it simply being present. It draws people, who otherwise may not travel, to a natural environment. The result is an expansion of the public’s sense of natural resource stewardship. Because park managers could not achieve their mission without public support, this fostering role of giant sequoia is critical for park natural resources and is important for natural resources in general. Despite its social relevance and physical size, we re-emphasize here that the giant sequoia resource is a relatively small component of the ecosystems of the southern Sierra Nevada. As is the case with all of the resources assessed in the NRCA, we focus on giant sequoia with the understanding that other resources will be considered simultaneously when evaluating management decisions that impact giant sequoia. While we attempt to explicitly address the interaction of giant sequoia with other resources and stressors, we also realize that ultimately managers will integrate much more information than is presented here when making decisions that influence giant sequoia. The autecology and management issues surrounding giant sequoia have been thoroughly reviewed elsewhere (Harvey et al. 1980, Aune 1994, Stephenson 1996). Stephenson (1996), in particular, should be reviewed when considering any management decisions that potentially impact giant sequoia. For those who may not be familiar with giant sequoia ecology, a summary of basic information is provided in a table below. In some parts of this assessment, we reproduce text from Stephenson

  13. The Dawn Topography Investigation

    Science.gov (United States)

    Raymond, C. A.; Jaumann, R.; Nathues, A.; Sierks, H.; Roatsch, T.; Preusker, E; Scholten, F.; Gaskell, R. W.; Jorda, L.; Keller, H.-U.; hide

    2011-01-01

    The objective of the Dawn topography investigation is to derive the detailed shapes of 4 Vesta and 1 Ceres in order to create orthorectified image mosaics for geologic interpretation, as well as to study the asteroids' landforms, interior structure, and the processes that have modified their surfaces over geologic time. In this paper we describe our approaches for producing shape models, plans for acquiring the needed image data for Vesta, and the results of a numerical simulation of the Vesta mapping campaign that quantify the expected accuracy of our results. Multi-angle images obtained by Dawn's framing camera will be used to create topographic models with 100 m/pixel horizontal resolution and 10 m height accuracy at Vesta, and 200 m/pixel horizontal resolution and 20 m height accuracy at Ceres. Two different techniques, stereophotogrammetry and stereophotoclinometry, are employed to model the shape; these models will be merged with the asteroidal gravity fields obtained by Dawn to produce geodetically controlled topographic models for each body. The resulting digital topography models, together with the gravity data, will reveal the tectonic, volcanic and impact history of Vesta, and enable co-registration of data sets to determine Vesta's geologic history. At Ceres, the topography will likely reveal much about processes of surface modification as well as the internal structure and evolution of this dwarf planet.

  14. Cosmic Dawn with WFIRST

    Science.gov (United States)

    Rhoads, James

    Central objectives: WFIRST-AFTA has tremendous potential for studying the epoch of "Cosmic Dawn" the period encompassing the formation of the first galaxies and quasars, and their impact on the surrounding universe through cosmological reionization. Our goal is to ensure that this potential is realized through the middle stages of mission planning, culminating in designs for both WFIRST and its core surveys that meet the core objectives in dark energy and exoplanet science, while maximizing the complementary Cosmic Dawn science. Methods: We will consider a combined approach to studying Cosmic Dawn using a judicious mixture of guest investigator data analysis of the primary WFIRST surveys, and a specifically designed Guest Observer program to complement those surveys. The Guest Observer program will serve primarily to obtain deep field observations, with particular attention to the capabilities of WFIRST for spectroscopic deep fields using the WFI grism. We will bring to bear our years of experience with slitless spectroscopy on the Hubble Space Telescope, along with an expectation of JWST slitless grism spectroscopy. We will use this experience to examine the implications of WFIRST’s grism resolution and wavelength coverage for deep field observations, and if appropriate, to suggest potential modifications of these parameters to optimize the science return on WFIRST. We have assembled a team of experts specializing in (1) Lyman Break Galaxies at redshifts higher than 7 (2) Quasars at high redshifts (3) Lyman-alpha galaxies as probes of reionization (4) Theoretical simulations of high-redshift galaxies (5) Simulations of grism observations (6) post-processing analysis to find emission line galaxies and high redshift galaxies (7) JWST observations and calibrations. With this team we intend to do end-to-end simulations starting with halo populations and expected spectra of high redshift galaxies and finally extracting what we can learn about (a) reionization

  15. Tracing Cosmic Dawn

    Science.gov (United States)

    Fialkov, Anastasia

    2018-05-01

    Observational effort is on the way to probe the 21-cm of neutral hydrogen from the epochs of Reionization and Cosmic Dawn. Our current poor knowledge of high redshift astrophysics results in a large uncertainty in the theoretically predicted 21-cm signal. A recent parameter study that is highlighted here explores the variety of 21-cm signals resulting from viable astrophysical scenarios. Model-independent relations between the shape of the signal and the underlying astrophysics are discussed. Finally, I briefly note on possible alternative probes of the high redshift Universe, specifically Fast Radio Bursts.

  16. Nectar and pollen production in Arabis procurrens Waldst. & Kit. and Iberis sempervirens L. (Brassicaceae

    Directory of Open Access Journals (Sweden)

    Monika Strzałkowska-Abramek

    2016-04-01

    Full Text Available Ecological environment in urban areas is specific in many aspects. There are evidences that ornamental plants cultivated in local urban gardens may help in conservation of pollinators. In this study, the flowering pattern, the abundance of flowering, nectar and pollen production as well as insect visitation in Arabis procurrens Waldst. & Kit. and Iberis sempervirens L. were investigated. The species were grown in the UMCS Botanical Garden in Lublin, southeastern Poland. Arabis procurrens bloomed from the middle of April until middle of May and I. sempervirens from the end of April until middle of June. In both species, most flowers opened in the morning hours (40–45% of total were opened by 8:00 h GMT + 2 h. The average sugar yield of A. procurrens was ca. 53% lower compared to I. sempervirens (mean = 1.08 g/m2 and 2.32 g/m2, respectively. In both species, considerable differences in the amount of produced sugars were noted between years. The mass of pollen produced in the flowers of A. procurrens was approx. 35% lower compared to that of I. sempervirens (mean = 0.06 mg and 0.09 mg per flower, respectively. Pollen produced per unit area was correlated with the number of flowers. On average, the species produced 1.46 g (A. procurrens and 2.54 g (I. sempervirens of pollen per 1 m2. The flowers of A. procurrens attracted mainly dipterans (56.3% of total visitors, while I. sempervirens lured chiefly solitary bees (47.4% of total visitors, however in both cases, honeybees, bumblebees and lepidopterans were also recorded. The A. procurrens and I. sempervirens due to flowering in early spring period may be promoted for use in small gardens (rock or pot gardens for both aesthetic value and as plants that support insect visitors in nectar and pollen rewards.

  17. Dawn Mission Update

    Science.gov (United States)

    Sykes, M. V.; Russell, C. T.; Coradini, A.; Christensen, U.; de Sanctis, M. C.; Feldman, W. C.; Jaumann, R.; Keller, U.; Konopliv, A. S.; McCord, T. B.; McFadden, L. A.; McSween, H. Y.; Mottola, S.; Neukum, G.; Pieters, C. M.; Prettyman, T. H.; Raymond, C. A.; Smith, D. E.; Williams, B. G.; Wise, J.; Zuber, M. T.

    2004-11-01

    Dawn, the ninth Discovery mission, will be the first spacecraft to rendezvous with two solar system bodies, the main belt asteroids Vesta and Ceres. This is made possible by utilizing ion propulsion to reach its targets and to maneuver into (and depart) orbits about these bodies. Vesta and Ceres are two terrestrial protoplanets that have survived since the earliest epoch of the solar system and will provide important insights into planet building processes and their evolution under very different circumstances, with and without water. Dawn carries a double framing camera, a visible and infrared mapping spectrometer, and a gamma ray and neutron detector. At Vesta our studies will include the volcanic emplacement of basalts, its differentiation, the possible exposure of its interior near the south pole. At Ceres our studies will include the role of water in its evolution, hydration processes on its surface, and the possible existence of a subsurface ocean. The mission has passed its critical design review and is scheduled to be launched in June 2006 with arrival at Vesta in 2011 and Ceres in 2015. Operation strategies will be presented. Groundbased observations of Vesta, Ceres, and Vesta family members over broad wavelengths, periods and phases will play an important role in detailed mission planning.

  18. Experimental neuropharmacology of Gelsemium sempervirens: Recent advances and debated issues.

    Science.gov (United States)

    Bellavite, Paolo; Bonafini, Clara; Marzotto, Marta

    Gelsemium sempervirens L. (Gelsemium) is traditionally used for its anxiolytic-like properties and its action mechanism in laboratory models are under scrutiny. Evidence from rodent models was reported suggesting the existence of a high sensitivity of central nervous system to anxiolytic power of Gelsemium extracts and Homeopathic dilutions. In vitro investigation of extremely low doses of this plant extract showed a modulation of gene expression of human neurocytes. These studies were criticized in a few commentaries, generated a debate in literature and were followed by further experimental studies from various laboratories. Toxic doses of Gelsemium cause neurological signs characterized by marked weakness and convulsions, while ultra-low doses or high Homeopathic dilutions counteract seizures induced by lithium and pilocarpine, decrease anxiety after stress and increases the anti-stress allopregnanolone hormone, through glycine receptors. Low (non-Homeopathic) doses of this plant or its alkaloids decrease neuropathic pain and c-Fos expression in mice brain and oxidative stress. Due to the complexity of the matter, several aspects deserve interpretation and the main controversial topics, with a focus on the issues of high dilution pharmacology, are discussed and clarified. Copyright © 2017 Transdisciplinary University, Bangalore and World Ayurveda Foundation. Published by Elsevier B.V. All rights reserved.

  19. 78 FR 66380 - Final Environmental Impact Statement for the Restoration of the Mariposa Grove of Giant Sequoias...

    Science.gov (United States)

    2013-11-05

    ... sequoia habitat, wetlands, and soundscapes within the Mariposa Grove, this alternative would relocate... for restoration of wetlands, soundscapes, and giant sequoia habitat within the Mariposa Grove by...

  20. Comparative Analysis of Gelsemine and Gelsemium sempervirens Activity on Neurosteroid Allopregnanolone Formation in the Spinal Cord and Limbic System

    Directory of Open Access Journals (Sweden)

    Christine Venard

    2011-01-01

    Full Text Available Centesimal dilutions (5, 9 and 15 cH of Gelsemium sempervirens are claimed to be capable of exerting anxiolytic and analgesic effects. However, basic results supporting this assertion are rare, and the mechanism of action of G. sempervirens is completely unknown. To clarify the point, we performed a comparative analysis of the effects of dilutions 5, 9 and 15 cH of G. sempervirens or gelsemine (the major active principle of G. sempervirens on allopregnanolone (3α,5α-THP production in the rat limbic system (hippocampus and amygdala or H-A and spinal cord (SC. Indeed, H-A and SC are two pivotal structures controlling, respectively, anxiety and pain that are also modulated by the neurosteroid 3α,5α-THP. At the dilution 5 cH, both G. sempervirens and gelsemine stimulated [3H]progesterone conversion into [3H]3α,5α-THP by H-A and SC slices, and the stimulatory effect was fully (100% reproducible in all assays. The dilution 9 cH of G. sempervirens or gelsemine also stimulated 3α,5α-THP formation in H-A and SC but the reproducibility rate decreased to 75%. At 15 cH of G. sempervirens or gelsemine, no effect was observed on 3α,5α-THP neosynthesis in H-A and SC slices. The stimulatory action of G. sempervirens and gelsemine (5 cH on 3α,5α-THP production was blocked by strychnine, the selective antagonist of glycine receptors. Altogether, these results, which constitute the first basic demonstration of cellular effects of G. sempervirens, also offer interesting possibilities for the improvement of G. sempervirens-based therapeutic strategies.

  1. Meet EPA researcher Dawn King

    Science.gov (United States)

    Research microbiologist Dawn King works in EPA’s National Exposure Research Laboratory where she identifies and assesses the health risk of microbial pathogens in water. This is her researchers at work profile.

  2. The dawn of freudism

    Directory of Open Access Journals (Sweden)

    Renato Barilli

    2013-02-01

    Full Text Available The author is a follower of the so called cultural materialism, which invites us to put the incoming of a new technology at the origin of each cultural age. A big rupture  arrived at the end of the 18th century, when scientists (as Galvani and Volta realized the first discoveries concerning electromagnetism. Such discoveries led to establish that matter is mainly energy, so opening a path which had to reach  the audacious conclusions due to Einstein’s relativism. But at the same time some writers and visual artists (Blake, Goethe, Alfieri, Foscolo, Leopardi discovered that a corresponding energy exists also into each of us. By this way they anticipated on a psychological level the intuitions  which should come from  Freud and his psychoanalisis. So we may conclude that at the end of i8th century there was a kind  of dawn both of technetronic era  and  of psychoanalysis.

  3. Communicating the role of science in managing giant sequoia groves

    Science.gov (United States)

    Douglas D. Pilrto; Robert R. Rogers; Mary Chislock Bethke

    1997-01-01

    Management of giant sequoia groves has been and continues to be a hotly debated issue. The debate has reached Congress, with all parties seeking resolution as to what constitutes an ecologically and publicly acceptable management approach. Determining the correct management approach and communicating that approach to the general public is the crux of the problem....

  4. Management of Giant Sequoia on Mountain Home Demonstration State Forest

    Science.gov (United States)

    Norman J. Benson

    1986-01-01

    Established in 1946, the Mountain Home Demonstration State Forest, Tulare County, California, is managed by the California Department of Forestry. It is a multiple-use forest with recreation as its primary focus, although timber management has always played an important role. Giant sequoia (Sequoiadendron giganteum [Lindl. ] Buchholz) occurs in...

  5. Landscape-scale variation in canopy water content of giant sequoias during drought

    Science.gov (United States)

    Paz-Kagan, Tarin; Vaughn, Nicolas R.; Martin, Roberta E.; Brodrick, Philip G.; Stephenson, Nathan L.; Das, Adrian; Nydick, Koren R.; Asner, Gregory P.

    2018-01-01

    Recent drought (2012–2016) caused unprecedented foliage dieback in giant sequoias (Sequoiadendron giganteum), a species endemic to the western slope of the southern Sierra Nevada in central California. As part of an effort to understand and map sequoia response to droughts, we studied the patterns of remotely sensed canopy water content (CWC), both within and among sequoia groves in two successive years during the drought period (2015 and 2016). Our aims were: (1) to quantify giant sequoia responses to severe drought stress at a landscape scale using CWC as an indicator of crown foliage status, and (2) to estimate the effect of environmental correlates that mediate CWC change within and among giant sequoia groves. We utilized airborne high fidelity imaging spectroscopy (HiFIS) and light detection and ranging (LiDAR) data from the Carnegie Airborne Observatory to assess giant sequoia foliage status during 2015 and 2016 of the 2012–2016 droughts. A series of statistical models were generated to classify giant sequoias and to map their location in Sequoia and Kings Canyon National Parks (SEKI) and vicinity. We explored the environmental correlates and the spatial patterns of CWC change at the landscape scale. The mapped CWC was highly variable throughout the landscape during the two observation years, and proved to be most closely related to geological substrates, topography, and site-specific water balance. While there was an overall net gain in sequoia CWC between 2015 and 2016, certain locations (lower elevations, steeper slopes, areas more distant from surface water sources, and areas with greater climate water deficit) showed CWC losses. In addition, we found greater CWC loss in shorter sequoias and those growing in areas with lower sequoia stem densities. Our results suggest that CWC change indicates sequoia response to droughts across landscapes. Long-term monitoring of giant sequoia CWC will likely be useful for modeling and predicting their population

  6. Coping with gravity: the foliar water relations of giant sequoia.

    Science.gov (United States)

    Williams, Cameron B; Reese Næsborg, Rikke; Dawson, Todd E

    2017-10-01

    In tall trees, the mechanisms by which foliage maintains sufficient turgor pressure and water content against height-related constraints remain poorly understood. Pressure-volume curves generated from leafy shoots collected crown-wide from 12 large Sequoiadendron giganteum (Lindley) J. Buchholz (giant sequoia) trees provided mechanistic insights into how the components of water potential vary with height in tree and over time. The turgor loss point (TLP) decreased with height at a rate indistinguishable from the gravitational potential gradient and was controlled by changes in tissue osmotica. For all measured shoots, total relative water content at the TLP remained above 75%. This high value has been suggested to help leaves avoid precipitous declines in leaf-level physiological function, and in giant sequoia was controlled by both tissue elasticity and the balance of water between apoplasm and symplasm. Hydraulic capacitance decreased only slightly with height, but importantly this parameter was nearly double in value to that reported for other tree species. Total water storage capacity also decreased with height, but this trend essentially disappeared when considering only water available within the typical range of water potentials experienced by giant sequoia. From summer to fall measurement periods we did not observe osmotic adjustment that would depress the TLP. Instead we observed a proportional shift of water into less mobile apoplastic compartments leading to a reduction in hydraulic capacitance. This collection of foliar traits allows giant sequoia to routinely, but safely, operate close to its TLP, and suggests that gravity plays a major role in the water relations of Earth's largest tree species. © The Author 2017. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  7. Biological and Management Implications of Fire-Pathogen Interactions in the Giant Sequoia Ecosystem

    Science.gov (United States)

    Douglas D. Piirto; John R. Parmeter; Fields W. Cobb; Kevin L. Piper; Amy C. Workinger; William J. Otrosina

    1998-01-01

    An overriding management goal for national parks is the maintenance or, where necessary, the restoration of natural ecological processes. In Sequoia-Kings Canyon and Yosemite National Parks, there is concern about the effects of fire suppression on the giant sequoia-mixed conifer forest ecosystem. The National Park Service is currently using prescribed fire management...

  8. 78 FR 16294 - Draft Environmental Impact Statement for Restoration of the Mariposa Grove of Giant Sequoias...

    Science.gov (United States)

    2013-03-14

    ... Environmental Impact Statement for Restoration of the Mariposa Grove of Giant Sequoias, Yosemite National Park, Madera, and Mariposa Counties, CA AGENCY: National Park Service, Interior. ACTION: Notice of availability... the Mariposa Grove of giant sequoias in Yosemite National Park. This Draft EIS presents three...

  9. Visual Impacts of Prescribed Burning on Mixed Conifer and Giant Sequoia Forests

    Science.gov (United States)

    Lin Cotton; Joe R. McBride

    1987-01-01

    Prescribed burning programs have evolved with little concern for the visual impact of burning and the potential prescribed burning can have in managing the forest scene. Recent criticisms by the public of the prescribed burning program at Sequoia National Park resulted in an outside review of the National Park fire management programs in Sequoia, Kings Canyon, and...

  10. The Dawn of Vesta Science

    Science.gov (United States)

    Garner, Charles E.; Rayman, Marc D.; Brophy, John R.; Mikes, Steven C.

    2011-01-01

    The Dawn mission is part of NASA's Discovery Program and has as its goal the scientific exploration of the two most massive main-belt asteroids, Vesta and Ceres. The Dawn spacecraft was launched from the Cape Canaveral Air Force Station on September 27, 2007 on a Delta-II 7925H-9.5 (Delta-II Heavy) rocket that placed the 1218-kg spacecraft onto an Earth-escape trajectory. On-board the spacecraft is an ion propulsion system (IPS) developed at the Jet Propulsion Laboratory which will provide a total ?V of 11.3 km/s for the heliocentric transfer to Vesta, orbit capture at Vesta, transfer between Vesta science orbits, departure and escape from Vesta, heliocentric transfer to Ceres, orbit capture at Ceres, and transfer between Ceres science orbits. Fullpower thrusting from December 2007 through October 2008 was used to successfully target a Mars gravity assist flyby in February 2009 that provided an additional ?V of 2.6 km/s. Deterministic thrusting for the heliocentric transfer to Vesta resumed in June 2009 and concluded with orbit capture at Vesta on July 16, 2011. An additional 210 hours of IPS thrusting was used to enter the first Vesta science orbit, called Survey orbit, on August 3, 2011 at an altitude of approximately 2,735 km. To date the IPS has been operated for 23,621 hours, consumed approximately 252 kg of xenon, and provided a delta-V of approximately 6.7 km/s. The IPS performance characteristics are very close to the expected performance based on analysis and testing performed pre-launch. The only significant issue in over the almost four years of IPS operations in flight was the temporary failure of a valve driver board in the Digital Control and Interface Unit-1 (DCIU-1), resulting in a loss of thrust of approximately 29 hours. Thrusting operations resumed after switching to DCIU-2, and power cycling conducted after orbit capture restored DCIU-1 to full functionality. After about three weeks of Survey orbit operations the IPS will be used to transfer the

  11. Remote measurement of canopy water content in giant sequoias (Sequoiadendron giganteum) during drought

    Science.gov (United States)

    Martin, Roberta E.; Asner, Gregory P.; Francis, Emily; Ambrose, Anthony; Baxter, Wendy; Das, Adrian J.; Vaughn, Nicolas R.; Paz-Kagan, Tarin; Dawson, Todd E.; Nydick, Koren R.; Stephenson, Nathan L.

    2018-01-01

    California experienced severe drought from 2012 to 2016, and there were visible changes in the forest canopy throughout the State. In 2014, unprecedented foliage dieback was recorded in giant sequoia (Sequoiadendron giganteum) trees in Sequoia National Park, in the southern California Sierra Nevada mountains. Although visible changes in sequoia canopies can be recorded, biochemical and physiological responses to drought stress in giant sequoia canopies are not well understood. Ground-based measurements provide insight into the mechanisms of drought responses in trees, but are often limited to few individuals, especially in trees of tall stature such as giant sequoia. Recent studies demonstrate that remotely measured forest canopy water content (CWC) is a general indicator of canopy response to drought, but the underpinning leaf- to canopy-level causes of observed variation in CWC remain poorly understood. We combined field and airborne remote sensing measurements taken in 2015 and 2016 to assess the biophysical responses of giant sequoias to drought. In 49 study trees, CWC was related to leaf water potential, but not to the other foliar traits, suggesting that changes in CWC were made at whole-canopy rather than leaf scales. We found a non-random, spatially varying pattern in mapped CWC, with lower CWC values at lower elevation and along the outer edges of the groves. This pattern was also observed in empirical measurements of foliage dieback from the ground, and in mapped CWC across multiple sequoia groves in this region, supporting the hypothesis that drought stress is expressed in canopy-level changes in giant sequoias. The fact that we can clearly detect a relationship between CWC and foliage dieback, even without taking into account prior variability or new leaf growth, strongly suggests that remotely sensed CWC, and changes in CWC, are a useful measure of water stress in giant sequoia, and valuable for assessing and managing these iconic forests in drought.

  12. Drug Abuse Warning Network (DAWN-2011)

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Drug Abuse Warning Network (DAWN) is a nationally representative public health surveillance system that has monitored drug related emergency department (ED)...

  13. Drug Abuse Warning Network (DAWN-2006)

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Drug Abuse Warning Network (DAWN) is a nationally representative public health surveillance system that has monitored drug related emergency department (ED)...

  14. Drug Abuse Warning Network (DAWN-2005)

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Drug Abuse Warning Network (DAWN) is a nationally representative public health surveillance system that has monitored drug related emergency department (ED)...

  15. Drug Abuse Warning Network (DAWN-2007)

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Drug Abuse Warning Network (DAWN) is a nationally representative public health surveillance system that has monitored drug related emergency department (ED)...

  16. Drug Abuse Warning Network (DAWN-2004)

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Drug Abuse Warning Network (DAWN) is a nationally representative public health surveillance system that has monitored drug related emergency department (ED)...

  17. Drug Abuse Warning Network (DAWN-2009)

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Drug Abuse Warning Network (DAWN) is a nationally representative public health surveillance system that has monitored drug related emergency department (ED)...

  18. Drug Abuse Warning Network (DAWN-2010)

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Drug Abuse Warning Network (DAWN) is a nationally representative public health surveillance system that has monitored drug related emergency department (ED)...

  19. Drug Abuse Warning Network (DAWN-2008)

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Drug Abuse Warning Network (DAWN) is a nationally representative public health surveillance system that has monitored drug related emergency department (ED)...

  20. Multiyear impacts of partial throughfall exclusion on Buxus sempervirens in a Mediterranean forest

    Energy Technology Data Exchange (ETDEWEB)

    Rodriguez-Calcerrada, J.; Letts, M. G.; Rolo, V.; Roset, S.; Rambal, S.

    2013-09-01

    Aim of study:We examined the impact of sustained partial throughfall exclusion on the functional performance of Buxus sempervirens L. in the understory of a Mediterranean evergreen forest. We further considered whether any impacts of throughfall exclusion were affected by light availability. Area of study: The study was conducted in the south of France. Material and methods: Several leaf physiological and branch structural traits were measured along a light gradient after seven years from the onset of a throughfall exclusion experiment (TEE). The results were analysed along with annual growth and survival data. Main results: Plant mortality was nil in both the throughfall exclusion and control treatments. Stem diameter growth was reduced by 39% in plants subjected to throughfall exclusion, but this difference was only significant at the p = 0.10 significance level. Leaf physiology remained unaffected by the TEE, but small changes were evident in branch structural traits in high light microsites following throughfall exclusion; branches had lower wood density in the TEE plot, and more biomass was partitioned to leaves relative to stems. Research highlights: These changes do not seem to reflect an acclimatory response that would enhance drought tolerance. Instead, we suggest that these drought effects might exacerbate vulnerability to xylem cavitation in the more open microsites. Reduced growth and increased vulnerability to drought may indicate an incipient decline in plant vitality following TEE. The extension of observations to the whole-plant level and longer periods will elucidate the consequences of these observations for plant fitness, and permit verification of the positive effect of shade on Buxus sempervirens under increased drought. (Author)

  1. Dawn at Vesta: testing the protoplanetary paradigm

    Science.gov (United States)

    Russell, C.T.; Raymond, C.A.; Coradini, A.; McSween, H.Y.; Zuber, M.T.; Nathues, A.; DeSanctis, Maria-Cristina; Jaumann, R.; Konopliv, A.S.; Preusker, F.; Asmar, S.W.; Park, R.S.; Gaskell, R.; Keller, H.U.; Mottola, S.; Roatsch, T.; Scully, J.E.C.; Smith, D.E.; Tricarico, P.; Toplis, M.J.; Christensen, U.R.; Feldman, W.C.; Lawrence, D.J.; McCoy, T.J.; Prettyman, T.H.; Reedy, R.C.; Sykes, M.E.; Titus, T.N.

    2012-01-01

    The Dawn spacecraft targeted 4 Vesta, believed to be a remnant intact protoplanet from the earliest epoch of solar system formation, based on analyses of howardite-eucrite-diogenite (HED) meteorites that indicate a differentiated parent body. Dawn observations reveal a giant basin at Vesta's south pole, whose excavation was sufficient to produce Vesta-family asteroids (Vestoids) and HED meteorites. The spatially resolved mineralogy of the surface reflects the composition of the HED meteorites, confirming the formation of Vesta's crust by melting of a chondritic parent body. Vesta's mass, volume, and gravitational field are consistent with a core having an average radius of 107 to 113 kilometers, indicating sufficient internal melting to segregate iron. Dawn's results confirm predictions that Vesta differentiated and support its identification as the parent body of the HEDs.

  2. GRIP DOPPLER AEROSOL WIND LIDAR (DAWN) V1

    Data.gov (United States)

    National Aeronautics and Space Administration — The GRIP Doppler Aerosol WiNd Lidar (DAWN) Dataset was collected by the Doppler Aerosol WiNd (DAWN), a pulsed lidar, which operated aboard a NASA DC-8 aircraft...

  3. Modeling mountain pine beetle habitat suitability within Sequoia National Park

    Science.gov (United States)

    Nguyen, Andrew

    Understanding significant changes in climate and their effects on timber resources can help forest managers make better decisions regarding the preservation of natural resources and land management. These changes may to alter natural ecosystems dependent on historical and current climate conditions. Increasing mountain pine beetle (MBP) outbreaks within the southern Sierra Nevada are the result of these alterations. This study better understands MPB behavior within Sequoia National Park (SNP) and model its current and future habitat distribution. Variables contributing to MPB spread are vegetation stress, soil moisture, temperature, precipitation, disturbance, and presence of Ponderosa (Pinus ponderosa) and Lodgepole (Pinus contorta) pine trees. These variables were obtained using various modeled, insitu, and remotely sensed sources. The generalized additive model (GAM) was used to calculate the statistical significance of each variable contributing to MPB spread and also created maps identifying habitat suitability. Results indicate vegetation stress and forest disturbance to be variables most indicative of MPB spread. Additionally, the model was able to detect habitat suitability of MPB with a 45% accuracy concluding that a geospatial driven modeling approach can be used to delineate potential MPB spread within SNP.

  4. Dawn: Testing Paradigms by Exploring Dichotomies

    Science.gov (United States)

    Russell, C. T.; Schmidt, B. E.; Wise, J.; Ristvey, J.; Raymond, C. A.

    2010-12-01

    NASA’s Dawn mission represents a series of “firsts” for major NASA missions. Dawn is the first major NASA science mission to use ion propulsion engines, allowing Dawn to be the first mission to orbit one target and then leave its gravity well to explore a second destination. Dawn is the first science mission to the main asteroid belt, reaching protoplanet Vesta in summer 2011, and will be the first mission to reach a “dwarf planet” when it arrives at Ceres in 2015. By targeting both Vesta and Ceres, Dawn explores two intriguing dichotomies in the solar system, that of the dry rocky planets and the wet icy bodies (Fire and Ice) and the dichotomy between planets and asteroids. Is there a clear dividing line here? Vesta, the second most massive asteroid, is a protoplanet: a round, mostly intact asteroid that bears more resemblance to a planet than to smaller asteroids. Vesta is also the likely parent body of the HED meteorites that richly populate Earth’s meteorite collections. It is possible to hold a piece of Vesta in your hands. From the HED meteorites, scientists have learned the Vesta is one of few differentiated asteroids. And from its spectrum, rich in basaltic minerals, it is known to be much like a mini-version of Earth’s Moon and Mercury. Vesta’s surface once was home to floods of lava not unlike those found still today on the Earth. Vesta is very similar to a terrestrial planet. Ceres is the giant of the asteroid belt with a hydrostatic shape that earns it a dwarf planet classification. Like its larger cousins, Ceres’ round shape suggests that the body may be differentiated, but due to its low density, Ceres’ interior is more like an icy moon of Jupiter. Beneath a relatively thin clay veneer probably lies an ice-rich mantle and rocky core, and even possibly a liquid ocean. With such enticing questions posed for Vesta and Ceres, Dawn will enable scientists and the public alike to explore how planets were born, how fire and ice have shaped

  5. 76 FR 75558 - Environmental Impact Statement for Restoration of the Mariposa Grove of Giant Sequoias, Yosemite...

    Science.gov (United States)

    2011-12-02

    ... tree. Fire plays an important role in giant sequoia ecology, creating canopy openings and releasing soil nutrients needed for seedling establishment. Fire scars on the trees indicate that fires occurred... and sites within the Grove include the parking areas, gift shop, ticket booth, tram staging area...

  6. The spectral response of Buxus sempervirens to different types of environmental stress - A laboratory experiment

    Science.gov (United States)

    de Jong, Steven M.; Addink, Elisabeth A.; Hoogenboom, Priscilla; Nijland, Wiebe

    2012-11-01

    The European Mediterranean regions are expected to encounter drier summer conditions and warmer temperatures for the winter of +2 °C and of +5 °C for the summer in the next six decennia. As a result the natural vegetation will face harsher conditions due to lower water availability, longer summer droughts and higher temperatures resulting in plant stress conditions. To monitor vegetation conditions like stress and leaf area index dynamics in our study area in Mediterranean France we use earth observation techniques like imaging spectroscopy. To assist image analysis interpretation we carried out a laboratory experiment to investigate the spectral and visible response of Buxus sempervirens, a common Mediterranean species, to five different types of stress: drought, drought-and-heat, light deprivation, total saturation and chlorine poisoning. For 52 days plants were subjected to stress. We collected data on the visible and spectral signs, and calculated thirteen vegetation indices. The plant's response time to different stress types varied from 10 to 32 days. Spectroscopic techniques revealed plant stress up to 15 days earlier than visual inspection. Visible signs of stress of the plants included curling and shrinking of the leaves, de-colouring of the leaves, leaves becoming breakable, opening up of the plant's canopy and sagging of the branches. Spectral signs of stress occurred first in the water absorption bands at 1450 and 1940 nm, followed by reduced absorption in the visible wavelengths, and next by reduced reflectance in near infrared. Light deprivation did not result in any stress signs, while drought, drought and heat and chlorine poisoning resulted in significant stress. The spectral response did not show differences for different stress types. Analysis of the vegetation indices identified the Carter-2 (R695/R760), the Red-Green Index (R690/R550) and the Vogelman-2 (R734 - R747)/(R715 + R726) as the best performing ones to identify stress. The lab

  7. Ceres' Geophysical Evolution Inferred from Dawn Data

    Science.gov (United States)

    Castillo-Rogez, Julie; Bowling, Timothy; Ermakov, Anton I.; Fu, Roger; Park, Ryan; Raymond, Carol; De Sanctis, Maria Cristina; Ammannito, Eleonora; Ruesch, Ottaviano; Prettyman, Thomas H.; Y McSween, Harry; Toplis, Michael J.; Russell, Christopher T.; Dawn Team

    2016-10-01

    If Ceres formed as an ice-rich body, as suggested by its low density and the detection of ammoniated phyllosilicates [1], then it should have differentiated an ice-dominated shell, analogous to large icy satellites [2]. Instead, Dawn observations revealed an enrichment of Ceres' shell in strong materials, either a rocky component and/or salts and gas hydrates [3, 4, 5, 6]. We have explored several scenarios for the emplacement of Ceres' surface. Endogenic processes cannot account for its overall homogeneity. Instead we suggest that Ceres differentiated an icy shell upon freezing of its early ocean that was removed as a consequence of frequent exposure by impacting after the dwarf planet migrated from a cold accretional environment to the warmer outer main belt (or when the solar nebula dissipated, if Ceres formed in situ). This scenario implies that Ceres' current surface represents the interface between the original ice shell and the top of the frozen ocean, a region that is extremely rich chemistry-wise, as illustrated by the mineralogical observations returned by Dawn [7]. Thermal modeling shows that the shell could remain warm over the long term and offer a setting for the generation of brines that may be responsible for the emplacement of Ahuna Mons [8] and Occator's bright spots [7] on an otherwise homogeneous surface [9]. An important implication is that Ceres' surface offers an analog for better understanding the deep interior and chemical evolution of large ice-rich bodies.References: [1] De Sanctis et al., Nature, 2015; [2] McCord and Sotin, Journal of Geophysical Research, 2005; [3] Park et al., Nature, 2016 (in press); [4] Hiesinger et al., Science (submitted); [5] Bland et al., Nature Geoscience, 2016 (in press); [6] Fu et al., AGU Fall Meeting, 2015 [7] De Sanctis et al., Nature, 2016 (in press); [8] Ruesch et al., Science, in revision; [9] Ammannito et al., Science, 2016 (accepted).Acknowledgements: Part of this work is being carried out at the Jet

  8. Estimating Leaf Water Potential of Giant Sequoia Trees from Airborne Hyperspectral Imagery

    Science.gov (United States)

    Francis, E. J.; Asner, G. P.

    2015-12-01

    Recent drought-induced forest dieback events have motivated research on the mechanisms of tree survival and mortality during drought. Leaf water potential, a measure of the force exerted by the evaporation of water from the leaf surface, is an indicator of plant water stress and can help predict tree mortality in response to drought. Scientists have traditionally measured water potentials on a tree-by-tree basis, but have not been able to produce maps of tree water potential at the scale of a whole forest, leaving forest managers unaware of forest drought stress patterns and their ecosystem-level consequences. Imaging spectroscopy, a technique for remote measurement of chemical properties, has been used to successfully estimate leaf water potentials in wheat and maize crops and pinyon-pine and juniper trees, but these estimates have never been scaled to the canopy level. We used hyperspectral reflectance data collected by the Carnegie Airborne Observatory (CAO) to map leaf water potentials of giant sequoia trees (Sequoiadendron giganteum) in an 800-hectare grove in Sequoia National Park. During the current severe drought in California, we measured predawn and midday leaf water potentials of 48 giant sequoia trees, using the pressure bomb method on treetop foliage samples collected with tree-climbing techniques. The CAO collected hyperspectral reflectance data at 1-meter resolution from the same grove within 1-2 weeks of the tree-level measurements. A partial least squares regression was used to correlate reflectance data extracted from the 48 focal trees with their water potentials, producing a model that predicts water potential of giant sequoia trees. Results show that giant sequoia trees can be mapped in the imagery with a classification accuracy of 0.94, and we predicted the water potential of the mapped trees to assess 1) similarities and differences between a leaf water potential map and a canopy water content map produced from airborne hyperspectral data, 2

  9. Cosmological Structure Formation: From Dawn till Dusk

    DEFF Research Database (Denmark)

    Heneka, Caroline Samantha

    Cosmology has entered an era where a plethora data is available on structure formation to constrain astrophysics and underlying cosmology. This thesis strives to both investigate new observables and modeling of the Epoch of Reionization, as well as to constrain dark energy phenomenology with mass......Cosmology has entered an era where a plethora data is available on structure formation to constrain astrophysics and underlying cosmology. This thesis strives to both investigate new observables and modeling of the Epoch of Reionization, as well as to constrain dark energy phenomenology...... with massive galaxy clusters, traveling from the dawn of structure formation, when the first galaxies appear, to its dusk, when a representative part of the mass in the Universe is settled in massive structures. This hunt for accurate constraints on cosmology is complemented with the demonstration of novel...... Bayesian statistical tools and kinematical constraints on dark energy. Starting at the dawn of structure formation, we study emission line fluctuations, employing semi-numerical simulations of cosmological volumes of their line emission, in order to cross-correlate fluctuations in brightness. This cross...

  10. Paradigms and Paradoxes: Dawn at Vesta

    Science.gov (United States)

    Raymond, Carol; Russell, Christopher; Mittlefehldt, David

    2014-05-01

    While confirming the paradigm of Vesta as the parent body of the HED meteorites, measurements by Dawn have discovered many unexpected aspects of the vestan surface. First, an olivine layer was not found in the bottom of the large basin near the south pole of Vesta where excavation of the mantle was thought to have occurred. In fact, while patches of olivine have been found in the north, it is rare on the surface. Secondly, while Vesta has little gravity and appears to have completely differentiated, it is not completely dry. Morphological evidence from the walls and floors of some craters suggest transient fluid flows and pits formed by devolatization, implying a substantial amount of accessible water. The question is, did this water derive from internal or external sources? Thirdly, transport of material to the surface of Vesta from elsewhere in the asteroid belt appears as dark material buried near the top of the regolith of Vesta. This may have arrived in a single large impact and been spread around the surface and buried, later to be re-excavated. However, this is not the only scenario possible for the source of this material. Meteoritical evidence from howardites shows that debris from multiple types of impactors are present in the vestan regolith. In short, Dawn's observations of Vesta have been both reassuring but unsettling at the same time.

  11. Fungistatic Activity Of Essential Oils Extracted from Peumus boldus Mol., Laureliopsis philippiana (Looser Schodde and Laurelia sempervirens (Ruiz & Pav. Tul. (Chilean Monimiaceae Actividad Fungistática de Extractos de Aceites Asenciales de Peumus boldus Mol., Laureliopsis philippiana (Looser Schodde y Laurelia sempervirens (Ruiz & Pav. Tul. (Monimiaceae chilenas

    Directory of Open Access Journals (Sweden)

    Magalis Bittner

    2009-03-01

    Full Text Available Components of essential oils from the Chilean Monimiaceae, boldo (Peumus boldus Mol., tepa (Laureliopsis philippiana (Looser Schodde, and laurel (Laurelia sempervirens (Ruiz & Pav. Tul. were determined using Gas Chromatography- Mass Spectrometry (GCMS and fungistatic activity of the essential oils was tested against Rhizoctonia solani Kühn (Donk, Pythium irregulare Buisman, Ceratocystis pilifera (Fr. C. Moreau, Phragmidium violaceum (Schultz G. Winter, and Fusarium oxysporum Schltdl. The essential oils of the Monimiaceae species shared some common components; all three had the 3-carene, α-phellandrene, and α-pinene terpenes. L. philippiana and L. sempervirens also had safrole.The main components were ascaridol in P. boldus oil, 3-carene in L. philippiana, and safrole in L. sempervirens. The essential oil from L. sempervirens showed the highest fungistatic activity with significant differences in dose as well as exposure. P. violaceum was the most sensitive strain and P. irregulare the most resistant of all the essential oils (P. boldus extract affected growth by only 19%. Therefore, essential oils from these three plants could be used to control the fungal strains studied.Se determinaron los compuestos de aceites esenciales de Monimiaceae chilenas, boldo (Peumus boldus Mol., tepa (Laureliopsis philippiana (Looser Schodde, y laurel (Laurelia sempervirens (Ruiz & Pav. Tul. a través de cromatografía de gas con espectrometría de masas (CG-EM y se midió la actividad fungistática de los aceites sobre los hongos Rhizoctonia solani Kühn (Donk, Pythium irregulare Buisman, Ceratocystis pilifera (Fr. C. Moreau, Phragmidium violaceum (Schultz Winter y Fusarium oxysporum Schltdl. Los aceites esenciales de las especies de Monimiaceae tienen algunos compuestos en común; en las especies estudiadas se encontró que todos tenían los terpenos 3-careno, α-felandreno, y α-pineno. L. philippiana y L. sempervirens además tienen safrol. En cambio

  12. High-resolution 3D simulations of NIF ignition targets performed on Sequoia with HYDRA

    Science.gov (United States)

    Marinak, M. M.; Clark, D. S.; Jones, O. S.; Kerbel, G. D.; Sepke, S.; Patel, M. V.; Koning, J. M.; Schroeder, C. R.

    2015-11-01

    Developments in the multiphysics ICF code HYDRA enable it to perform large-scale simulations on the Sequoia machine at LLNL. With an aggregate computing power of 20 Petaflops, Sequoia offers an unprecedented capability to resolve the physical processes in NIF ignition targets for a more complete, consistent treatment of the sources of asymmetry. We describe modifications to HYDRA that enable it to scale to over one million processes on Sequoia. These include new options for replicating parts of the mesh over a subset of the processes, to avoid strong scaling limits. We consider results from a 3D full ignition capsule-only simulation performed using over one billion zones run on 262,000 processors which resolves surface perturbations through modes l = 200. We also report progress towards a high-resolution 3D integrated hohlraum simulation performed using 262,000 processors which resolves surface perturbations on the ignition capsule through modes l = 70. These aim for the most complete calculations yet of the interactions and overall impact of the various sources of asymmetry for NIF ignition targets. This work was performed under the auspices of the Lawrence Livermore National Security, LLC, (LLNS) under Contract No. DE-AC52-07NA27344.

  13. The dawn of gravitational wave astronomy

    CERN Multimedia

    CERN. Geneva

    2016-01-01

    On Sep 14 2015, gravitational waves were for the first time detected directly. This observation by the LIGO interferometric detectors marks the dawn of a new era in our observational study of the cosmos as a qualitatively new window to its exploration has been opened. This talk reviews some of the fundamental concepts of gravitational waves and the methodology employed for their observation. The first event, dubbed GW150914, and the properties of its source, as inferred from the observation, will be discussed. The talk concludes with a selected set of the most important topics where we expect gravitational-wave observations to deepen and either challenge or confirm our present understanding of the laws and the history of our universe.

  14. Vesta and Ceres as Seen by Dawn

    Science.gov (United States)

    Russell, C. T.; Nathues, A.; De Sanctis, M. C.; Prettyman, T. H.; Konopliv, A. S.; Park, R. S.; Jaumann, R.; McSween, H. Y., Jr.; Raymond, C. A.; Pieters, C. M.; McCord, T. B.; Marchi, S.; Schenk, P.; Buczkowski, D.

    2015-12-01

    Ceres and Vesta are the most massive bodies in the main asteroid belt. They have witnessed 4.6 Ga of solar system history. Dawn's objective is to interview these two witnesses. These bodies are relatively simple protoplanets, with a modest amount of thermal evolution and geochemical alteration. They are our best archetypes of the early building blocks of the terrestrial planets. In particular siderophile elements in the Earth's core were probably first segregated in Vesta-like bodies, and its water was likely first condensed in Ceres-like bodies. Vesta has provided copious meteorites for geochemical analysis. This knowledge was used to infer the constitution of the parent body. Dawn verified that Vesta was consistent with being that body, confirming the geochemical inferences from these samples on the formation and evolution of the solar system. Ceres has not revealed itself with a meteoritic record nor an asteroid family. While the surface is scarred with craters, it is probable that the ejecta from the crater-forming events created little competent material from the icy crust and any such ejected material that reached Earth might have disintegrated upon entry into the Earth's atmosphere. Ceres' surface differs greatly from Vesta's. Plastic or fluidized mass wasting is apparent as are many irregularly shaped craters, including many polygonal crater forms. There are many central-pit craters possibly caused by volatilization of the crust in the center of the impact. There are many central-peak craters but are these due to rebound or pingo-like formation processes? Bright spots, possibly salt deposits, dot the landscape, evidence of fluvial processes beneath the crust. Observations of the largest region of bright spots may suggest sublimation from the surface of the bright area, consistent with Herschel water vapor observations. Ceres is not only the most massive body in the asteroid belt but also possibly the most active occupant of the main belt.

  15. Patterns and correlates of giant sequoia foliage dieback during California’s 2012–2016 hotter drought

    Science.gov (United States)

    Stephenson, Nathan L.; Das, Adrian J.; Ampersee, Nicholas J.; Cahill, Kathleen G.; Caprio, Anthony C.; Sanders, John E.; Williams, A. Park

    2018-01-01

    Hotter droughts – droughts in which unusually high temperatures exacerbate the effects of low precipitation – are expected to increase in frequency and severity in coming decades, challenging scientists and managers to identify which parts of forested landscapes may be most vulnerable. In 2014, in the middle of California’s historically unprecedented 2012–2016 hotter drought, we noticed apparently drought-induced foliage dieback in giant sequoias (Sequoiadendron giganteum Lindl. [Buchholz]) in Sequoia and Kings Canyon national parks, California. Characteristics of the dieback were consistent with a controlled process of drought-induced senescence: younger (distal) shoots remained green while older (proximal) shoots were preferentially shed. As part of an ongoing interdisciplinary effort to understand and map sequoia vulnerability to hotter droughts, we reviewed historical records for evidence of previous foliage dieback events, surveyed dieback along trail corridors in eight sequoia groves, and analyzed tree-ring data from a high- and a low-foliage-dieback area. In sharp contrast to the greatly elevated mortality of other coniferous species found at low and middle elevations, we estimate that <1% of sequoias died during the drought. Foliage dieback was notably elevated in 2014 – the most severe single drought year in our 122-year record – but much lower in subsequent years. We found no historical records of similar foliage dieback during previous droughts. Dieback in 2014 was highly variable both within and among groves, ranging from virtually no dieback in some areas to nearly 50% in others. Dieback was highest (1) at low elevations, probably due to higher temperatures, reduced snowpack, and earlier snowmelt; (2) in areas of low adult sequoia densities, which likely reflect intrinsically more stressful sites; and (3) on steep slopes, probably reflecting reduced water availability. Average sequoia ring widths were narrower at the high-dieback than the

  16. Leaf to landscape responses of giant sequoia to hotter drought: An introduction and synthesis for the special section

    Science.gov (United States)

    Nydick, Koren R.; Stephenson, Nathan L.; Ambrose, Anthony R.; Asner, Gregory P.; Baxter, Wendy L.; Das, Adrian J.; Dawson, Todd E.; Martin, Roberta E.; Paz-Kagan, Tarin

    2018-01-01

    Hotter droughts are becoming more common as climate change progresses, and they may already have caused instances of forest dieback on all forested continents. Learning from hotter droughts, including where on the landscape forests are more or less vulnerable to these events, is critical to help resource managers proactively prepare for the future. As part of our Leaf to Landscape Project, we measured the response of giant sequoia, the world’s largest tree species, to the extreme 2012–2016 hotter drought in California. The project integrated leaf-level physiology measurements, crown-level foliage dieback surveys, and remotely sensed canopy water content (CWC) to shed light on mechanisms and spatial patterns in drought response. Here we summarize initial findings, present a conceptual model of drought response, and discuss management implications; details are presented in the other four articles of the special section on Giant Sequoias and Drought. Giant sequoias exhibited both leaf- and canopy-level responses that were effective in protecting whole-tree hydraulic integrity for the vast majority of individual sequoias. Very few giant sequoias died during the drought compared to other mixed conifer tree species; however, the magnitude of sequoia drought response varied across the landscape. This variability was partially explained by local site characteristics, including variables related to site water balance. We found that low CWC is an indicator of recent foliage dieback, which occurs when stress levels are high enough that leaf-level adjustments alone are insufficient for giant sequoias to maintain hydraulic integrity. CWC or change in CWC may be useful indicators of drought stress that reveal patterns of vulnerability to future hotter droughts. Future work will measure recovery from the drought and strengthen our ability to interpret CWC maps. Our ultimate goal is to produce giant sequoia vulnerability maps to help target management actions, such as

  17. Comparative study of two coniferous species (Pinus pinaster Aiton and Cupressus sempervirens L. var. dupreziana [A. Camus] Silba) essential oils: chemical composition and biological activity

    OpenAIRE

    Amri, Ismail; Hanana, Mohsen; Gargouri, Samia; Jamoussi, Bassem; Hamrouni, Lamia

    2013-01-01

    Maritime pine (Pinus pinaster Aiton) and Saharan cypress (Cupressus sempervirens L. var. dupreziana [A. Camus] Silba) are two cone-bearing seed coniferous woody plants. The chemical composition of their essential oils, isolated from needles and leaves by hydrodistillation, was analyzed with gas chromatography (GC) and gas chromatography mass spectrometry (GC/MS). A total of 66 and 28 compounds were identified, which represented 99.5% and 98.9% of total pine and cypress oils, respectively. Pin...

  18. Drug Abuse Warning Network US (DAWN-NS-1994)

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Drug Abuse Warning Network (DAWN) survey is designed to capture data on emergency department (ED) episodes that are induced by or related to the use of an...

  19. Drug Abuse Warning Network US (DAWN-NS-1997)

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Drug Abuse Warning Network (DAWN) survey is designed to capture data on emergency department (ED) episodes that are induced by or related to the use of an...

  20. Ceres: Dawn visits a Warm Wet Planet

    Science.gov (United States)

    McCord, T. B.; Combe, J. P.

    2014-12-01

    Ceres likely contains considerable water, has differentiated, and formed a hydrated silicate core and water mantle. There were major dimensional, thermal and chemical changes over its history, making it more a planet than an asteroid. These factors created the present day body, which the Dawn misson will visit next March. I will summarize our current understanding of Ceres and suggest what Dawn will find. A major uncertainty is how processes, such as aqueous mineralization, impact and cratering, infall of external material, mixing, and viscous relaxation of surface features have altered the formation materials and surface, hiding Ceres' secrets. Ceres' bulk density of 2100 kg/m3, suggest major water content. Modeling of Ceres' thermodynamic evolution for different times of accretion, assuming several radioactive heating scenarios, produces results ranging from a dry Vestal-like object (earlier, hotter formation) to retention and melting of the ice and differentiation of silicates from liquid water. Mixing of liquid water and silicates leads to exothermic hydration reactions, formation of a core and a liquid mantle. Large dimensional changes are associated. A crust stays frozen but founders at times due to gravitational instability, dimensional changes and impacts. The liquid mantle freezes from top, down, but a layer of salty liquid water probably exists today near the core. Hydrated silicates from the initial differentiation would likely dehydrate near the core center due to temperature and pressure. From observations, only subdued spatial albedo and color variations are observed at UV and IR wavelengths on Ceres' surface at the scale possible from Earth (~50-100 km) and an oblate spheroid shape is found, consistent with a differentiated body. Compositional evidence includes the long known similarity of Ceres' albedo and visual-IR reflectance spectrum to those for carbonaceous chondrite meteorites. Thus, the surface is likely made of carbon-bearing, hydroxolated

  1. Reionization and Cosmic Dawn: theory and simulations

    Science.gov (United States)

    Mesinger, Andrei

    2018-05-01

    We highlight recent progress in the sophistication and diversification of the simulations of cosmic dawn and reionization. The application of these modeling tools to recent observations has allowed us narrow down the timing of reionization. The midpoint of reionization is constrained to z = 7.6-0.7+0.8 (1 σ), with the strongest constraints coming from the optical depth to the CMB measured with the Planck satellite and the first detection of ongoing reionization from the spectra of the z = 7.1 QSOs ULASJ1120+0641. However, we still know virtually nothing about the astrophysical sources during the first billion years. The revolution in our understanding will be led by upcoming interferometric observations of the cosmic 21-cm signal. The properties of the sources and sinks of UV and X-ray photons are encoded in the 3D patterns of the signal. The development of Bayesian parameter recovery techniques, which tap into the wealth of the 21-cm signal, will soon usher in an era of precision astrophysical cosmology.

  2. Dawn Mission Education and Public Outreach: Science as Human Endeavor

    Science.gov (United States)

    Cobb, W. H.; Wise, J.; Schmidt, B. E.; Ristvey, J.

    2012-12-01

    Dawn Education and Public Outreach strives to reach diverse learners using multi-disciplinary approaches. In-depth professional development workshops in collaboration with NASA's Discovery Program, MESSENGER and Stardust-NExT missions focusing on STEM initiatives that integrate the arts have met the needs of diverse audiences and received excellent evaluations. Another collaboration on NASA ROSES grant, Small Bodies, Big Concepts, has helped bridge the learning sequence between the upper elementary and middle school, and the middle and high school Dawn curriculum modules. Leveraging the Small Bodies, Big Concepts model, educators experience diverse and developmentally appropriate NASA activities that tell the Dawn story, with teachers' pedagogical skills enriched by strategies drawn from NSTA's Designing Effective Science Instruction. Dawn mission members enrich workshops by offering science presentations to highlight events and emerging data. Teachers' awareness of the process of learning new content is heightened, and they use that experience to deepen their science teaching practice. Activities are sequenced to enhance conceptual understanding of big ideas in space science and Vesta and Ceres and the Dawn Mission 's place within that body of knowledge Other media add depth to Dawn's resources for reaching students. Instrument and ion engine interactives developed with the respective science team leads help audiences engage with the mission payload and the data each instrument collects. The Dawn Dictionary, an offering in both audio as well as written formats, makes key vocabulary accessible to a broader range of students and the interested public. Further, as Dawn E/PO has invited the public to learn about mission objectives as the mission explored asteroid Vesta, new inroads into public presentations such as the Dawn MissionCast tell the story of this extraordinary mission. Asteroid Mapper is the latest, exciting citizen science endeavor designed to invite the

  3. The Dawn of Human Matrilineal Diversity

    Science.gov (United States)

    Behar, Doron M.; Villems, Richard; Soodyall, Himla; Blue-Smith, Jason; Pereira, Luisa; Metspalu, Ene; Scozzari, Rosaria; Makkan, Heeran; Tzur, Shay; Comas, David; Bertranpetit, Jaume; Quintana-Murci, Lluis; Tyler-Smith, Chris; Wells, R. Spencer; Rosset, Saharon

    2008-01-01

    The quest to explain demographic history during the early part of human evolution has been limited because of the scarce paleoanthropological record from the Middle Stone Age. To shed light on the structure of the mitochondrial DNA (mtDNA) phylogeny at the dawn of Homo sapiens, we constructed a matrilineal tree composed of 624 complete mtDNA genomes from sub-Saharan Hg L lineages. We paid particular attention to the Khoi and San (Khoisan) people of South Africa because they are considered to be a unique relic of hunter-gatherer lifestyle and to carry paternal and maternal lineages belonging to the deepest clades known among modern humans. Both the tree phylogeny and coalescence calculations suggest that Khoisan matrilineal ancestry diverged from the rest of the human mtDNA pool 90,000–150,000 years before present (ybp) and that at least five additional, currently extant maternal lineages existed during this period in parallel. Furthermore, we estimate that a minimum of 40 other evolutionarily successful lineages flourished in sub-Saharan Africa during the period of modern human dispersal out of Africa approximately 60,000–70,000 ybp. Only much later, at the beginning of the Late Stone Age, about 40,000 ybp, did introgression of additional lineages occur into the Khoisan mtDNA pool. This process was further accelerated during the recent Bantu expansions. Our results suggest that the early settlement of humans in Africa was already matrilineally structured and involved small, separately evolving isolated populations. PMID:18439549

  4. Using Dawn to Observe SEP Events Past 2 AU

    Science.gov (United States)

    Villarreal, M. N.; Russell, C. T.; Prettyman, T. H.

    2017-12-01

    The launch of the STEREO spacecraft provided much insight into the longitudinal and radial distribution of solar energetic particles (SEPs) relative to their origin site. However, almost all of the observations of SEP events have been made exclusively near 1 AU. The Dawn mission, which orbited around Vesta before arriving at Ceres, provides an opportunity to analyze these events at much further distances. Although Dawn's Gamma Ray and Neutron Detector (GRaND) is not optimized for SEP characterization, it is sensitive to protons greater than 4 MeV, making it capable of detecting a solar energetic particle event in its vicinity. Solar energetic particles in this area of the solar system are important as they are believed to cause sputtering at bodies such as Ceres and comets (Villarreal et al., 2017; Wurz et al., 2015). In this study, we use Dawn's GRaND data from 2011-2015 when Dawn was at distances between 2-3 AU. We compare the SEP events seen by Dawn with particle measurements at 1 AU using STEREO, Wind, and ACE to understand how the SEP events evolved past 1 AU.References: Villarreal, M. N., et al. (2017), The dependence of the Cerean exosphere on solar energetic particle events, Astrophys. J. Lett., 838, L8.Wurz, P. et al. (2015), Solar wind sputtering of dust on the surface of 67P/Churyumov-Gerasimenko, A&A, 583, A22.

  5. Dignity and Dawn: Libya’s Escalating Civil War

    Directory of Open Access Journals (Sweden)

    Daveed Gartenstein-Ross

    2015-02-01

    Full Text Available In this Research Paper, ICCT Associate Fellow Dr. Daveed Gartenstein-Ross and Nathaniel Barr provides a detailed examination of the armed conflict in Libya between the Operation Dignity and Libya Dawn military coalitions. The conflict erupted in May 2014, when Dignity leader Khalifa Hifter announced the launch of his campaign, which was aimed at ridding eastern Libya of Islamist militias, beginning with Benghazi. This offensive shattered a fragile status quo. Revolutionary forces concentrated in the city of Misrata and Islamist politicians perceived Hifter’s offensive as a direct affront and, following parliamentary elections that these factions lost, the Misrata-Islamist bloc announced the launch of the Libya Dawn offensive, aimed at driving pro-Dignity forces out of Tripoli. More broadly, the Dawn offensive was an effort to change facts on the ground in order to ensure that the Misrata-Islamist bloc retained political influence. The Dignity and Dawn offensives have contributed to the continuing political and geographic fragmentation of Libya. Libya now has two separate parliaments and governments, while much of the country has been carved into spheres of influence by warring factions. The Dignity-Dawn conflict has also caused a deterioration of security, which has played into the hands of a variety of violent non-state actors, including al-Qaeda and Islamic State affiliates that have capitalized on Libya’s security vacuum to establish bases of operation. This report provides a blow-by-blow account of the military conflict between Dignity and Dawn forces, then assesses the implications of the Libyan civil war on regional security and potential policy options for Western states.

  6. Moon Search Algorithms for NASA's Dawn Mission to Asteroid Vesta

    Science.gov (United States)

    Memarsadeghi, Nargess; Mcfadden, Lucy A.; Skillman, David R.; McLean, Brian; Mutchler, Max; Carsenty, Uri; Palmer, Eric E.

    2012-01-01

    A moon or natural satellite is a celestial body that orbits a planetary body such as a planet, dwarf planet, or an asteroid. Scientists seek understanding the origin and evolution of our solar system by studying moons of these bodies. Additionally, searches for satellites of planetary bodies can be important to protect the safety of a spacecraft as it approaches or orbits a planetary body. If a satellite of a celestial body is found, the mass of that body can also be calculated once its orbit is determined. Ensuring the Dawn spacecraft's safety on its mission to the asteroid Vesta primarily motivated the work of Dawn's Satellite Working Group (SWG) in summer of 2011. Dawn mission scientists and engineers utilized various computational tools and techniques for Vesta's satellite search. The objectives of this paper are to 1) introduce the natural satellite search problem, 2) present the computational challenges, approaches, and tools used when addressing this problem, and 3) describe applications of various image processing and computational algorithms for performing satellite searches to the electronic imaging and computer science community. Furthermore, we hope that this communication would enable Dawn mission scientists to improve their satellite search algorithms and tools and be better prepared for performing the same investigation in 2015, when the spacecraft is scheduled to approach and orbit the dwarf planet Ceres.

  7. ORIGIN: metal creation and evolution from the cosmic dawn

    NARCIS (Netherlands)

    den Herder, J.W.; Piro, L.; Ohashi, T.; Kouveliotou, C.; Hartmann, D.H.; Kaastra, J.S.; Amati, L.; Andersen, M.I.; Arnaud, M.; Atteia, J.-L.; Bandler, S.; Barbera, M.; Barcons, X.; Barthelmy, S.; Basa, S.; Basso, S.; de Boer, M.; Branchini, E.; Branduardi-Raymont, G.; Borgani, S.; Boyarsky, A.; Brunetti, G.; Budtz-Jorgensen, C.; Burrows, D.; Butler, N.; Campana, S.; Caroli, E.; Ceballos, M.; Christensen, F.; Churazov, E.; Comastri, A.; Colasanti, L.; Cole, R.; Content, R.; Corsi, A.; Costantini, E.; Conconi, P.; Cusumano, G.; de Plaa, J.; De Rosa, A.; Del Santo, M.; Di Cosimo, S.; De Pasquale, M.; Doriese, R.; Ettori, S.; Evans, P.; Ezoe, Y.; Ferrari, L.; Finger, H.; Figueroa-Feliciano, T.; Friedrich, P.; Fujimoto, R.; Furuzawa, A.; Fynbo, J.; Gatti, F.; Galeazzi, M.; Gehrels, N.; Gendre, B.; Ghirlanda, G.; Ghisellini, G.; Gilfanov, M.; Giommi, P.; Girardi, M.; Grindlay, J.; Cocchi, M.; Godet, O.; Guedel, M.; Haardt, F.; Hartog, R.; Hepburn, I.; Hermsen, W.; Hjorth, J.; Hoekstra, H.; Holland, A.; Hornstrup, A.; van der Horst, A.; Hoshino, A.; in 't Zand, J.; Irwin, K.; Ishisaki, Y.; Jonker, P.; Kitayama, T.; Kawahara, H.; Kawai, N.; Kelley, R.; Kilbourne, C.; de Korte, P.; Kusenko, A.; Kuvvetli, I.; Labanti, M.; Macculi, C.; Maiolino, R.; Mas Hesse, M.; Matsushita, K.; Mazzotta, P.; McCammon, D.; Méndez, M.; Mignani, R.; Mineo, T.; Mitsuda, K.; Mushotzky, R.; Molendi, S.; Moscardini, L.; Natalucci, L.; Nicastro, F.; O'Brien, P.; Osborne, J.; Paerels, F.; Page, M.; Paltani, S.; Pedersen, K.; Perinati, E.; Ponman, T.; Pointecouteau, E.; Predehl, P.; Porter, S.; Rasmussen, A.; Rauw, G.; Röttgering, H.; Roncarelli, M.; Rosati, P.; Quadrini, E.; Ruchayskiy, O.; Salvaterra, R.; Sasaki, S.; Sato, K.; Savaglio, S.; Schaye, J.; Sciortino, S.; Shaposhnikov, M.; Sharples, R.; Shinozaki, K.; Spiga, D.; Sunyaev, R.; Suto, Y.; Takei, Y.; Tanvir, N.; Tashiro, M.; Tamura, T.; Tawara, Y.; Troja, E.; Tsujimoto, M.; Tsuru, T.; Ubertini, P.; Ullom, J.; Ursino, E.; Verbunt, F.; van de Voort, F.; Viel, M.; Wachter, S.; Watson, D.; Weisskopf, M.; Werner, N.; White, N.; Willingale, R.; Wijers, R.; Yamasaki, N.; Yoshikawa, K.; Zane, S.

    2012-01-01

    ORIGIN is a proposal for the M3 mission call of ESA aimed at the study of metal creation from the epoch of cosmic dawn. Using high-spectral resolution in the soft X-ray band, ORIGIN will be able to identify the physical conditions of all abundant elements between C and Ni to red-shifts of z = 10,

  8. ORIGIN : Metal creation and evolution from the cosmic dawn

    NARCIS (Netherlands)

    den Herder, Jan-Willem; Piro, Luigi; Ohashi, Takaya; Kouveliotou, Chryssa; Hartmann, Dieter H.; Kaastra, Jelle S.; Amati, L.; Andersen, M. I.; Arnaud, M.; Attéia, J.-L.; Bandler, S.; Barbera, M.; Barcons, X.; Barthelmy, S.; Basa, S.; Basso, S.; Boer, M.; Branchini, E.; Branduardi-Raymont, G.; Borgani, S.; Boyarsky, A.; Brunetti, G.; Budtz-Jorgensen, C.; Burrows, D.; Butler, N.; Campana, S.; Caroli, E.; Ceballos, M.; Christensen, F.; Churazov, E.; Comastri, A.; Colasanti, L.; Cole, R.; Content, R.; Corsi, A.; Costantini, E.; Conconi, P.; Cusumano, G.; de Plaa, J.; De Rosa, A.; Del Santo, M.; Di Cosimo, S.; De Pasquale, M.; Doriese, R.; Ettori, S.; Evans, P.; Ezoe, Y.; Ferrari, L.; Finger, H.; Figueroa-Feliciano, T.; Friedrich, P.; Fujimoto, R.; Furuzawa, A.; Fynbo, J.; Gatti, F.; Galeazzi, M.; Gehrels, N.; Gendre, B.; Ghirlanda, G.; Ghisellini, G.; Gilfanov, M.; Giommi, P.; Girardi, M.; Grindlay, J.; Cocchi, M.; Godet, O.; Guedel, M.; Haardt, F.; den Hartog, R.; Hepburn, I.; Hermsen, W.; Hjorth, J.; Hoekstra, H.; Holland, A.; Hornstrup, A.; van der Horst, A.; Hoshino, A.; in't Zand, J.; Irwin, K.; Ishisaki, Y.; Jonker, P.; Kitayama, T.; Kawahara, H.; Kawai, N.; Kelley, R.; Kilbourne, C.; de Korte, P.; Kusenko, A.; Kuvvetli, I.; Labanti, M.; Macculi, C.; Maiolino, R.; Hesse, M. Mas; Matsushita, K.; Mazzotta, P.; McCammon, D.; Méndez, M.; Mignani, R.; Mineo, T.; Mitsuda, K.; Mushotzky, R.; Molendi, S.; Moscardini, L.; Natalucci, L.; Nicastro, F.; O'Brien, P.; Osborne, J.; Paerels, F.; Page, M.; Paltani, S.; Pedersen, K.; Perinati, E.; Ponman, T.; Pointecouteau, E.; Predehl, P.; Porter, S.; Rasmussen, A.; Rauw, G.; Röttgering, H.; Roncarelli, M.; Rosati, P.; Quadrini, E.; Ruchayskiy, O.; Salvaterra, R.; Sasaki, S.; Sato, K.; Savaglio, S.; Schaye, J.; Sciortino, S.; Shaposhnikov, M.; Sharples, R.; Shinozaki, K.; Spiga, D.; Sunyaev, R.; Suto, Y.; Takei, Y.; Tanvir, N.; Tashiro, M.; Tamura, T.; Tawara, Y.; Troja, E.; Tsujimoto, M.; Tsuru, T.; Ubertini, P.; Ullom, J.; Ursino, E.; Verbunt, F.; van de Voort, F.; Viel, M.; Wachter, S.; Watson, D.; Weisskopf, M.; Werner, N.; White, N.; Willingale, R.; Wijers, R.; Yamasaki, N.; Yoshikawa, K.; Zane, S.

    2012-01-01

    ORIGIN is a proposal for the M3 mission call of ESA aimed at the study of metal creation from the epoch of cosmic dawn. Using high-spectral resolution in the soft X-ray band, ORIGIN will be able to identify the physical conditions of all abundant elements between C and Ni to red-shifts of z = 10,

  9. Monte Carlo simulation of the resolution volume for the SEQUOIA spectrometer

    Directory of Open Access Journals (Sweden)

    Granroth G.E.

    2015-01-01

    Full Text Available Monte Carlo ray tracing simulations, of direct geometry spectrometers, have been particularly useful in instrument design and characterization. However, these tools can also be useful for experiment planning and analysis. To this end, the McStas Monte Carlo ray tracing model of SEQUOIA, the fine resolution fermi chopper spectrometer at the Spallation Neutron Source (SNS of Oak Ridge National Laboratory (ORNL, has been modified to include the time of flight resolution sample and detector components. With these components, the resolution ellipsoid can be calculated for any detector pixel and energy bin of the instrument. The simulation is split in two pieces. First, the incident beamline up to the sample is simulated for 1 × 1011 neutron packets (4 days on 30 cores. This provides a virtual source for the backend that includes the resolution sample and monitor components. Next, a series of detector and energy pixels are computed in parallel. It takes on the order of 30 s to calculate a single resolution ellipsoid on a single core. Python scripts have been written to transform the ellipsoid into the space of an oriented single crystal, and to characterize the ellipsoid in various ways. Though this tool is under development as a planning tool, we have successfully used it to provide the resolution function for convolution with theoretical models. Specifically, theoretical calculations of the spin waves in YFeO3 were compared to measurements taken on SEQUOIA. Though the overall features of the spectra can be explained while neglecting resolution effects, the variation in intensity of the modes is well described once the resolution is included. As this was a single sharp mode, the simulated half intensity value of the resolution ellipsoid was used to provide the resolution width. A description of the simulation, its use, and paths forward for this technique will be discussed.

  10. Red Dawn: Characterizing Iron Oxide Minerals in Atmospheric Dust

    Science.gov (United States)

    Yauk, K.; Ottenfeld, C. F.; Reynolds, R. L.; Goldstein, H.; Cattle, S.; Berquo, T. S.; Moskowitz, B. M.

    2012-12-01

    Atmospheric dust is comprised of many components including small amounts of iron oxide minerals. Although the iron oxides make up a small weight percent of the bulk dust, they are important because of their roles in ocean fertilization, controls on climate, and as a potential health hazard to humans. Here we report on the iron oxide mineralogy in dust from a large dust storm, dubbed Red Dawn, which engulfed eastern Australia along a 3000 km front on 23 September 2009. Red Dawn originated from the lower Lake Eyre Basin of South Australia, western New South Wales (NSW) and southwestern Queensland and was the worst dust storm to have hit the city of Sydney in more than 60 years. Dust samples were collected from various locations across eastern Australia (Lake Cowal, Orange, Hornsby, Sydney) following the Red Dawn event. Our dust collection provides a good opportunity to study the physical and mineralogical properties of iron oxides from Red Dawn using a combination of reflectance spectroscopy, Mössbauer spectroscopy (MB), and magnetic measurements. Magnetization measurements from 20-400 K reveal that magnetite/maghemite, hematite and goethite are present in all samples with magnetite occurring in trace amounts (effects (d< 100 nm). Finally, we compared reflectance with a magnetic parameter (hard isothermal remanent magnetization, HIRM) for ferric oxide abundance to assess the degree to which ferric oxide in these samples might absorb solar radiation. In samples for which both parameters were obtained, HIRM and average reflectance over the visible wavelengths are correlated as a group (r2=0.24). These results indicate that the ferric oxide minerals in Red Dawn dust absorb solar radiation. Much of this ferric oxide occurs likely as grain coatings of nanohematite and nanogoethite, thereby providing high surface area to enhance absorption of solar radiation.

  11. The Enabling Use of Ion Propulsion on Dawn

    Science.gov (United States)

    Rayman, M.; Russell, C. T.; Raymond, C. A.; Mase, R. M.

    2011-12-01

    Dawn's mission to orbit both Vesta and Ceres is enabled by its use of ion propulsion. Even orbiting Vesta alone with conventional propulsion would have been unaffordable within the constraints of the Discovery Program, and orbiting both would have been impossible. In fact, no other spacecraft has been targeted to orbit two solar system destinations, which is only one of the many firsts that Dawn will achieve. The successful testing of ion propulsion on Deep Space 1 paved the way for Dawn not only to use the hardware with confidence but also to learn how to design the flight system and design the mission to take advantage of its capabilities. In addition to allowing Dawn to reach these two important targets, ion propulsion allows the spacecraft to accomplish significant changes in its orbit. Therefore, science observations of Vesta are planned from four different orbits, at varying altitudes and solar geometry. The use of ion propulsion results in a significant mission design effort since the trajectory is constantly being refined. This also creates a flexible mission architecture, which allows for optimization of the mission as conditions change. Solar electric ion propulsion is especially well suited to missions to the Main Asteroid Belt since solar energy is still a viable power source, whereas the size of the solar array needed beyond 3.5 AU is a potential limitation. Dawn has already surpassed the record for greatest propulsive velocity, but its greatest achievements will no doubt be the incredible bounty of science data enabled by this innovative flight system.

  12. Antiprotozoal Activity of Buxus sempervirens and Activity-Guided Isolation of O-tigloylcyclovirobuxeine-B as the Main Constituent Active against Plasmodium falciparum

    Directory of Open Access Journals (Sweden)

    Julia B. Althaus

    2014-05-01

    Full Text Available Buxus sempervirens L. (European Box, Buxaceae has been used in ethnomedicine to treat malaria. In the course of our screening of plant extracts for antiprotozoal activity, a CH2Cl2 extract from leaves of B. sempervirens showed selective in vitro activity against Plasmodium falciparum (IC50 = 2.79 vs. 20.2 µg/mL for cytotoxicity against L6 rat cells. Separation of the extract by acid/base extraction into a basic and a neutral non-polar fraction led to a much more active and even more selective fraction with alkaloids while the fraction of non-polar neutral constituents was markedly less active than the crude extract. Thus, the activity of the crude extract could clearly be attributed to alkaloid constituents. Identification of the main triterpene-alkaloids and characterization of the complex pattern of this alkaloid fraction was performed by UHPLC/+ESI-QTOF-MS analyses. ESI-MS/MS target-guided larger scale preparative separation of the alkaloid fraction was performed by ‘spiral coil-countercurrent chromatography’. From the most active subfraction, the cycloartane alkaloid O-tigloylcyclovirobuxeine-B was isolated and evaluated for antiplasmodial activity which yielded an IC50 of 0.455 µg/mL (cytotoxicity against L6 rat cells: IC50 = 9.38 µg/mL. O-tigloylcyclovirobuxeine-B is thus most significantly responsible for the high potency of the crude extract.

  13. Bioactivity of Peumus boldus Molina, Laurelia sempervirens (Ruiz & Pav. Tul. and Laureliopsis philippiana (Looser Schodde (Monimiacea essential oils against Sitophilus zeamais Motschulsky

    Directory of Open Access Journals (Sweden)

    Carmen Herrera-Rodríguez

    2015-09-01

    Full Text Available The maize weevil (Sitophilus zeamais Motschulsky is one of most important pest of stored seeds worldwide, but its current control method is based on the use of synthetic insecticides, usually leading to undesirable problems such as insecticide residues on treated food, human intoxications, and insect resistance development. Therefore the search of friendly alternative methods is required. The aim of this study was to assess, under laboratory conditions, the insecticidal properties of Peumus boldus Molina, Laurelia sempervirens (Ruiz & Pav. Tul., and Laureliopsis philippiana (Looser Schodde essential oils against S. zeamais. The phytochemical analysis of the three essential oils showed 1,8-cineole, safrole and methyleugenol as the common components; all of them documented with insecticidal activity from essential oils from other plant species. The highest toxicity (100% mortality of these three oils acting as a contact insecticide was observed at 24 h exposure at 4% concentration. The estimated LC50 values for P. boldus, L. sempervirens, and L. philippiana were 0.37, 1.02, and 0.28 μL g-1, respectively. Peumus boldus exhibited the highest fumigant activity with 100% adult mortality at 30 μL oil L-1 air. At ≥ 0.5% (v/w concentration, all essential oils showed repellent activity. These three essential oils showed a promissory insecticidal activity against the maize weevil.

  14. Demography of the California spotted owl in the Sierra National Forest and Sequoia/Kings Canyon National Parks

    Science.gov (United States)

    George N. Steger; Thomas E. Munton; Kenneth D. Johnson; Gary P. Eberlein

    2002-01-01

    Nine years (1990–1998) of demographic data on California spotted owls (Strix occidentalis occidentalis) in two study areas on the western slopes of the Sierra Nevada—one in the Sierra National Forest (SNF), the other in Sequoia/Kings Canyon National Parks (SNP)—are summarized. Numbers of territorial owls fluctuated from 85 to 50 in SNF and 80 to 58...

  15. Surface Mineralogy Mapping of Ceres from the Dawn Mission

    Science.gov (United States)

    McCord, T. B.; Zambon, F.

    2017-12-01

    Ceres' surface composition is of special interest because it is a window into the interior state and the past evolution of this dwarf planet. Disk-integrated telescopic spectral observations indicated that Ceres' surface is hydroxylated, similar to but not exactly the same as some of the carbonaceous chondrite classes of meteorites. Furthermore, Ceres' bulk density is low, indicating significant water content. The Dawn mission in orbit around Ceres, provided a new and larger set of observations on the mineralogy, molecular and elemental composition, and their distributions in association with surface features and geology. A set of articles was prepared, from which this presentation is derived, that is the first treatment of the entire surface composition of Ceres using the complete High Altitude Mapping Orbit (HAMO) Dawn Ceres data set and the calibrations from all the Dawn instruments. This report provides a current and comprehensive view of Ceres' surface composition and integrates them into general conclusions. Ceres' surface composition shows a fairly uniform distribution of NH4- and Mg-phyllosilicates, carbonates, mixed with a dark component. The widespread presence of phyllosilicates, and salts on Ceres' surface is indicative of the presence of aqueous alteration processes, which involved the whole dwarf planet. There is also likely some contamination by low velocity infall, as seen on Vesta, but it is more difficult to distinguish this infall from native Ceres material, unlike for the Vesta case.

  16. Laboratory evaluation of the Sequoia Scientific LISST-ABS acoustic backscatter sediment sensor

    Science.gov (United States)

    Snazelle, Teri T.

    2017-12-18

    Sequoia Scientific’s LISST-ABS is an acoustic backscatter sensor designed to measure suspended-sediment concentration at a point source. Three LISST-ABS were evaluated at the U.S. Geological Survey (USGS) Hydrologic Instrumentation Facility (HIF). Serial numbers 6010, 6039, and 6058 were assessed for accuracy in solutions with varying particle-size distributions and for the effect of temperature on sensor accuracy. Certified sediment samples composed of different ranges of particle size were purchased from Powder Technology Inc. These sediment samples were 30–80-micron (µm) Arizona Test Dust; less than 22-µm ISO 12103-1, A1 Ultrafine Test Dust; and 149-µm MIL-STD 810E Silica Dust. The sensor was able to accurately measure suspended-sediment concentration when calibrated with sediment of the same particle-size distribution as the measured. Overall testing demonstrated that sensors calibrated with finer sized sediments overdetect sediment concentrations with coarser sized sediments, and sensors calibrated with coarser sized sediments do not detect increases in sediment concentrations from small and fine sediments. These test results are not unexpected for an acoustic-backscatter device and stress the need for using accurate site-specific particle-size distributions during sensor calibration. When calibrated for ultrafine dust with a less than 22-µm particle size (silt) and with the Arizona Test Dust with a 30–80-µm range, the data from sensor 6039 were biased high when fractions of the coarser (149-µm) Silica Dust were added. Data from sensor 6058 showed similar results with an elevated response to coarser material when calibrated with a finer particle-size distribution and a lack of detection when subjected to finer particle-size sediment. Sensor 6010 was also tested for the effect of dissimilar particle size during the calibration and showed little effect. Subsequent testing revealed problems with this sensor, including an inadequate temperature

  17. Ceres Photometry and Albedo from Dawn Framing Camera Images

    Science.gov (United States)

    Schröder, S. E.; Mottola, S.; Keller, H. U.; Li, J.-Y.; Matz, K.-D.; Otto, K.; Roatsch, T.; Stephan, K.; Raymond, C. A.; Russell, C. T.

    2015-10-01

    The Dawn spacecraft is in orbit around dwarf planet Ceres. The onboard Framing Camera (FC) [1] is mapping the surface through a clear filter and 7 narrow-band filters at various observational geometries. Generally, Ceres' appearance in these images is affected by shadows and shading, effects which become stronger for larger solar phase angles, obscuring the intrinsic reflective properties of the surface. By means of photometric modeling we attempt to remove these effects and reconstruct the surface albedo over the full visible wavelength range. Knowledge of the albedo distribution will contribute to our understanding of the physical nature and composition of the surface.

  18. A lightning multiple casualty incident in Sequoia and Kings Canyon National Parks.

    Science.gov (United States)

    Spano, Susanne J; Campagne, Danielle; Stroh, Geoff; Shalit, Marc

    2015-03-01

    Multiple casualty incidents (MCIs) are uncommon in remote wilderness settings. This is a case report of a lightning strike on a Boy Scout troop hiking through Sequoia and Kings Canyon National Parks (SEKI), in which the lightning storm hindered rescue efforts. The purpose of this study was to review the response to a lightning-caused MCI in a wilderness setting, address lightning injury as it relates to field management, and discuss evacuation options in inclement weather incidents occurring in remote locations. An analysis of SEKI search and rescue data and a review of current literature were performed. A lightning strike at 10,600 feet elevation in the Sierra Nevada Mountains affected a party of 5 adults and 7 Boy Scouts (age range 12 to 17 years old). Resources mobilized for the rescue included 5 helicopters, 2 ambulances, 2 hospitals, and 15 field and 14 logistical support personnel. The incident was managed from strike to scene clearance in 4 hours and 20 minutes. There were 2 fatalities, 1 on scene and 1 in the hospital. Storm conditions complicated on-scene communication and evacuation efforts. Exposure to ongoing lightning and a remote wilderness location affected both victims and rescuers in a lightning MCI. Helicopters, the main vehicles of wilderness rescue in SEKI, can be limited by weather, daylight, and terrain. Redundancies in communication systems are vital for episodes of radio failure. Reverse triage should be implemented in lightning injury MCIs. Education of both wilderness travelers and rescuers regarding these issues should be pursued. Copyright © 2015 Wilderness Medical Society. Published by Elsevier Inc. All rights reserved.

  19. Estimating the spatial and temporal distribution of species richness within Sequoia and Kings Canyon National Parks.

    Directory of Open Access Journals (Sweden)

    Steve Wathen

    Full Text Available Evidence for significant losses of species richness or biodiversity, even within protected natural areas, is mounting. Managers are increasingly being asked to monitor biodiversity, yet estimating biodiversity is often prohibitively expensive. As a cost-effective option, we estimated the spatial and temporal distribution of species richness for four taxonomic groups (birds, mammals, herpetofauna (reptiles and amphibians, and plants within Sequoia and Kings Canyon National Parks using only existing biological studies undertaken within the Parks and the Parks' long-term wildlife observation database. We used a rarefaction approach to model species richness for the four taxonomic groups and analyzed those groups by habitat type, elevation zone, and time period. We then mapped the spatial distributions of species richness values for the four taxonomic groups, as well as total species richness, for the Parks. We also estimated changes in species richness for birds, mammals, and herpetofauna since 1980. The modeled patterns of species richness either peaked at mid elevations (mammals, plants, and total species richness or declined consistently with increasing elevation (herpetofauna and birds. Plants reached maximum species richness values at much higher elevations than did vertebrate taxa, and non-flying mammals reached maximum species richness values at higher elevations than did birds. Alpine plant communities, including sagebrush, had higher species richness values than did subalpine plant communities located below them in elevation. These results are supported by other papers published in the scientific literature. Perhaps reflecting climate change: birds and herpetofauna displayed declines in species richness since 1980 at low and middle elevations and mammals displayed declines in species richness since 1980 at all elevations.

  20. Effect of simulated dawn on quality of sleep – a community-based trial

    Directory of Open Access Journals (Sweden)

    Haukka Jari

    2003-10-01

    Full Text Available Abstract Background Morning light exposure administered as simulated dawn looks a promising method to treat Seasonal Affective Disorder, but it may moreover help with resetting the inaccurate organisation of body clock functions relative to sleep occurring in winter among people in general. Disturbances in sleep patterns are common and may compromise wellbeing even in the short term. Our hypothesis was that simulated dawn could improve the subjective quality of sleep during winter. Methods A community-based trial with 100 volunteer subjects provided with dawn simulators. Study period lasted for eight weeks, and subjects used the dawn simulators for two weeks at a time, each subject acting as his own control (ABAB-design. Main outcome measure was subjective quality of sleep recorded each morning with Groningen Sleep Quality Scale. Results 77 subjects completed the trial. Quality of sleep improved while subjects were using dawn simulator-devices (p = 0.001. The treatment became beneficial after six days' use of dawn simulator, but the effect did not last after the use was ceased. Conclusion Dawn simulation may help to improve the subjective quality of sleep, but the benefits are modest. Further research is needed to verify these findings and to elucidate the mechanism by which dawn simulation acts on the sleep-wake pattern.

  1. Natural entrainment without dawn and dusk : The case of the European ground squirrel (Spermophilus citellus)

    NARCIS (Netherlands)

    Hut, RA; van Oort, BEH; Daan, S; Oort, Bob E.H. van

    Observational data collected in the field and in enclosures show that diurnal, burrow-dwelling European ground squirrels (Spermophilus citellus) never were above ground during twilight at dawn or at dusk. The animals emerged on average 4.02 h (SD = 0.45) after civil twilight at dawn and retreated in

  2. Nature of the "Orange" Material on Vesta From Dawn

    Science.gov (United States)

    LeCorre, L.; Reddy, V.; Schmedemann, N.; Becker, K. J.; OBrien, D. P.; Yamashita, N.; Peplowski, P. N.; Prettyman, T. H.; Li, J.-Y.; Coultis, E. A.; hide

    2014-01-01

    From ground-based observations of Vesta, it is well-known that the vestan surface has a large variation in albedo. Analysis of images acquired by the Hubble Space Telescope allowed production of the first color maps of Vesta and showed a diverse surface in terms of reflectance. Thanks to images collected by the Dawn spacecraft at Vesta, it became obvious that these specific units observed previously can be linked to geological features. The presence of the darkest material mostly around impact craters and scattered in the Western hemisphere has been associated with carbonaceous chondrite contamination [4]; whereas the brightest materials are believed to result from exposure of unaltered material from the subsurface of Vesta (in fresh looking impact crater rims and in Rheasilvia's ejecta and rim remants). Here we focus on a distinct material characterized by a steep slope in the near-IR relative to all other kinds of materials found on Vesta. It was first detected when combining Dawn Framing Camera (FC) color images in Clementine false-color composites [5] during the Approach phase of the mission (100000 to 5200 km from Vesta). We investigate the mineralogical and elemental composition of this material and its relationship with the HEDs (Howardite-Eucrite- Diogenite group of meteorites).

  3. ORIGIN: Metal Creation and Evolution from the Cosmic Dawn

    DEFF Research Database (Denmark)

    Herder, J. W. den; Piro, L.; Ohashi, T.

    2011-01-01

    , and beyond. The mission will answer questions such as: When were the first metals created? How does the cosmic metal content evolve? Where do most of the metals reside in the Universe? What is the role of metals in structure formation and evolution? To reach out to the early Universe ORIGIN will use Gamma......ORIGIN is a proposal for the M3 mission call of ESA aimed at the study of metal creation from the epoch of cosmic dawn. Using high-spectral resolution in the soft X-ray band, ORIGIN will be able to identify the physical conditions of all abundant elements between C and Ni to red-shifts of z=10...

  4. Before the dawn recovering the lost history of our ancestors

    CERN Document Server

    Wade, Nicholas

    2007-01-01

    Nicholas Wade’s articles are a major reason why the science section has become the most popular, nationwide, in the New York Times. In his groundbreaking Before the Dawn, Wade reveals humanity’s origins as never before—a journey made possible only recently by genetic science, whose incredible findings have answered such questions as: What was the first human language like? How large were the first societies, and how warlike were they? When did our ancestors first leave Africa, and by what route did they leave? By eloquently solving these and numerous other mysteries, Wade offers nothing less than a uniquely complete retelling of a story that began 500 centuries ago.

  5. Plasma bubbles near the dawn terminator in the topside ionosphere

    International Nuclear Information System (INIS)

    Burke, W.J.

    1979-01-01

    The physical properties of plasma bubbles in the topside ionosphere near the dawn terminator are investigated. It is assumed that the bubbles result from either a Rayleigh-Taylor or an E X B instability on the bottom side of the F-layer. While the E-region is in darkness, the top and bottomsides of the ionospheres are electrically decoupled and the motion of the bubbles can be described by non-linear, two-dimensional theory. After sunrise, electric fields within the bubbles discharge through the conducting lower ionosphere. The upward drift of the bubbles is effectively halted. To achieve a dayside state of diffusive equilibrium the bubbles slowly begin to collapse from the bottom. (author)

  6. Diabetes Attitudes, Wishes and Needs second study (DAWN2™)

    DEFF Research Database (Denmark)

    Nicolucci, Antonio; Kovacs Burns, K; Holt, Richard I G

    2013-01-01

    AIMS: The second Diabetes Attitudes, Wishes and Needs (DAWN2) study aimed to assess psychosocial outcomes in people with diabetes across countries for benchmarking. METHODS: Surveys included new and adapted questions from validated questionnaires that assess health-related quality of life, self......-management, attitudes/beliefs, social support and priorities for improving diabetes care. Questionnaires were conducted online, by telephone or in person. RESULTS: Participants were 8596 adults with diabetes across 17 countries. There were significant between-country differences for all benchmarking indicators; no one...... (17.2-67.6%). Overall quality of life was rated 'poor' or 'very poor' by 12.2% of participants (7.6-26.1%). Diabetes had a negative impact on all aspects investigated, ranging from 20.5% on relationship with family/friends to 62.2% on physical health. Approximately 40% of participants (18...

  7. First observations of Ceres by VIR on Dawn mission

    Science.gov (United States)

    De Sanctis, M. Cristina; Ammannito, Eleonora; Fonte, Sergio; Magni, Gianfranco; Capaccioni, Fabrizio; Capria, M. Teresa; Raymond, Carol. A.; Russell, Christopher T.

    2015-04-01

    The Dawn spacecraft [1] is now approaching Ceres, the second of its targets. Ceres represents the key to understand some important points relative to the role of the protoplanet size and the water content in the evolution of these bodies. Ceres is thought to be differentiated, and hydrated minerals were proposed to exist on its surface [2,3,4]. Its low density [3] associated with the presence of transient water vapour, suggests a high content of ice inside the body and on its surface. Ceres seems to have been subject to differentiation and hydrothermal activity, and might host a liquid subsurface layer even today. Dawn is equipped with a Visible and InfraRed Mapping Spectrometer (VIR-MS) [5]. VIR-MS is an imaging spectrometer coupling high spectral and spatial resolution in the VIS (0.25-1 micron) and IR (0.95-5 micron) spectral ranges. The surface composition of Ceres is poorly understood through its nearly featureless visible spectrum. Its visible reflectance spectrum has a steep UV absorption edge that begins at a relatively short wavelength, around 0.4 micron, unlike many C-type asteroids where the UV drop-off begins around 0.6 to 0.7 micron[6]. The near-IR spectrum has a strong absorption band centered at about 3-micron. The absorption features in the 3-micron region were attributed to structural water in clay minerals [7,8] but could also be ammoniated clays [9]. [10] reported the discovery of carbonates and iron-rich clays from measurements of weak 3-micron features, and the results are consistent with the mid-IR spectra of clay minerals. On approach to Ceres, Dawn will obtain images and hyperspectral . VIR data, with resolution larger than Hubble images will reveal the first details of the Ceres' surface composition. Here we report about the first data obtained by VIR during its approach to Ceres. Acknowledgments VIR is funded by the Italian Space Agency-ASI and was developed under the leadership of INAF-Istituto di Astrofisica e Planetologia Spaziali, Rome

  8. Changes in gas exchange characteristics during the life span of giant sequoia: Implications for response to current and future concentrations of atmospheric ozone

    Energy Technology Data Exchange (ETDEWEB)

    Grulke, N.E.; Miller, P.R. (USDA Forest Service, Riverside, CA (United States))

    Native stands of giant sequoia are being exposed to relatively high concentrations of atmospheric ozone produced in urban and agricultural areas upwind. The expected change in environmental conditions over the next 100 y is likely to be unprecendented in the life span (ca 2,500 y) of giant sequoia. Changes in the physiological responses of three age classes of giant sequoia (current year, 12 y and 25 y) to different concentrations of ozone were determined, and age-related differences in sensitivity to pollutants were assessed by examining physiological changes (gas exchange, water use efficiency) across the life span of giant sequoia. The CO[sub 2] exchange rate (CER) was greater in current year (12.1 [mu]mol CO[sub 2]/m[sup 2]s) and 2 year old seedlings (4.8 [mu]mol CO[sub 2]/m[sup 2]s) than in all older trees (average of 3.0 [mu]mol CO[sub 2]/m[sup 2]s). Dark respiration was highest for current year seedlings and was increased twofold in symptotic individuals exposed to elevated ozone concentrations. Stomatal conductance was greater in current-year and 2 year old seedlings (335 and 200 mmol H[sub 2]O/m[sup 2]s), respectively, than in all older trees (50 mmol H[sub 2]O/m[sup 2]s), indicating that the ozone concentration in substomatol cavities is higher in young seedlings than in older trees. Significant changes in water use efficiency occurred in trees between ages 5 and 20 years. It is concluded that giant sequoia seedlings are sensitive to atmospheric ozone until they are ca 5 y old. Low conductance, high water use efficiency, and compact mesophyll all contribute to a natural ozone tolerance, or defense, or both, in foliage of older trees. 11 refs., 1 fig., 1 tab.

  9. [Correlation study between obesity and dawn phenomenon in patients with type 2 diabetes].

    Science.gov (United States)

    Guo, Zhenhong; Xu, Jie; Wang, Jingyu; Han, Fei; Zhang, Yi; Yang, X iaoyun; Yang, Shaohua; Chang, Bai; Yang, Juhong; Shan, Chunyan; Chen, Liming; Chang, Baocheng; Xu, Yanguang

    2016-01-01

    To investigate the correlation between the frequency of dawn phenomenon and obesity in patients with type 2 diabetes. This study was conducted in 98 patients with type 2 diabetes admitted to the Metabolic Disease Hospital of Tianjin Medical University from 2011 to 2014. The subjects were divided into 3 groups according to BMI: the normal weight (BMI 18.5-23.9 kg/m(2), n = 30), the overweight(BMI 24-27.9 kg/m(2), n = 33)and the obesity (BMI ≥ 28.0 kg/m(2), n = 35). All participants underwent continuous glucose monitoring for 72 h. Fasting plasma glucose(FPG), insulin and C-peptide were tested. Frequency of dawn phenomenon among the 3 groups was calculated, and the correlations between dawn phenomenon and its related factors were analyzed. The frequency of dawn phenomenon in type 2 diabetes increased with the increase of BMI in the 3 groups (P obesity groups, respectively. The dawn phenomenon was positively correlated with BMI (r = 0.424, P fasting C-peptide (r = 0.254, P 0.05). The dawn phenomenon is closely associated with obesity and insulin resistance. The frequency of dawn phenomenon increases with BMI.

  10. A new DAWN: Improving the psychosocial management of diabetes

    Directory of Open Access Journals (Sweden)

    Richard I. G. Holt

    2013-01-01

    Full Text Available Aims: The second Diabetes Attitudes, Wishes and Needs (DAWN-2 study assessed psychosocial issues and health-care provision of people with diabetes, their family members and health-care professionals. Materials and Methods: Participants completed an online, telephone or in-person survey designed to assess health-related quality-of-life, self-management, attitudes/beliefs, social support and priorities for improving diabetes care as well as health-care provision and the impact of diabetes on family life. Results: A total of 8596 adults with diabetes, 2057 family members of people with diabetes and 4785 health-care professionals across 17 countries completed the survey. There were significant between country differences, but no one country′s outcomes were consistently better or worse than others. A high proportion of people with diabetes reported likely depression (13.8% and poor quality-of-life (12.2%. Diabetes had a negative impact on many aspects of life, including relationships with family/friends and physical health. A third of family members did not know how to help the person with diabetes, but wanted to be more involved in their care. Many health-care professionals indicated that major improvements were needed across a range of areas including health-care organization, resources for diabetes prevention, earlier diagnosis and treatment and psychological support. Conclusions: DAWN-2 is a multinational, multidisciplinary systematic study that compared unmet needs of people with diabetes and those who care for them in 17 countries across four continents. Its findings should facilitate innovative efforts to improve self-management and psychosocial support in diabetes, with the aim of reducing the burden of disease. The implications for India are discussed.

  11. Mersin-Aydıncık İlçesi Anıt Dallı Servileri (Cupressus sempervirens L. var. horizontalis (Mill. Gord.

    Directory of Open Access Journals (Sweden)

    R. ÖZÇELİK

    2009-04-01

    Full Text Available Ülkemizde bugüne kadar bir çok anıt ağaç ve meşcerenin tespiti yapılmıştır. Bu çalışmada, Mersin ili Aydıncık İlçesindeki; çap, boy, yaş, tepe çapı (somut özellikler ve Mistik özellikleri (soyut özellikler nedeniyle anıt ağaç niteliği taşıyan iki adet Dallı Servi (Cupresus sempervirens L. var. horizontalis (Mill. Gord. tanıtılmıştır. Bu iki ağaç, şimdiye kadar anıt ağaç olarak tescili yapılmış en uzun boylu servi bireyleridir. Bu nedenle; doğal, kültürel ve estetik değere sahip bu doğal varlıkların korunması gerekmektedir.

  12. Determination of epigenetic inheritance, genetic inheritance, and estimation of genome DNA methylation in a full-sib family of Cupressus sempervirens L.

    Science.gov (United States)

    Avramidou, Evangelia V; Doulis, Andreas G; Aravanopoulos, Filippos A

    2015-05-15

    Genetic inheritance and epigenetic inheritance are significant determinants of plant evolution, adaptation and plasticity. We studied inheritance of restriction site polymorphisms by the f-AFLP method and epigenetic DNA cytosine methylation inheritance by the f-MSAP technique. The study involved parents and 190 progeny of a Cupressus sempervirens L. full-sib family. Results from AFLP genetic data revealed that 71.8% of the fragments studied are under Mendelian genetic control, whereas faithful Mendelian inheritance for the MSAP fragments was low (4.29%). Further, MSAP fragment analysis showed that total methylation presented a mean of 28.2%, which was higher than the midparent value, while maternal inheritance was higher (5.65%) than paternal (3.01%). Interestingly de novo methylation in the progeny was high (19.65%) compared to parental methylation. Genetic and epigenetic distances for parents and offspring were not correlated (R(2)=0.0005). Furthermore, we studied correlation of total relative methylation and CG methylation with growth (height, diameter). We found CG/CNG methylation (N: A, C, T) to be positively correlated with height and diameter, while total relative methylation and CG methylation were positively correlated with height. Results are discussed in light of further research needed and of their potential application in breeding. Copyright © 2015 Elsevier B.V. All rights reserved.

  13. The loss of essential oil components induced by the Purge Time in the Pressurized Liquid Extraction (PLE) procedure of Cupressus sempervirens.

    Science.gov (United States)

    Dawidowicz, Andrzej L; Czapczyńska, Natalia B; Wianowska, Dorota

    2012-05-30

    The influence of different Purge Times on the effectiveness of Pressurized Liquid Extraction (PLE) of volatile oil components from cypress plant matrix (Cupressus sempervirens) was investigated, applying solvents of diverse extraction efficiencies. The obtained results show the decrease of the mass yields of essential oil components as a result of increased Purge Time. The loss of extracted components depends on the extrahent type - the greatest mass yield loss occurred in the case of non-polar solvents, whereas the smallest was found in polar extracts. Comparisons of the PLE method with Sea Sand Disruption Method (SSDM), Matrix Solid-Phase Dispersion Method (MSPD) and Steam Distillation (SD) were performed to assess the method's accuracy. Independent of the solvent and Purge Time applied in the PLE process, the total mass yield was lower than the one obtained for simple, short and relatively cheap low-temperature matrix disruption procedures - MSPD and SSDM. Thus, in the case of volatile oils analysis, the application of these methods is advisable. Copyright © 2012 Elsevier B.V. All rights reserved.

  14. Attività sperimentale di agricoltura di precisione su vigneto Confronto tra i sensori Mapir Survey2 e Parrot Sequoia

    Directory of Open Access Journals (Sweden)

    Simone Kartsiotis

    2018-01-01

    Full Text Available This report presents a comparison via field-testing between Parrot Sequoia and Mapir Survey2 multispectral cameras. Both sensors are commonly used in precision farming activities conducted by micro-RPAS (drones, thanks to their small size and light weight. The experimental activity was performed in summer on the vineyards of the Savignola Paolina agricultural holding in Tuscany. The sensors were taken on board the EXOS drone, a hexacopter developed by Zephyr S.r.l. company and specifically designed for precision farming operations. Good and bad qualities for each cameras are examined by a comprehensive approach, starting from technical specifications and continuing with a comparison of the results obtained on field. All the activity was performed by a partnership between the companies DroneBee and Zephyr S.r.l. .

  15. Impacts of fire management on aboveground tree carbon stocks in Yosemite and Sequoia & Kings Canyon National Parks

    Science.gov (United States)

    Matchett, John R.; Lutz, James A.; Tarnay, Leland W.; Smith, Douglas G.; Becker, Kendall M.L.; Brooks, Matthew L.

    2015-01-01

    Forest biomass on Sierra Nevada landscapes constitutes one of the largest carbon stocks in California, and its stability is tightly linked to the factors driving fire regimes. Research suggests that fire suppression, logging, climate change, and present management practices in Sierra Nevada forests have altered historic patterns of landscape carbon storage, and over a century of fire suppression and the resulting accumulation in surface fuels have been implicated in contributing to recent increases in high severity, stand-replacing fires. For over 30 years, fire management at Yosemite (YOSE) and Sequoia & Kings Canyon (SEKI) national parks has led the nation in restoring fire to park landscapes; however, the impacts on the stability and magnitude of carbon stocks have not been thoroughly examined.

  16. A natural resource condition assessment for Sequoia and Kings Canyon National Parks: Appendix 22: climatic change

    Science.gov (United States)

    Das, Adrian J.; Stephenson, Nathan L.

    2013-01-01

    Climate is a master controller of the structure, composition, and function of biotic communities, affecting them both directly, through physiological effects, and indirectly, by mediating biotic interactions and by influencing disturbance regimes. Sequoia and Kings Canyon National Park’s (SEKI’s) dramatic elevational changes in biotic communities -- from warm mediterranean to cold alpine -- are but one manifestation of climate’s overarching importance in shaping SEKI’s landscape. Yet humans are now altering the global climate, with measurable effects on ecosystems (IPCC 2007). Over the last few decades across the western United States, human-induced climatic changes have likely contributed to observed declines in fraction of precipitation falling as snow and snowpack water content (Mote et al. 2005, Knowles et al. 2006), advance in spring snowmelt (Stewart et al. 2005, Barnett et al. 2008), and consequent increase in area burned in wildfires (Westerling et al. 2006). In the Sierra Nevada, warming temperatures have likely contributed to observed glacial recession (Basagic 2008), uphill migration of small mammals (Moritz et al. 2008), and increasing tree mortality rates (van Mantgem and Stephenson 2007, van Mantgem et al. 2009). More substantial changes can be expected for the future (e.g., IPCC 2007). Given the central importance of climate and climatic changes, we sought to describe long-term trends in temperature and precipitation at SEKI. Time and budget constraints limited us to analyses of mean annual temperature and mean annual precipitation, using readily-available data. If funds become available in the future, further analyses will be needed to analyze trends by season, trends in daily minimum and maximum temperatures, and so on. We chose to analyze data from individual weather stations rather than use interpolated climatic data from sources such as PRISM (http://www.prism.oregonstate.edu/). In topographically complex mountainous regions with few

  17. The highest-ranking rooster has priority to announce the break of dawn

    OpenAIRE

    Shimmura, Tsuyoshi; Ohashi, Shosei; Yoshimura, Takashi

    2015-01-01

    The ?cock-a-doodle-doo? crowing of roosters, which symbolizes the break of dawn in many cultures, is controlled by the circadian clock. When one rooster announces the break of dawn, others in the vicinity immediately follow. Chickens are highly social animals, and they develop a linear and fixed hierarchy in small groups. We found that when chickens were housed in small groups, the top-ranking rooster determined the timing of predawn crowing. Specifically, the top-ranking rooster always start...

  18. Dawn song in natural and artificial continuous day: Light pollution affects songbirds at high latitudes.

    Science.gov (United States)

    Derryberry, Elizabeth P

    2017-10-01

    In Focus: Da Silva, A., & Kempenaers, B. (2017). Singing from North to South: Latitudinal variation in timing of dawn singing under natural and artificial light conditions. Journal of Animal Ecology, 86, 1286-1297. doi: 10.1111/1365-2656.12739 Satellite images of the world at night show bright dots connected by glowing lines crisscrossing the globe. As these connect-the-dots become brighter and expand into more and more remote regions, much of the flora and fauna of the world are experiencing evolutionarily unprecedented levels of light at night. Light cues are essential to most physiological and behavioural processes, and so the need to measure the effects of light pollution on these processes is critical. In this issue, Da Silva and Kempenaers take on this task using an important reproductive behaviour in songbirds-dawn song. The geographic, temporal and taxonomic breadth of sampling in this study allows for a close examination of a potentially complex interaction between light pollution and natural variation in the behaviour of dawn singing across latitude, season and species. Their extensive dataset highlights complexity in how songbirds respond to light pollution. Although light pollution has a strong effect on the timing of dawn song, not all songbirds respond the same way to light pollution, and the effects of light pollution vary with changes in natural light levels. Early dawn singers show more flexibility in the timing of dawn song across the season and across latitudes than late dawn singers, and also appear less affected by light pollution at high latitudes than are late dawn singers. These findings suggest that not all songbirds are responding to artificial continuous daylight as they do to natural continuous daylight, highlighting the general need to measure the fitness effects of light pollution. © 2017 The Author. Journal of Animal Ecology © 2017 British Ecological Society.

  19. Extreme sensitivity of gene expression in human SH-SY5Y neurocytes to ultra-low doses of Gelsemium sempervirens

    Science.gov (United States)

    2014-01-01

    Background Gelsemium sempervirens L. (Gelsemium s.) is a traditional medicinal plant, employed as an anxiolytic at ultra-low doses and animal models recently confirmed this activity. However the mechanisms by which it might operate on the nervous system are largely unknown. This work investigates the gene expression of a human neurocyte cell line treated with increasing dilutions of Gelsemium s. extract. Methods Starting from the crude extract, six 100 × (centesimal, c) dilutions of Gelsemium s. (2c, 3c, 4c, 5c, 9c and 30c) were prepared according to the French homeopathic pharmacopoeia. Human SH-SY5Y neuroblastoma cells were exposed for 24 h to test dilutions, and their transcriptome compared by microarray to that of cells treated with control vehicle solutions. Results Exposure to the Gelsemium s. 2c dilution (the highest dose employed, corresponding to a gelsemine concentration of 6.5 × 10-9 M) significantly changed the expression of 56 genes, of which 49 were down-regulated and 7 were overexpressed. Several of the down-regulated genes belonged to G-protein coupled receptor signaling pathways, calcium homeostasis, inflammatory response and neuropeptide receptors. Fisher exact test, applied to the group of 49 genes down-regulated by Gelsemium s. 2c, showed that the direction of effects was significantly maintained across the treatment with high homeopathic dilutions, even though the size of the differences was distributed in a small range. Conclusions The study shows that Gelsemium s., a medicinal plant used in traditional remedies and homeopathy, modulates a series of genes involved in neuronal function. A small, but statistically significant, response was detected even to very low doses/high dilutions (up to 30c), indicating that the human neurocyte genome is extremely sensitive to this regulation. PMID:24642002

  20. ORIGIN: Metal Creation and Evolution from the Cosmic Dawn

    CERN Document Server

    Herder, Jan-Willem den; Ohashi, Takaya; Kouveliotou, Chryssa; Hartmann, Dieter H.; Kaastra, Jelle S.; Amati, L.; Andersen, M.I.; Arnaud, M.; Attéia, J.-L.; Bandler, S.; Barbera, M.; Barcons, X.; Barthelmy, S.; Basa, S.; Basso, S.; Boer, M.; Branchini, E.; Branduardi-Raymont, G.; Borgani, S.; Boyarsky, A.; Brunetti, G.; Budtz-Jorgensen, C.; Burrows, D.; Butler, N.; Campana, S.; Caroli, E.; Ceballos, M.; Christensen, F.; Churazov, E.; Comastri, A.; Colasanti, L.; Cole, R.; Content, R.; Corsi, A.; Costantini, E.; Conconi, P.; Cusumano, G.; de Plaa, J.; De Rosa, A.; Del Santo, M.; Di Cosimo, S.; De Pasquale, M.; Doriese, R.; Ettori, S.; Evans, P.; Ezoe, Y.; Ferrari, L.; Finger, H.; Figueroa-Feliciano, T.; Friedrich, P.; Fujimoto, R.; Furuzawa, A.; Fynbo, J.; Gatti, F.; Galeazzi, M.; Gehrels, N.; Gendre, B.; Ghirlanda, G.; Ghisellini, G.; Gilfanov, M.; Giommi, P.; Girardi, M.; Grindlay, J.; Cocchi, M.; Godet, O.; Guedel, M.; Haardt, F.; den Hartog, R.; Hepburn, I.; Hermsen, W.; Hjorth, J.; Hoekstra, H.; Holland, A.; Hornstrup, A.; van der Horst, A.; Hoshino, A.; in 't Zand, J.; Irwin, K.; Ishisaki, Y.; Jonker, P.; Kitayama, T.; Kawahara, H.; Kawai, N.; Kelley, R.; Kilbourne, C.; de Korte, P.; Kusenko, A.; Kuvvetli, I.; Labanti, M.; Macculi, C.; Maiolino, R.; Hesse, M. Mas; Matsushita, K.; Mazzotta, P.; McCammon, D.; Méndez, M.; Mignani, R.; Mineo, T.; Mitsuda, K.; Mushotzky, R.; Molendi, S.; Moscardini, L.; Natalucci, L.; Nicastro, F.; O'Brien, P.; Osborne, J.; Paerels, F.; Page, M.; Paltani, S.; Pedersen, K.; Perinati, E.; Ponman, T.; Pointecouteau, E.; Predehl, P.; Porter, S.; Rasmussen, A.; Rauw, G.; Röttgering, H.; Roncarelli, M.; Rosati, P.; Quadrini, E.; Ruchayskiy, O.; Salvaterra, R.; Sasaki, S.; Sato, K.; Savaglio, S.; Schaye, J.; Sciortino, S.; Shaposhnikov, M.; Sharples, R.; Shinozaki, K.; Spiga, D.; Sunyaev, R.; Suto, Y.; Takei, Y.; Tanvir, N.; Tashiro, M.; Tamura, T.; Tawara, Y.; Troja, E.; Tsujimoto, M.; Tsuru, T.; Ubertini, P.; Ullom, J.; Ursino, E.; Verbunt, F.; van de Voort, F.; Viel, M.; Wachter, S.; Watson, D.; Weisskopf, M.; Werner, N.; White, N.; Willingale, R.; Wijers, R.; Yamasaki, N.; Yoshikawa, K.; Zane, S.

    2011-01-01

    ORIGIN is a proposal for the M3 mission call of ESA aimed at the study of metal creation from the epoch of cosmic dawn. Using high-spectral resolution in the soft X-ray band, ORIGIN will be able to identify the physical conditions of all abundant elements between C and Ni to red-shifts of z=10, and beyond. The mission will answer questions such as: When were the first metals created? How does the cosmic metal content evolve? Where do most of the metals reside in the Universe? What is the role of metals in structure formation and evolution? To reach out to the early Universe ORIGIN will use Gamma-Ray Bursts (GRBs) to study their local environments in their host galaxies. This requires the capability to slew the satellite in less than a minute to the GRB location. By studying the chemical composition and properties of clusters of galaxies we can extend the range of exploration to lower redshifts (z ~ 0.2). For this task we need a high-resolution spectral imaging instrument with a large field of view. Using the ...

  1. Technologies for Low Frequency Radio Observations of the Cosmic Dawn

    Science.gov (United States)

    Jones, Dayton L.

    2014-01-01

    The Jet Propulsion Laboratory (JPL) is developing concepts and technologies for low frequency radio astronomy space missions aimed at observing highly redshifted neutral Hydrogen from the Dark Ages. This is the period of cosmic history between the recombination epoch when the microwave background radiation was produced and the re-ionization of the intergalactic medium by the first generation of stars (Cosmic Dawn). This period, at redshifts greater than about 20, is a critical epoch for the formation and evolution of large-scale structure in the universe. The 21-cm spectral line of Hydrogen provides the most promising method for directly studying the Dark Ages, but the corresponding frequencies at such large redshifts are only tens of MHz and thus require space-based observations to avoid terrestrial RFI and ionospheric absorption and refraction. This paper reports on the status of several low frequency technology development activities at JPL, including deployable bi-conical dipoles for a planned lunar-orbiting mission, and both rover-deployed and inflation-deployed long dipole antennas for use on the lunar surface.

  2. Red Dawn – the final episode of the Cold war

    Directory of Open Access Journals (Sweden)

    Ivan Kovačević

    2016-02-01

    Full Text Available In the period of renewal of the Cold war, after 1980, movies which abandon the idea of the dentate appear, and they represent the response to Soviet expansion taking place under the auspices of diminished military confrontation. Of course, the Hollywood reaction to the real expansion of communism was not at adequate response, but it is a part of the wider restructuring of American politics regarding the Soviet Union, which was evidenced by strengthening defenses through the Strategic Defense Initiative (SDI, forcible intervention in Grenada, helping anti-communist movements around the world etc. In opposition to part of the US political scene which shut down attempts to stop the spread of communism across the world, action through popular culture, especially film, created a new climate in which multifaceted pressures on the socialist block were prepared. The movie Red Dawn can be considered part of the reaction of US politics on the particularistic view of the dentate as a shield for military and political spread of the USSR in Africa and other parts of the world. This pressure played on the inherent weaknesses of Soviet society in the 1980’s, a society which, after a brief period of failed transformation fell apart at the start of the final decade of the 20th century.

  3. Geologic Mapping Results for Ceres from NASA's Dawn Mission

    Science.gov (United States)

    Williams, D. A.; Mest, S. C.; Buczkowski, D.; Scully, J. E. C.; Raymond, C. A.; Russell, C. T.

    2017-12-01

    NASA's Dawn Mission included a geologic mapping campaign during its nominal mission at dwarf planet Ceres, including production of a global geologic map and a series of 15 quadrangle maps to determine the variety of process-related geologic materials and the geologic history of Ceres. Our mapping demonstrates that all major planetary geologic processes (impact cratering, volcanism, tectonism, and gradation (weathering-erosion-deposition)) have occurred on Ceres. Ceres crust, composed of altered and NH3-bearing silicates, carbonates, salts and 30-40% water ice, preserves impact craters and all sizes and degradation states, and may represent the remains of the bottom of an ancient ocean. Volcanism is manifested by cryovolcanic domes, such as Ahuna Mons and Cerealia Facula, and by explosive cryovolcanic plume deposits such as the Vinalia Faculae. Tectonism is represented by several catenae extending from Ceres impact basins Urvara and Yalode, terracing in many larger craters, and many localized fractures around smaller craters. Gradation is manifested in a variety of flow-like features caused by mass wasting (landslides), ground ice flows, as well as impact ejecta lobes and melts. We have constructed a chronostratigraphy and geologic timescale for Ceres that is centered around major impact events. Ceres geologic periods include Pre-Kerwanan, Kerwanan, Yalodean/Urvaran, and Azaccan (the time of rayed craters, similar to the lunar Copernican). The presence of geologically young cryovolcanic deposits on Ceres surface suggests that there could be warm melt pockets within Ceres shallow crust and the dwarf planet remain geologically active.

  4. Decomposition and N cycling changes in redwood forests caused by sudden oak death

    Science.gov (United States)

    Richard C. Cobb; David M. Rizzo

    2012-01-01

    Phytophthora ramorum is an emergent pathogen in redwood forests which causes the disease sudden oak death. Although the disease does not kill coast redwood (Sequoia sempervirens), extensive and rapid mortality of tanoak (Notholithocarpus densiflorus) has removed this...

  5. Evolution of asteroid (4) Vesta in the light of Dawn

    Science.gov (United States)

    Thangjam, Guneshwar; Mengel, Kurt; Nathues, Andreas; Schmidt, Kai H.; Hoffmann, Martin

    2016-04-01

    Asteroid (4) Vesta has been visited by the NASA Dawn spacecraft in 2011/12. The combination of compositional/elemental information from the three onboard instruments with mineralogical information from the howardite-eucrite-diogenite (HED) clan of stony achondrites has shed new light on the surface lithologic heterogeneity and the early evolution. Although petrologic/chemical models have tried to unravel the evolutionary processes, inconsistencies exist for some chemical major element/phase [e.g., 1, 2]. A revised evolutionary model is presented here [3]. The three oxygen isotope signature of HEDs and, thus, of proto-Vesta is best met by a mixture of 80% ordinary plus 20 % CV chondrites. Assuming a 27Al-triggered magma ocean within the first MA after accretion and taking into account the reliable major element data of the silicate fraction of the chondritic mixture results a crystallization sequence that differs from the earlier models [1, 2, 3]. The crystallized phase obtained by 'MELTS' software [4] starts with olivine and continues with minor olivine plus orthopyroxene until the liquid reaches a Kd value (partition coefficient) of 0.31 where the fractionated melt is in equilibrium with the residual liquid [5]. The abundance of minerals and rocks formed in this model are converted in volume proportions assuming a spherical shape of early Vesta (262 km radius) with a core (FeNi, FeNiS) radius of 110 km [6]. Two scenarios are considered to describe the early bulk silicate Vesta. First, the early-crystallized olivine accumulated at the base of the silicate shell is accounted for a dunitic lower mantle having a thickness of 46 km while the later crystallized phases form an orthopyroxenitic upper mantle and a crust of thickness 84 and 22 km, respectively. Second, an olivine-rich lower mantle that gradually changes to orthopyroxene-rich upper mantle is expected having an overall shell thickness of 137 km, with a 15 km thick crust. An important result is that the deep

  6. Cluster observations of surface waves on the dawn flank magnetopause

    Directory of Open Access Journals (Sweden)

    C. J. Owen

    2004-03-01

    Full Text Available On 14 June 2001 the four Cluster spacecraft recorded multiple encounters of the dawn-side flank magnetopause. The characteristics of the observed electron populations varied between a cold, dense magnetosheath population and warmer, more rarified boundary layer population on a quasi-periodic basis. The demarcation between these two populations can be readily identified by gradients in the scalar temperature of the electrons. An analysis of the differences in the observed timings of the boundary at each spacecraft indicates that these magnetopause crossings are consistent with a surface wave moving across the flank magnetopause. When compared to the orientation of the magnetopause expected from models, we find that the leading edges of these waves are approximately 45° steeper than the trailing edges, consistent with the Kelvin-Helmholtz (KH driving mechanism. A stability analysis of this interval suggests that the magnetopause is marginally stable to this mechanism during this event. Periods in which the analysis predicts that the magnetopause is unstable correspond to observations of greater wave steepening. Analysis of the pulses suggests that the waves have an average wavelength of approximately 3.4 RE and move at an average speed of ~65km s-1 in an anti-sunward and northward direction, despite the spacecraft location somewhat south of the GSE Z=0 plane. This wave propagation direction lies close to perpendicular to the average magnetic field direction in the external magnetosheath, suggesting that these waves may preferentially propagate in the direction that requires no bending of these external field lines

    Key words. Magnetospheric physics (magnetospheric configuration and dynamics; MHD waves and unstabilities; solar wind-magnetosphere interactions

  7. Technologies for low radio frequency observations of the Cosmic Dawn

    Science.gov (United States)

    Jones, D. L.

    2014-03-01

    The Jet Propulsion Laboratory (JPL) is developing concepts and technologies for low frequency radio astronomy space missions aimed at observing highly redshifted neutral Hydrogen from the Dark Ages. This is the period of cosmic history between the recombination epoch when the microwave background radiation was produced and the re-ionization of the intergalactic medium by the first generation of stars (Cosmic Dawn). This period, at redshifts z > ~20, is a critical epoch for the formation and evolution of large-scale structure in the universe. The 21-cm spectral line of Hydrogen provides the most promising method for directly studying the Dark Ages, but the corresponding frequencies at such large redshifts are only tens of MHz and thus require space-based observations to avoid terrestrial RFI and ionospheric absorption and refraction. This paper reports on the status of several low frequency technology development activities at JPL, including deployable bi-conical dipoles for a planned lunar-orbiting mission, and both rover-deployed and inflation-deployed long dipole antennas for use on the lunar surface. In addition, recent results from laboratory testing of low frequency receiver designs are presented. Finally, several concepts for space-based imaging interferometers utilizing deployable low frequency antennas are described. Some of these concepts involve large numbers of antennas and consequently a large digital cross-correlator will be needed. JPL has studied correlator architectures that greatly reduce the DC power required for this step, which can dominate the power consumption of real-time signal processing. Strengths and weaknesses of each mission concept are discussed in the context of the additional technology development required.

  8. Source modelling at the dawn of gravitational-wave astronomy

    Science.gov (United States)

    Gerosa, Davide

    2016-09-01

    The age of gravitational-wave astronomy has begun. Gravitational waves are propagating spacetime perturbations ("ripples in the fabric of space-time") predicted by Einstein's theory of General Relativity. These signals propagate at the speed of light and are generated by powerful astrophysical events, such as the merger of two black holes and supernova explosions. The first detection of gravitational waves was performed in 2015 with the LIGO interferometers. This constitutes a tremendous breakthrough in fundamental physics and astronomy: it is not only the first direct detection of such elusive signals, but also the first irrefutable observation of a black-hole binary system. The future of gravitational-wave astronomy is bright and loud: the LIGO experiments will soon be joined by a network of ground-based interferometers; the space mission eLISA has now been fully approved by the European Space Agency with a proof-of-concept mission called LISA Pathfinder launched in 2015. Gravitational-wave observations will provide unprecedented tests of gravity as well as a qualitatively new window on the Universe. Careful theoretical modelling of the astrophysical sources of gravitational-waves is crucial to maximize the scientific outcome of the detectors. In this Thesis, we present several advances on gravitational-wave source modelling, studying in particular: (i) the precessional dynamics of spinning black-hole binaries; (ii) the astrophysical consequences of black-hole recoils; and (iii) the formation of compact objects in the framework of scalar-tensor theories of gravity. All these phenomena are deeply characterized by a continuous interplay between General Relativity and astrophysics: despite being a truly relativistic messenger, gravitational waves encode details of the astrophysical formation and evolution processes of their sources. We work out signatures and predictions to extract such information from current and future observations. At the dawn of a revolutionary

  9. Preparing for Dawn's Mission at Ceres: Challenges and Opportunities in the Exploration of a Dwarf Planet

    Science.gov (United States)

    Rayman, Marc D.; Mase, Robert A.

    2014-01-01

    After escaping from Vesta in 2012, Dawn is continuing its 2.5-year flight to dwarf planet Ceres. Investigating this second destination promises to provide a view of an intriguing world of ice and rock, likely displaying fascinating geology entirely unlike any body yet orbited by a spacecraft. Dawn spends the significant majority of the time thrusting with its ion propulsion system to deliver the 3.6 km/s required to rendezvous with Ceres. Meanwhile, the operations team has developed the sequences that will be used there. Following orbit capture in March 2015, Dawn will fly to a series of four circular polar science orbits. The orbits, ranging from about 13,500 km to 375 km in altitude, are designed to optimize the scientific observations. The overall strategy for exploring Ceres is based strongly on the extremely successful 16 months of Vesta operations, during which Dawn met or exceeded all of its objectives. Nevertheless, the loss of two of the spacecraft's four reaction wheels has necessitated some important changes. Based on a very productive hydrazine conservation campaign in the interplanetary cruise and the development of new hydrazine-efficient methods of operating at Ceres, there is good reason to expect that Dawn will be able to accomplish all of its objectives regardless of the health of the reaction wheels. This paper describes the progress in traveling to Ceres as well as the plans for exploring this giant, icy world.

  10. "The Voyage of the Dawn Treader": The World at the Dawn of 2006-2011. Understanding societal themes

    Directory of Open Access Journals (Sweden)

    Sanchen Henning

    2014-01-01

    Full Text Available This article offers a snapshot of the societal dynamics of individual countries around the world, integrated into a global view to provide the tourism and hospitality industry insight into potential customer needs and perceptions. The OPUS Reports on the Global Dynamics at the Dawn of 20...are published annually since 2006 in the Journal of Organisational and Social Dynamics in London. The researchers were interested in a metaphoric tour of the world's social dynamics over time as perceived from both the Systems psychodynamics and Positive psychology theoretical paradigms. The research methodology was qualitative using a case study approach where each of the six (2006- 2011 years' integrated hypotheses was studied as a separate case study. The six cases were integrated into new hypotheses reflecting how global social dynamics changed over the years. The findings were presented as hypotheses per individual country followed by an integrated global hypothesis. The three main emerging themes were framed as Identity, Hope and Love. Identity contains the sub-theme of Facelessness, described as the fragmentation of cultures, a loss of cultural identity and a search for shared social meaning. Hope embodies the theme Knight/s in shining armour which describes youth as saviours and Obama as saviour. The loss of Hope is illustrated by the sub-themes of the impotence of the older generation, pessimism, fear and the death of a way of life. Love consists of human connection described as affiliation, support and trust. The lack of Love consists of human alienation described as loneliness, aggression and violence. The findings of the study identify societal themes that can be operationalized in the tourism and hospitality industry through targeted offerings to provide in the unmet needs of society. In addition, training interventions to improve customer service and return on investment can be based on the findings of this research.

  11. High-resolution Ceres Low Altitude Mapping Orbit Atlas derived from Dawn Framing Camera images

    Science.gov (United States)

    Roatsch, Th.; Kersten, E.; Matz, K.-D.; Preusker, F.; Scholten, F.; Jaumann, R.; Raymond, C. A.; Russell, C. T.

    2017-06-01

    The Dawn spacecraft Framing Camera (FC) acquired over 31,300 clear filter images of Ceres with a resolution of about 35 m/pxl during the eleven cycles in the Low Altitude Mapping Orbit (LAMO) phase between December 16 2015 and August 8 2016. We ortho-rectified the images from the first four cycles and produced a global, high-resolution, uncontrolled photomosaic of Ceres. This global mosaic is the basis for a high-resolution Ceres atlas that consists of 62 tiles mapped at a scale of 1:250,000. The nomenclature used in this atlas was proposed by the Dawn team and was approved by the International Astronomical Union (IAU). The full atlas is available to the public through the Dawn Geographical Information System (GIS) web page [http://dawngis.dlr.de/atlas] and will become available through the NASA Planetary Data System (PDS) (http://pdssbn.astro.umd.edu/).

  12. Vesta and Ceres by the light of Dawn

    Science.gov (United States)

    Russell, Christopher T.

    2015-11-01

    Ceres and Vesta are the most massive bodies in the main asteroid belt. They both appear to be intact protoplanets whose growth may have been drastically altered by the concomitant formation of Jupiter.. These two bodies have witnessed 4.6 Ga of solar system history, much, but not all, of which has been recorded in their surfaces. Dawn’s objective is to interview these two witnesses to learn as much as possible about the early epoch. These bodies are protoplanets, our best archetypes of the early building blocks of the terrestrial planets. In particular, siderophile elements in the Earth’s core were probably first segregated in Vesta-like bodies, and its water was likely first condensed in Ceres-like bodies.Many of the basaltic achondrites originated from a common parent body. Dawn verified that Vesta was consistent with that parent body. hence strengthening geochemical inferences from these samples on the formation and evolution of the solar system and supporting hypotheses for their delivery from Vesta to Earth. Ceres has not revealed itself with a meteoritic record. While the surface is scarred with craters, it is probable that the ejecta from the crater-forming event created little competent material from the icy crust and any such ejected projectiles that reached Earth might have disintegrated upon entry into the Earth’s atmosphere.Ceres’ surface differs greatly from Vesta’s. Plastic or fluidized mass wasting is apparent, as are many irregularly shaped craters, including many polygonal crater forms. There are many central-pit craters possibly caused by volatilization of the crust in the center of the impact. There are also many central-peak craters, which were made by rebound or pingo-like formation processes. Bright deposits dot the landscape, which are possibly salt-rich, suggesting fluvial activity beneath the crust. Observations of the brightest spots on Ceres could suggest sublimation from the surface of the bright area, which may be water vapor

  13. ORIGIN: Metal Creation and Evolution from the Cosmic Dawn

    Science.gov (United States)

    Kouveliotou, C.; vanderHorst, A.; Weisskopf, M.; White, N.; denHerder, J. W.; Costantini, E.; denHartog, R.; Hermsen, W.; in'tZhand, J.; Kaastra, J.; hide

    2012-01-01

    ORIGIN is a proposal for the M3 mission call of ESA aimed at the study of metal creation from the epoch of cosmic dawn. Using high-spectral resolution in the soft X-ray band, ORIGIN will be able to identify the physical conditions of all abundant elements between C and Ni to red-shifts of z=10, and beyond. The mission will answer questions such as: When were the first metals created? How does the cosmic metal content evolve? Where do most of the metals reside in the Universe? What is the role of metals in structure formation and evolution? To reach out to the early Universe ORIGIN will use Gamma-Ray Bursts (GRBs) to study their local environments in their host galaxies. This requires the capability to slew the satellite in less than a minute to the GRB location. By studying the chemical composition and properties of clusters of galaxies we can extend the range of exploration to lower redshifts (z approx. 0.2). For this task we need a high-resolution spectral imaging instrument with a large field of view. Using the same instrument, we can also study the so far only partially detected baryons in the Warm-Hot Intergalactic Medium (WHIM). The less dense part of the WHIM will be studied using absorption lines at low redshift in the spectra for GRBs. The ORIGIN mission includes a Transient Event Detector (coded mask with a sensitivity of 0.4 photon/sq cm/s in 10 s in the 5-150 keV band) to identify and localize 2000 GRBs over a five year mission, of which approx.65 GRBs have a redshift >7. The Cryogenic Imaging Spectrometer, with a spectral resolution of 2.5 eV, a field of view of 30 arcmin and large effective area below 1 keV has the sensitivity to study clusters up to a significant fraction of the virial radius and to map the denser parts of the WHIM (factor 30 higher than achievable with current instruments). The payload is complemented by a Burst InfraRed Telescope to enable onboard red-shift determination of GRBs (hence securing proper follow up of high-z bursts

  14. A natural resource condition assessment for Sequoia and Kings Canyon National Parks: Appendix 14: plants of conservation concern

    Science.gov (United States)

    Huber, Ann; Das, Adrian; Wenk, Rebecca; Haultain, Sylvia

    2013-01-01

    Sequoia and Kings Canyon National Parks are located in the California Floristic Province, which has been named one of world‘s hotspots of endemic biodiversity (Myers et al. 2000). The California Floristic Province is the largest and most important geographic floristic unit in California and extends from the Klamath Mountains of southwestern Oregon to the northwestern portion of Baja California (Hickman 1993). The Sierra Nevada, one of six regions that make up the California Floristic Province, covers nearly 20% of the land in California yet contains over 50% of its flora. Within the Sierra Nevada, the southern Sierra supports more Sierran endemic and rare plant taxa than the central and northern portions of the region (Shevock 1996). Sequoia and Kings Canyon National Parks (SEKI) encompass roughly 20% of the southern Sierra Nevada region. The parks overlap three floristic subregions (central Sierra Nevada High, southern Sierra Nevada High, and southern Sierra Nevada Foothills), and border the Great Basin Floristic Province. The parks support a rich and diverse vascular flora composed of over 1,560 taxa. Of these, 150 taxa are identified as having special status. The term special status is applied here to include taxa that are state or federally listed, rare in California, or at risk because they have a limited distribution. Only one species from these parks is listed under the state or federal Endangered Species Acts (Carex tompkinsii, Tompkins‘ sedge, is listed as a rare species under the California Endangered Species Act), and one species is under review for federal endangered listing (Pinus albicaulis, whitebark pine). However, an absence of threatened and endangered species recognized by Endangered Species Acts is not equivalent to an absence of species at risk. There are 83 plant taxa documented as occurring in SEKI that are considered imperiled or vulnerable in the state by the California Department of Fish and Game‘s California Natural Diversity

  15. Instituto SEQUOIA : Um serviço privado,  multidisciplinar e de cuidado aos idosos SEQUOIA Institute: A multidisciplinary private service for the care of senior citizens L’Institut SEQUOIA : Un service privé multidisciplinaire pour les soins des personnes du troisième âge Instituto SEQUOIA : Un servicio privado y multidisciplinario de atención a las personas de la tercera edad

    Directory of Open Access Journals (Sweden)

    Anelise Fonseca

    2011-10-01

    Full Text Available Population aging is a reality all over the world, requiring a change in the way care is perceived and resources are divided for different age groups. In Brazil, current indicators and projections place the country among those with the highest number of elderly people. By contrast, there is a shortage of action plans and inter- and multi-disciplinary teams, as well as public policies and professionals, focusing on the elderly, in part as a consequence of an accelerated aging process in developing countries. Within this context, the SEQUOIA Institute (IS was created to attend to this process by monitoring the overall health of patients. The institute's routine work includes clinical actions, team meetings, socialization projects and lectures. The IS features a 10% yearly growth in medical assistance, a 20% rise in psychological treatments, and a 50% increase in lecture attendance.Le vieillissement de la population est un phénomène mondial qui exige de revoir la façon dont sont perçus les soins et dont sont divisées les ressources en fonction des différentes tranches d’âge. Les indicateurs et les projections actuels montrent que le Brésil est le pays qui compte la plus grande proportion de personnes âgées. Et pourtant, les plans d’action, les équipes inter- et pluridisciplinaires, mais aussi les politiques publiques et les professionnels spécialistes des questions liées aux personnes âgées sont en nombre insuffisant, notamment en raison d’un processus de vieillissement accéléré dans les pays en développement. C’est dans ce contexte qu’a été créé l’Institut SEQUOIA (IS, dont la mission consiste à gérer ce processus en effectuant un suivi de la santé générale des patients. Les principales tâches de l’institut incluent études cliniques, réunions d’équipes, projets impliquant des débats et conférences. L’IS affiche une croissance annuelle de 10 % dans le secteur de l’assistance médicale, de 20

  16. Critical Loads of Atmospheric Nitrogen Deposition for Aquatic Ecosystems in Yosemite and Sequoia and Kings Canyon National Parks

    Science.gov (United States)

    Nanus, L.; Clow, D. W.; Sickman, J. O.

    2016-12-01

    High-elevation aquatic ecosystems in Yosemite (YOSE) and Sequoia and Kings Canyon (SEKI) National Parks are impacted by atmospheric nitrogen (N) deposition associated with local and regional air pollution. Documented effects include elevated surface water nitrate concentrations, increased algal productivity, and changes in diatom species assemblages. Annual wet inorganic N deposition maps, developed at 1-km resolution for YOSE and SEKI to quantify N deposition to sensitive high-elevation ecosystems, range from 1.0 to over 5.0 kg N ha-1 yr-1. Critical loads of N deposition for nutrient enrichment of aquatic ecosystems were quantified and mapped using a geostatistical approach, with N deposition, topography, vegetation, geology, and climate as potential explanatory variables. Multiple predictive models were created using various combinations of explanatory variables; this approach allowed us to better quantify uncertainty and more accurately identify the areas most sensitive to atmospherically deposited N. The lowest critical loads estimates and highest exceedances identified within YOSE and SEKI occurred in high-elevation basins with steep slopes, sparse vegetation, and areas of neoglacial till and talus. These results are consistent with previous analyses in the Rocky Mountains, and highlight the sensitivity of alpine ecosystems to atmospheric N deposition.

  17. Dawn chorus variation in East-Asian tropical montane forest birds and its ecological and morphological correlates

    NARCIS (Netherlands)

    Chen, W.-M.; Lee, Y.-F.; Tsai, C.-F.; Yao, C.-T.; Chen, Y.-H.; Li, S.-H.; Kuo, Y.-M.

    2015-01-01

    Many birds in breeding seasons engage in vigorous dawn singing that often turns to a prominent chorus. We examined dawn chorus variation of avian assemblages in a tropical montane forest in Taiwan and tested the hypothesis that onset sequence is affected by eye sizes, foraging heights, and diet of

  18. Parallel computing of a climate model on the dawn 1000 by domain decomposition method

    Science.gov (United States)

    Bi, Xunqiang

    1997-12-01

    In this paper the parallel computing of a grid-point nine-level atmospheric general circulation model on the Dawn 1000 is introduced. The model was developed by the Institute of Atmospheric Physics (IAP), Chinese Academy of Sciences (CAS). The Dawn 1000 is a MIMD massive parallel computer made by National Research Center for Intelligent Computer (NCIC), CAS. A two-dimensional domain decomposition method is adopted to perform the parallel computing. The potential ways to increase the speed-up ratio and exploit more resources of future massively parallel supercomputation are also discussed.

  19. Chemical Mixing Model and K-Th-Ti Systematics and HED Meteorites for the Dawn Mission

    Science.gov (United States)

    Usui, T.; McSween, H. Y., Jr.; Mittlefehldt, D. W.; Prettyman, T. H.

    2009-01-01

    The Dawn mission will explore 4 Vesta, a large differentiated asteroid believed to be the parent body of the howardite, eucrite and diogenite (HED) meteorite suite. The Dawn spacecraft carries a gamma-ray and neutron detector (GRaND), which will measure the abundances of selected elements on the surface of Vesta. This study provides ways to leverage the large geochemical database on HED meteorites as a tool for interpreting chemical analyses by GRaND of mapped units on the surface of Vesta.

  20. SEQUOIA Institute: A multidisciplinary private service for the care of senior citizens L’Institut SEQUOIA : Un service privé multidisciplinaire pour les soins des personnes du troisième âge Instituto SEQUOIA : Un servicio privado y multidisciplinario de atención a las personas de la tercera edad

    Directory of Open Access Journals (Sweden)

    Anelise Fonseca

    2011-10-01

    Full Text Available Population aging is a reality all over the world, requiring a change in the way care is perceived and resources are divided for different age groups. In Brazil, current indicators and projections place the country among those with the highest number of elderly people. By contrast, there is a shortage of action plans and inter- and multi-disciplinary teams, as well as public policies and professionals, focusing on the elderly, in part as a consequence of an accelerated aging process in developing countries. Within this context, the SEQUOIA Institute (IS was created to attend to this process by monitoring the overall health of patients. The institute's routine work includes clinical actions, team meetings, socialization projects and lectures. The IS features a 10% yearly growth in medical assistance, a 20% rise in psychological treatments, and a 50% increase in lecture attendance.Le vieillissement de la population est un phénomène mondial qui exige de revoir la façon dont sont perçus les soins et dont sont divisées les ressources en fonction des différentes tranches d’âge. Les indicateurs et les projections actuels montrent que le Brésil est le pays qui compte la plus grande proportion de personnes âgées. Et pourtant, les plans d’action, les équipes inter- et pluridisciplinaires, mais aussi les politiques publiques et les professionnels spécialistes des questions liées aux personnes âgées sont en nombre insuffisant, notamment en raison d’un processus de vieillissement accéléré dans les pays en développement. C’est dans ce contexte qu’a été créé l’Institut SEQUOIA (IS, dont la mission consiste à gérer ce processus en effectuant un suivi de la santé générale des patients. Les principales tâches de l’institut incluent études cliniques, réunions d’équipes, projets impliquant des débats et conférences. L’IS affiche une croissance annuelle de 10 % dans le secteur de l’assistance médicale, de 20

  1. Dawn approaches Ceres: Analysis of first FC color data

    Science.gov (United States)

    Hoffmann, Martin; Nathues, Andreas; Schäfer, Michael; Russell, Christopher T.; Schäfer, Tanja; Memgel, Kurt; Reddy, Vishnu; Thangjam, Guneshwar S.; Sierks, Holger; Christensen, Ulrich; Hiesinger, Harald; Le Corre, Lucille; Gutiérrez-Marqués, Pablo; Büttner, Irene; Hall, Ian; Ripken, Joachim; Sykes, Mark V.; Li, Jian-Yang

    2015-04-01

    Since December 1, 2014 the Dawn spacecraft obtains images of Ceres by its onboard Framing Camera in seven color bands and one clear (panchromatic) filter. The size of Ceres (in pixels) has increased during this time from a diameter of 9 pixels to about a quarter of the full frame. The higher resolution of more recent data reveals first details of the topography and distribution of reflectances. Also, we are going to show evidence on extent and elevation of impact structures and other geologic features. These are first indications on their context and unique properties of the surface and evolution of Ceres. The relationship of these features to previous resolved HST observations (Li et al., 2006) and the recent discussion on water emission activity (Küppers et al., 2014), as well as their distribution in longitude and latitude, will be discussed. The (anticipated) most recent data will be able to resolve water related features comparable with those on icy satellites. Potential consequences for the upcoming high resolution data and their planning are to be shown. The first data, obtained on Dec 1st, have been used to start studying the phase curve and to derive an integrated spectrum of Ceres (17 co-registered pixels around the center of the disk). The data were integrated to a single spectrum between 0.44 µm and 0.96 µm. The spectrum is essentially flat over all bands within the accuracy of the data (± 0.01 in reflectance). It is consistent with previous Earth based spectra (Vilas and McFadden, 1992, Burbine et al., 2002, Li et al., 2006). Potential sites showing spectral absorption features in the visual wavelength range will be discussed. The distribution of reflectances at positions relative to the sub-solar longitude also confirms the expected extrapolation of the phase curve from ground based observations. A comparison of the observed phase effect and detected surface features will be presented. Thus differences of the surface roughness on different size

  2. A Study on the Type of School during the Dawn of Modern Education in Bhutan

    Science.gov (United States)

    Hirayama, Takehiro

    2015-01-01

    This study aims to clarify the state of school education in the Bhutan during the 1940-50s, a period of dawn of the modern education in Bhutan, by classifying schools and identifying their contrasting characteristics. The origins of modern education in Bhutan can be traced back approximately 100 years. Bhutan's modern period began in 1907 when…

  3. The Square Kilometre Array Epoch of Reionisation and Cosmic Dawn Experiment

    Science.gov (United States)

    Trott, Cathryn M.

    2018-05-01

    The Square Kilometre Array (SKA) Epoch of Reionisation and Cosmic Dawn (EoR/CD) experiments aim to explore the growth of structure and production of ionising radiation in the first billion years of the Universe. Here I describe the experiments planned for the future low-frequency components of the Observatory, and work underway to define, design and execute these programs.

  4. A new dawn for plant mitochondrial NAD(P)H dehydrogenases

    DEFF Research Database (Denmark)

    Møller, I.M.

    2002-01-01

    The expression of complex I and two homologues of bacterial and yeast NADH dehydrogenases, NDA and NDB, have been studied in potato leaf mitochondria. The mRNA level of NDA is completely light dependent and shows a diurnal rhythm with a sharp maximum just after dawn. NDA protein quantity and inte...

  5. 4 Vesta in Color: High Resolution Mapping from Dawn Framing Camera Images

    Science.gov (United States)

    Reddy, V.; LeCorre, L.; Nathues, A.; Sierks, H.; Christensen, U.; Hoffmann, M.; Schroeder, S. E.; Vincent, J. B.; McSween, H. Y.; Denevi, B. W.; hide

    2011-01-01

    Rotational surface variations on asteroid 4 Vesta have been known from ground-based and HST observations, and they have been interpreted as evidence of compositional diversity. NASA s Dawn mission entered orbit around Vesta on July 16, 2011 for a year-long global characterization. The framing cameras (FC) onboard the Dawn spacecraft will image the asteroid in one clear (broad) and seven narrow band filters covering the wavelength range between 0.4-1.0 microns. We present color mapping results from the Dawn FC observations of Vesta obtained during Survey orbit (approx.3000 km) and High-Altitude Mapping Orbit (HAMO) (approx.950 km). Our aim is to create global color maps of Vesta using multi spectral FC images to identify the spatial extent of compositional units and link them with other available data sets to extract the basic mineralogy. While the VIR spectrometer onboard Dawn has higher spectral resolution (864 channels) allowing precise mineralogical assessment of Vesta s surface, the FC has three times higher spatial resolution in any given orbital phase. In an effort to extract maximum information from FC data we have developed algorithms using laboratory spectra of pyroxenes and HED meteorites to derive parameters associated with the 1-micron absorption band wing. These parameters will help map the global distribution of compositionally related units on Vesta s surface. Interpretation of these units will involve the integration of FC and VIR data.

  6. Effects of artificial dawn on sleep inertia, skin temperature, and the awakening cortisol response

    NARCIS (Netherlands)

    van de Werken, Maan; Gimenez, Marina C.; de Vries, Bonnie; Beersma, Domien G. M.; van Someren, Eus J. W.; Gordijn, Marijke C. M.

    P>The effect of artificial dawn during the last 30 min of sleep on subsequent dissipation of sleep inertia was investigated, including possible involvement of cortisol and thermoregulatory processes. Sixteen healthy subjects who reported difficulty with waking up participated in random order in a

  7. The effect of low- and high-power microwave irradiation on in vitro grown Sequoia plants and their recovery after cryostorage.

    Science.gov (United States)

    Halmagyi, A; Surducan, E; Surducan, V

    2017-09-01

    Two distinct microwave power levels and techniques have been studied in two cases: low-power microwave (LPM) irradiation on in vitro Sequoia plants and high-power microwave (HPM) exposure on recovery rates of cryostored (-196°C) Sequoia shoot apices. Experimental variants for LPM exposure included: (a) in vitro plants grown in regular conditions (at 24 ± 1°C during a 16-h light photoperiod with a light intensity of 39.06 μEm -2 s -1 photosynthetically active radiation), (b) in vitro plants grown in the anechoic chamber with controlled environment without microwave irradiation, and (c) in vitro plants grown in the anechoic chamber with LPM irradiation for various times (5, 15, 30, 40 days). In comparison to control plants, significant differences in shoot multiplication and growth parameters (length of shoots and roots) were observed after 40 days of LPM exposure. An opposite effect was achieved regarding the content of total soluble proteins, which decreased with increasing exposure time to LPM. HPM irradiation was tested as a novel rewarming method following storage in liquid nitrogen. To our knowledge, this is the first report using this type of rewarming method. Although, shoot tips subjected to HPM exposure showed 28% recovery following cryostorage compared to 44% for shoot tips rewarmed in liquid medium at 22 ± 1 °C, we consider that the method represent a basis and can be further improved. The results lead to the overall conclusion that LPM had a stimulating effect on growth and multiplication of in vitro Sequoia plants, while the HPM used for rewarming of cryopreserved apices was not effective to achieve high rates of regrowth after liquid nitrogen exposure.

  8. Effects of stock use and backpackers on water quality in wilderness in Sequoia and Kings Canyon National Parks, USA

    Science.gov (United States)

    Clow, David W.; Forrester, Harrison; Miller, Benjamin; Roop, Heidi; Sickman, James O.; Ryu, Hodon; Santo Domingo, Jorge

    2013-01-01

    During 2010-2011, a study was conducted in Sequoia and Kings Canyon National Parks (SEKI) to evaluate the influence of pack animals (stock) and backpackers on water quality in wilderness lakes and streams. The study had three main components: (1) a synoptic survey of water quality in wilderness areas of the parks, (2) paired water-quality sampling above and below several areas with differing types and amounts of visitor use, and (3) intensive monitoring at six sites to document temporal variations in water quality. Data from the synoptic water-quality survey indicated that wilderness lakes and streams are dilute and have low nutrient and Escherichia coli (E. coli) concentrations. The synoptic survey sites were categorized as minimal use, backpacker use, or mixed use (stock and backpackers), depending on the most prevalent type of use upstream from the sampling locations. Sites with mixed use tended to have higher concentrations of most constituents (including E.coli) than those categorized as minimal-use (p≤0.05); concentrations at backpacker-use sites were intermediate. Data from paired-site sampling indicated that E.coli, total coliform, and particulate phosphorus concentrations were greater in streams downstream from mixed-use areas than upstream from those areas (p≤0.05). Paired-site data also indicated few statistically significant differences in nutrient, E. coli, or total coliform concentrations in streams upstream and downstream from backpacker-use areas. The intensive-monitoring data indicated that nutrient and E. coli concentrations normally were low, except during storms, when notable increases in concentrations of E.coli, nutrients, dissolved organic carbon, and turbidity occurred. In summary, results from this study indicate that water quality in SEKI wilderness generally is good, except during storms; and visitor use appears to have a small, but statistically significant influence on stream water quality.

  9. A comparison of effects from prescribed fires and wildfires managed for resource objectives in Sequoia and Kings Canyon National Parks

    Science.gov (United States)

    Nesmith, C.B.; Caprio, Anthony C.; Pfaff, Anne H.; McGinnis, Thomas W.; Keeley, Jon E.

    2011-01-01

    Current goals for prescription burning are focused on measures of fuel consumption and changes in forest density. These benchmarks, however, do not address the extent to which prescription burning meets perceived ecosystem needs of heterogeneity in burning, both for overstory trees and understory herbs and shrubs. There are still questions about how closely prescribed fires mimic these patterns compared to natural wildfires. This study compared burn patterns of prescribed fires and managed unplanned wildfires to understand how the differing burning regimes affect ecosystem properties. Measures of forest structure and fire severity were sampled in three recent prescribed fires and three wildfires managed for resource objectives in Sequoia and Kings Canyon National Parks. Fine scale patterns of fire severity and heterogeneity were compared between fire types using ground-based measures of fire effects on fuels and overstory and understory vegetation. Prescribed fires and wildfires managed for resource objectives displayed similar patterns of overstory and understory fire severity, heterogeneity, and seedling and sapling survival. Variation among plots within the same fire was always greater than between fire types. Prescribed fires can provide burned landscapes that approximate natural fires in many ways. It is recognized that constraints placed on when wildfires managed for resource objectives are allowed to burn freely may bias the range of conditions that might have been experienced under more natural conditions. Therefore they may not exactly mimic natural wildfires. Overall, the similarity in fire effects that we observed between prescribed fires and managed wildfires indicate that despite the restrictions that are often placed on prescribed fires, they appear to be creating post-fire conditions that approximate natural fires when assessed on a fine spatial scale.

  10. Early birds are sexy: male age, dawn song and extrapair paternity in blue tits, Cyanistes (formerly Parus) caeruleus

    DEFF Research Database (Denmark)

    Poesel, Angelika; Kunc, H.P.; Foerster, K.

    2006-01-01

    Sexual selection theory predicts that signals reflecting the relative quality of individuals should be used in mate choice. Females could base their choice of copulation partners on male secondary sexual traits that honestly signal male age, as predicted by the age-based indicator mechanism....... Studies have shown that female blue tits prefer older males and that aspects of dawn song reflect male quality, but it remains unknown whether dawn song characteristics correlate with male age. We compared dawn song characteristics of second-year (SY) and older (ASY) male blue tits (cross......-sectional analysis), and tested for age-related changes within individuals (longitudinal analysis) and differential overwinter survival of SY males. We further investigated the relation between dawn song and paternity gain and loss. We found that ASY male blue tits began to sing earlier relative to sunrise than did...

  11. Cultural Appropriation in Games : A Comparative Study Between Far Cry 3 (2012), Overwatch (2016) and Horizon Zero Dawn (2017)

    OpenAIRE

    Svensson, Tova

    2017-01-01

    This thesis is a comparative study between Far Cry 3 (2012), Overwatch (2016) and Horizon Zero Dawn (2017) to determine how game developers appropriate minority cultures in character design. The character designs are compared to the cultures of origin to determine whether they have been appropriated and to what extent. Far Cry 3 appropriates Maori and Samoan cultures, Horizon Zero Dawn appropriates native American cultures, and Overwatch appropriates both Maori and native American cultures. A...

  12. The effects of raking on sugar pine mortality following prescribed fire in Sequoia and Kings Canyon National Parks, California, USA

    Science.gov (United States)

    Nesmith, Jonathan C. B.; O'Hara, Kevin L.; van Mantgem, Phillip J.; de Valpine, Perry

    2010-01-01

    Prescribed fire is an important tool for fuel reduction, the control of competing vegetation, and forest restoration. The accumulated fuels associated with historical fire exclusion can cause undesirably high tree mortality rates following prescribed fires and wildfires. This is especially true for sugar pine (Pinus lambertiana Douglas), which is already negatively affected by the introduced pathogen white pine blister rust (Cronartium ribicola J.C. Fisch. ex Rabenh). We tested the efficacy of raking away fuels around the base of sugar pine to reduce mortality following prescribed fire in Sequoia and Kings Canyon national parks, California, USA. This study was conducted in three prescribed fires and included 457 trees, half of which had the fuels around their bases raked away to mineral soil to 0.5 m away from the stem. Fire effects were assessed and tree mortality was recorded for three years after prescribed fires. Overall, raking had no detectable effect on mortality: raked trees averaged 30% mortality compared to 36% for unraked trees. There was a significant effect, however, between the interaction of raking and average pre-treatment forest floor fuel depth: the predicted probability of survival of a 50 cm dbh tree was 0.94 vs. 0.96 when average pre-treatment fuel depth was 0 cm for a raked and unraked tree, respectively. When average pre-treatment forest floor fuel depth was 30 cm, the predicted probability of survival for a raked 50 cm dbh tree was 0.60 compared to only 0.07 for an unraked tree. Raking did not affect mortality when fire intensity, measured as percent crown volume scorched, was very low (0% scorch) or very high (>80% scorch), but the raking treatment significantly increased the proportion of trees that survived by 9.6% for trees that burned under moderate fire intensity (1% to 80% scorch). Raking significantly reduced the likelihood of bole charring and bark beetle activity three years post fire. Fuel depth and anticipated fire intensity need

  13. Operations Odyssey Dawn and Unified Protector: Another Win for Warden s Theory

    Science.gov (United States)

    2014-12-04

    the aircraft aimed at armoured vehicles just outside Benghazi. At night, US Navy ships and Royal Navy submarine HMS Triumph launched 112 Tomahawk...the vicinity of Zintan: 3 tanks, 1 anti-aircraft weapon system and 1 armoured vehicles were destroyed. In the vicinity of Brega: 1 building was... demographic groups) to be sympathetic and helpful in a variety of ways.”95 For Operations Odyssey Dawn and Unified Protector, the objective was

  14. [Role of growth hormone in the pathogenesis of dawn phenomenon in IDDM].

    Science.gov (United States)

    Mimura, A; Kageyama, S; Itoh, K; Miura, J; Kurata, H; Yokoyama, J; Ikeda, Y

    1992-06-20

    The early morning hyperglycemia of diabetic patients has been commonly referred to as the "dawn phenomenon". Recently the nocturnal surges of growth hormone (GH) have been suggested as an important factor in the pathogenesis of the dawn phenomenon. In order to reassess the role of the nocturnal GH secretion in the dawn phenomenon, seven C-peptide negative diabetic patients were studied during 48hr-feedback control using a closed-loop insulin infusion device (Biostator). They received oral sleeping medication only on the first night (control) and sleeping medication with anticholinergic agent (pirenzepine 75mg) on the second night, and blood glucose, insulin requirements, GH and cortisol concentrations during 0000hr and 0700hr were measured. The peak of sleep-induced GH secretions was markedly suppressed by pirenzepine in comparison with the control night (19.8 +/- 3.7 vs. 3.0 +/- 1.2ng/ml; p less than 0.05). Insulin requirements during 0500hr and 0700hr were suppressed significantly by pirenzepine (3.0 +/- 0.2 vs. 2.0 +/- 0.2U/2hr; p less than 0.05). Insulin infusion ratio, i.e. insulin requirements during 0500hr and 0700hr divided by those during 0000hr and 0200hr, was decreased by pirenzepine (2.2 +/- 0.3 vs. 1.5 +/- 0.2; p less than 0.05). There were no significant differences in blood glucose and cortisol concentrations whether or not the anticholinergic agent was given. In conclusion, these results have shown that an anticholinergic agent may be useful in the management of insulin-treated patients with marked dawn phenomenon.

  15. Measurements of the global 21-cm signal from the Cosmic Dawn

    Science.gov (United States)

    Bernardi, Gianni

    2018-05-01

    The sky-averaged (global) 21-cm signal is a very promising probe of the Cosmic Dawn, when the first luminous sources were formed and started to shine in a substantially neutral intergalactic medium. I here report on the status and early result of the Large-Aperture Experiment to Detect the Dark Age that focuses on observations of the global 21-cm signal in the 16 <~ z <~ 30 range.

  16. Reconciling the dawn-dusk asymmetry in Mercury's exosphere with the micrometeoroid impact directionality

    OpenAIRE

    Pokorný, Petr; Sarantos, Menelaos; Janches, Diego

    2017-01-01

    Combining dynamical models of dust from Jupiter Family Comets and Halley-type Comets, we demonstrate that the seasonal variation of the dust/meteoroid environment at Mercury is responsible for producing the dawn-dusk asymmetry in Mercury's exosphere observed by the MESSENGER spacecraft. Our latest models, calibrated recently from ground-based and space-borne measurements, provide unprecedented statistics that enable us to study the longitudinal and latitudinal distribution of meteoroids impac...

  17. The highest-ranking rooster has priority to announce the break of dawn.

    Science.gov (United States)

    Shimmura, Tsuyoshi; Ohashi, Shosei; Yoshimura, Takashi

    2015-07-23

    The "cock-a-doodle-doo" crowing of roosters, which symbolizes the break of dawn in many cultures, is controlled by the circadian clock. When one rooster announces the break of dawn, others in the vicinity immediately follow. Chickens are highly social animals, and they develop a linear and fixed hierarchy in small groups. We found that when chickens were housed in small groups, the top-ranking rooster determined the timing of predawn crowing. Specifically, the top-ranking rooster always started to crow first, followed by its subordinates, in descending order of social rank. When the top-ranking rooster was physically removed from a group, the second-ranking rooster initiated crowing. The presence of a dominant rooster significantly reduced the number of predawn crows in subordinates. However, the number of crows induced by external stimuli was independent of social rank, confirming that subordinates have the ability to crow. Although the timing of subordinates' predawn crowing was strongly dependent on that of the top-ranking rooster, free-running periods of body temperature rhythms differed among individuals, and crowing rhythm did not entrain to a crowing sound stimulus. These results indicate that in a group situation, the top-ranking rooster has priority to announce the break of dawn, and that subordinate roosters are patient enough to wait for the top-ranking rooster's first crow every morning and thus compromise their circadian clock for social reasons.

  18. A radar study of emigratory flight and layer formation by insects at dawn over southern Britain.

    Science.gov (United States)

    Reynolds, D R; Smith, A D; Chapman, J W

    2008-02-01

    Radar observations have consistently shown that high-altitude migratory flight in insects generally occurs after mass take-off at dusk or after take-off over a more extended period during the day (in association with the growth of atmospheric convection). In this paper, we focus on a less-studied third category of emigration - the 'dawn take-off' - as recorded by insect-monitoring radars during the summer months in southern England. In particular, we describe occasions when dawn emigrants formed notable layer concentrations centred at altitudes ranging from ca. 240 m to 700 m above ground, very probably due to the insects responding to local temperature maxima in the atmosphere, such as the tops of inversions. After persisting for several hours through the early morning, the layers eventually merged into the insect activity building up later in the morning (from 06.00-08.00 h onwards) in conjunction with the development of daytime convection. The species forming the dawn layers have not been positively identified, but their masses lay predominantly in the 16-32 mg range, and they evidently formed a fauna quite distinct from that in flight during the previous night. The displacement and common orientation (mutual alignment) characteristics of the migrants are described.

  19. Light pollution alters the phenology of dawn and dusk singing in common European songbirds.

    Science.gov (United States)

    Da Silva, Arnaud; Valcu, Mihai; Kempenaers, Bart

    2015-05-05

    Artificial night lighting is expanding globally, but its ecological consequences remain little understood. Animals often use changes in day length as a cue to time seasonal behaviour. Artificial night lighting may influence the perception of day length, and may thus affect both circadian and circannual rhythms. Over a 3.5 month period, from winter to breeding, we recorded daily singing activity of six common songbird species in 12 woodland sites, half of which were affected by street lighting. We previously reported on analyses suggesting that artificial night lighting affects the daily timing of singing in five species. The main aim of this study was to investigate whether the presence of artificial night lighting is also associated with the seasonal occurrence of dawn and dusk singing. We found that in four species dawn and dusk singing developed earlier in the year at sites exposed to light pollution. We also examined the effects of weather conditions and found that rain and low temperatures negatively affected the occurrence of dawn and dusk singing. Our results support the hypothesis that artificial night lighting alters natural seasonal rhythms, independently of other effects of urbanization. The fitness consequences of the observed changes in seasonal timing of behaviour remain unknown.

  20. Evidence for ground-ice occurrence on asteroid Vesta using Dawn bistatic radar observations

    Science.gov (United States)

    Palmer, E. M.; Heggy, E.; Kofman, W. W.

    2017-12-01

    From 2011 to 2012, the Dawn spacecraft orbited asteroid Vesta, the first of its two targets in the asteroid belt, and conducted the first bistatic radar (BSR) experiment at a small-body, during which Dawn's high-gain communications antenna is used to transmit radar waves that scatter from Vesta's surface toward Earth at high incidence angles just before and after occultation of the spacecraft behind the asteroid. Among the 14 observed mid-latitude forward-scatter reflections, the radar cross section ranges from 84 ± 8 km2 (near Saturnalia Fossae) to 3,588 ± 200 km2 (northwest of Caparronia crater), implying substantial spatial variation in centimeter- to decimeter-scale surface roughness. The compared distributions of surface roughness and subsurface hydrogen concentration [H]—measured using data from Dawn's BSR experiment and Gamma Ray and Neutron Spectrometer (GRaND), respectively—reveal the occurrence of heightened subsurface [H] with smoother terrains that cover tens of square kilometers. Furthermore, unlike on the Moon, we observe no correlation between surface roughness and surface ages on Vesta—whether the latter is derived from lunar or asteroid-flux chronology [Williams et al., 2014]—suggesting that cratering processes alone are insufficient to explain Vesta's surface texture at centimeter-to-decimeter scales. Dawn's BSR observations support the hypothesis of transient melting, runoff and recrystallization of potential ground-ice deposits, which are postulated to flow along fractures after an impact, and provide a mechanism for the smoothing of otherwise rough, fragmented impact ejecta. Potential ground-ice presence within Vesta's subsurface was first proposed by Scully et al. [2014], who identified geomorphological evidence for transient water flow along several of Vesta's crater walls using Dawn Framing Camera images. While airless, differentiated bodies such as Vesta and the Moon are thought to have depleted their initial volatile content

  1. Preliminary Results from Initial Investigations of Ceres' Cratering Record from Dawn Imaging Data

    Science.gov (United States)

    Schmedemann, Nico; Michael, Gregory; Ivanov, Boris A.; Kneissl, Thomas; Neesemann, Adrian; Hiesinger, Harald; Jaumann, Ralf; Raymond, Carol A.; Russell, Christopher T.

    2015-04-01

    The highly successful Dawn mission [1] finished data collection at Vesta in 2012 and is now on its way to the dwarf planet Ceres. According to the current Ceres approach timeline of the Dawn mission, the ground resolution of the Dawn FC camera [2] will be about 10 times better than Hubble data [3] at the time of the presentation of this work. This may allow for identification of craters about 15 km in diameter. Initial mapping of sample areas may provide enough information of the cratering record in order to compare it with the theoretical Ceres crater production function we present at the 46th LPSC conference (March 16-20, 2015, The Woodlands, Texas) [4]. Our preliminary crater production function for Ceres is derived from the assumption of an icy crust just below a thin surface layer of dust [5], and a projectile population that is very similar to the one that impacted the Moon [6]. In order to scale the lunar cratering record to Ceres we use the Ivanov scaling laws [7], which allow for crater scaling based on parameters that can be derived from observations. The lunar-like approach gave reasonable good results for the crater production function on the asteroids Vesta, Ida, Lutetia and Gaspra [8]. Since the lunar surface is of basaltic composition, the correct scaling between the different materials is challenging. One crucial parameter is the transition diameter from simple to complex craters. Based on the simple to complex transition diameter on Iapetus, an icy satellite of Saturn, we expect this transition at about 12 km crater size at Ceres. This value may be slightly different due to the different temperatures at Ceres and Iapetus. If the simple to complex transition is observed at much larger diameters, the reason could be a substantial fraction of rock in the shallow subsurface of Ceres. In an ice-rich surface material high relaxation rates may also be expected that could change the shape of the crater production function. A thorough geological mapping

  2. PHASE ANGLE EFFECTS ON 3 μm ABSORPTION BAND ON CERES: IMPLICATIONS FOR DAWN MISSION

    Energy Technology Data Exchange (ETDEWEB)

    Takir, D.; Reddy, V.; Sanchez, J. A.; Corre, L. Le [Planetary Science Institute, 1700 E Fort Lowell Road, Suite 106, Tucson, AZ 85719 (United States); Hardersen, P. S. [Department of Space Studies, University of North Dakota, Grand Forks, ND 58202 (United States); Nathues, A., E-mail: dtakir@psi.edu [Max-Planck-Institute for Solar System Research, Justus-von-Liebig-Weg 3, D-37077 Göttingen (Germany)

    2015-05-01

    Phase angle-induced spectral effects are important to characterize since they affect spectral band parameters such as band depth and band center, and therefore skew mineralogical interpretations of planetary bodies via reflectance spectroscopy. Dwarf planet (1) Ceres is the next target of NASA’s Dawn mission, which is expected to arrive in 2015 March. The visible and near-infrared mapping spectrometer (VIR) on board Dawn has the spatial and spectral range to characterize the surface between 0.25–5.0 μm. Ceres has an absorption feature at 3.0 μm due to hydroxyl- and/or water-bearing minerals. We analyzed phase angle-induced spectral effects on the 3 μm absorption band on Ceres using spectra measured with the long-wavelength cross-dispersed (LXD: 1.9–4.2 μm) mode of the SpeX spectrograph/imager at the NASA Infrared Telescope Facility. Ceres LXD spectra were measured at different phase angles ranging from 0.°7 to 22°. We found that the band center slightly increases from 3.06 μm at lower phase angles (0.°7 and 6°) to 3.07 μm at higher phase angles (11° and 22°), the band depth decreases by ∼20% from lower phase angles to higher phase angles, and the band area decreases by ∼25% from lower phase angles to higher phase angles. Our results will have implications for constraining the abundance of OH on the surface of Ceres from VIR spectral data, which will be acquired by Dawn starting spring 2015.

  3. Dawn- Dusk Auroral Oval Oscillations Associated with High- Speed Solar Wind

    Science.gov (United States)

    Liou, Kan; Sibeck, David G.

    2018-01-01

    We report evidence of global-scale auroral oval oscillations in the millihertz range, using global auroral images acquired from the Ultraviolet Imager on board the decommissioned Polar satellite and concurrent solar wind measurements. On the basis of two events (15 January 1999 and 6 January 2000) studied, it is found that (1) quasi-periodic auroral oval oscillations (approximately 3 megahertz) can occur when solar wind speeds are high at northward or southward interplanetary magnetic field turning, (2) the oscillation amplitudes range from a few to more than 10 degrees in latitudes, (3) the oscillation frequency is the same for each event irrespective of local time and without any azimuthal phase shift (i.e., propagation), (4) the auroral oscillations occur in phase within both the dawn and dusk sectors but 180 degrees out of phase between the dawn and dusk sectors, and (5) no micropulsations on the ground match the auroral oscillation periods. While solar wind conditions favor the growth of the Kelvin-Helmholtz (K-H) instability on the magnetopause as often suggested, the observed wave characteristics are not consistent with predictions for K-H waves. The in-phase and out-of-phase features found in the dawn-dusk auroral oval oscillations suggest that wiggling motions of the magnetotail associated with fast solar winds might be the direct cause of the global-scale millihertz auroral oval oscillations. Plain Language Summary: We utilize global auroral image data to infer the motion of the magnetosphere and show, for the first time, the entire magnetospheric tail can move east-west in harmony like a windsock flapping in wind. The characteristic period of the flapping motion may be a major source of global long-period ULF (Ultra Low Frequency) waves, adding an extra source of the global mode ULF waves.

  4. PHASE ANGLE EFFECTS ON 3 μm ABSORPTION BAND ON CERES: IMPLICATIONS FOR DAWN MISSION

    International Nuclear Information System (INIS)

    Takir, D.; Reddy, V.; Sanchez, J. A.; Corre, L. Le; Hardersen, P. S.; Nathues, A.

    2015-01-01

    Phase angle-induced spectral effects are important to characterize since they affect spectral band parameters such as band depth and band center, and therefore skew mineralogical interpretations of planetary bodies via reflectance spectroscopy. Dwarf planet (1) Ceres is the next target of NASA’s Dawn mission, which is expected to arrive in 2015 March. The visible and near-infrared mapping spectrometer (VIR) on board Dawn has the spatial and spectral range to characterize the surface between 0.25–5.0 μm. Ceres has an absorption feature at 3.0 μm due to hydroxyl- and/or water-bearing minerals. We analyzed phase angle-induced spectral effects on the 3 μm absorption band on Ceres using spectra measured with the long-wavelength cross-dispersed (LXD: 1.9–4.2 μm) mode of the SpeX spectrograph/imager at the NASA Infrared Telescope Facility. Ceres LXD spectra were measured at different phase angles ranging from 0.°7 to 22°. We found that the band center slightly increases from 3.06 μm at lower phase angles (0.°7 and 6°) to 3.07 μm at higher phase angles (11° and 22°), the band depth decreases by ∼20% from lower phase angles to higher phase angles, and the band area decreases by ∼25% from lower phase angles to higher phase angles. Our results will have implications for constraining the abundance of OH on the surface of Ceres from VIR spectral data, which will be acquired by Dawn starting spring 2015

  5. In-Flight Operation of the Dawn Ion Propulsion System Through Survey Science Orbit at Ceres

    Science.gov (United States)

    Garner, Charles E.; Rayman, Marc D.

    2015-01-01

    The Dawn mission, part of NASA's Discovery Program, has as its goal the scientific exploration of the two most massive main-belt objects, Vesta and Ceres. The Dawn spacecraft was launched from the Cape Canaveral Air Force Station on September 27, 2007 on a Delta-II 7925H- 9.5 (Delta-II Heavy) rocket that placed the 1218-kg spacecraft onto an Earth-escape trajectory. On-board the spacecraft is an ion propulsion system (IPS) developed at the Jet Propulsion Laboratory which will provide a total delta V of 11 km/s for the heliocentric transfer to Vesta, orbit capture at Vesta, transfer between Vesta science orbits, departure and escape from Vesta, heliocentric transfer to Ceres, orbit capture at Ceres, and transfer between Ceres science orbits. Full-power thrusting from December 2007 through October 2008 was used to successfully target a Mars gravity assist flyby in February 2009 that provided an additional delta V of 2.6 km/s. Deterministic thrusting for the heliocentric transfer to Vesta resumed in June 2009 and concluded with orbit capture at Vesta on July 16, 2011. From July 2011 through September 2012 the IPS was used to transfer to all the different science orbits at Vesta and to escape from Vesta orbit. Cruise for a rendezvous with Ceres began in September 2012 and concluded with the start of the approach to Ceres phase on December 26, 2015, leading to orbit capture on March 6, 2015. Deterministic thrusting continued during approach to place the spacecraft in its first science orbit, called RC3, which was achieved on April 23, 2015. Following science operations at RC3 ion thrusting was resumed for twenty-five days leading to arrival to the next science orbit, called survey orbit, on June 3, 2015. The IPS will be used for all subsequent orbit transfers and trajectory correction maneuvers until completion of the primary mission in approximately June 2016. To date the IPS has been operated for over 46,774 hours, consumed approximately 393 kg of xenon, and provided

  6. Zero to Integration in Eight Months, the Dawn Ground Data System Engineering Challange

    Science.gov (United States)

    Dubon, Lydia P.

    2006-01-01

    The Dawn Project has presented the Ground Data System (GDS) with technical challenges driven by cost and schedule constraints commonly associated with National Aeronautics and Space Administration (NASA) Discovery Projects. The Dawn mission consists of a new and exciting Deep Space partnership among: the Jet Propulsion Laboratory (JPL), responsible for project management and flight operations; Orbital Sciences Corporation (OSC), spacecraft builder and responsible for flight system test and integration; and the University of California, at Los Angeles (UCLA), responsible for science planning and operations. As a cost-capped mission, one of Dawn s implementation strategies is to leverage from both flight and ground heritage. OSC's ground data system is used for flight system test and integration as part of the flight heritage strategy. Mission operations, however, are to be conducted with JPL s ground system. The system engineering challenge of dealing with two heterogeneous ground systems emerged immediately. During the first technical interchange meeting between the JPL s GDS Team and OSC's Flight Software Team, August 2003, the need to integrate the ground system with the flight software was brought to the table. This need was driven by the project s commitment to enable instrument engineering model integration in a spacecraft simulator environment, for both demonstration and risk mitigation purposes, by April 2004. This paper will describe the system engineering approach that was undertaken by JPL's GDS Team in order to meet the technical challenge within a non-negotiable eight-month schedule. Key to the success was adherence to an overall systems engineering process and fundamental systems engineering practices: decomposition of the project request into manageable requirements; definition of a structured yet flexible development process; integration of multiple ground disciplines and experts into a focused team effort; in-process risk management; and aggregation

  7. First detection of global dawn-dusk ionospheric current intensities using Ampere's integral law on Orsted orbits

    DEFF Research Database (Denmark)

    Stauning, P.; Primdahl, Fritz

    2000-01-01

    -to-dusk ionospheric current is found to be proportional to the gee-effective solar wind electric field and is around 1 million ampere for a typical solar wind electric field of 2 mV/m. Dividing the Ampere integral into semi-orbit parts has enabled us to show that the hemispherical total current intensities depend......The magnetic measurements by the Orsted satellite in noon-midnight orbits have enabled the derivation of the global dawn-dusk oriented ionospheric currents from an Ampere's law closed loop line integral of the geomagnetic vector field along the satellite track. The globally integrated dawn...... on the respective polar cap conductivities, which relate to the daily and seasonally varying solar illumination. The more illuminated hemisphere conveys up to three times more current from dawn to dusk than does the less illuminated....

  8. A simple model describing the nonlinear dynamics of the dusk/dawn asymmetry in the high-latitude thermospheric flow

    Science.gov (United States)

    Gundlach, J. P.; Larsen, M. F.; Mikkelsen, I. S.

    1988-01-01

    A simple nonlinear, axisymmetric, shallow-water numerical model has been used to study the asymmetry in the neutral flow between the dusk and dawn sides of the auroral oval. The results indicate that the Coriolis force and the curvature terms are nearly in balance on the evening side and require only a small pressure gradient to effect adjustment. The result is smaller neutral velocities near dawn and larger velocities near dusk than would be the case for a linearized treatment. A consequence is that more gravity wave energy is produced on the morning side than on the evening side.

  9. The Metaphor of the Dawn of the Space Age in the Contemporary Social Sciences and Humanities

    Directory of Open Access Journals (Sweden)

    Natalija Majsova

    2015-05-01

    Full Text Available The dawn of the space age in the early 1960s first provoked unabashed awe. Then, it inspired numerous attempts to explain (away the evental status of the first examples of manned spaceflight accounts that mainly interpreted Yuri Garagin’s flight (1961 and the Moon landing (1969 as logical consequences of technological progress, a certain constellation of political circumstances, and a pinch of ‘imagination’ to begin with. Curiously enough, conclusions of the vast majority of such accounts cannot but resort to ‘terrestrial’ metaphors in order to explain why these endeavours were worth undertaking in the first place. In the 21st century, reflections on outer space seem to have settled within three conceptually designed research fields within the social sciences and humanities: astrosociology, noocosmology and cultural studies of outer space. The text analyses conceptualisations and accounts of the dawn of the space age exhibited by the core texts and methodologies of these research fields to demonstrate how they actually hinge on variant epistemologies, and interpret the role of metaphor in world-formation in radically differing ways.

  10. Intruders: New Neighbors in "Dawn of the Planet of the Apes" and "The Hundred-Foot Journey"

    Science.gov (United States)

    Beck, Bernard

    2015-01-01

    Conflicts over territory are about the power to establish dominant cultures in territories and are often accompanied by cultural claims to legitimacy by each side. The cultural claims, or ideologies, are often expressed in terms of "homeland" dwellers versus "intruders." Two recent movies, "Dawn of the Planet of the…

  11. 77 FR 8943 - Culturally Significant Objects Imported for Exhibition Determinations: “The Dawn of Egyptian Art”

    Science.gov (United States)

    2012-02-15

    ... Determinations: ``The Dawn of Egyptian Art'' SUMMARY: Notice is hereby given of the following determinations... Egyptian Art,'' imported from abroad for temporary exhibition within the United States, are of cultural... of Art, New York, NY from on or about April 2, 2012, until on or about August 5, 2012, and at...

  12. Dawn-dusk asymmetry in particles of solar wind origin within the magnetosphere

    Directory of Open Access Journals (Sweden)

    T. J. Stubbs

    Full Text Available Solar wind/magnetosheath plasma in the magnetosphere can be identified using a component that has a higher charge state, lower density and, at least soon after their entry into the magnetosphere, lower energy than plasma from a terrestrial source. We survey here observations taken over 3 years of He2+ ions made by the Magnetospheric Ion Composition Sensor (MICS of the Charge and Mass Magnetospheric Ion Composition Experiment (CAMMICE instrument aboard POLAR. The occurrence probability of these solar wind ions is then plotted as a function of Magnetic Local Time (MLT and invariant latitude (7 for various energy ranges. For all energies observed by MICS (1.8–21.4 keV and all solar wind conditions, the occurrence probabilities peaked around the cusp region and along the dawn flank. The solar wind conditions were filtered to see if this dawnward asymmetry is controlled by the Svalgaard-Mansurov effect (and so depends on the BY component of the interplanetary magnetic field, IMF or by Fermi acceleration of He2+ at the bow shock (and so depends on the IMF ratio BX /BY . It is shown that the asymmetry remained persistently on the dawn flank, suggesting it was not due to effects associated with direct entry into the magnetosphere. This asymmetry, with enhanced fluxes on the dawn flank, persisted for lower energy ions (below a "cross-over" energy of about 23 keV but reversed sense to give higher fluxes on the dusk flank at higher energies. This can be explained by the competing effects of gradient/curvature drifts and the convection electric field on ions that are convecting sunward on re-closed field lines. The lower-energy He2+ ions E × B drift dawnwards as they move earthward, whereas the higher energy ions curvature/ gradient drift towards dusk. The convection electric field in the tail is weaker for

  13. Dawn-dusk asymmetry in particles of solar wind origin within the magnetosphere

    Directory of Open Access Journals (Sweden)

    T. J. Stubbs

    2001-01-01

    Full Text Available Solar wind/magnetosheath plasma in the magnetosphere can be identified using a component that has a higher charge state, lower density and, at least soon after their entry into the magnetosphere, lower energy than plasma from a terrestrial source. We survey here observations taken over 3 years of He2+ ions made by the Magnetospheric Ion Composition Sensor (MICS of the Charge and Mass Magnetospheric Ion Composition Experiment (CAMMICE instrument aboard POLAR. The occurrence probability of these solar wind ions is then plotted as a function of Magnetic Local Time (MLT and invariant latitude (7 for various energy ranges. For all energies observed by MICS (1.8–21.4 keV and all solar wind conditions, the occurrence probabilities peaked around the cusp region and along the dawn flank. The solar wind conditions were filtered to see if this dawnward asymmetry is controlled by the Svalgaard-Mansurov effect (and so depends on the BY component of the interplanetary magnetic field, IMF or by Fermi acceleration of He2+ at the bow shock (and so depends on the IMF ratio BX /BY . It is shown that the asymmetry remained persistently on the dawn flank, suggesting it was not due to effects associated with direct entry into the magnetosphere. This asymmetry, with enhanced fluxes on the dawn flank, persisted for lower energy ions (below a "cross-over" energy of about 23 keV but reversed sense to give higher fluxes on the dusk flank at higher energies. This can be explained by the competing effects of gradient/curvature drifts and the convection electric field on ions that are convecting sunward on re-closed field lines. The lower-energy He2+ ions E × B drift dawnwards as they move earthward, whereas the higher energy ions curvature/ gradient drift towards dusk. The convection electric field in the tail is weaker for northward IMF. Ions then need less energy to drift to the dusk flank, so that the cross-over energy, at which the asymmetry changes sense, is reduced

  14. Exploring Vesta's Surface Roughness and Dielectric Properties Using VIR Spectrometer and Bistatic Radar Observations by the Dawn Mission

    Science.gov (United States)

    Palmer, E. M.; Heggy, E.; Capria, M. T.; Tosi, F.; Kofman, W. W.; Russell, C. T.

    2014-12-01

    Multiple lines of evidence from NASA's Dawn mission suggest transient volatile presence at the surface of asteroid Vesta. Radar remote sensing is a useful technique for the investigation of volatile content at the surface and shallow subsurface, but requires the use of accurate dielectric and topographic models in order to deconvolve the effect of surface roughness from the total observed radar backscatter. Toward this end, we construct a dielectric model for the dry, volatile-poor case of Vesta's surface to represent average surface conditions, and to assess the expected average range of dielectric properties due to known variations in mineralogy, temperature, and density as inferred from Dawn VIR data. We employ dielectric studies of lunar samples to serve as a suitable analog to the Vestan regolith, and in the case of 10-wavelength penetration depth of X-band frequency radar observations, our model yields ɛ' from 2.5 to 2.6 from the night to dayside of Vesta, and tan δ from 0.011 to 0.014. Our estimation of ɛ' corresponds to specular surface reflectivity of ~0.05. In addition to modeling, we have also conducted an opportunistic bistatic radar (BSR) experiment at Vesta using the communications antennas aboard Dawn and on Earth. In this configuration, Dawn transmits a continuous radar signal toward the Earth while orbiting Vesta. As the Dawn spacecraft passes behind Vesta (entering an occultation), the line of sight between Dawn and Earth intersects Vesta's surface, resulting in a reflection of radar waves from the surface and shallow subsurface, which are then received on Earth for analysis. The geometry of the Dawn BSR experiment results in high incidence angles on Vesta's surface, and leads to a differential Doppler shift of only a few 10s of Hz between the direct signal and the surface echo. As a consequence, this introduces ambiguity in the measurement of bandwidth and peak power of each surface echo. We report our interpretations of each surface echo in

  15. Isozyme markers associated with O3 tolerance indicate shift in genetic structure of ponderosa and Jeffrey pine in Sequoia National Park, California

    International Nuclear Information System (INIS)

    Staszak, J.; Grulke, N.E.; Marrett, M.J.; Prus-Glowacki, W.

    2007-01-01

    Effects of canopy ozone (O 3 ) exposure and signatures of genetic structure using isozyme markers associated with O 3 tolerance were analyzed in ∼20-, ∼80-, and >200-yr-old ponderosa (Pinus ponderosa Dougl. ex Laws.) and Jeffrey pine (Pinus jeffreyi Grev. and Balf.) in Sequoia National Park, California. For both species, the number of alleles and genotypes per loci was higher in parental trees relative to saplings. In ponderosa pine, the heterozygosity value increased, and the fixation index indicated reduction of homozygosity with increasing tree age class. The opposite tendencies were observed for Jeffrey pine. Utilizing canopy attributes known to be responsive to O 3 exposure, ponderosa pine was more symptomatic than Jeffrey pine, and saplings were more symptomatic than old growth trees. We suggest that these trends are related to differing sensitivity of the two species to O 3 exposure, and to higher O 3 exposures and drought stress that younger trees may have experienced during germination and establishment. - Genetic variation in isozyme markers associated with ozone tolerance differed between parental trees and their progeny in two closely related species of yellow pine

  16. Isozyme markers associated with O{sub 3} tolerance indicate shift in genetic structure of ponderosa and Jeffrey pine in Sequoia National Park, California

    Energy Technology Data Exchange (ETDEWEB)

    Staszak, J. [A Mickiewicz University, Genetics Department, ul. Umultowska 89, 61-614 Poznan (Poland); Grulke, N.E. [USDA Forest Service, 4955 Canyon Crest Drive, Riverside, CA 92507 (United States)], E-mail: ngrulke@fs.fed.us; Marrett, M.J. [5184 Tower Road, Riverside, CA 92506 (United States); Prus-Glowacki, W. [A Mickiewicz University, Genetics Department, ul. Umultowska 89, 61-614 Poznan (Poland)

    2007-10-15

    Effects of canopy ozone (O{sub 3}) exposure and signatures of genetic structure using isozyme markers associated with O{sub 3} tolerance were analyzed in {approx}20-, {approx}80-, and >200-yr-old ponderosa (Pinus ponderosa Dougl. ex Laws.) and Jeffrey pine (Pinus jeffreyi Grev. and Balf.) in Sequoia National Park, California. For both species, the number of alleles and genotypes per loci was higher in parental trees relative to saplings. In ponderosa pine, the heterozygosity value increased, and the fixation index indicated reduction of homozygosity with increasing tree age class. The opposite tendencies were observed for Jeffrey pine. Utilizing canopy attributes known to be responsive to O{sub 3} exposure, ponderosa pine was more symptomatic than Jeffrey pine, and saplings were more symptomatic than old growth trees. We suggest that these trends are related to differing sensitivity of the two species to O{sub 3} exposure, and to higher O{sub 3} exposures and drought stress that younger trees may have experienced during germination and establishment. - Genetic variation in isozyme markers associated with ozone tolerance differed between parental trees and their progeny in two closely related species of yellow pine.

  17. Magnetotail Fast Flow Occurrence Rate and Dawn-Dusk Asymmetry at XGSM ˜ -60 RE

    Science.gov (United States)

    Kiehas, S. A.; Runov, A.; Angelopolos, V.; Hietala, H.; Korovinksiy, D.

    2018-03-01

    As a direct result of magnetic reconnection, plasma sheet fast flows act as primary transporter of mass, flux, and energy in the Earth's magnetotail. During the last decades, these flows were mainly studied within XGSM>-60RE, as observations near or beyond lunar orbit were limited. By using 5 years (2011-2015) of ARTEMIS (Acceleration, Reconnection, Turbulence, and Electrodynamics of the Moons Interaction with the Sun) data, we statistically investigate earthward and tailward flows at around 60 RE downtail. A significant fraction of fast flows is directed earthward, comprising 43% (vx>400 km/s) to 56% (vx>100 km/s) of all observed flows. This suggests that near-Earth and midtail reconnection are equally probable of occurring on either side of the ARTEMIS downtail distance. For fast convective flows (v⊥x>400 km/s), this fraction of earthward flows is reduced to about 29%, which is in line with reconnection as source of these flows and a downtail decreasing Alfvén velocity. More than 60% of tailward convective flows occur in the dusk sector (as opposed to the dawn sector), while earthward convective flows are nearly symmetrically distributed between the two sectors for low AL (>-400 nT) and asymmetrically distributed toward the dusk sector for high AL (infer that near-Earth reconnection is preferentially located at dusk, whereas midtail reconnection (X >- 60RE) is likely symmetric across the tail during weak substorms and asymmetric toward the dusk sector for strong substorms, as the dawn-dusk asymmetric nature of reconnection onset in the near-Earth region progresses downtail.

  18. Vesta in the Light of Dawn: A Nuanced Confirmation of Expectations

    Science.gov (United States)

    Russell, C. T.

    The ion-engine propelled Discovery-class mission Dawn was launched on its near decade-long odyssey to explore the two most massive asteroids in the main belt, 4 Vesta and 1 Ceres, in September 2007. Based on its mass and volume, its basaltic crust, and the chemistry of the associated HED meteorites, Vesta was expected to consist of a completely differentiated dry silicate body with an iron core in contrast to Ceres, whose much smaller density implied a much wetter body, perhaps with liquid water beneath the crust. Upon entering vestan orbit in July 2001, Dawn discovered that indeed the surface resembled the HED meteorites and the gravity data were consistent with a differentiated body with a 110-km radius core. The large southern basin seen from HST was studied and found to consist of two ancient impact basins with associated planetary rings of graben-like fossae. The water that had been hinted at in reflectance spectra observed by terrestrial telescopes was seen more broadly over the surface as was hydrogen detected with the GRaND gamma ray and neutron spectrometer. Moreover, some craters showed evidence for both running and standing water: gullies in the crater walls and pits in the crater floors. Furthermore, the expected exposure of olivine in the southern basin was not found. The presence of water, even if only transient, on the surface of Vesta, and the apparent lack of an olivine mantle were unexpected results. While these observations do not negate the earlier work based on the HED meteorites, they do add important new insight into the conditions under which Vesta formed and evolved.

  19. Use of Cumulative Degradation Factor Prediction and Life Test Result of the Thruster Gimbal Assembly Actuator for the Dawn Flight Project

    Science.gov (United States)

    Lo, C. John; Brophy, John R.; Etters, M. Andy; Ramesham, Rajeshuni; Jones, William R., Jr.; Jansen, Mark J.

    2009-01-01

    The Dawn Ion Propulsion System is the ninth project in NASA s Discovery Program. The Dawn spacecraft is being developed to enable the scientific investigation of the two heaviest main-belt asteroids, Vesta and Ceres. Dawn is the first mission to orbit two extraterrestrial bodies, and the first to orbit a main-belt asteroid. The mission is enabled by the onboard Ion Propulsion System (IPS) to provide the post-launch delta-V. The three Ion Engines of the IPS are mounted on Thruster Gimbal Assembly (TGA), with only one engine operating at a time for this 10-year mission. The three TGAs weigh 14.6 kg.

  20. [Analysis of the effectiveness of the spa and health resort-based treatment of the patients presenting with broncho-pulmonary pathology at the southern coast of the Crimea depending on the period of flowering of Mediterranean Cypress (Cupressus sempervirens)].

    Science.gov (United States)

    Savchenko, V M; Belyaeva, S N; Govorun, M I; Pirogova, M E

    The objective of the present study was to evaluate the influence of pollen of Mediterranean Cypress (Cupressus sempervirens) on the effectiveness of the spa and health resort-based treatment (SHRT) of the patients with broncho-pulmonary pathology at the southern coast of the Crimea (SCC). This article presents the results of the analysis of the data on 122 patients presenting with broncho-pulmonary pathology who received SHRT under the conditions of the Southern Coast of the Crimea. Fifty one (41.8%) of these patients suffered from chronic obstructive pulmonary disease and 71 (58.2%) ones had bronchial asthma. The whole group was comprised of 44 men (36.1%) and 78 women (63.9%). The average (median) age of the patients was 55.8 years. All the participants of the study underwent the comprehensive examination including the general medical and physical examination, complete blood count, the study of sputum cytology and immunological properties of blood including the standard characteristics, IgE and lysozyme levels), evaluation of the respiratory and locomotor (physical) functions with the use of the 6-minute walking test. The aeropollenological study of the aerial environment of the southern coast of the Crimea in the region of Yalta showed that the «bloom» of the Mediterranean Cypress occurs during the period from February till April inclusive. The highest concentrations of cypress pollen are observed in March and early April. The overall effectiveness of SHRT for the patients with broncho-pulmonary pathology arriving for the treatment at the southern coast of the Crimea from other Crimean localities does not depend on the period of «flowering» (the presence of pollen in the air) of the Mediterranean Cypress. In these patients, the termination of the spa and health resort-based treatment during the «flowering» of the Mediterranean Cypress resulted in nothing more than a strained adaptive response manifested as the altered blood leukocyte count. Such reaction

  1. In-Flight Operation of the Dawn Ion Propulsion System: Status at One Year from the Vesta Rendezvous

    Science.gov (United States)

    Garner, Charles E.; Rayman, Marc D.

    2010-01-01

    The Dawn mission, part of NASA's Discovery Program, has as its goal the scientific exploration of the two most massive main-belt asteroids, Vesta and Ceres. The Dawn spacecraft was launched from Cape Canaveral Air Force Station on September 27, 2007 on a Delta-II 7925H-9.5 (Delta-II Heavy) rocket that placed the 1218 kg spacecraft into an Earth-escape trajectory. On-board the spacecraft is an ion propulsion system (IPS) developed at the Jet Propulsion Laboratory which will provide most of the delta V needed for heliocentric transfer to Vesta, orbit capture at Vesta, transfer among Vesta science orbits, departure and escape from Vesta, heliocentric transfer to Ceres, orbit capture at Ceres, and transfer among Ceres science orbits. The Dawn ion thruster [I thought we only called it a thruster. Both terms are used in the paper, but I think a replacement of every occurrence of "engine" with "thruster" would be clearer.] design is based on the design validated on NASA's Deep Space 1 (DS1) mission. However, because of the very substantial (11 km/s) delta V requirements for this mission Dawn requires two engines to complete its mission objectives. The power processor units (PPU), digital control and interface units (DCIU) slice boards and the xenon control assembly (XCA) are derivatives of the components used on DS1. The DCIUs and thrust gimbal assemblies (TGA) were developed at the Jet Propulsion Laboratory. The spacecraft was provided by Orbital Sciences Corporation, Sterling, Virginia, and the mission is managed by and operated from the Jet Propulsion Laboratory. Dawn partnered with Germany, Italy and Los Alamos National Laboratory for the science instruments. The mission is led by the principal investigator, Dr. Christopher Russell, from the University of California, Los Angeles. The first 80 days after launch were dedicated to the initial checkout of the spacecraft followed by cruise to Mars. Cruise thrusting leading to a Mars gravity assist began on December 17

  2. Iron oxide minerals in dust of the Red Dawn event in eastern Australia, September 2009

    Science.gov (United States)

    Reynolds, Richard L.; Cattle, Stephen R.; Moskowitz, Bruce M.; Goldstein, Harland L.; Yauk, Kimberly; Flagg, Cody B.; Berquó, Thelma S.; Kokaly, Raymond F.; Morman, Suzette A.; Breit, George N.

    2014-01-01

    Iron oxide minerals typically compose only a few weight percent of bulk atmospheric dust but are important for potential roles in forcing climate, affecting cloud properties, influencing rates of snow and ice melt, and fertilizing marine phytoplankton. Dust samples collected from locations across eastern Australia (Lake Cowal, Orange, Hornsby, and Sydney) following the spectacular “Red Dawn” dust storm on 23 September 2009 enabled study of the dust iron oxide assemblage using a combination of magnetic measurements, Mössbauer spectroscopy, reflectance spectroscopy, and scanning electron microscopy. Red Dawn was the worst dust storm to have hit the city of Sydney in more than 60 years, and it also deposited dust into the Tasman Sea and onto snow cover in New Zealand. Magnetization measurements from 20 to 400 K reveal that hematite, goethite, and trace amounts of magnetite are present in all samples. Magnetite concentrations (as much as 0.29 wt%) were much higher in eastern, urban sites than in western, agricultural sites in central New South Wales (0.01 wt%), strongly suggesting addition of magnetite from local urban sources. Variable temperature Mössbauer spectroscopy (300 and 4.2 K) indicates that goethite and hematite compose approximately 25–45% of the Fe-bearing phases in samples from the inland sites of Orange and Lake Cowal. Hematite was observed at both temperatures but goethite only at 4.2 K, thereby revealing the presence of nanogoethite (less than about 20 nm). Similarly, hematite particulate matter is very small (some of it d < 100 nm) on the basis of magnetic results and Mössbauer spectra. The degree to which ferric oxide in these samples might absorb solar radiation is estimated by comparing reflectance values with a magnetic parameter (hard isothermal remanent magnetization, HIRM) for ferric oxide abundance. Average visible reflectance and HIRM are correlated as a group (r2 = 0.24), indicating that Red Dawn ferric oxides have

  3. A preliminary global geologic map of Vesta based on Dawn Survey orbit data

    Science.gov (United States)

    Yingst, R.; Williams, D. A.; Garry, W. B.; Mest, S. C.; Petro, N. E.; Buczkowski, D.; Schenk, P.; Jaumann, R.; Pieters, C. M.; Roatsch, T.; Preusker, F.; Nathues, A.; LeCorre, L.; Reddy, V.; Russell, C. T.; Raymond, C. A.; DeSanctis, C.; Ammannito, E.; Filacchione, G.

    2011-12-01

    NASA's Dawn spacecraft arrived at the asteroid 4Vesta on July 15, 2011, and is now collecting imaging, spectroscopic, and elemental abundance data during its one-year orbital mission. As part of the geological analysis of the surface, we have utilized images and data from the Survey orbital sequence to produce a global map of Vesta's surface. Unit boundaries and feature characteristics were determined primarily from morphologic analysis of image data; projected Framing Camera (FC) images were used as the base map. Spectral information from FC and VIR are used to refine unit contacts and to separate compositional distinctions from differences arising from illumination or other factors. Those units that could be discerned both in morphology and in the color data were interpreted as geologically distinct units. Vesta's surface is highly-cratered; differences in color and albedo are possible indicators of varying thicknesses and areal extents of crater ejecta. The most prominent candidate impact feature dominates the south pole. This feature consists of a depression roughly circular in shape, with a central hill that is characterized by smoother texture and lower albedo distinctive from the lower-lying surrounding terrain. A complex network of deep troughs and ridges cuts through the floor of the feature. Many of these troughs trend north-south, while others appear circumferential to the hill and are truncated by or terminate at orthogonal ridges/grooves. Detailed mapping of these features will provide information on their orientations, possible origin(s), and their relationship, if any, to the central hill. The equator of Vesta is also girdled by a wide set of flat-floored troughs. Their orientation implies that their formation is related to the south polar structure. Several regions on Vesta have a concentration of craters displaying low-albedo interiors or exteriors. These craters may have an exogenic origin, or may be the result of excavation of a thin sub

  4. Assessing the response of Emerald Lake, an alpine watershed in Sequoia National Park, California, to acidification during snowmelt by using a simple hydrochemical model

    International Nuclear Information System (INIS)

    Hooper, R.P.; West, C.T.; Peters, N.E.

    1990-01-01

    A sparsely parameterized hydrochemical model has been developed by using data from Emerald Lake watershed, which is a 120-ha alpine catchment in Sequoia National Park, California. Greater than 90% of the precipitation to this watershed is snow; hence, snowmelt is the dominant hydrologic event. A model which uses a single alkalinity-generating mechanism, primary mineral weathering, was able to capture the pattern of solute concentrations in surface waters during snowmelt. An empirical representation of the weathering reaction, which is based on rock weathering stoichiometry and which uses discharge as a measure of residence time, was included in the model. Results of the model indicate that current deposition levels would have to be increased between three-fold and eight-fold to exhaust the alkalinity of the lake during snowmelt if their is a mild acidic pulse in the stream at the beginning of snowmelt as was observed during the study period. The acidic pulse in the inflow stream at the onset of snowmelt was less pronounced than acidic pulses observed in the meltwater draining the snowpack at a point using snow lysimeters or in the laboratory. Sulfate concentrations in the stream water were the most constant; chloride and nitrate concentrations increased slightly at the beginning of snowmelt. Additional field work is required to resolve whether an acidic meltwater pulse occurs over a large area as well as at a point or whether, due to physical and chemical processes within the snowpack, the acidic meltwater pulse is attenuated at the catchment scale. The modest data requirements of the model permit its applications to other alpine watersheds that are much less intensively studied than Emerald Lake watershed

  5. The influence of prefire tree growth and crown condition on postfire mortality of sugar pine following prescribed fire in Sequoia National Park

    Science.gov (United States)

    Nesmith, Jonathan C. B.; Das, Adrian J.; O'Hara, Kevin L.; van Mantgem, Phillip J.

    2015-01-01

    Tree mortality is a vital component of forest management in the context of prescribed fires; however, few studies have examined the effect of prefire tree health on postfire mortality. This is especially relevant for sugar pine (Pinus lambertiana Douglas), a species experiencing population declines due to a suite of anthropogenic factors. Using data from an old-growth mixed-conifer forest in Sequoia National Park, we evaluated the effects of fire, tree size, prefire radial growth, and crown condition on postfire mortality. Models based only on tree size and measures of fire damage were compared with models that included tree size, fire damage, and prefire tree health (e.g., measures of prefire tree radial growth or crown condition). Immediately following the fire, the inclusion of different metrics of prefire tree health produced variable improvements over the models that included only tree size and measures of fire damage, as models that included measures of crown condition performed better than fire-only models, but models that included measures of prefire radial growth did not perform better. However, 5 years following the fire, sugar pine mortality was best predicted by models that included measures of both fire damage and prefire tree health, specifically, diameter at breast height (DBH, 1.37 m), crown scorch, 30-year mean growth, and the number of sharp declines in growth over a 30-year period. This suggests that factors that influence prefire tree health (e.g., drought, competition, pathogens, etc.) may partially determine postfire mortality, especially when accounting for delayed mortality following fire.

  6. Utilizing Remote Sensing Information to Improve Post-fire Rainfall-runoff Predictions after the 2010 Bull Fire in the Sequoia National Forest, CA

    Science.gov (United States)

    Kinoshita, A. M.; Hale, B.; Hogue, T. S.

    2012-12-01

    Post-fire management decisions are guided by rainfall-runoff predictions, which ultimately influence downstream treatment and mitigation costs. The current study investigates evolving rainfall-runoff partitioning at the watershed scale over a two-year period after the 2010 Bull Fire which occurred in the southern Sequoia National Forest in California. Stage height was measured at five-minute intervals using pressure transducers, tipping buckets were installed for rainfall duration and intensity, and channel cross-sections were measured approximately every two months to detail sediment deposition or scour. We also utilize remotely sensed vegetation data to evaluate vegetation recovery in the studied watersheds and the corresponding relationship to storm runoff. Normalized Difference Vegetation Index (NDVI), a measure of vegetation greenness, is evaluated for its potential use as a key recovery indicator. Preliminary results focus on alterations in annual and seasonal precipitation and discharge relationships using in-situ data and Landsat NDVI values for the period of study. NDVI values are consistent with a comprehensive burn, with an acute decrease observed in the initial post-fire period. However, vegetation recovery is highly variable in the studied systems and influenced by shorter-term biomass pulses (grasses) while longer-term recovery of other species (chaparral and pine) is ongoing. Runoff ratios are elevated during early storms and show some recovery in the later part of the study period. The ability to accurately and confidently predict post-fire runoff and longer-term recovery is critical for monitoring values-at-risk, reducing mitigation costs, and improving warnings to downstream public communities.

  7. Evaluating potential overlap between pack stock and Sierra Nevada bighorn sheep (Ovis canadensis sierrae) in Sequoia and Kings Canyon National Parks, California

    Science.gov (United States)

    Klinger, Robert C.; Few, Alexandra P.; Knox, Kathleen A.; Hatfield, Brian E.; Clark, Jonathan; German, David W.; Stephenson, Thomas R.

    2015-01-01

    Pack stock (horses, mules, burros, llamas, and goats) are frequently assumed to have negative effects on public lands, but there is a general lack of data to be able to quantify the degree to which this is actually the case. Sequoia and Kings Canyon National Parks have received complaints that pack stock may affect Sierra Nevada bighorn sheep (Ovis canadensis sierrae; SNBS), a federally endangered subspecies that occurs in largely disjunct herds in the Sierra Nevada Range of California. The potential effects are thought to be displacement of SNBS from meadows on their summer range (altered habitat use) or, more indirectly, through changes in SNBS habitat or forage quality. Our goals were to conduct an association analysis to quantify the degree of potential spatial overlap in meadow use between SNBS and pack stock and to compare differences in vegetation community composition, structure, and diversity among meadows with different levels of use by bighorn sheep and pack stock. For the association analysis, we used two approaches: (1) we quantified the proportion of meadows that were within the herd home ranges of bighorn sheep and were potentially open to pack stock, and, (2) we used Monte Carlo simulations and use-availability analyses to compare the proportion of meadows used by bighorn sheep relative to the proportional occurrence or area of meadows available to bighorn sheep that were used by pack stock. To evaluate potential effects of pack stock on meadow plant communities and SNBS forage, we sampled vegetation in 2011 and 2012 at 100 plots to generate data that allowed us to compare:

  8. Executive summary - Assessing the response of Emerald Lake, an alpine watershed in Sequoia National Park, California, to acidification during snowmelt using a simple hydrochemical model

    International Nuclear Information System (INIS)

    Hooper, R.P.; West, C.T.; Peters, N.E.

    1990-01-01

    A simple process-oriented model, called the Alpine Lake Forecaster (ALF), was constructed using data collected from the Integrated Watershed Study of Emerald Lake, Sequoia National Park, California. ALF is able to capture the basic solute patterns during snowmelt in this alpine catchment where groundwater is a minor contributor to streamflow. It includes an empirical representation of primary mineral weathering as the only alkalinity generating mechanism. During a heavy snow year, such as the one used for calibrating the model, the model accurately simulated the surface water chemical change in response to the initial ionic pulse from the snowpack and to the dilution that occurs at peak snowmelt. Because the model does not consider cation exchange, it over-predicts the acidification during the initial period of snowmelt, and therefore is a conservative predictor. However, the minimum alkalinity observed in the main inflows to Emerald Lake and in the lake outflow is accurately simulated by the model. The representation of the lake as simply a missing volume with no additional chemical reactions is supported by the observation. The model predicts a change of 2 to 5 microequiv/L in the minimum alkalinity of the lake outflow during snowmelt if the deposition would have to increase between two and 18 times the current load-alkalinity of the lake; the precise increase depends on hydrologic conditions and on the pattern of solute release from the snowpack. An acidic rainstorm that exhausted the alkalinity of the lake was observed during summer 1984 after the lake had stratified, and is the likely cause of the acidification of Emerald Lake

  9. Seasonal and diel environmental conditions predict western pond turtle (Emys marmorata) behavior at a perennial and an ephemeral stream in Sequoia National Park, California

    Science.gov (United States)

    Ruso, Gabrielle; Meyer, Erik; Das, Adrian J.

    2017-01-01

    Managers making decisions may benefit from a well-informed understanding of a species' population size and trends. Given the cryptic nature and habitat characteristics of the western pond turtle (Emys marmorata), however, imperfect detection may be high and population estimates are frequently varied and unreliable. As a case study to investigate this issue, we used temperature dataloggers to examine turtle behavior at 2 long-term monitoring sites with different hydrological characteristics in Sequoia National Park, California, to determine if common stream-survey techniques are consistent with site-specific turtle behavior. Sycamore Creek is an intermittent stream that dries up every summer while the North Fork Kaweah River flows year-round. We found that while turtles spent most of the recorded time in the water (55% in Sycamore Creek and 82% in the North Fork Kaweah River), the timing of traditional surveys only coincided with the turtles' aquatic activity in the North Fork Kaweah River. At Sycamore Creek, turtles were most likely to be in the water at night. In contrast, failure to detect turtles in North Fork Kaweah River is likely owing to the larger size and complexity of the underwater habitat. In both streams, turtles were also more likely to be in the water in the weeks leading up to important changes in hydroperiods. Our findings illustrate the effects that differences in water permanence can have on turtle behavior within the same watershed and how phenotypic plasticity may then affect detection during surveys. Our study highlights the importance of tailoring survey practices to the site-specific behavioral traits of the target species.

  10. The location of the open-closed magnetic field line boundary in the dawn sector auroral ionosphere

    Directory of Open Access Journals (Sweden)

    J. A. Wild

    2004-11-01

    Full Text Available As a measure of the degree of coupling between the solar wind-magnetosphere-ionosphere systems, the rate at which the size of the polar cap (the region corresponding to ionospheric termini of open magnetic flux tubes varies is of prime importance. However, a reliable technique by which the extent of the polar cap might be routinely monitored has yet to be developed. Current techniques provide particularly ambiguous indications of the polar cap boundary in the dawn sector. We present a case study of space- and ground-based observations of the dawn-sector auroral zone and attempt to determine the location of the polar cap boundary using multi-wavelength observations of the ultraviolet aurora (made by the IMAGE FUV imager, precipitating particle measurements (recorded by the FAST, DMSP, and Cluster 1 and 3 satellites, and SuperDARN HF radar observations of the ionospheric Doppler spectral width boundary. We conclude that in the dawn sector, during the interval presented, neither the poleward edge of the wideband auroral UV emission (140-180nm nor the Doppler spectral width boundary were trustworthy indicators of the polar cap boundary location, while narrow band UV emissions in the range 130-140nm appear to be much more reliable.

  11. Colors and Photometry of Bright Materials on Vesta as Seen by the Dawn Framing Camera

    Science.gov (United States)

    Schroeder, S. E.; Li, J.-Y.; Mittlefehldt, D. W.; Pieters, C. M.; De Sanctis, M. C.; Hiesinger, H.; Blewett, D. T.; Russell, C. T.; Raymond, C. A.; Keller, H. U.; hide

    2012-01-01

    The Dawn spacecraft has been in orbit around the asteroid Vesta since July, 2011. The on-board Framing Camera has acquired thousands of high-resolution images of the regolith-covered surface through one clear and seven narrow-band filters in the visible and near-IR wavelength range. It has observed bright and dark materials that have a range of reflectance that is unusually wide for an asteroid. Material brighter than average is predominantly found on crater walls, and in ejecta surrounding caters in the southern hemisphere. Most likely, the brightest material identified on the Vesta surface so far is located on the inside of a crater at 64.27deg S, 1.54deg . The apparent brightness of a regolith is influenced by factors such as particle size, mineralogical composition, and viewing geometry. As such, the presence of bright material can indicate differences in lithology and/or degree of space weathering. We retrieve the spectral and photometric properties of various bright terrains from false-color images acquired in the High Altitude Mapping Orbit (HAMO). We find that most bright material has a deeper 1-m pyroxene band than average. However, the aforementioned brightest material appears to have a 1-m band that is actually less deep, a result that awaits confirmation by the on-board VIR spectrometer. This site may harbor a class of material unique for Vesta. We discuss the implications of our spectral findings for the origin of bright materials.

  12. At the dawn of the Anthropocene, a "crude look at the whole"

    Science.gov (United States)

    Revkin, Andrew

    2016-04-01

    This lecture provides an informed lay reflection on evidence that, for the first time in planetary history, a species is both a planet-scale force and slowly becoming aware of that potency. The presenter, a veteran science journalist who is also a member of the Anthropocene Working Group, will argue for the value of a rough overview by alluding to Nobelist Murray Gell-mann's stragey for finding meaning in complex systems by taking a "crude look at the whole." The debate around the dawn of the Anthropocene, whether it is accepted as a geological epoch or remains an informal construct, is really a debate about the burdens that come with increased knowledge. Human beings are essentially in a three-pronged race -- between their environmental potency; their awareness of the expressed and potential ramifications of impacts on Earth's operating systems; and growing awareness of the deeply embedded perceptual and behavioral traits that shape how our species does, or doesn't, address certain kinds of risks. The outcome of this race remains an open question, this lecture will argue, and whether the outcome can be judged good or bad is not just a function of more science. The talk will focus on the role of communication innovation in tipping the odds in a positive direction.

  13. Dusk to dawn activity patterns of anopheline mosquitoes in West Timor and Java, Indonesia.

    Science.gov (United States)

    Ndoen, Ermi; Wild, Clyde; Dale, Pat; Sipe, Neil; Dale, Mike

    2011-05-01

    Malaria is a serious health issue in Indonesia. We investigated the dusk to dawn anopheline mosquito activity patterns, host-seeking and resting locations in coastal plain, hilly and highland areas in West Timor and Java. Adult mosquitoes were captured landing on humans or resting in houses or animal barns. Data analyzed were: mosquito night-time activities; period of peak activity; night-time activity in specific periods of time and for mosquito resting locations. Eleven species were recorded; data were sparse for some species therefore detailed analyses were performed for four species only. In Java Anopheles vagus was common, with a bimodal pattern of high activity. In West Timor, its activity peaked around midnight. Other species with peak activity around the middle of the night were An. barbirostris and An. subpictus. Most species showed no biting and resting preference for indoors or outdoors, although An. barbirostris preferred indoors in West Timor, but outdoors in Java. An. aconitus and An. annularis preferred resting in human dwellings; An. subpictus and An. vagus preferred resting in animal barns. An. barbirostris preferred resting in human dwellings in West Timor and in animal barns in Java. The information is useful for planning the mosquito control aspect of malaria management. For example, where mosquito species have peak activity at night indoors, bednets and indoor residual spraying should reduce malaria risk, but where mosquitoes are most active outdoors, other options may be more effective.

  14. On the Occurrence of Magnetic Reconnection Along the Dawn and Dusk Magnetopause

    Science.gov (United States)

    Petrinec, S. M.; Burch, J. L.; Fuselier, S. A.; Trattner, K. J.; Gomez, R. G.; Giles, B. L.; Pollock, C.; Russell, C. T.; Strangeway, R. J.

    2017-12-01

    Magnetic reconnection is recognized as the primary process by which bulk solar wind plasma is able to enter the magnetosphere. The amount of plasma and energy transport is affected by the reconnection rate along the reconnection line as well as the spatial extent of the reconnection line. These parameters are in turn influenced by parameters such as the orientation of the interplanetary magnetic field (IMF), the dipole tilt angle of the Earth, and the local change in plasma beta between the magnetosheath and magnetosphere. Local variations of magnetosheath parameters are influenced by the character of the standing bow shock upstream of the observing location; i.e., there is greater variation downstream of the quasi-parallel shock than downstream of the quasi-perpendicular shock. Observations from the MMS mission are used to examine the occurrence of quasi-steady magnetic reconnection along the dawn and dusk regions of the magnetopause, and to determine the influence of local magnetosheath variations on the characteristics of the extended reconnection line.

  15. Performance of High-Efficiency Advanced Triple-Junction Solar Panels for the LILT Mission Dawn

    Science.gov (United States)

    Fatemi, Navid S.; Sharma, Surya; Buitrago, Oscar; Sharps, Paul R.; Blok, Ron; Kroon, Martin; Jalink, Cees; Harris, Robin; Stella, Paul; Distefano, Sal

    2005-01-01

    NASA's Discovery Mission Dawn is designed to (LILT) conditions. operate within the solar system's Asteroid belt, where the large distance from the sun creates a low-intensity, low-temperature (LILT) condition. To meet the mission power requirements under LlLT conditions, very high-efficiency multi-junction solar cells were selected to power the spacecraft to be built by Orbital Sciences Corporation (OSC) under contract with JPL. Emcore's InGaP/InGaAs/Ge advanced triple-junction (ATJ) solar cells, exhibiting an average air mass zero (AMO) efficiency of greater than 27.6% (one-sun, 28 C), were used to populate the solar panels [1]. The two solar array wings, to be built by Dutch Space, with 5 large- area panels each (total area of 36.4 sq. meters) are projected to produce between 10.3 kWe and 1.3 kWe of end-of life (EOL) power in the 1.0 to 3.0 AU range, respectively. The details of the solar panel design, testing and power analysis are presented.

  16. Dusk but not dawn burrow emergence rhythms of Nephrops norvegicus (Crustacea: Decapoda

    Directory of Open Access Journals (Sweden)

    Valerio Sbragaglia

    2013-10-01

    Full Text Available The Norway lobster, Nephrops norvegicus, can be captured by haul nets only during the emergence from its burrow. In the last few decades, an extensive field research revealed distinct diel (24-h–based catchability patterns at different depths. Laboratory experiments suggested that burrow emergence (used as a proxy of catchability is endogenously controlled via a circadian system. Results were usually presented in terms of mean effects without a quantification of inter-individual variability and arrhythmia. Here, we studied the burrow emergence of 52 adult Nephrops by an infrared actograph endowed with an artificial burrow. Animals were exposed to 12-12 h light-darkness cycle, simulating photic condition of the lower shelf. Forty-five animals showed rhythmic emergence (87%, while seven were arrhythmic (13%. Rhythmic animals were clustered according to their timing of emergence: 54% at dusk and 4% at dawn. Moreover, other animals showed fully diurnal or nocturnal emergence (10% and 19%, respectively. The comparison of our results with those derived from temporally scheduled trawling indicates that bimodal catch patterns observed in shelf populations are poorly observed during individual experiments in the laboratory, where the same light conditions are simulated. Nephrops burrow emergence seems to be the result of a mixed endogenous-exogenous control, while arrhythmia could also be present in the wild.

  17. Understanding Creation: Cosmology at the Dawn of the 21st Century

    Science.gov (United States)

    Lang, Andrew E.

    1997-01-01

    Cosmology attempts to answer questions concerning the origin of the universe, the way in which it evolves, and the way in which it will end. These are ancient questions that fascinate humanity and attendant metaphysical answers predate recorded history. The dawn of the 21st century has witnessed the first scientific answers. The goal of modern cosmology is to determine the basic properties of the universe. Numerous discoveries have been made in the last century which have had a profound influence on cosmology such as the expansion of the universe and the existence of the cosmic microwave background (CMB). CMB and other phenomena act as fossils for cosmologists who attempt to characterize the early universe through an interpretive methodology similar to that of archaeologists. Programs and tools such as NASA's Cosmic Background Explorer (COBE) have been designed to illuminate the morphologic history of the universe including the big bang theory and the current density of the universe. In this primer for cosmology, these and other discoveries and postulations are discussed.

  18. Bayesian constraints on the global 21-cm signal from the Cosmic Dawn

    Science.gov (United States)

    Bernardi, G.; Zwart, J. T. L.; Price, D.; Greenhill, L. J.; Mesinger, A.; Dowell, J.; Eftekhari, T.; Ellingson, S. W.; Kocz, J.; Schinzel, F.

    2016-09-01

    The birth of the first luminous sources and the ensuing epoch of reionization are best studied via the redshifted 21-cm emission line, the signature of the first two imprinting the last. In this work, we present a fully Bayesian method, HIBAYES, for extracting the faint, global (sky-averaged) 21-cm signal from the much brighter foreground emission. We show that a simplified (but plausible) Gaussian model of the 21-cm emission from the Cosmic Dawn epoch (15 ≲ z ≲ 30), parametrized by an amplitude A_{H I}, a frequency peak ν _{H I} and a width σ _{H I}, can be extracted even in the presence of a structured foreground frequency spectrum (parametrized as a seventh-order polynomial), provided sufficient signal-to-noise (400 h of observation with a single dipole). We apply our method to an early, 19-min-long observation from the Large aperture Experiment to detect the Dark Ages, constraining the 21-cm signal amplitude and width to be -890 6.5 MHz (corresponding to Δz > 1.9 at redshift z ≃ 20) respectively at the 95-per cent confidence level in the range 13.2 ν > 50 MHz).

  19. The prehistory of potyviruses: their initial radiation was during the dawn of agriculture.

    Science.gov (United States)

    Gibbs, Adrian J; Ohshima, Kazusato; Phillips, Matthew J; Gibbs, Mark J

    2008-06-25

    Potyviruses are found world wide, are spread by probing aphids and cause considerable crop damage. Potyvirus is one of the two largest plant virus genera and contains about 15% of all named plant virus species. When and why did the potyviruses become so numerous? Here we answer the first question and discuss the other. We have inferred the phylogenies of the partial coat protein gene sequences of about 50 potyviruses, and studied in detail the phylogenies of some using various methods and evolutionary models. Their phylogenies have been calibrated using historical isolation and outbreak events: the plum pox virus epidemic which swept through Europe in the 20th century, incursions of potyviruses into Australia after agriculture was established by European colonists, the likely transport of cowpea aphid-borne mosaic virus in cowpea seed from Africa to the Americas with the 16th century slave trade and the similar transport of papaya ringspot virus from India to the Americas. Our studies indicate that the partial coat protein genes of potyviruses have an evolutionary rate of about 1.15x10(-4) nucleotide substitutions/site/year, and the initial radiation of the potyviruses occurred only about 6,600 years ago, and hence coincided with the dawn of agriculture. We discuss the ways in which agriculture may have triggered the prehistoric emergence of potyviruses and fostered their speciation.

  20. Dark-ages reionization and galaxy formation simulation - XII. Bubbles at dawn

    Science.gov (United States)

    Geil, Paul M.; Mutch, Simon J.; Poole, Gregory B.; Duffy, Alan R.; Mesinger, Andrei; Wyithe, J. Stuart B.

    2017-12-01

    The direct detection of regions of ionized hydrogen (H II) has been suggested as a promising probe of cosmic reionization. Observing the redshifted 21-cm signal of hydrogen from the epoch of reionization (EoR) is a key scientific driver behind new-generation, low-frequency radio interferometers. We investigate the feasibility of combining low-frequency observations with the Square Kilometre Array and near infra-red survey data of the Wide-Field Infrared Survey Telescope to detect cosmic reionization by imaging H II bubbles surrounding massive galaxies during the cosmic dawn. While individual bubbles will be too small to be detected, we find that by stacking redshifted 21-cm spectra centred on known galaxies, it will be possible to directly detect the EoR at z ∼ 9-12, and to place qualitative constraints on the evolution of the spin temperature of the intergalactic medium (IGM) at z ≳ 9. In particular, given a detection of ionized bubbles using this technique, it is possible to determine if the IGM surrounding them is typically in absorption or emission. Determining the globally averaged neutral fraction of the IGM using this method will prove more difficult due to degeneracy with the average size of H II regions.

  1. Internal lecture: The dawn of the Standard Model's revolution | 6 June | Main Auditorium

    CERN Multimedia

    2014-01-01

    "The dawn of the Standard Model's revolution", by Luigi di Lella and Alvaro de Rujula.   Alvaro de Rujula. 15:30 - 16:20: Lecture by Alvaro de Rujula (followed by 20 minutes of questions) Abstract In the few years around November 1974, particle physics changed very significantly and at a frantic pace. Practitioners began to get accustomed to the successful predictions of the Standard Model, which did not have many believers at that time. I shall recall the main experimental and theoretical advances, concerning in particular quarks as partons, the asymptotic freedom of QCD, charmonia and the first openly charmed particles. Career Alvaro de Rújula was at Harvard University during the Standard Model revolution. Before and after, amongst many other places, he worked at CERN.   16:40 - 17:00: Coffee break   Luigi di Lella. 17:00 - 17:50: Lecture by Luigi di Lella: Experiments at CERN in the decade 1964-1974 (followed by 20 minut...

  2. Insights from the correlation of the preliminary Geologic and Mineralogic maps of Vesta from the Dawn mission data

    Science.gov (United States)

    Frigeri, A.; De Sanctis, M. C.; Ammannito, E.; Yingst, R. A.; Mest, S.; Garry, B.; Magni, G.; Palomba, E.; Petro, N.; Tosi, F.; Williams, D.; Zambon, F.; Jaumann, R.; Pieters, C. M.; Raymond, C. A.; Russell, C. T.

    2012-04-01

    The Dawn mission to Vesta has greatly improved the quality and resolution of data available to explore the asteroid. Prior to the Dawn mission the best data available was the one from Hubble Space Telescope with a maximum resolution of 50 km per pixel. The survey phase of the mission has pushed spatial resolution up to about 100 meters per pixel by the Framing Camera on-board Dawn, and 700 meters per pixel for the VIR spectrometer, spanning the spectral range from the visible to infrared at 0.25-1 μm and 1-5 μm. The frames of the FC and VIR have been processed and mosaicked. A preliminary Geologic map has been produced by mapping units and structures over the FC mosaic and the DTM derived from stereo processing of visible imagery. We will present some examples of correlation between the preliminary geologic and VIR-derived mineralogic maps. The Dawn mission team is using Geographic Information System tools for locating frames and for data exchange among the team. The use of GIS tools and data formats significantly improves our ability to create and interpret geologic maps, and also improves the interoperability of high level data products among the instruments' team. VIR data have been synthesized into a series of spectral indicators that give indications on the mineralogical composition and the physical state of the surface. We ingested in GIS the the preliminary geologic map as units and structures and we projected the mosaics of spectral indicators in a common coordinate reference system. The first spectral indicators we started to look at were the Band Depth computed on pyroxene Band II and the Band Center also computed on Band II. The comparison of the preliminary geologic map and the mosaics of spectral indicators extracted from VIR data show promising aspects on both the geologic and mineralogic aspects. Geologic units are made up of bodies of rock that are interpreted to have been formed by a particular process or set of related processes over a discrete

  3. One Year of Observations of Dawn at Ceres: Composition as seen by VIR

    Science.gov (United States)

    De Sanctis, M. Cristina; Ammannito, Eleonora; Ciarniello, Mauro; Raponi, Andrea; Carrozzo, F. Giacomo; Frigeri, Alessandro; Longobardo, Andrea; Palomba, Ernesto; Tosi, Federico; Zambon, Francesca; Fonte, Sergio; Formisano, Michelangelo; Giardino, Marco; Magni, Gianfranco; Capaccioni, Fabrizio; Capria, M. Teresa; Marchi, Simone; Pieters, Carle M.; Ehlmann, Bethany; McCord, Tom

    2016-04-01

    NASA's Dawn spacecraft [1] arrived at Ceres on March 5, 2015, and has been studying the dwarf planet. The Dawn mission is observing Ceres' surface with its suite of instruments [1] including a Visible and InfraRed Mapping Spectrometer (VIR-MS) [2]. VIR-MS is an imaging spectrometer coupling high spectral and spatial resolution in the VIS (0.25-1-micron) and IR (0.95-5-micron) spectral ranges. Ceres' surface is very dark, but small localized areas exhibit unexpectedly bright materials. Since the first approach data, near infrared spectra revealed a dark surface, with a strong and complex absorption band in the spectral region around 3 microns [3]. Near-infrared spectroscopic analyses confirmed previous observation of bands at 3.1, 3.3-3.5, 3.9 micron but have clearly identified a band at 2.72 micron. This characteristic narrow feature is distinctive for OH-bearing minerals, while H2O-bearing phases, show a much broader absorption band that is a poor match for the Ceres spectrum. Water ice does not fit the observed spectrum. The 3.05-3.1 μm band is also visible in Ceres' ground-based spectra, and has been previously attributed to different phases including water ice, hydrated or NH4-bearing clays and brucite [4,5,6]. We find here that the best fit is obtained with ammoniated phyllosilicate added to a dark material (likely magnetite), antigorite and carbonate [7]. These different components, including ammoniated phases, occur everywhere across the surface although with different relative abundances [8]. Particularly interesting are the bright materials present in some craters like Occator, Haulani and Oxo that show different proportions of the components of the mixture [8]. However, the distribution of the band depths are not always linked to morphological structures. The retrieved mineralogy and composition indicates pervasive aqueous alteration of the surface, processes that are expected to be favored on large bodies like Ceres [9]. Furthermore, Ceres' low density

  4. Compressional wave events in the dawn plasma sheet observed by Interball-1

    Directory of Open Access Journals (Sweden)

    O. Verkhoglyadova

    1999-09-01

    Full Text Available Compressional waves with periods greater than 2 min (about 10-30 min at low geomagnetic latitudes, namely compressional Pc5 waves, are studied. The data set obtained with magnetometer MIF-M and plasma analyzer instrument CORALL on board the Interball-1 are analyzed. Measurements performed in October 1995 and October 1996 in the dawn plasma sheet at -30 RE ≤ XGSM and |ZGSM| ≤ 10 RE are considered. Anti-phase variations of magnetic field and ion plasma pressures are analyzed by searching for morphological similarities in the two time series. It is found that longitudinal and transverse magnetic field variations with respect to the background magnetic field are of the same order of magnitude. Plasma velocities are processed for each time period of the local dissimilarity in the pressure time series. Velocity disturbances occur mainly transversely to the local field line. The data reveal the rotation of the velocity vector. Because of the field line curvature, there is no fixed position of the rotational plane in the space. These vortices are localized in the regions of anti-phase variations of the magnetic field and plasma pressures, and the vortical flows are associated with the compressional Pc5 wave process. A theoretical model is proposed to explain the main features of the nonlinear wave processes. Our main goal is to study coupling of drift Alfven wave and magnetosonic wave in a warm inhomogeneous plasma. A vortex is the partial solution of the set of the equations when the compression is neglected. A compression effect gives rise to a nonlinear soliton-like solution.Key words. Magnetosphere physics (magnetotail · Space plasma physics (kinetic and MHD theory; non-linear phenomena

  5. Dawn and Dusk Set States of the Circadian Oscillator in Sprouting Barley (Hordeum vulgare Seedlings.

    Directory of Open Access Journals (Sweden)

    Weiwei Deng

    Full Text Available The plant circadian clock is an internal timekeeper that coordinates biological processes with daily changes in the external environment. The transcript levels of clock genes, which oscillate to control circadian outputs, were examined during early seedling development in barley (Hordeum vulgare, a model for temperate cereal crops. Oscillations of clock gene transcript levels do not occur in barley seedlings grown in darkness or constant light but were observed with day-night cycles. A dark-to-light transition influenced transcript levels of some clock genes but triggered only weak oscillations of gene expression, whereas a light-to-dark transition triggered robust oscillations. Single light pulses of 6, 12 or 18 hours induced robust oscillations. The light-to-dark transition was the primary determinant of the timing of subsequent peaks of clock gene expression. After the light-to-dark transition the timing of peak transcript levels of clock gene also varied depending on the length of the preceding light pulse. Thus, a single photoperiod can trigger initiation of photoperiod-dependent circadian rhythms in barley seedlings. Photoperiod-specific rhythms of clock gene expression were observed in two week old barley plants. Changing the timing of dusk altered clock gene expression patterns within a single day, showing that alteration of circadian oscillator behaviour is amongst the most rapid molecular responses to changing photoperiod in barley. A barley EARLY FLOWERING3 mutant, which exhibits rapid photoperiod-insensitive flowering behaviour, does not establish clock rhythms in response to a single photoperiod. The data presented show that dawn and dusk cues are important signals for setting the state of the circadian oscillator during early development of barley and that the circadian oscillator of barley exhibits photoperiod-dependent oscillation states.

  6. Observations of unusual pre-dawn response of the equatorial F-region during geomagnetic disturbances

    Science.gov (United States)

    Lima, W.; Becker-Guedes, F.; Fagundes, P.; Sahai, Y.; Abalde, J.; Pillat, V.

    It is known that the disturbed solar wind-magnetosphere interactions have important effects on equatorial and low-latitude ionospheric electrodynamics. The response of equatorial ionosphere during storm-time is an important aspect of space weather studies. It has been observed that during geomagnetic disturbances both suppression as well as generation of equatorial spread-F (ESF) or plasma irregularities takes place. However, the mechanism(s) associated with the generation of ESF still needs further investigations. This work reports some unusual events of pre-dawn occurrence of ionospheric F-region satellite traces followed by spread-F and cusp-like spread-F from ionospheric sounding observations carried out by a Canadian Advanced Digital Ionosonde (CADI) localized at Palmas (10.2°, 48.2°W, dip latitude 5.7°S), Brazil during 2002, every 5 minutes. For the present work we have scaled and analyzed the ionospheric sounding data for three events (April 20, September 04 and 08, 2002), which are associated with geomagnetic disturbances. In the events studied, the ionograms show the occurrence of satellite trace followed by cusp-like spread. The cusp like features move up in frequency and height and finally attain the F-layer peak value (foF2) and then disappear. They had duration of about 30 min and always occurred in the early morning hours. Our studies involved seven geomagnetic disturbances as well as quiet days during the year 2002, but only on these three occasions we observed these features. We present and discuss these observations in this paper and suggest possible mechanisms for the occurrence of these unusual features.

  7. Detection of serpentine in exogenic carbonaceous chondrite material on Vesta from Dawn FC data

    Science.gov (United States)

    Nathues, Andreas; Hoffmann, Martin; Cloutis, Edward A.; Schäfer, Michael; Reddy, Vishnu; Christensen, Ulrich; Sierks, Holger; Thangjam, Guneshwar Singh; Le Corre, Lucille; Mengel, Kurt; Vincent, Jean-Baptist; Russell, Christopher T.; Prettyman, Tom; Schmedemann, Nico; Kneissl, Thomas; Raymond, Carol; Gutierrez-Marques, Pablo; Hall, Ian; Büttner, Irene

    2014-09-01

    The Dawn mission’s Framing Camera (FC) observed Asteroid (4) Vesta in 2011 and 2012 using seven color filters and one clear filter from different orbits. In the present paper we analyze recalibrated HAMO color cubes (spatial resolution ∼60 m/pixel) with a focus on dark material (DM). We present a definition of highly concentrated DM based on spectral parameters, subsequently map the DM across the Vestan surface, geologically classify DM, study its spectral properties on global and local scales, and finally, compare the FC in-flight color data with laboratory spectra. We have discovered an absorption band centered at 0.72 μm in localities of DM that show the lowest albedo values by using FC data as well as spectral information from Dawn’s imaging spectrometer VIR. Such localities are contained within impact-exposed outcrops on inner crater walls and ejecta material. Comparisons between spectral FC in-flight data, and laboratory spectra of meteorites and mineral mixtures in the wavelength range 0.4-1.0 μm, revealed that the absorption band can be attributed to the mineral serpentine, which is typically present in CM chondrites. Dark material in its purest form is rare on Vesta’s surface and is distributed globally in a non-uniform manner. Our findings confirm the hypothesis of an exogenic origin of the DM by the infall of carbonaceous chondritic material, likely of CM type. It further confirms the hypothesis that most of the DM was deposited by the Veneneia impact.

  8. Spectral measurements of howardites in support of the interpretation of the Dawn VIR spectra at Vesta

    Science.gov (United States)

    De Angelis, S.; Ammannito, E.; Di Iorio, T.; De Sanctis, M.; Mittlefehldt, D.

    2014-07-01

    The howardites, eucrites, and diogenites constitute a suite of meteorite lithologies (HED) known to be related to asteroid Vesta [1]. Howardites are physical mixtures of eucrites and diogenites. Howardites are divided in two subtypes: regolithic howardites are actually linked to the true regolith, while fragmental howardites are simple polymict breccias [2]. Mapping of Vesta's surface, as obtained with data from Visible and Infrared mapping Spectrometer (VIR) on Dawn [3,4], showed that it is mainly howarditic, with few regions of diogenite-rich and eucrite-rich terrains [5, 6]. In order to map quantitatively the distribution of lithologic types on Vesta, we are carrying on a study of a set of well-characterized howardites [7]. Spectra were measured on sample powders sieved to 75 μ m in the laboratories of the Istituto di Astrofisica e Planetologia Spaziali (IAPS-INAF) in Rome (Italy) and Brown University, in Providence (USA). Here we report about the measurements done at IAPS-INAF. The spectra of 33 samples have been acquired with the S.LAB setup, consisting in the FieldSpec Pro spectrometer (range 0.35-2.5 μ m, spatial resolution 0.5 cm^2) coupled with a goniometer (incidence i=30°, emission e=0°) [8]. Some representative spectra of the measured howardites are shown in the figure. The spectra are characterized by the two broad Fe^{2+} absorption bands near 1 and 2 μ m (BI and BII) indicative of pyroxenes. Band parameters relative to BI and BII have been calculated using the algorithm developed to process VIR spectra [4]. This enables us to compare laboratory data directly with the VIR results. Other weaker absorptions also characterize some spectra: the 0.5 μ m feature (Mn^{2+} or Cr^{3+}) and the 1.2 μ m feature possibly due to Fe^{2+} in plagioclases. The PRA04401 sample is characterized by a pyroxene-carbonaceous matter mixture [7].

  9. Machine Learning Applied to Dawn/VIR data of Vesta in view of MERTIS/BepiColombo.

    Science.gov (United States)

    Helbert, J.; D'Amore, M.; Le Scaon, R.; Maturilli, A.; Palomba, E.; Longobardo, A.; Hiesinger, H.

    2016-12-01

    Remote sensing spectroscopy is one of the most commonly used technique in planetary science and for recent instruments producing huge amount of data, classic methods could fails to unlock the full scientific potential buried in the measurements. We explored several Machine Learning techniques: multi-step clustering method is developed, using an image segmentation method, a stream algorithm, and hierarchical clustering. The MErcury Radiometer and Thermal infrared Imaging Spectrometer (MERTIS) is part of the payload of the Mercury Planetary Orbiter spacecraft of the ESA-JAXA BepiColombo mission. MERTIS's scientific goals are to infer rock-forming minerals, to map surface composition, and to study surface temperature variations on Mercury. The NASA mission DAWN carry a suites of instruments aimed at understanding the two most massive objects in the main asteroid belt: Vesta and Ceres. DAWN has already successfully completed the exploration of Vesta in September 2012 and it is now in the last phase of the mission around Ceres. To cope with the stream of data that will be delivered by MERTIS, we developed an algorithm that could aggregate new data as they come in during the mission giving the scientist a guide for the most interesting and new discovery on Mercury. The DAWN/VESTA VIR data is a testbed for the algorithm. The algorithm identified the Olivine outcrops around two craters on Vesta's surface described in Ammannito et al., 2013. We furthermore mimic the data acquisition process as if the mission were dumping the data live. The algorithm provides insightful information on the novelty and classes int he data as they are collected. This will enhance MERTIS targeting and maximize its scientific return during BepiColombo mission at Mercury. E Ammannito et al. "Olivine in an unexpected location on Vesta/'s surface". In: Nature 504.7478 (2013), pp. 122-125.

  10. Gender Bias in The Rural Community as Reflected in Minfong Ho’s Sing to The Dawn

    Directory of Open Access Journals (Sweden)

    Hermanus Wahyaka

    2017-01-01

    Full Text Available This study aims at identifying the evidences of gender-biased behaviour and actions and at finding the possible reasons why those gender-biased behaviour and actions happen within the life of the rural community as depicted in the novel. The problems, therefore, are formulated as follows: 1. What are the evidences of gender-biased behaviour and actions experienced by the major female characters of Ho’sSing to the Dawn?and 2. Why do the gender-biased behaviour and actions occur within the life of the rural communityas in Ho’sSing to the Dawn? This study is a library research. The primary source is the novel itself, Sing to the Dawn. The secondary sources are obtained from several relevant books related to literary theories such as the critical approach, the theory of gender, the theory of society, and the review of Thai society. In order to relate the gender bias and a certain community, the socio-cultural approach is used to examine the novel. This study found that gender biased behaviour and actions committed by the male characters towards the major female characters manifest in several manners; they are subordination of women, mental violence, violent intention, physical violence, sex role stereotyping, and marginalization. The possible reasons enabling the manifestation of gender biased behaviour and actions committed by the male characters towards the major female characters are cultural construction on women subordination, cultural construction on sex roles stereotyping as the result of patriarchal system, religious misinterpretation, and poverty.   DOI: https://doi.org/10.24071/llt.2012.150205

  11. An extended study of the low-latitude boundary layer on the dawn and dusk flanks of the magnetosphere

    International Nuclear Information System (INIS)

    Mitchell, D.G.; Kutchko, F.; Williams, D.J.; Eastman, T.E.; Frank, L.A.; Russell, C.T.

    1987-01-01

    The authors present a study of the low-latitude boundary layer (LLBL) using ISEE 1 energetic particle, plasma, and magnetic field data obtained during numerous traversals of the LLBL that occurred on 66 ISEE 1 passes through the magnetospheric flank LLBL region. They use energetic particle distributions to determine dawn and dusk LLBL behavior and topology for varying orientations of the magnetosheath and/or interplanetary magnetic field (M/IMF), for different local times, and for changing levels of geomagnetic activity (Kp). This study corroborates and extends the earlier work of Williams et al. (1985) who presented a detailed study of two (dusk and dawn) ISEE 1 passes through the LLBL region for the case of northward M/IMF. They find that the dawn and dusk LLBL are on closed geomagnetic field lines for northward M/IMF but are on a combination of closed and open field lines for a southward M/IMF. The energetic particle distributions show that cases of reverse-draped field lines in the LLBL are consistent with an open field line topology. In addition, they find that the LLBL is thicker (thinner) for northward (southward) M/IMF and becomes thicker with increasing distance from the subsolar point. LLBL electric fields nominally are in the few (3-5) millivolts per meter range and display an apparent maximum value of ∼10mV/m. These electric fields capture magnetospherically drifting particles as they approach the LLBL and propel them tailward. In this way, the plasma sheet is the dominant source of energetic (approx-gt 10 keV) particles in the LLBL while the magnetosheath appears to be the dominant source for lower-energy (approx-lt 10 keV) LLBL particles

  12. Factors associated to the career choice of family medicine among Japanese physicians: the dawn of a new era.

    Science.gov (United States)

    Ie, Kenya; Tahara, Masao; Murata, Akiko; Komiyama, Manabu; Onishi, Hirotaka

    2014-01-01

    Despite recent developments in post-graduate family medicine training in Japan, the numbers of junior doctors entering family medicine residencies are still limited. The objective of this qualitative study was to investigate the possible factors associated to the career choice of family medicine, especially in the context of the newly established family medicine programs in Japan. From December 2010 to January 2011, we distributed a semi-structured questionnaire about career choice to 58 physician members of the Japan Primary Care Association, and 41 of them responded. Four researchers used the Modified Grounded Theory Approach (Kinoshita, 2003) for three-stage conceptualization. We extracted a conceptual model of the choice of newly established family medicine as a career in Japan, consisting of six categories and 77 subordinate concepts from 330 variations. The subcategories of personal background affecting the family-medicine career choice were characteristics ("self-reliance," "pioneering spirit"), career direction ("community/rural-orientedness," "multifaceted orientation") and experience (e.g., "discomfort with fragmented care"). We divided the influencing factors that were identified for career choice into supporters (e.g., "role model"), conflict of career choice (e.g., "anxiety about diverse/broad practice"), and the dawn of a new era in family medicine in Japan (e.g., "lack of social recognition," "concern about livelihood," and "too few role models"). Although the dawn of a new era seemed a rather negative influencer, it was unique to our study that the dawn itself could attract those with a "pioneering spirit" and an "attitude of self-training." Unlike previous studies, the positive factors such as lifestyle and the short residency program were not shown to be part of family medicine's attractiveness. In contrast, "concern about livelihood" was specific among our respondents and was related to career choice in the dawn period. "Community

  13. Black bear damage to northwestern conifers in California: a review

    Science.gov (United States)

    Kenneth O. Fulgham; Dennis Hosack

    2017-01-01

    A total of 789 black bear damaged trees were investigate over a multi-year period on 14 different study sites chosen on lands of four participating timber companies. The sites ranged from 30 to 50 years of age. Four different conifer species were found to have black bear damage: coastal redwood (Sequoia sempervirens (D. Don) Endl.), Douglas-fir (...

  14. Post-fire response of coast redwood one year after the Mendocino lightning complex fires

    Science.gov (United States)

    Robert B. Douglas; Tom. Bendurel

    2012-01-01

    Coast redwood (Sequoia sempervirens) forests have undergone significant changes over the past century and are now in state more conducive for wildfires. Because fires have been uncommon in redwood forests over the past 80 years, managers have limited data to make decisions about the post-fire environment. In June 2008, a series of lightning storms...

  15. Management practices eelated to the Restoration of old dorest characteristics in coast redwood forests

    Science.gov (United States)

    Gregory A. Guisti

    2012-01-01

    A standardized, interactive, interview process was used with practicing Registered Professional Foresters asking a suite of questions to ascertain their management approaches to coast redwood (Sequoia sempervirens [D. Don] Endl.) stands that could best be transferred to other projects and lands interested in recruiting older forest...

  16. Bark water uptake promotes localized hydraulic recovery in coastal redwood crown

    Science.gov (United States)

    J. Mason Earles; Or Sperling; Lucas C. R. Silva; Andrew J. McElrone; Craig R. Brodersen; Malcolm P. North; Maciej A. Zwieniecki

    2015-01-01

    Coastal redwood (Sequoia sempervirens), the world’s tallest tree species, rehydrates leaves via foliar water uptake during fog/rain events. Here we examine if bark also permits water uptake in redwood branches, exploring potential flow mechanisms and biological significance. Using isotopic labelling and microCT imaging, we observed that water...

  17. A Multiple Logistic Regression Model for Predicting the Development of Phytophthora ramorum symptoms in Tanoak (Lithocarpus densiflorus)

    Science.gov (United States)

    Mark Spencer; Kevin O' Hara

    2007-01-01

    Phytophthora ramorum attacks tanoak (Lithocarpus densiflorus) in California and Oregon. We present a stand-level study examining the presence of disease symptoms in individual stems. Working with data from four plots in redwood (Sequoia sempervirens)/tanoak forests in Marin County, and three plots in Mendocino...

  18. Sudden Oak Death in redwood forests: vegetation dynamics in the wake of tanoak decline

    Science.gov (United States)

    Benjamin Ramage; Kevin O’Hara

    2010-01-01

    Numerous lines of inquiry have concluded that tanoak (Lithocarpus densiflorus) will continue to experience drastic population declines and may even disappear entirely from redwood (Sequoia sempervirens) forests as a result of the exotic disease sudden oak death (SOD) (Maloney and others 2005, McPherson and others 2005,...

  19. Biodegrading effects of some rot fungi on Pinus caribaea wood

    African Journals Online (AJOL)

    STORAGESEVER

    2008-05-16

    May 16, 2008 ... species of white-rot fungi; Corioliopsis polyzona and Pleurotus squarrosulus, and two species of brown- rot fungi; Lentinus ... The results indicated that biodegradation by rot fungi differs in intensity according to the fungus ..... wood of coast red wood Sequoia Sempervirens (D. Don). For. Prod. J. 33(5): 15-20 ...

  20. Rangewide Genetic Variation in Coast Redwood Populations at a Chloroplast Microsatellite Locus

    Science.gov (United States)

    Chris Brinegar

    2012-01-01

    Old growth and second growth populations of coast redwood (Sequoia sempervirens) were sampled at 10 locations throughout its range and analyzed at a highly variable chloroplast microsatellite locus. Very low FST values indicated that there was no significant genetic differentiation between adjacent old growth and second growth populations at each location. Genetic...

  1. Physiology and growth of redwood and Douglas-fir planted after variable density retention outside redwood’s range

    Science.gov (United States)

    Lucy Kerhoulas; Nicholas Kerhoulas; Wade Polda; John-Pascal Berrill

    2017-01-01

    Reforestation following timber harvests is an important topic throughout the coast redwood (Sequoia sempervirens (D. Don) Endl.) range. Furthermore, as drought-induced mortality spreads across many of California’s forests, it is important to understand how physiology and stand structure influence reforestation success. Finally, as climate...

  2. Using wood quality measures to evaluate second-growth redwood

    Science.gov (United States)

    Stephen L. Quarles; Yana. Vlachovic

    2012-01-01

    Redwood (Sequoia sempervirens) a valued species for use in appearance grade applications, such as decking, exterior siding and interior paneling, because of its dimensional stability. It is also valued for certain exterior-use applications because of its natural decay resistance. Studies have found that young-growth redwood is less resistant to...

  3. Inbreeding depression in selfs of redwood

    Science.gov (United States)

    W. J. Libby; B. G. McCutchan; C. I. Millar

    1981-01-01

    Given the polyploid chromosome constitution of Sequoia sempervirens, there was reason to question whether it would exhibit inbreeding depression. Preliminary results from studies of self and related outcross families are reported as a guide to the selection of trees for redwood seed orchards and breeding-orchards. The data indicate that, compared to...

  4. Bat use of remnant old-growth redwood stands

    Science.gov (United States)

    William J. Zielinski; Steven T. Gellman

    1999-01-01

    Most of the old-growth redwood (Sequoia sempervirens) in Calfornia has been cut; regenerating forests will probably never resemble those that were harvested, and what old growth remains on private land occurs in small, isolated remnant patches. The landscapes in which these stands occur differ so markedly from their original condition that their...

  5. Cradle-to-gate life cycle impacts of redwood forest resource harvesting in northern California

    Science.gov (United States)

    Han-Sup Han; Elaine Oneil; Richard D. Bergman; Ivan L. Eastin; Leonard R. Johnson

    2015-01-01

    The first life cycle impact assessment for redwood (Sequoia sempervirens) forest management activities (i.e. a cradle-to-sawmill gate input) including the growing, harvesting, and hauling of redwood sawlogs to a sawmill was completed. In the stump-to-truck timber harvesting analysis, primary transport activities such as skidding and yarding consumed...

  6. Life-cycle assessment of redwood decking in the United States with a comparison to three other decking materials

    Science.gov (United States)

    R. Bergman; H. Sup-Han; E. Oneil; I. Eastin

    2013-01-01

    The goal of the study was to conduct a life-cycle inventory (LCI) of California redwood (Sequoia sempervirens) decking that would quantify the critical environmental impacts of decking from cradle to grave. Using that LCI data, a life-cycle assessment (LCA) was produced for redwood decking. The results were used to compare the environmental footprint...

  7. Natural seedlings and sprouts after regeneration cuttings in old-growth redwood

    Science.gov (United States)

    Kenneth N. Boe

    1975-01-01

    Natural regeneration of harvested old-growth stands of redwood (Sequoia sempervirens) is one way to start a new forest that is needed quickly for continuous timber production. Natural seedlings and sprouts developing after stands were cut were studied on the Redwood Experimental Forest, northern California. Three types of regeneration cuttings were...

  8. Coast redwood live crown and sapwood

    Science.gov (United States)

    John-Pascal Berrill; Jesse L. Deffress; Jessica M. Engle

    2012-01-01

    Understanding crown rise and sapwood taper will help meet management objectives such as producing long branch-free boles for clear wood and old-growth restoration, or producing sawlogs with a high proportion of heartwood. Coast redwood (Sequoia sempervirens) tree crown ratio data were collected 20 years after partial harvesting in a 65-year-old second growth stand....

  9. Impacts on soils and residual trees from cut-to-length thinning operations in California's redwood forests

    Science.gov (United States)

    Kyungrok Hwang; Han-sup Han; Susan E. Marshall; Deborah S. Page-Dumroese

    2017-01-01

    Cut-to-length (CTL) harvest systems have recently been introduced for thinning third-growth, young (<25 years old) redwood forests (Sequoia sempervirens (Lamb. ex D. Don) Endl.) in northern California. This type of harvesting can effective for thinning overstocked stands consisting of small-diameter trees. However, forestland managers and government agencies...

  10. Predicting redwood productivity using biophysical data, spatial statistics and site quality indices

    Science.gov (United States)

    John-Pascal Berrill; Kevin L. O’Hara; Shawn Headley

    2017-01-01

    Coast redwood (Sequoia sempervirens (D. Don) Endl.) height growth and basal area growth are sensitive to variations in site quality. Site factors known to be correlated with redwood stand growth and yield include topographic variables such as position on slope, exposure, and the composite variable: topographic relative moisture index. Species...

  11. Resolved spectrophotometric properties of the Ceres surface from Dawn Framing Camera images

    Science.gov (United States)

    Schröder, S. E.; Mottola, S.; Carsenty, U.; Ciarniello, M.; Jaumann, R.; Li, J.-Y.; Longobardo, A.; Palmer, E.; Pieters, C.; Preusker, F.; Raymond, C. A.; Russell, C. T.

    2017-05-01

    We present a global spectrophotometric characterization of the Ceres surface using Dawn Framing Camera (FC) images. We identify the photometric model that yields the best results for photometrically correcting images. Corrected FC images acquired on approach to Ceres were assembled into global maps of albedo and color. Generally, albedo and color variations on Ceres are muted. The albedo map is dominated by a large, circular feature in Vendimia Planitia, known from HST images (Li et al., 2006), and dotted by smaller bright features mostly associated with fresh-looking craters. The dominant color variation over the surface is represented by the presence of "blue" material in and around such craters, which has a negative spectral slope over the visible wavelength range when compared to average terrain. We also mapped variations of the phase curve by employing an exponential photometric model, a technique previously applied to asteroid Vesta (Schröder et al., 2013b). The surface of Ceres scatters light differently from Vesta in the sense that the ejecta of several fresh-looking craters may be physically smooth rather than rough. High albedo, blue color, and physical smoothness all appear to be indicators of youth. The blue color may result from the desiccation of ejected material that is similar to the phyllosilicates/water ice mixtures in the experiments of Poch et al. (2016). The physical smoothness of some blue terrains would be consistent with an initially liquid condition, perhaps as a consequence of impact melting of subsurface water ice. We find red terrain (positive spectral slope) near Ernutet crater, where De Sanctis et al. (2017) detected organic material. The spectrophotometric properties of the large Vendimia Planitia feature suggest it is a palimpsest, consistent with the Marchi et al. (2016) impact basin hypothesis. The central bright area in Occator crater, Cerealia Facula, is the brightest on Ceres with an average visual normal albedo of about 0.6 at

  12. Constraining Cosmic Dawn and Cosmological Reionization via the global redshifted 21-cm signal

    Science.gov (United States)

    Singh, Saurabh

    2018-01-01

    The formation of first stars and consequent thermal evolution in baryons during Cosmic Dawn and the Epoch of Reionization (EoR) is poorly constrained. The 21-cm line transition of neutral hydrogen is one of the richest probes of the astrophysics during this era. The signal has the potential to reveal the nature and timing of the emergence of first stars, first light, and the consequent evolution in thermal and ionization state of the baryons.The detection of the global redshifted 21-cm signal, which represents the mean thermal history of the gas, is challenging since it is extremely faint and seen through orders of magnitude stronger contributions from Galactic and extragalactic foregrounds. Man-made terrestrial Radio Frequency Interference (RFI) and the exacting tolerances required on instrument systematics make the detection even more daunting.The design considerations for a precision spectral radiometer are first listed, and a comparison is made of different radiometer configurations, including short and zero baseline interferometers along with methods to enhance the response. We discuss the relative merits of different methods.We then describe SARAS 2, a spectral radiometer custom-designed for precision measurement of the global 21-cm signal. SARAS 2 has been designed to have a system transfer function and internal systematics – both multiplicative and additive – to be spectrally smooth so as to allow a separation of foregrounds and systematics from plausible and predicted global cosmological 21-cm signals. The algorithms for calibration and RFI mitigation are carefully developed so that they do not introduce spectral features that may confuse the detection of the 21-cm signal.We present the outcomes for cosmology from analysis of 60 hr observing with the radiometer deployed at the Timbaktu Collective in Southern India. The detailed analysis of the data reveals an RMS noise level of 11 mK, without being limited by systematic structures. The likelihood

  13. Thermal measurements of dark and bright surface features on Vesta as derived from Dawn/VIR

    Science.gov (United States)

    Tosi, Federico; Capria, Maria Teresa; De Sanctis, M.C.; Combe, J.-Ph.; Zambon, F.; Nathues, A.; Schröder, S.E.; Li, J.-Y.; Palomba, E.; Longobardo, A.; Blewett, D.T.; Denevi, B.W.; Palmer, E.; Capaccioni, F.; Ammannito, E.; Titus, Timothy N.; Mittlefehldt, D.W.; Sunshine, J.M.; Russell, C.T.; Raymond, C.A.; Dawn/VIR Team,

    2014-01-01

    Remote sensing data acquired during Dawn’s orbital mission at Vesta showed several local concentrations of high-albedo (bright) and low-albedo (dark) material units, in addition to spectrally distinct meteorite impact ejecta. The thermal behavior of such areas seen at local scale (1-10 km) is related to physical properties that can provide information about the origin of those materials. We use Dawn’s Visible and InfraRed (VIR) mapping spectrometer hyperspectral data to retrieve surface temperatures and emissivities, with high accuracy as long as temperatures are greater than 220 K. Some of the dark and bright features were observed multiple times by VIR in the various mission phases at variable spatial resolution, illumination and observation angles, local solar time, and heliocentric distance. This work presents the first temperature maps and spectral emissivities of several kilometer-scale dark and bright material units on Vesta. Results retrieved from the infrared data acquired by VIR show that bright regions generally correspond to regions with lower temperature, while dark regions correspond to areas with higher temperature. During maximum daily insolation and in the range of heliocentric distances explored by Dawn, i.e. 2.23-2.54 AU, the warmest dark unit found on Vesta rises to a temperature of 273 K, while bright units observed under comparable conditions do not exceed 266 K. Similarly, dark units appear to have higher emissivity on average compared to bright units. Dark-material units show a weak anticorrelation between temperature and albedo, whereas the relation is stronger for bright material units observed under the same conditions. Individual features may show either evanescent or distinct margins in the thermal images, as a consequence of the cohesion of the surface material. Finally, for the two categories of dark and bright materials, we were able to highlight the influence of heliocentric distance on surface temperatures, and estimate an

  14. Emergency Department Visits Involving Misuse and Abuse of the Antipsychotic Quetiapine: Results from the Drug Abuse Warning Network (DAWN

    Directory of Open Access Journals (Sweden)

    Margaret E. Mattson

    2015-01-01

    Full Text Available Case reports in medical literature suggest that the atypical antipsychotic quetiapine, a medication not previously considered to have abuse potential, is now being subject to misuse and abuse (MUA; ie, taken when not prescribed for them or used in a way other than instructed by their health professional. Here we present systematic, nationally representative data from the 2005 to 2011 Drug Abuse Warning Network (DAWN for prevalence of emergency department (ED visits among the U.S. general population involving quetiapine and related to MUA, suicide attempts, and adverse reactions. Nationally, quetiapine-related ED visits increased 90% between 2005 and 2011, from 35,581 ED visits to 67,497. DAWN data indicate that when used without medical supervision for recreational/self-medication purposes, quetiapine poses health risks for its users, especially among polydrug users and women. These findings suggest that the medical and public health communities should increase vigilance concerning this drug and its potential for MUA.

  15. Structure of the auroral precipitation region in the dawn sector: relationship to convection reversal boundaries and field-aligned currents

    Directory of Open Access Journals (Sweden)

    Y. I. Feldstein

    2001-05-01

    precipitation (AO is mapped to the dawn periphery of the Central Plasma Sheet (CPS; the soft small scale structured precipitation (SSSL is mapped to the outer magnetosphere close to the magnetopause, i.e. the Low Latitude Boundary Layer (LLBL. In the near-noon sector, earthward fluxes of soft electrons, which cause the Diffuse Red Aurora (DRA, are observed. The ion energies decrease with increasing latitude. The plasma spectra of the DRA regime are analogous to the spectra of the Plasma Mantle (PM. In the dawn sector, the large-scale field-aligned currents flow into the ionosphere at the SSSL latitudes (Region 1 and flow out at the AO or DAZ latitudes (Region 2. In the dawn and dusk sectors, the large-scale Region 1 and Region 2 FAC generation occurs in different plasma domains of the distant magnetosphere. The dawn and dusk FAC connection to the traditional Region 1 and Region 2 has only formal character, as FAC generating in various magnetospheric plasma domains integrate in the same region (Region 1 or Region 2. In the SSSL, there is anti-sunward convection; in the DAZ and the AO, there is the sunward convection. At PM latitudes, the convection is controlled by the azimuthal IMF component (By . It is suggested to extend the notation of the plasma pattern boundaries, as proposed by Newell et al. (1996, for the nightside sector of the auroral oval to the dawn sector.Key words. Magnetospheric physics (current systems; magnetospheric configuration and dynamics; plasma convection

  16. Structure of the auroral precipitation region in the dawn sector: relationship to convection reversal boundaries and field-aligned currents

    Directory of Open Access Journals (Sweden)

    Y. I. Feldstein

    electrons and isotropic ion precipitation (AO is mapped to the dawn periphery of the Central Plasma Sheet (CPS; the soft small scale structured precipitation (SSSL is mapped to the outer magnetosphere close to the magnetopause, i.e. the Low Latitude Boundary Layer (LLBL. In the near-noon sector, earthward fluxes of soft electrons, which cause the Diffuse Red Aurora (DRA, are observed. The ion energies decrease with increasing latitude. The plasma spectra of the DRA regime are analogous to the spectra of the Plasma Mantle (PM. In the dawn sector, the large-scale field-aligned currents flow into the ionosphere at the SSSL latitudes (Region 1 and flow out at the AO or DAZ latitudes (Region 2. In the dawn and dusk sectors, the large-scale Region 1 and Region 2 FAC generation occurs in different plasma domains of the distant magnetosphere. The dawn and dusk FAC connection to the traditional Region 1 and Region 2 has only formal character, as FAC generating in various magnetospheric plasma domains integrate in the same region (Region 1 or Region 2. In the SSSL, there is anti-sunward convection; in the DAZ and the AO, there is the sunward convection. At PM latitudes, the convection is controlled by the azimuthal IMF component (By . It is suggested to extend the notation of the plasma pattern boundaries, as proposed by Newell et al. (1996, for the nightside sector of the auroral oval to the dawn sector.

    Key words. Magnetospheric physics (current systems; magnetospheric configuration and dynamics; plasma convection

  17. The ASC Sequoia Programming Model

    Energy Technology Data Exchange (ETDEWEB)

    Seager, M

    2008-08-06

    In the late 1980's and early 1990's, Lawrence Livermore National Laboratory was deeply engrossed in determining the next generation programming model for the Integrated Design Codes (IDC) beyond vectorization for the Cray 1s series of computers. The vector model, developed in mid 1970's first for the CDC 7600 and later extended from stack based vector operation to memory to memory operations for the Cray 1s, lasted approximately 20 years (See Slide 5). The Cray vector era was deemed an extremely long lived era as it allowed vector codes to be developed over time (the Cray 1s were faster in scalar mode than the CDC 7600) with vector unit utilization increasing incrementally over time. The other attributes of the Cray vector era at LLNL were that we developed, supported and maintained the Operating System (LTSS and later NLTSS), communications protocols (LINCS), Compilers (Civic Fortran77 and Model), operating system tools (e.g., batch system, job control scripting, loaders, debuggers, editors, graphics utilities, you name it) and math and highly machine optimized libraries (e.g., SLATEC, and STACKLIB). Although LTSS was adopted by Cray for early system generations, they later developed COS and UNICOS operating systems and environment on their own. In the late 1970s and early 1980s two trends appeared that made the Cray vector programming model (described above including both the hardware and system software aspects) seem potentially dated and slated for major revision. These trends were the appearance of low cost CMOS microprocessors and their attendant, departmental and mini-computers and later workstations and personal computers. With the wide spread adoption of Unix in the early 1980s, it appeared that LLNL (and the other DOE Labs) would be left out of the mainstream of computing without a rapid transition to these 'Killer Micros' and modern OS and tools environments. The other interesting advance in the period is that systems were being developed with multiple 'cores' in them and called Symmetric Multi-Processor or Shared Memory Processor (SMP) systems. The parallel revolution had begun. The Laboratory started a small 'parallel processing project' in 1983 to study the new technology and its application to scientific computing with four people: Tim Axelrod, Pete Eltgroth, Paul Dubois and Mark Seager. Two years later, Eugene Brooks joined the team. This team focused on Unix and 'killer micro' SMPs. Indeed, Eugene Brooks was credited with coming up with the 'Killer Micro' term. After several generations of SMP platforms (e.g., Sequent Balance 8000 with 8 33MHz MC32032s, Allian FX8 with 8 MC68020 and FPGA based Vector Units and finally the BB&N Butterfly with 128 cores), it became apparent to us that the killer micro revolution would indeed take over Crays and that we definitely needed a new programming and systems model. The model developed by Mark Seager and Dale Nielsen focused on both the system aspects (Slide 3) and the code development aspects (Slide 4). Although now succinctly captured in two attached slides, at the time there was tremendous ferment in the research community as to what parallel programming model would emerge, dominate and survive. In addition, we wanted a model that would provide portability between platforms of a single generation but also longevity over multiple--and hopefully--many generations. Only after we developed the 'Livermore Model' and worked it out in considerable detail did it become obvious that what we came up with was the right approach. In a nutshell, the applications programming model of the Livermore Model posited that SMP parallelism would ultimately not scale indefinitely and one would have to bite the bullet and implement MPI parallelism within the Integrated Design Code (IDC). We also had a major emphasis on doing everything in a completely standards based, portable methodology with POSIX/Unix as the target environment. We decided against specialized libraries like STACKLIB for performance, but kept as many general purpose, portable math libraries as were needed by the codes. Third, we assumed that the SMPs in clusters would evolve in time to become more powerful, feature rich and, in particular, offer more cores. Thus, we focused on OpenMP, and POSIX PThreads for programming SMP parallelism. These code porting efforts were lead by Dale Nielsen, A-Division code group leader, and Randy Christensen, B-Division code group leader. Most of the porting effort revolved removing 'Crayisms' in the codes: artifacts of LTSS/NLTSS, Civic compiler extensions beyond Fortran77, IO libraries and dealing with new code control languages (we switched to Perl and later to Python). Adding MPI to the codes was initially problematic and error prone because the programmers used MPI directly and sprinkled the calls throughout the code.

  18. [Ginkgo biloba extract (EGb 761). State of knowledge in the dawn of the year 2000].

    Science.gov (United States)

    Clostre, F

    1999-07-01

    stress-alleviating action of EGb 761: its facilitates behavioral adaptation to stress and may decrease the excess of cortisol release to stress. Moreover, EGb 761 shows a specific neuroprotective effects to hippocampic cells. Regarding the visual system, experimental studies have shown that EGb 761 can inhibit or reduce the functional retinal impairments resulting from ischemia-reperfusion, photo-degeneration, diabetic or proliferative retinopathy. Clinical studies have revealed that EGb 761 may be useful in treating visual activity impairments and damages to the visual field associated with chronic cerebrovascular insufficiency, senile macular degeneration and diabete mellitus. Regarding the vestibular and auditory systems, experimental and clinical studies have shown the efficacy of EGb 761 in treating hypoacusis, tinnitus, vertigo, dizziness and other symptoms of vestibulocochlear disorders. At least, adequatly controlled studies in patients with peripheral arterial occlusive disease have provided good evidence for therapeutic efficacy in intermittent claudication. The future of EGb 761 is undoubtedly in the promise in slowing the progression of Alzheimer's disease. Indeed, two recent american clinical studies have shown the efficacy and safety of EGb 761 in patients with mild to severe Alzheimer's disease and multi-infarct dementia. In clinical terms, progression of symptoms was delayed by approximately 6 months. Actually new clinical studies are undertaken in USA and Europe. At the dawn of the third millenium (the Sixth for Ginkgo biloba) we propose a state of art about it.

  19. The Surface and Interior Evolution of Ceres Revealed by Analysis of Fractures and Secondary Crater Chains Using Dawn Data

    Science.gov (United States)

    Scully, J. E. C.; Buczkowski, D.; King, S. D.; Castillo, J. C.; Schmedemann, N.; Raymond, C. A.; O'Brien, D. P.; Marchi, S.; Russell, C. T.; Mitri, G.; Bland, M. T.

    2016-12-01

    Dawn is the first spacecraft to visit and orbit Ceres, a dwarf planet and the largest body in the asteroid belt (radius 470 km) (Russell et al., 2016). Previously, telescopic observations and thermal evolution modeling indicated Ceres was at least partially differentiated, with a density of 2,100 kg/m3 (e.g. Drummond et al., 2014; Castillo-Rogez & McCord, 2010). Moreover, models of crater retention predicted that pervasive viscous relaxation in a water-ice-rich outer layer could erase most surface features (Bland, 2013). However, a full understanding of Ceres' surface and interior evolution remained elusive until Dawn explored Ceres. Here we present a global geologic map of Ceres' ≥1 km wide linear features, which we interpret as: 1) the surface expression of subsurface fractures, and 2) secondary crater chains formed when material ejected during impact-crater formation impacts and scours the surface. The formation and preservation of these linear features indicate Ceres' outer layer is relatively strong, and not dominated by viscous relaxation as predicted (Buczkowski et al., 2016). The fractures (called the Samhain Catenae) give us insights into the interior. Based on a fracture spacing to fractured layer thickness ratio of 1 (Bai & Pollard, 2000), the spacing of the Samhain Catenae indicates that the outer, fractured layer is 88 km thick. Moreover, consistent with geodynamic modeling (King et al., 2016), we interpret the Samhain Catenae formed because of uplift and extension induced by an upwelling region. Unlike many cerean secondary crater chains, the Junina Catenae secondary crater chains are not radial to their source impact crater(s). On account of Ceres' fast rotation (period of 9 hours) and relatively small radius, modeling indicates that the Junina Catenae originated from the Urvara/Yalode impact craters, which are located in a different hemisphere. Our results show Ceres has different surface and interior characteristics than predicted, and underwent

  20. A Howardite-Eucrite-Diogenite (HED) Meteorite Compendium: Summarizing Samples of ASteroid 4 Vesta in Preparation for the Dawn Mission

    Science.gov (United States)

    Garber, J. M.; Righter, K.

    2011-01-01

    The Howardite-Eucrite-Diogenite (HED) suite of achondritic meteorites, thought to originate from asteroid 4 Vesta, has recently been summarized into a meteorite compendium. This compendium will serve as a guide for researchers interested in further analysis of HEDs, and we expect that interest in these samples will greatly increase with the planned arrival of the Dawn Mission at Vesta in August 2011. The focus of this abstract/poster is to (1) introduce and describe HED samples from both historical falls and Antarctic finds, and (2) provide information on unique HED samples available for study from the Antarctic Meteorite Collection at JSC, including the vesicular eucrite PCA91007, the olivine diogenite EETA79002, and the paired ALH polymict eucrites.

  1. Dawn of the electronic age electrical technologies in the shaping of the modern world 1914 to 1945

    CERN Document Server

    Nebeker, Frederik

    2009-01-01

    Much of the infrastructure of today's industrialized world arose in the period from the outbreak of World War I to the conclusion of World War II. It was during these years that the capabilities of traditional electrical engineering became ubiquitous. Even more importantly, it was during this time that a new type of electrical engineering--electronics--emerged. Because of its applications in communications, entertainment, industry, science and medicine, and the military, the electronics industry became a major part of the economy. Dawn of the Electronic Age explores how this engineering knowledge and its main applications developed in various scientific, economic, and social contexts, and explains how each was profoundly affected by electrical technologies. It takes an international perspective and a narrative approach, unfolding the story chronologically. --from publisher description.

  2. Constraints on Ceres' Internal Structure and Evolution From Its Shape and Gravity Measured by the Dawn Spacecraft

    Science.gov (United States)

    Ermakov, A. I.; Fu, R. R.; Castillo-Rogez, J. C.; Raymond, C. A.; Park, R. S.; Preusker, F.; Russell, C. T.; Smith, D. E.; Zuber, M. T.

    2017-11-01

    Ceres is the largest body in the asteroid belt with a radius of approximately 470 km. In part due to its large mass, Ceres more closely approaches hydrostatic equilibrium than major asteroids. Pre-Dawn mission shape observations of Ceres revealed a shape consistent with a hydrostatic ellipsoid of revolution. The Dawn spacecraft Framing Camera has been imaging Ceres since March 2015, which has led to high-resolution shape models of the dwarf planet, while the gravity field has been globally determined to a spherical harmonic degree 14 (equivalent to a spatial wavelength of 211 km) and locally to 18 (a wavelength of 164 km). We use these shape and gravity models to constrain Ceres' internal structure. We find a negative correlation and admittance between topography and gravity at degree 2 and order 2. Low admittances between spherical harmonic degrees 3 and 16 are well explained by Airy isostatic compensation mechanism. Different models of isostasy give crustal densities between 1,200 and 1,400 kg/m3 with our preferred model giving a crustal density of 1,287+70-87 kg/m3. The mantle density is constrained to be 2,434+5-8 kg/m3. We compute isostatic gravity anomaly and find evidence for mascon-like structures in the two biggest basins. The topographic power spectrum of Ceres and its latitude dependence suggest that viscous relaxation occurred at the long wavelengths (>246 km). Our density constraints combined with finite element modeling of viscous relaxation suggests that the rheology and density of the shallow surface are most consistent with a rock, ice, salt and clathrate mixture.

  3. The control of auroral zone dynamics and thermodynamics by the interplanetary magnetic field dawn-dusk (Y) component

    International Nuclear Information System (INIS)

    Sica, R.J.; Hernandez, G.; Emery, B.A.; Roble, R.G.; Smith, R.W.; Rees, M.H.

    1989-01-01

    Previous theoretical and experimental studies have shown that the dawn-dusk component of the interplanetary magnetic field (IMF B y ) expands the classical symmetric two-cell convection pattern toward dusk (B y negative) or toward dawn (B y positive) in the northern hemisphere, altering the ion drag forcing on the neutral atmosphere. Measurements of the neutral dynamics associated with these convection patterns have been presented primarily at magnetic latitudes greater than 70 degree in the polar cap. In this study, nights with coincident IMF measurements have been selected from the extensive four-year auroral zone thermospheric wind and temperature data set derived from Fabry-Perot spectrometer measurements of the Doppler shifts and widths of the O( 1 D) 15,867 cm -1 (630.0 nm) emission from College, Alaska. Averages from 112 nights of measurements from College were also computed using a selection criterion that depended on the previous 2 hours of IMF measurements (case 2). This procedure yielded averages that differed at times from case 1. The wind and temperature averages for both cases show large variations with B y in the auroral zone. The wind averages for B y negative and positive are compared with National Center for Atmospheric Research thermospheric general circulation model predictions that use a B y -dependent model of ionospheric convection. The results for B y negative and positive are compared with National Center for Atmospheric Research thermospheric general circulation model predictions that use a B y -dependent model of ionospheric convection. The results for B y negative compare favorably with the averages, but there are significant differences between model calculations and averages for the B y positive case

  4. Imaging the redshifted 21 cm pattern around the first sources during the cosmic dawn using the SKA

    Science.gov (United States)

    Ghara, Raghunath; Choudhury, T. Roy; Datta, Kanan K.; Choudhuri, Samir

    2017-01-01

    Understanding properties of the first sources in the Universe using the redshifted H I 21 cm signal is one of the major aims of present and upcoming low-frequency experiments. We investigate the possibility of imaging the redshifted 21 cm pattern around the first sources during the cosmic dawn using the SKA1-low. We model the H I 21 cm image maps, appropriate for the SKA1-low, around the first sources consisting of stars and X-ray sources within galaxies. In addition to the system noise, we also account for the astrophysical foregrounds by adding them to the signal maps. We find that after subtracting the foregrounds using a polynomial fit and suppressing the noise by smoothing the maps over 10-30 arcmin angular scale, the isolated sources at z ˜ 15 are detectable with the ˜4σ-9σ confidence level in 2000 h of observation with the SKA1-low. Although the 21 cm profiles around the sources get altered because of the Gaussian smoothing, the images can still be used to extract some of the source properties. We account for overlaps in the patterns of the individual sources by generating realistic H I 21 cm maps of the cosmic dawn that are based on N-body simulations and a one-dimensional radiative transfer code. We find that these sources should be detectable in the SKA1-low images at z = 15 with a signal-to-noise ratio (SNR) of ˜14(4) in 2000 (200) h of observations. One possible observational strategy thus could be to observe multiple fields for shorter observation times, identify fields with SNR ≳ 3 and observe these fields for much longer duration. Such observations are expected to be useful in constraining the parameters related to the first sources.

  5. Updates in the IR responsivity of VIR, the spectrometer of the Dawn mission.

    Science.gov (United States)

    Ammannito, Eleonora; Mc Cord, Thomas B.; De Sanctis, Maria Cristina.; Combe, Jean-Philippe

    VIR-MS (Visual and Infrared Mapping Spectrometer) is the imaging spectrometer of the Dawn mission (1,2). Here, first we describe the computation of a new instrument responsivity based on the internal calibration data acquired during the operations at Vesta, and then we describe its effect on the dataset and on the results published so far. VIR-MS was built in Italy by a scientific-industrial (IAPS/INAF in Rome (Italy) and Selex ES in Campi Bisenzio (Fi, Italy)) consortium financially supported by the Italian Space Agency. VIR-MS is an high spatial resolution spectrometer (FOV of 64mrad, IFOV of 250 µrad) in the 0.25-5 µm range with an IFOV of 250 µrad and a spectral sampling of about 2 nm in the visible range and 10 nm in the IR range. The results of the on-ground calibration held in the Selex calibration facility in September 2005 were already presented and discussed in a paper (2). This version has been used to calibrate the data available on the Planetary Data System (PDS) Small Bodies Node, dataset used in all the papers published so far. However, after the operations at the asteroid Vesta, we have identified some artifacts in the instrument responsivity in the 2.5-3.5 µm region, which is where several absorption bands of OH and H2O occur. Those artifacts were systematic, and therefore they did not prevent the detection of relative spectral variations associated to OH and H2O. Actually, the only paper published in which are discussed spectra in this range (3) used a different calibration method described in the paper itself. This method used a simple correction of the response function based on an empirical calibration correction that is appropriate to recover the signal in that specific range. However, the absolute absorption band depth of OH and H2O could not be calculated. To compute a new instrument responsivity we used the internal lamp of the spectrometer. This lamp, made of a tungsten filament, is characterized by a blackbody-like emission at about

  6. Impact of Time-Restricted Feeding and Dawn-to-Sunset Fasting on Circadian Rhythm, Obesity, Metabolic Syndrome, and Nonalcoholic Fatty Liver Disease

    Directory of Open Access Journals (Sweden)

    Ayse L. Mindikoglu

    2017-01-01

    Full Text Available Obesity now affects millions of people and places them at risk of developing metabolic syndrome, nonalcoholic fatty liver disease (NAFLD, and even hepatocellular carcinoma. This rapidly emerging epidemic has led to a search for cost-effective methods to prevent the metabolic syndrome and NAFLD as well as the progression of NAFLD to cirrhosis and hepatocellular carcinoma. In murine models, time-restricted feeding resets the hepatic circadian clock and enhances transcription of key metabolic regulators of glucose and lipid homeostasis. Studies of the effect of dawn-to-sunset Ramadan fasting, which is akin to time-restricted feeding model, have also identified significant improvement in body mass index, serum lipid profiles, and oxidative stress parameters. Based on the findings of studies conducted on human subjects, dawn-to-sunset fasting has the potential to be a cost-effective intervention for obesity, metabolic syndrome, and NAFLD.

  7. Impact of Time-Restricted Feeding and Dawn-to-Sunset Fasting on Circadian Rhythm, Obesity, Metabolic Syndrome, and Nonalcoholic Fatty Liver Disease

    Science.gov (United States)

    Gagan, Sood K.

    2017-01-01

    Obesity now affects millions of people and places them at risk of developing metabolic syndrome, nonalcoholic fatty liver disease (NAFLD), and even hepatocellular carcinoma. This rapidly emerging epidemic has led to a search for cost-effective methods to prevent the metabolic syndrome and NAFLD as well as the progression of NAFLD to cirrhosis and hepatocellular carcinoma. In murine models, time-restricted feeding resets the hepatic circadian clock and enhances transcription of key metabolic regulators of glucose and lipid homeostasis. Studies of the effect of dawn-to-sunset Ramadan fasting, which is akin to time-restricted feeding model, have also identified significant improvement in body mass index, serum lipid profiles, and oxidative stress parameters. Based on the findings of studies conducted on human subjects, dawn-to-sunset fasting has the potential to be a cost-effective intervention for obesity, metabolic syndrome, and NAFLD. PMID:29348746

  8. Dynamics and local boundary properties of the dawn-side magnetopause under conditions observed by Equator-S

    Directory of Open Access Journals (Sweden)

    M. W. Dunlop

    Full Text Available Magnetic field measurements, taken by the magnetometer experiment (MAM on board the German Equator-S spacecraft, have been used to identify and categorise 131 crossings of the dawn-side magnetopause at low latitude, providing unusual, long duration coverage of the adjacent magnetospheric regions and near magnetosheath. The crossings occurred on 31 orbits, providing unbiased coverage over the full range of local magnetic shear from 06:00 to 10:40 LT. Apogee extent places the spacecraft in conditions associated with intermediate, rather than low, solar wind dynamic pressure, as it processes into the flank region. The apogee of the spacecraft remains close to the magnetopause for mean solar wind pressure. The occurrence of the magnetopause encounters are summarised and are found to compare well with predicted boundary location, where solar wind conditions are known. Most scale with solar wind pressure. Magnetopause shape is also documented and we find that the magnetopause orientation is consistently sunward of a model boundary and is not accounted for by IMF or local magnetic shear conditions. A number of well-established crossings, particularly those at high magnetic shear, or exhibiting unusually high-pressure states, were observed and have been analysed for their boundary characteristics and some details of their boundary and near magnetosheath properties are discussed. Of particular note are the occurrence of mirror-like signatures in the adjacent magnetosheath during a significant fraction of the encounters and a high number of multiple crossings over a long time period. The latter is facilitated by the spacecraft orbit which is designed to remain in the near magnetosheath for average solar wind pressure. For most encounters, a well-ordered, tangential (draped magnetosheath field is observed and there is little evidence of large deviations in local boundary orientations. Two passes corresponding to close conjunctions of the Geotail spacecraft

  9. Photometric behavior of spectral parameters in Vesta dark and bright regions as inferred by the Dawn VIR spectrometer

    Science.gov (United States)

    Longobardo, Andrea; Palomba, Ernesto; Capaccioni, Fabrizio; De Sanctis, Maria Cristina; Tosi, Federico; Ammannito, Eleonora; Schröder, Stefan E.; Zambon, Francesca; Raymond, Carol A.; Russell, Christopher T.

    2014-09-01

    NASA’s Dawn spacecraft orbited Vesta for approximately one year, collecting thousands of hyperspectral images of its surface. The mission revealed that Vesta’s surface shows the largest variations in surface albedo on asteroids visited thus far, due to the presence of dark and bright materials at the local scale (i.e. 0.1-10 km). The aim of this work is to characterize the photometric properties of bright and dark regions, and thus derive and apply an empirical photometric correction to all the hyperspectral observations of Vesta. The very large dataset (i.e. more than 20 million spectra) provided by the VIR imaging spectrometer onboard Dawn enabled accurate statistical analysis of the spectral dataset, aimed at retrieving empirical relations between several spectral parameters (i.e. visible and infrared reflectance, band depths, band centers, Band Area Ratio) and the illumination/viewing angles. The derived relations made it possible to derive photometrically corrected maps of these spectral parameters and to infer information on the regolith shadowing effect in the Vestan dark and bright regions. As an additional analysis, we also evaluated the correlation between surface temperature and band center position. A general conclusion of this analysis is that, from a photometric point of view, the distinction between bright and dark material units lies mainly in the larger contribution due to multiple scattering in the bright units. We observed reflectance and band depth variations over Vesta’s entire surface, but these variations were much larger in the dark regions than in the bright ones. Band centers have been found to shift to longer wavelengths at increasing temperatures, with a trend that is the same observed for HED meteorites (Reddy et al. [2012]. Icarus 217, 153-158). Finally, the Band Area Ratio (i.e. the ratio between areas of the main pyroxene absorption bands located at 1.9 μm and at 0.9 μm, respectively) did not show any dependence on

  10. The Geology of the Marcia Quadrangle of Asteroid 4Vesta: An Integrated Mapping Study Using Dawn Spacecraft Data

    Science.gov (United States)

    Williams, David A.; Denevi, B. W.; Mittlefehldt, D. W.; Mest, S. C.; Schenk, P. M.; Jaumann, R.; DeSanctis, M. C.; Buczkowski, D. L.; Ammannito, E.; Prettyman, T. H.; hide

    2012-01-01

    We used geologic mapping applied to Dawn data as a tool to understand the geologic history of the Marcia quadrangle of Vesta. This region hosts a set of relatively fresh craters and surrounding ejecta field, an unusual dark hill named Arisia Tholus, and a orange (false color) diffuse material surrounding the crater Octavia. Stratigraphically, from oldest to youngest, three increasingly larger impact craters named Minucia, Calpurnia, and Marcia make up a snowmanlike feature, which is surrounded by a zone of dark material interpreted to consist of impact ejecta and possibly impact melts. The floor of Marcia contains a pitted terrain thought to be related to release of volatiles (1). The dark ejecta field has an enhanced signature of H, possibly derived from carbonaceous chondritic material that accumulated in Vesta s crust (2,3). The dark ejecta has a spectrally distinctive behavior with shallow pyroxenes band depths. Outside the ejecta field this quadrangle contains various cratered terrains, with increasing crater abundance moving south to north away from the Rheasilvia basin. Arisia Tholus, originally suggested as an ancient volcano, appears to be an impact-sculpted basin rim fragment with a superposed darkrayed impact crater. There remains no unequivocal evidence of volcanic features on Vesta s surface, likely because basaltic material of the HED meteorite suite demonstrates magmatism ended very early on Vesta (4). Ongoing work includes application of crater statistical techniques to obtain model ages of surface units, and more detailed estimates of the compositional variations among the surface units.

  11. An analysis of United States K-12 stem education versus STEM workforce at the dawn of the digital revolution

    Science.gov (United States)

    Cataldo, Franca

    The world is at the dawn of a third industrial revolution, the digital revolution, that brings great changes the world over. Today, computing devices, the Internet, and the World Wide Web are vital technology tools that affect every aspect of everyday life and success. While computing technologies offer enormous benefits, there are equally enormous safety and security risks that have been growing exponentially since they became widely available to the public in 1994. Cybercriminals are increasingly implementing sophisticated and serious hack attacks and breaches upon our nation's government, financial institutions, organizations, communities, and private citizens. There is a great need for computer scientists to carry America's innovation and economic growth forward and for cybersecurity professionals to keep our nation safe from criminal hacking. In this digital age, computer science and cybersecurity are essential foundational ingredients of technological innovation, economic growth, and cybersecurity that span all industries. Yet, America's K-12 education institutions are not teaching the computer science and cybersecurity skills required to produce a technologically-savvy 21st century workforce. Education is the key to preparing students to enter the workforce and, therefore, American K-12 STEM education must be reformed to accommodate the teachings required in the digital age. Keywords: Cybersecurity Education, Cybersecurity Education Initiatives, Computer Science Education, Computer Science Education Initiatives, 21 st Century K-12 STEM Education Reform, 21st Century Digital Literacies, High-Tech Innovative Problem-Solving Skills, 21st Century Digital Workforce, Standardized Testing, Foreign Language and Culture Studies, Utica College, Professor Chris Riddell.

  12. Dawn-dusk asymmetries and sub-Alfvénic flow in the high and low latitude magnetosheath

    Directory of Open Access Journals (Sweden)

    M. Longmore

    2005-11-01

    Full Text Available We present the results of a statistical survey of the magnetosheath using four years of Cluster orbital coverage. Moments of the plasma distribution obtained from the electron and ion instruments together with magnetic field data are used to characterise the flow and density in the magnetosheath. We note two important differences between our survey and the gasdynamic model predictions: a deceleration of the flow at higher latitudes close to the magnetopause, resulting in sub-Alfvénic flow near the cusp, and a dawn-dusk asymmetry with higher velocity magnitudes and lower densities measured on the dusk side of the magnetosheath in the Northern Hemisphere. The latter observation is in agreement with studies carried out by Paularena et al. (2001, Němeček et al. (2000, and Šafránková et al. (2004. In equations of hydrodynamics for a single-component additon to this we observe a reverse of this asymmetry for the Southern Hemisphere. High-latitude sub-Alfvénic flow is thought to be a necessary condition for steady state reconnection pole-ward of the cusp.

  13. Incidence of Mental Health Diagnoses in Veterans of Operations Iraqi Freedom, Enduring Freedom, and New Dawn, 2001-2014.

    Science.gov (United States)

    Ramsey, Christine; Dziura, James; Justice, Amy C; Altalib, Hamada Hamid; Bathulapalli, Harini; Burg, Matthew; Decker, Suzanne; Driscoll, Mary; Goulet, Joseph; Haskell, Sally; Kulas, Joseph; Wang, Karen H; Mattocks, Kristen; Brandt, Cynthia

    2017-02-01

    To evaluate gender, age, and race/ethnicity as predictors of incident mental health diagnoses among Operations Iraqi Freedom, Enduring Freedom, and New Dawn veterans. We used US Veterans Health Administration (VHA) electronic health records from 2001 to 2014 to examine incidence rates and sociodemographic risk factors for mental health diagnoses among 888 142 veterans. Posttraumatic stress disorder (PTSD) was the most frequently diagnosed mental health condition across gender and age groups. Incidence rates for all mental health diagnoses were highest at ages 18 to 29 years and declined thereafter, with the exceptions of major depressive disorder (MDD) in both genders, and PTSD among women. Risk of incident bipolar disorder and MDD diagnoses were greater among women; risk of incident schizophrenia, and alcohol- and drug-use disorders diagnoses were greater in men. Compared with Whites, risk incident PTSD, MDD, and alcohol-use disorder diagnoses were lower at ages 18 to 29 years and higher at ages 45 to 64 years for both Hispanics and African Americans. Differentiating high-risk demographic and gender groups can lead to improved diagnosis and treatment of mental health diagnoses among veterans and other high-risk groups.

  14. Modeling the Radio Foreground for Detection of CMB Spectral Distortions from the Cosmic Dawn and the Epoch of Reionization

    Energy Technology Data Exchange (ETDEWEB)

    Sathyanarayana Rao, Mayuri; Subrahmanyan, Ravi; Shankar, N Udaya [Raman Research Institute, C V Raman Avenue, Sadashivanagar, Bangalore 560080 (India); Chluba, Jens, E-mail: mayuris@rri.res.in [Jodrell Bank Centre for Astrophysics, University of Manchester, Oxford Road, M13 9PL (United Kingdom)

    2017-05-01

    Cosmic baryon evolution during the Cosmic Dawn and Reionization results in redshifted 21-cm spectral distortions in the cosmic microwave background (CMB). These encode information about the nature and timing of first sources over redshifts 30–6 and appear at meter wavelengths as a tiny CMB distortion along with the Galactic and extragalactic radio sky, which is orders of magnitude brighter. Therefore, detection requires precise methods to model foregrounds. We present a method of foreground fitting using maximally smooth (MS) functions. We demonstrate the usefulness of MS functions over traditionally used polynomials to separate foregrounds from the Epoch of Reionization (EoR) signal. We also examine the level of spectral complexity in plausible foregrounds using GMOSS, a physically motivated model of the radio sky, and find that they are indeed smooth and can be modeled by MS functions to levels sufficient to discern the vanilla model of the EoR signal. We show that MS functions are loss resistant and robustly preserve EoR signal strength and turning points in the residuals. Finally, we demonstrate that in using a well-calibrated spectral radiometer and modeling foregrounds with MS functions, the global EoR signal can be detected with a Bayesian approach with 90% confidence in 10 minutes’ integration.

  15. US ethnic group differences in self-management in the 2nd diabetes attitudes, wishes and needs (DAWN2) study.

    Science.gov (United States)

    Peyrot, Mark; Egede, Leonard E; Funnell, Martha M; Hsu, William C; Ruggiero, Laurie; Siminerio, Linda M; Stuckey, Heather L

    2018-03-08

    Understanding the relationship between ethnicity and self-management is important due to disparities in healthcare access, utilization, and outcomes among adults with type 2 diabetes from different ethnic groups in the US. Self-reports of self-management and interest in improving self-management from US people with diabetes (PWD) in the 2nd Diabetes Attitudes, Wishes and Needs (DAWN2) study, a multinational, multi-stakeholder survey, were analyzed, including 447 non-Hispanic White, 241 African American, 194 Hispanic American, and 173 Chinese American PWD (>18 years). Overall, self-management behavior was highest for medication taking and lowest for physical activity. Non-Hispanic Whites had lowest physical activity and highest adherence to insulin therapy. Chinese Americans had lowest foot care and highest healthy eating. Overall, interest was highest for improving healthy eating and physical activity. Chinese Americans and Hispanic Americans were more interested than non-Hispanic Whites in improving most self-management behaviors. Chinese Americans were more interested than African Americans in improving most self-management behaviors. Healthcare providers telling PWD that their A1c needs improvement was associated with lower self-rated glucose control, which was associated with higher PWD interest in improving self-management behaviors. Diabetes care providers should use patient-centered approaches and consider ethnicity in tailoring self-management support. Copyright © 2017 The Authors. Published by Elsevier Inc. All rights reserved.

  16. Surface mapping via unsupervised classification of remote sensing: application to MESSENGER/MASCS and DAWN/VIRS data.

    Science.gov (United States)

    D'Amore, M.; Le Scaon, R.; Helbert, J.; Maturilli, A.

    2017-12-01

    Machine-learning achieved unprecedented results in high-dimensional data processing tasks with wide applications in various fields. Due to the growing number of complex nonlinear systems that have to be investigated in science and the bare raw size of data nowadays available, ML offers the unique ability to extract knowledge, regardless the specific application field. Examples are image segmentation, supervised/unsupervised/ semi-supervised classification, feature extraction, data dimensionality analysis/reduction.The MASCS instrument has mapped Mercury surface in the 400-1145 nm wavelength range during orbital observations by the MESSENGER spacecraft. We have conducted k-means unsupervised hierarchical clustering to identify and characterize spectral units from MASCS observations. The results display a dichotomy: a polar and equatorial units, possibly linked to compositional differences or weathering due to irradiation. To explore possible relations between composition and spectral behavior, we have compared the spectral provinces with elemental abundance maps derived from MESSENGER's X-Ray Spectrometer (XRS).For the Vesta application on DAWN Visible and infrared spectrometer (VIR) data, we explored several Machine Learning techniques: image segmentation method, stream algorithm and hierarchical clustering.The algorithm successfully separates the Olivine outcrops around two craters on Vesta's surface [1]. New maps summarizing the spectral and chemical signature of the surface could be automatically produced.We conclude that instead of hand digging in data, scientist could choose a subset of algorithms with well known feature (i.e. efficacy on the particular problem, speed, accuracy) and focus their effort in understanding what important characteristic of the groups found in the data mean. [1] E Ammannito et al. "Olivine in an unexpected location on Vesta's surface". In: Nature 504.7478 (2013), pp. 122-125.

  17. Persistent pain and comorbidity among Operation Enduring Freedom/Operation Iraqi Freedom/operation New Dawn veterans.

    Science.gov (United States)

    Higgins, Diana M; Kerns, Robert D; Brandt, Cynthia A; Haskell, Sally G; Bathulapalli, Harini; Gilliam, Wesley; Goulet, Joseph L

    2014-05-01

    Chronic pain is a significant concern for the Veterans Health Administration (VHA), with chronic pain conditions among those most frequently reported by Operation Enduring Freedom (OEF)/Operation Iraqi Freedom (OIF)/Operation New Dawn (OND) veterans. The current study examined VHA electronic medical record data to examine variation in demographics and high prevalence and high impact medical and mental health conditions in order to characterize the differences between patients with persistent pain and no pain. A conservative operational definition of chronic or "persistent pain" based on multiple indicators of pain (i.e., pain intensity ratings, prescription opioids, pain clinic visits, International Classification of Diseases, Ninth Revision codes) was employed. Analyses included the entire roster of longitudinal clinical data on OEF/OIF/OND veterans who used VHA care to compare those with persistent pain with those with no clinical evidence of pain. Results of logistic regression models suggest that sex, race, education, military variables, body mass index (BMI), traumatic brain injury (TBI), and mental health conditions, but not age, reliably discriminate the two groups. Those with persistent pain were more likely to be Black, female, on active duty, enlisted, Army service members, have a high school education or less, and have diagnoses of mood disorders, post-traumatic stress disorder, substance use disorders, anxiety disorders, TBI, and have a BMI consistent with overweight and obesity. The operational definition of chronic pain used in this study may have research implications for examining predictors of incident and chronic pain. These data have important clinical implications in that addressing comorbid conditions of persistent pain may improve adaptive coping and functioning in these patients. Wiley Periodicals, Inc.

  18. SVD/MCMC Data Analysis Pipeline for Global Redshifted 21-cm Spectrum Observations of the Cosmic Dawn and Dark Ages

    Science.gov (United States)

    Burns, Jack O.; Tauscher, Keith; Rapetti, David; Mirocha, Jordan; Switzer, Eric

    2018-01-01

    We have designed a complete data analysis pipeline for constraining Cosmic Dawn physics using sky-averaged spectra in the VHF range (40-200 MHz) obtained either from the ground (e.g., the Experiment to Detect Global Epoch of Reionization Signal, EDGES; and the Cosmic Twilight Polarimeter, CTP) or from orbit above the lunar farside (e.g., the Dark Ages Radio Explorer, DARE). In the case of DARE, we avoid Earth-based RFI, ionospheric effects, and radio solar emissions (when observing at night). To extract the 21-cm spectrum, we parametrize the cosmological signal and systematics with two separate sets of modes defined through Singular Value Decomposition (SVD) of training set curves. The training set for the 21-cm spin-flip brightness temperatures is composed of theoretical models of the first stars, galaxies and black holes created by varying physical parameters within the ares code. The systematics training set is created using sky and beam data to model the beam-weighted foregrounds (which are about four orders of magnitude larger than the signal) as well as expected lab data to model receiver systematics. To constrain physical parameters determining the 21-cm spectrum, we apply to the extracted signal a series of consecutive fitting techniques including two usages of a Markov Chain Monte Carlo (MCMC) algorithm. Importantly, our pipeline efficiently utilizes the significant differences between the foreground and the 21-cm signal in spatial and spectral variations. In addition, it incorporates for the first time polarization data, dramatically improving the constraining power. We are currently validating this end-to-end pipeline using detailed simulations of the signal, foregrounds and instruments. This work was directly supported by the NASA Solar System Exploration Research Virtual Institute cooperative agreement number 80ARC017M0006 and funding from the NASA Ames Research Center cooperative agreement NNX16AF59G.

  19. A Vortical Dawn Flank Boundary Layer for Near-Radial IMF: Wind Observations on 24 October 2001

    Science.gov (United States)

    Farrugia, C. J.; Gratton, F. T.; Gnavi, G.; Torbert, R. B.; Wilson, Lynn B., III

    2014-01-01

    We present an example of a boundary layer tailward of the dawn terminator which is entirely populated by rolled-up flow vortices. Observations were made by Wind on 24 October 2001 as the spacecraft moved across the region at the X plane approximately equal to -13 Earth radii. Interplanetary conditions were steady with a near-radial interplanetary magnetic field (IMF). Approximately 15 vortices were observed over the 1.5 hours duration of Wind's crossing, each lasting approximately 5 min. The rolling up is inferred from the presence of a hot tenuous plasma being accelerated to speeds higher than in the adjoining magnetosheath, a circumstance which has been shown to be a reliable signature of this in single-spacecraft observations. A blob of cold dense plasma was entrained in each vortex, at whose leading edge abrupt polarity changes of field and velocity components at current sheets were regularly observed. In the frame of the average boundary layer velocity, the dense blobs were moving predominantly sunward and their scale size along the X plane was approximately 7.4 Earth radii. Inquiring into the generation mechanism of the vortices, we analyze the stability of the boundary layer to sheared flows using compressible magnetohydrodynamic Kelvin-Helmholtz theory with continuous profiles for the physical quantities. We input parameters from (i) the exact theory of magnetosheath flow under aligned solar wind field and flow vectors near the terminator and (ii) the Wind data. It is shown that the configuration is indeed Kelvin-Helmholtz (KH) unstable. This is the first reported example of KH-unstable waves at the magnetopause under a radial IMF.

  20. The INTERBALL-Tail ELECTRON experiment: initial results on the low-latitude boundary layer of the dawn magnetosphere

    Directory of Open Access Journals (Sweden)

    J.-A. Sauvaud

    Full Text Available The Toulouse electron spectrometer flown on the Russian project INTERBALL-Tail performs electron measurements from 10 to 26 000 eV over a 4 solid angle in a satellite rotation period. The INTERBALL-Tail probe was launched on 3 August 1995 together with a subsatellite into a 65° inclination orbit with an apogee of about 30 RE. The INTERBALL mission also includes a polar spacecraft launched in August 1996 for correlated studies of the outer magnetosphere and of the auroral regions. We present new observations concerning the low-latitude boundary layers (LLBL of the magnetosphere obtained near the dawn magnetic meridian. LLBL are encountered at the interface between two plasma regimes, the magnetosheath and the dayside extension of the plasma sheet. Unexpectedly, the radial extent of the region where LLBL electrons can be sporadically detected as plasma clouds can reach up to 5 RE inside the magnetopause. The LLBL core electrons have an average energy of the order of 100 eV and are systematically field-aligned and counterstreaming. As a trend, the temperature of the LLBL electrons increases with decreasing distance to Earth. Along the satellite orbit, the apparent time of occurrence of LLBL electrons can vary from about 5 to 20 min from one pass to another. An initial first comparison between electron- and magnetic-field measurements indicates that the LLBL clouds coincide with a strong increase in the magnetic field (by up to a factor of 2. The resulting strong magnetic field gradient can explain why the plasma-sheet electron flux in the keV range is strongly depressed in LLBL occurrence regions (up to a factor of sim10. We also show that LLBL electron encounters are related to field-aligned current structures and that wide LLBL correspond to northward interplanetary magnetic field. Evidence for LLBL/plasma-sheet electron leakage into the magnetosheath during southward IMF is also presented.

  1. mobile Digital Access to a Web-enhanced Network (mDAWN): Assessing the Feasibility of Mobile Health Tools for Self-Management of Type-2 Diabetes.

    Science.gov (United States)

    Ho, Kendall; Newton, Lana; Boothe, Allison; Novak-Lauscher, Helen

    2015-01-01

    The mobile Digital Access to a Web-enhanced Network (mDAWN) program was implemented as an online, mobile self-management system to support patients with type-2 diabetes and their informal caregivers. Patients used wireless physiological sensors, received text messages, and had access to a secure web platform with health resources and semi-facilitated discussion forum. Outcomes were evaluated using (1) pre and post self-reported health behavior measures, (2) physiological outcomes, (3) program cost, and (4) in-depth participant interviews. The group had significantly decreased health distress, HbA1c levels, and systolic blood pressure. Participants largely saw the mDAWN as providing good value for the costs involved and found the program to be empowering in gaining control over their diabetes. mHealth programs have the potential to improve clinical outcomes through cost effective patient-led care for chronic illness. Further evaluation needs to examine integration of similar mHealth programs into the patient-physician relationship.

  2. Dawn of Science

    Indian Academy of Sciences (India)

    Bible took the elaborate precaution of counting the total number of letters at the end of copying!) Gutenberg's genius was in realising that by producing a series of small and durable metallic seals, each representing a single letter, printing could be made much more efficient. The letters can be assembled to form a page and ...

  3. Dawn of Science

    Indian Academy of Sciences (India)

    Copernicus realised that his model could explain several things, which Ptolemy ... dedicated to Pope Paul III in order to pre-empt opposition from the Church. ... It was then rather strange to think that the Sun was going round the. Earth instead ...

  4. Dawn of Science

    Indian Academy of Sciences (India)

    2016-08-26

    Aug 26, 2016 ... Home; Journals; Resonance – Journal of Science Education; Volume 17; Issue 2 ... email addresses used by the office of Indian Academy of Sciences, including those of the staff, the journals, various programmes, and Current Science, has changed from 'ias.ernet.in' (or 'academy.ias.ernet.in') to 'ias.ac.in'.

  5. Undermining Patriarchal Ideology in African Literature: A Study of Ngozi Chuma-Udeh’s Echoes of a New Dawn

    Directory of Open Access Journals (Sweden)

    Ujowundu Cornel O.

    2013-11-01

    s sexual passion; and worst of all, not consulted in the decision making processes in their communities. The women as wives are expected to be submissive, obedient, unquestioning and servile while any challenge to these attributes attracts social disfavour. So the clearly defined roles for women are passed on to the girl-child as she grows. As soon as she is able to do things for herself, she starts assuming the roles society has mapped out for her: learning how to cook, care for the home, helping with everything else the mother does, and preparing for womanhood and matrimony. This paper, therefore, takes a critical look into Ngozi Chuma-Udeh’s novel that advocates a new dawn for the women. The novelist wants the men to reconsider their negative notions about women and to also appreciate their contributions in the well-being of their societies, their families and the upbringing of the children.

  6. The penalty of a long, hot summer. Photosynthetic acclimation to high CO2 and continuous light in "living fossil" conifers.

    Science.gov (United States)

    Osborne, Colin P; Beerling, David J

    2003-10-01

    Deciduous forests covered the ice-free polar regions 280 to 40 million years ago under warm "greenhouse" climates and high atmospheric pCO2. Their deciduous habit is frequently interpreted as an adaptation for minimizing carbon losses during winter, but experiments with "living fossils" in a simulated warm polar environment refute this explanation. Measured carbon losses through leaf abscission of deciduous trees are significantly greater than losses through winter respiration in evergreens, yet annual rates of primary productivity are similar in all species. Here, we investigate mechanisms underlying this apparent paradox by measuring the seasonal patterns of leaf photosynthesis (A) under pCO2 enrichment in the same trees. During spring, A increased significantly in coastal redwood (Sequoia sempervirens), dawn redwood (Metasequoia glyptostroboides), and swamp cypress (Taxodium distichum) at an elevated pCO2 of 80 Pa compared with controls at 40 Pa. However, strong acclimation in Rubisco carboxylation capacity (Vc,max) completely offset the CO2 response of A in all species by the end of 6 weeks of continuous illumination in the simulated polar summer. Further measurements demonstrated the temporary nature of acclimation, with increases in Vc,max during autumn restoring the CO2 sensitivity of A. Contrary to expectations, the acclimation of Vc,max was not always accompanied by accumulation of leaf carbohydrates, but was associated with a decline in leaf nitrogen in summer, suggesting an alteration of the balance in plant sources and sinks for carbon and nitrogen. Preliminary calculations using A indicated that winter carbon losses through deciduous leaf abscission and respiration were recovered by 10 to 25 d of canopy carbon fixation during summer, thereby explaining the productivity paradox.

  7. The Penalty of a Long, Hot Summer. Photosynthetic Acclimation to High CO2 and Continuous Light in “Living Fossil” Conifers1

    Science.gov (United States)

    Osborne, Colin P.; Beerling, David J.

    2003-01-01

    Deciduous forests covered the ice-free polar regions 280 to 40 million years ago under warm “greenhouse” climates and high atmospheric pCO2. Their deciduous habit is frequently interpreted as an adaptation for minimizing carbon losses during winter, but experiments with “living fossils” in a simulated warm polar environment refute this explanation. Measured carbon losses through leaf abscission of deciduous trees are significantly greater than losses through winter respiration in evergreens, yet annual rates of primary productivity are similar in all species. Here, we investigate mechanisms underlying this apparent paradox by measuring the seasonal patterns of leaf photosynthesis (A) under pCO2 enrichment in the same trees. During spring, A increased significantly in coastal redwood (Sequoia sempervirens), dawn redwood (Metasequoia glyptostroboides), and swamp cypress (Taxodium distichum) at an elevated pCO2 of 80 Pa compared with controls at 40 Pa. However, strong acclimation in Rubisco carboxylation capacity (Vc,max) completely offset the CO2 response of A in all species by the end of 6 weeks of continuous illumination in the simulated polar summer. Further measurements demonstrated the temporary nature of acclimation, with increases in Vc,max during autumn restoring the CO2 sensitivity of A. Contrary to expectations, the acclimation of Vc,max was not always accompanied by accumulation of leaf carbohydrates, but was associated with a decline in leaf nitrogen in summer, suggesting an alteration of the balance in plant sources and sinks for carbon and nitrogen. Preliminary calculations using A indicated that winter carbon losses through deciduous leaf abscission and respiration were recovered by 10 to 25 d of canopy carbon fixation during summer, thereby explaining the productivity paradox. PMID:12972654

  8. A new dawn for the naming of fungi: impacts of decisions made in Melbourne in July 2011 on the future publication and regulation of fungal names

    Directory of Open Access Journals (Sweden)

    David Hawksworth

    2011-09-01

    Full Text Available A personal synopsis of the decisions made at the Nomenclature Section meeting of the International Botanical Congress in Melbourne in July 2011 is provided, with an emphasis on those which will affect the working practices of, or will otherwise be of interest to, mycologists. The topics covered include the re-naming of the Code, the acceptance of English as an alternative to Latin for validating diagnoses, conditions for permitting electronic publication of names, mandatory deposit of key nomenclatural information in a recognized repository for the valid publication of fungal names, the discontinuance of dual nomenclature for pleomorphic fungi, and clarification over the typification of sanctioned names, and acceptability of names originally published under the zoological code. Collectively, these changes are the most fundamental to have been enacted at single Congress since the 1950s, and herald the dawn of a new era in the practice of fungal nomenclature.

  9. Dawn-dusk asymmetry induced by the Parker spiral angle in the plasma dynamics around comet 67P/Churyumov-Gerasimenko

    Science.gov (United States)

    Behar, E.; Tabone, B.; Nilsson, H.

    2018-05-01

    When interacting, the solar wind and the ionised atmosphere of a comet exchange energy and momentum. Our aim is to understand the influence of the average Parker spiral configuration of the solar wind magnetic field on this interaction. We compare the theoretical expectations of an analytical generalised gyromotion with Rosetta observations at comet 67P/Churyumov-Gerasimenko. A statistical approach allows one to overcome the lack of upstream solar wind measurement. We find that additionally to their acceleration along (for cometary pick-up ions) or against (for solar wind ions) the upstream electric field orientation and sense, the cometary pick-up ions are drifting towards the dawn side of the coma, while the solar wind ions are drifting towards the dusk side of the coma, independent of the heliocentric distance. The dynamics of the interaction is not taking place in a plane, as often assumed in previous works.

  10. Evidence of sub-optimal sleep in adolescent Middle Eastern academy soccer players which is exacerbated by sleep intermission proximal to dawn.

    Science.gov (United States)

    Fowler, Peter M; Paul, Darren J; Tomazoli, Gustavo; Farooq, Abdulaziz; Akenhead, Richard; Taylor, Lee

    2017-10-01

    The purpose was to assess sleep patterns, quantity and quality in adolescent (16.2 ± 1.2 yr) Middle Eastern academy soccer players (n = 20) and the influence of an intermission upon these characteristics. On a 17-day training camp (located one time zone west of home) including three discrete matches, sleep was assessed pre- (PRE) and post-match (POST) via wrist actigraphy. Retrospective actigraphy analysis identified sleep characteristics, including if players experienced a sleep intermission (YES) or not (NO) proximal to dawn, and bedtime (hh:mm), get-up time (hh:mm), time in bed (h), sleep duration (h) and sleep efficiency (%). Within YES two bouts were identified (BOUT1 and BOUT2). No differences were seen between PRE and POST, nor between BOUT1 and BOUT2 (p > .05). Overall players did not meet National Sleep Foundation (NSF) guidelines (7:04 ± 1:16 h vs. recommended 8-10 h for 14-17 yr). Sleep duration was significantly reduced (∼ -13% or -1:06) in YES compared to NO (6:33 ± 1:05 vs. 7:29 ± 1:17, p sleep durations relative to NSF guidelines, with decrements increased by an intermission proximal to dawn. High inter- and intra-individual variance in the players sleep characteristics indicates the need for individualized sleep education strategies and interventions to promote appropriate sleep.

  11. Unique bioactive polyphenolic profile of guava (Psidium guajava) budding leaf tea is related to plant biochemistry of budding leaves in early dawn.

    Science.gov (United States)

    Chang, Chi-Huang; Hsieh, Chiu-Lan; Wang, Hui-Er; Peng, Chiung-Chi; Chyau, Charng-Cherng; Peng, Robert Y

    2013-03-15

    Guava leaf tea (GLT), exhibiting a diversity of medicinal bioactivities, has become a popularly consumed daily beverage. To improve the product quality, a new process was recommended to the Ser-Tou Farmers' Association (SFA), who began field production in 2005. The new process comprised simplified steps: one bud-two leaves were plucked at 3:00-6:00 am, in the early dawn period, followed by withering at ambient temperature (25-28 °C), rolling at 50 °C for 50-70 min, with or without fermentation, then drying at 45-50 °C for 70-90 min, and finally sorted. The product manufactured by this new process (named herein GLTSF) exhibited higher contents (in mg g(-1), based on dry ethyl acetate fraction/methanolic extract) of polyphenolics (417.9 ± 12.3) and flavonoids (452.5 ± 32.3) containing a compositional profile much simpler than previously found: total quercetins (190.3 ± 9.1), total myricetin (3.3 ± 0.9), total catechins (36.4 ± 5.3), gallic acid (8.8 ± 0.6), ellagic acid (39.1 ± 6.4) and tannins (2.5 ± 9.1). We have successfully developed a new process for manufacturing GLTSF with a unique polyphenolic profile. Such characteristic compositional distribution can be ascribed to the right harvesting hour in the early dawn and appropriate treatment process at low temperature, avoiding direct sunlight. © 2012 Society of Chemical Industry.

  12. An exploration of barriers to insulin initiation for physicians in Japan: findings from the Diabetes Attitudes, Wishes And Needs (DAWN JAPAN study.

    Directory of Open Access Journals (Sweden)

    Hitoshi Ishii

    Full Text Available OBJECTIVE: Insulin is recommended as an appropriate treatment in type 2 diabetes patients with suboptimal glycemic control; however, its initiation is often delayed. We therefore conducted the DAWN (Diabetes Attitudes, Wishes and Needs JAPAN study in an attempt to identify specific patient- and physician-related factors which contribute to delay of insulin initiation among Japanese patients with diabetes. In this report, we explored barriers for physicians which prevent timely insulin initiation. METHODS: The DAWN JAPAN study is a multicenter, questionnaire-based survey, conducted between 2004 and 2005. Participating physicians were categorized as follows based on their expertise: Japan Diabetes Society (JDS certified specialists (n = 77, JDS-affiliated physicians (n = 30, and non-JDS-affiliated physicians (n = 27. To assess physician barriers to insulin initiation, we have used a newly developed 27- item questionnaire. RESULTS: The mean age of patients (n = 11,656 treated by participating physicians was 64.1 years. The mean duration of diabetes was 121.6 months, and their mean HbA1c was 7.5%. Insulin was used in 27.4% of total patients. With regard to physician barriers to insulin initiation, the biggest differences in concerns expressed by JDS-certified specialists and non-JDS-affiliated physicians were observed in the following items with statistical significance: "I do not have staff (nurse, pharmacists who can assist with explanations" (1.3% vs 55.5%, respectively, "I have concerns about the use of insulin therapy in elderly patients" (38.1% vs 81.5%, and "It is difficult to provide guidance and education on insulin injection to patients" (16.9% vs 55.5%. The mean HbA1c at which physicians responded they would recommend insulin to their patients was 8.7%; however, they would reduce this level to 8.2% if they themselves required insulin. CONCLUSIONS: Our results demonstrated that physicians have concerns about insulin use, and suggested that

  13. An examination of the roles of trauma exposure and posttraumatic stress disorder on emotion regulation strategies of Operation Iraqi Freedom, Operation Enduring Freedom, and Operation New Dawn veterans.

    Science.gov (United States)

    Sippel, Lauren M; Roy, Alicia M; Southwick, Steven M; Fichtenholtz, Harlan M

    2016-09-01

    Theories of posttraumatic stress disorder (PTSD) implicate emotional processes, including difficulties utilizing adaptive emotion regulation strategies, as critical to the etiology and maintenance of PTSD. Operation Iraqi Freedom, Operation Enduring Freedom, and Operation New Dawn (OIF/OEF/OND) veterans report high levels of combat exposure and PTSD. We aimed to extend findings suggesting that emotion regulation difficulties are a function of PTSD, rather than combat trauma exposure or common comorbidities, to OIF/OEF/OND veterans, in order to inform models of PTSD risk and recovery that can be applied to returning veterans. We tested differences in emotion regulation, measured with the Difficulties in Emotion Regulation Scale and Emotion Regulation Questionnaire, among trauma-exposed veterans with (n = 24) or without PTSD (n = 22) and healthy civilian comparison participants (n = 27) using multivariate analyses of covariance, adjusting for major depressive disorder, anxiety disorders, and demographic variables (age, sex, and ethnicity). Veterans with PTSD reported more use of expressive suppression and more difficulties with emotion regulation than veterans without PTSD and healthy comparison participants. Groups did not differ on cognitive reappraisal. Findings suggest the key role of PTSD above and beyond trauma exposure, depression, and anxiety in specific aspects of emotion dysregulation among OIF/OEF/OND veterans. Interventions that help veterans expand and diversify their emotion regulation skills may serve as helpful adjunctive treatments for PTSD among OIF/OEF/OND veterans.

  14. Stephen S. Wise and the Urban Frontier: American Jewish Life in New York and the Pacific Northwest at the Dawn of the 20th Century

    Directory of Open Access Journals (Sweden)

    Mark A. Raider

    2011-10-01

    Full Text Available The case of Stephen S. Wise provides a lens through which to examine American Jewry’s transformation at the dawn of the 20th century. Not only were New York City and Portland, Oregon – places Wise called home – two geographic poles of America’s urban frontier, they also highlight a spectrum of possibilities available to the New World’s fledgling Jewish community. Viewed in tandem, they illustrate American society’s raw, open, and pliable terrain as it emerged from a rural pre-industrial past. Moreover, by placing Wise in the context of the metropolitan growth that reshaped the Atlantic and Pacific frontiers in the late 19th century, we gain a better understanding of the relationship between the country’s dynamic environmental conditions and the phenomenon of Jewish immigrant absorption, acculturation, and Americanization.In withdrawing to the wilderness, Wise exposed himself to new possibilities for thinking about the place of Jews in American society and the future of American Judaism. He also honed the role of which he was to become a superlative exemplar – a 20th-century American rabbi at home in the worlds of religion and politics. Furthermore, his synthesis of liberal Judaism, American pluralism, Zionism, and Progressive-era notions of social justice anticipated the rise of a new American Jewish sensibility that would become normative in the 20th century.

  15. Ethnic differences in family member diabetes involvement and psychological outcomes: results from the second Diabetes Attitudes, Wishes and Needs (DAWN2) study in the USA.

    Science.gov (United States)

    Peyrot, Mark; Egede, Leonard E; Funnell, Martha M; Hsu, William C; Ruggiero, Laurie; Siminerio, Linda M; Stuckey, Heather L

    2015-01-01

    To assess differences among USA ethnic groups in psychological status of adult family members (FMs) and their involvement with the diabetes of another adult. Data are from the FM survey of the USA DAWN2 study, including 105 White non-Hispanics, 47 African Americans, 46 Hispanic Americans and 40 Chinese Americans. All FMs lived with and cared for an adult with diabetes. Analysis of covariance controlled for respondent and patient characteristics to assess ethnic group differences (P ethnic minority groups. African Americans reported the highest well-being and lowest negative life impact, Chinese Americans reported the most diabetes burden, Hispanic Americans reported the highest distress. There were no ethnic group differences in QoL. Ethnic minority FMs reported having more involvement with diabetes, greater support success, and more access to a diabetes support network than White non-Hispanics. Higher FM diabetes involvement was associated with negative psychological outcomes, while diabetes education, support success and diabetes support network size were associated with better psychological outcomes. Potential limitations are the sample sizes and representativeness. Minority ethnic FMs experienced both advantages and disadvantages in psychological outcomes relative to each other and to White non-Hispanics. Ethnic minority FMs had more involvement in diabetes care, support success and support from others, with the first associated with worse and the latter two with better psychological outcomes. Additional studies are needed with larger samples and broader representation of ethnic groups to better understand these associations and identify areas for intervention.

  16. Seasonal Variation in Soil Greenhouse Gas Emissions at Three Age-Stages of Dawn Redwood (Metasequoia glyptostroboides Stands in an Alluvial Island, Eastern China

    Directory of Open Access Journals (Sweden)

    Shan Yin

    2016-11-01

    Full Text Available Greenhouse gas (GHG emissions are an important part of the carbon (C and nitrogen (N cycle in forest soil. However, soil greenhouse gas emissions in dawn redwood (Metasequoia glyptostroboides stands of different ages are poorly understood. To elucidate the effect of plantation age and environmental factors on soil GHG emissions, we used static chamber/gas chromatography (GC system to measure soil GHG emissions in an alluvial island in eastern China for two consecutive years. The soil was a source of CO2 and N2O and a sink of CH4 with annual emissions of 5.5–7.1 Mg C ha−1 year−1, 0.15–0.36 kg N ha−1 year−1, and 1.7–4.5 kg C ha−1 year−1, respectively. A clear exponential correlation was found between soil temperature and CO2 emission, but a negative linear correlation was found between soil water content and CO2 emission. Soil temperature had a significantly positive effect on CH4 uptake and N2O emission, whereas no significant correlation was found between CH4 uptake and soil water content, and N2O emission and soil water content. These results implied that older forest stands might cause more GHG emissions from the soil into the atmosphere because of higher litter/root biomass and soil carbon/nitrogen content compared with younger stands.

  17. [Entering the Dawn of a New Life: A Discussion of Life for Survivors of the Formosa Fun Coast Water Park Explosion].

    Science.gov (United States)

    Wen, Hui-Min

    2016-02-01

    A dust explosion at the Formosa Fun Coast water park in Taiwan caused nearly 500 burn injury cases. One hundred of these cases involved burns over more than 20% of the total body surface area. This tragedy inundated hospitals across northern Taiwan with an unprecedented number of burn patients. Significant manpower and medical resources were targeted on related resuscitation and treatment efforts, with support and assistance provided by agencies and organizations nationwide. Most of the burn patients were young people in their teens and twenties, whose severe burns posed the greatest threat and challenge to their lives so far. Furthermore, their experience presented major psychosocial and physical health challenges. Patients received an array of clinical treatments such as debridement, skin grafting, dressing, and rehabilitation. Debilitating pain, skin damage, changes to body image, physical disabilities, helplessness, sadness, and anxiety have not only deeply affected the patients physically and psychologically but also created significant life stresses for their family members / companions, which requires counseling in order to facilitate emotional healing. Although burn patients gradually recover as they pass through the acute, recovery, and rehabilitation phases, they will face the challenges of lifelong rehabilitation after discharge. I hope that these young victims will take courage and be brave and strong in dealing with the difficulties and challenges of daily life and will embrace the future with hope as they enter the dawn of their new life.

  18. Towards Homo Digitalis: Important Research Issues for Psychology and the Neurosciences at the Dawn of the Internet of Things and the Digital Society

    Directory of Open Access Journals (Sweden)

    Christian Montag

    2018-02-01

    Full Text Available The present article gives an overview on central challenges humans face at the dawn of complex digital societies and the Internet of Things (IoT, i.e., a world completely connected to the Internet. Among the many challenges to be handled in digital societies is a growing fragmented life style leading to loss of productivity as well as moments for self-reflection. In all this, it is of tremendous importance to understand the impact of digital worlds on our brains and psyches and to reveal possible unintended side-effects of technology use. Does human nature change due to constant interactions with virtual realities? In this context, we also face the challenge to design digital worlds according to our mammalian-emotional heritage deeply anchored in subcortical areas of the human brain. Here, we refer to emotional needs as carved out by Panksepp’s Affective Neuroscience Theory and how they can or cannot be fulfilled in digital worlds. Aside from a review of several key studies dealing with the raised challenges, some first solutions to successfully meet the mentioned problems are provided to achieve sustainable and healthy digital worlds, with whom humans can interact carefree on a daily basis.

  19. Gender differences in service utilization among Operations Enduring Freedom, Iraqi Freedom, and New Dawn Veterans Affairs patients with severe mental illness and substance use disorders.

    Science.gov (United States)

    Painter, Janelle M; Brignone, Emily; Gilmore, Amanda K; Lehavot, Keren; Fargo, Jamison; Suo, Ying; Simpson, Tracy; Carter, Marjorie E; Blais, Rebecca K; Gundlapalli, Adi V

    2018-02-01

    Severe mental illness (SMI) and substance use disorders (SUD) are among the more chronic and costly mental health conditions treated in the Department of Veterans Affairs (VA). Service use patterns of returning veterans with SMI and SUD have received little attention. We examined gender differences in the utilization of VA services among a national sample of Operations Enduring Freedom, Iraqi Freedom, and New Dawn (OEF/OIF/OND) VA patients with SMI, SUD, and their comorbidity (SMI/SUD) in their first year of established VA care (N = 24,166). Outpatient services and acute-residential stays were modeled using negative binomial and logistic regression, respectively. Among all diagnostic categories, men used outpatient services less often than did women, including primary care (adjusted rate ratio [ARR] = .71, 95% confidence interval CI [.68, .74]), mental health (ARR = .85, 95% CI [.80, .91]), and addiction (ARR = .91, 95% CI [.83, .99]) services. For emergency department (ED) and psychiatric inpatient services, gender interacted significantly with diagnosis. The combination of SMI/SUD compared to either SMI or SUD conferred greater risk of ED utilization among men than women (adjusted odds ratio [AOR] = 2.09, 95% CI [1.24, 3.51], and 1.95, 95% CI [1.17, 3.26], respectively). SMI versus SUD conferred greater risk of psychiatric inpatient utilization among men than women (AOR = 1.83, 95% CI [1.43, 2.34]). Our findings point to gender differences in outpatient and acute service utilization among OEF/OIF/OND VA patients with some of the more chronic and costly mental health conditions. Further investigation of health care utilization patterns is needed to understand factors driving these gender differences to ensure that veterans have appropriate access to the services they need. (PsycINFO Database Record (c) 2018 APA, all rights reserved).

  20. SARAS 2: a spectral radiometer for probing cosmic dawn and the epoch of reionization through detection of the global 21-cm signal

    Science.gov (United States)

    Singh, Saurabh; Subrahmanyan, Ravi; Shankar, N. Udaya; Rao, Mayuri Sathyanarayana; Girish, B. S.; Raghunathan, A.; Somashekar, R.; Srivani, K. S.

    2018-04-01

    The global 21-cm signal from Cosmic Dawn (CD) and the Epoch of Reionization (EoR), at redshifts z ˜ 6-30, probes the nature of first sources of radiation as well as physics of the Inter-Galactic Medium (IGM). Given that the signal is predicted to be extremely weak, of wide fractional bandwidth, and lies in a frequency range that is dominated by Galactic and Extragalactic foregrounds as well as Radio Frequency Interference, detection of the signal is a daunting task. Critical to the experiment is the manner in which the sky signal is represented through the instrument. It is of utmost importance to design a system whose spectral bandpass and additive spurious signals can be well calibrated and any calibration residual does not mimic the signal. Shaped Antenna measurement of the background RAdio Spectrum (SARAS) is an ongoing experiment that aims to detect the global 21-cm signal. Here we present the design philosophy of the SARAS 2 system and discuss its performance and limitations based on laboratory and field measurements. Laboratory tests with the antenna replaced with a variety of terminations, including a network model for the antenna impedance, show that the gain calibration and modeling of internal additive signals leave no residuals with Fourier amplitudes exceeding 2 mK, or residual Gaussians of 25 MHz width with amplitudes exceeding 2 mK. Thus, even accounting for reflection and radiation efficiency losses in the antenna, the SARAS 2 system is capable of detection of complex 21-cm profiles at the level predicted by currently favoured models for thermal baryon evolution.

  1. A new dawn for CMS

    CERN Multimedia

    2007-01-01

    Supported by a gigantic crane and a factory-size room full of enthusiasm, the central barrel of CMS made its final journey underground on 28 February. The central section of the CMS detector starts its dramatic 10-hour descent underground.Several hours (and 100 metres) later, the massive barrel rests on the cavern floor. CMS scientists, journalists, photographers and members of the transport crew basked in the final rays of the 'solenoid-set' on 28 February as the central barrel of the CMS detector sinks below the horizon and began its ten-hour descent into the cavern 100 metres below. Thirteen metres long and weighing as much as five jumbo jets (1920 tonnes), the barrel is the largest of the 15 chunks of CMS detector that are being lowered one by one into the cavern. 'This is a challenging feat of engineering, as there are just 20 cm of leeway between the detector and the walls of the shaft,' said Austin Ball, Technical Coordinator of CMS. The section of the detector, which contains the solenoid of the magne...

  2. The hazy dawn of brachytherapy

    International Nuclear Information System (INIS)

    Dutreix, J.; Tubiana, M.; Pierquin, B.

    1998-01-01

    The discovery of radium by Pierre and Marie Curie in December 1898 opened a new era in science and within a few years provided medicine with a new means of tumor treatment. Their personal contribution to the start and early development of clinical applications should not be overlooked. The Curies did not limit their support to providing radium sources to medical pioneers but took a deep interest in the horizons of radiumtherapy. Pierre was one of the first to search for and demonstrate a biological effect of radium radiation. He investigated the radioactivity of the waters of hydrotherapeutic resorts. Marie took care of the measurement of the medical sources personally, convinced that the result of the treatment depends on the precise knowledge of the amount of radium applied. Her perseverance resulted in the establishment of the Institut du Radium (1909) in which, besides the physico-chemical laboratory, a biological department was set up. The latter became the Fondation Curie (1920), a leading medical center of treatment and training, with an integrated team of physicists, radiobiologists and clinicians led by Regaud. One hundred years after the discovery of radium, patients benefit today from the extensive clinical experience that has been collected over the years and from sophisticated developments in application techniques, dosimetry and quality assurance; the professional risk has been precisely assessed and the improvements in material and procedure have enabled the medical personnel to work in hazard-free conditions. This outcome results from the continuous progress that the pioneers gave impulse to. This paper intends to recall their efforts and achievements, as well as the difficulties and the problems they encountered during the first 2 decades when the sturdy foundations of brachytherapy were built. (Copyright (c) 1998 Elsevier Science B.V., Amsterdam. All rights reserved.)

  3. At the dawn of geodesy

    Science.gov (United States)

    Fischer, Irene K.

    1981-06-01

    The first land surveyors were rope stretchers and rope knotters, remembered in ancient documents and tomb paintings and also in some terminology. The L-shaped carpenter’s square, one of the earliest and most versatile basic tools, represents the observed direction of the plumb line versus the water level and appears as the shadow-casting gnomon and also as the geometrical gnomon in magically-restricted enlargements of altars. The related “Pythagorean” theorem was known in antiquity centuries before Pythagoras, with algebraic proofs in Babylonia and China. The spherical shape of the earth, deduced from the observation of circumpolar stars, was part of a complete equatorial astronomical system in ancient China. But although shadow measurements were generally used to establish north-south distances, only the Greeks derived from them the size of the earth. The striking difference between the abstract, geometric approach of Greece and the concrete, algebraic approach of Babylonia and China represents not a difference in talents but a difference in culture-bound interests.

  4. Dawn of the Social Cyborg

    Science.gov (United States)

    Campbell, Joe; Finegan, William

    2011-01-01

    Corporate learning environments have undergone disruptive changes over the last 20 years due to the explosion of information technology, globalization of the workforce, and shrinking travel and training budgets. Those disruptions are accelerating with the introduction of new technologies such as social media. Potentially the most disruptive change…

  5. RELICS of the Cosmic Dawn

    Science.gov (United States)

    Bradac, Marusa; Coe, Dan; Strait, Victoria; Salmon, Brett; Hoag, Austin; Bradley, Larry; Ryan, Russell; Dawson, Will; Zitrin, Adi; Jones, Christine; Sharon, Keren; Trenti, Michele; Stark, Daniel; Oesch, Pascal; Lam, Danel; Carrasco Nunez, Daniela Patricia; Paterno-Mahler, Rachel; Frye, Brenda

    2018-05-01

    When did galaxies start forming stars? What is the role of distant galaxies in galaxy formation models and epoch of reionization? Recent observations indicate at least two critical puzzles in these studies. (1) First galaxies might have started forming stars earlier than previously thought (knowledge of stellar masses, ages, and star formation rates at this epoch requires measuring both rest-frame UV and optical light, which only Spitzer and HST can probe at z 6-11 for a large enough sample of typical galaxies. To address this cosmic puzzle, we propose to complete deep Spitzer imaging of the fields behind the 10 most powerful cosmic telescopes selected using HST, Spitzer, and Planck data from the RELICS and SRELICS programs (Reionization Lensing Cluster Survey; 41 clusters, 190 HST orbits, 440 Spitzer hours). 6 clusters out of 10 are still lacking deep data. This proposal will be a valuable Legacy complement to the existing IRAC deep surveys, and it will open up a new parameter space by probing the ordinary yet magnified population with much improved sample variance. The program will allow us to study stellar properties of a large number, 60 galaxies at z 6-11. Deep Spitzer data will be crucial to unambiguously measure their stellar properties (age, SFR, M*). Finally this proposal will establish the presence (or absence) of an unusually early established stellar population, as was recently observed in MACS1149JD at z 9. If confirmed in a larger sample, this result will require a paradigm shift in our understanding of the earliest star formation.

  6. Dawn of e-government

    DEFF Research Database (Denmark)

    Henriksen, Helle Zinner; Damsgaard, Jan

    2007-01-01

    Most countries have defined strategies for e-government. The objectives for implementing e-government are often defined but the means for fuelling the adoption and diffusion of e-government are typically less well clear in the policy statements. The present study assesses the impact of latest...... internally and externally. The e-Day initiative represents a drastic change in the former policy statements concerning IT adoption and diffusion in Danish government. The policy statements had previously been based on voluntary adoption focusing on visions and pedagogical intervention in governmental...

  7. RELICS of the Cosmic Dawn

    Science.gov (United States)

    Bradac, Marusa; Coe, Dan; Huang, Kuang-Han; Salmon, Brett; Hoag, Austin; Bradley, Larry; Ryan, Russell; Dawson, Will; Zitrin, Adi; Jones, Christine; Sharon, Keren; Trentu, Michele; Stark, Daniel; Bouwens, Rychard; Oesch, Pascal; Lam, Daniel; Patricia Carasco Nunez, Daniela; Paterno-Mahler, Rachel; Strait, Victoria

    2017-10-01

    When did galaxies start forming stars? What is the role of distant galaxies in galaxy formation models and epoch of reionization? Recent observations indicate at least two critical puzzles in these studies. (1) First galaxies might have started forming stars earlier than previously thought (Big Bang). (2) It is still unclear what is their star formation history and whether these galaxies can reionize the Universe. Accurate knowledge of stellar masses, ages, and star formation rates at this epoch requires measuring both rest-frame UV and optical light, which only Spitzer and HST can probe at z 6-11 for a large enough sample of typical galaxies. To address this cosmic puzzle, we propose Spitzer imaging of the fields behind the most powerful cosmic telescopes selected using HST, Spitzer, and Planck data from the RELICS and SRELICS programs (Reionization Lensing Cluster Survey; 41 clusters, 190 HST orbits, 550 Spitzer hours). This proposal will be a valuable Legacy complement to the existing IRAC deep surveys, and it will open up a new parameter space by probing the ordinary yet magnified population with much improved sample variance. The program will allow us to study stellar properties of a large number, 20 galaxies at z 6-11. Deep Spitzer data will be crucial to unambiguously measure their stellar properties (age, SFR, M*). Finally this proposal is a unique opportunity to establish the presence (or absence) of an unusually early established stellar population, as was recently observed in MACS1149JD at z 9. If confirmed, this result will require a paradigm shift in our understanding of the earliest star formation.

  8. The dawn of chelonian research

    OpenAIRE

    MacCord, Kate; Caniglia, Guido; Moustakas-Verho, Jacqueline; Burke, Ann

    2015-01-01

    Many evo-devo studies of the turtle's shell draw hypotheses and support from historical sources. The groundbreaking works of Cuvier, Geoffroy St. Hilaire, Carus, Rathke, Owen, and others are being revived in modern research, and their centuries-old understanding of the turtle's shell reconsidered. In the works of these eminent biologists of the 19th century, comparative anatomy and embryology of turtle morphology set the stage for future studies in developmental biology, histology, and paleon...

  9. On the occurrence of nuclei in mature sieve elements.

    Science.gov (United States)

    Event, R F; Davis, J D; Tucker, C M; Alfieri, F J

    1970-12-01

    The secondary phloem of 3 species of the Taxodiaceae and 13 species of woody dicotyledons was examined for the occurrence of nuclei in mature sieve elements. Nuclei were found in all mature sieve cells of Metasequoia glyptostroboides, Sequoia sempervirens and Taxodium distichum, and in some mature sieve-tube members in 12 of the 13 species of woody dicotyledons. Except for nuclei of sieve cells undergoing cessation of function, the nuclei in mature sieve cells of M. glyptostroboides, S. sempervirens and T. distichum were normal in appearance. The occurrence and morphology of nuclei in mature sieve-tube members of the woody dicotyledons were quite variable. Only 3 species, Robinia pseudoacacia, Ulmus americana and Vitis riparia, contained some mature sieve elements with apparently normal nuclei.

  10. Skin tests of pollen grains of taxodiaceae and cupressaceae in children with bronchial asthma.

    Science.gov (United States)

    Midoro-Horiuti, T; Nouno, S; Seino, Y

    1992-10-01

    Atmospheric cedar pollen in the southern region of Okayama Prefecture (situated in south-western Japan) has been counted since 1988. Pollen of different species of the Taxodiaceae family (Cryptomeria japonica, Sequoia sempervirens and Metasequoia glyptostroboides) and Japanese juniper (Juniperus rigida) in the Cupressaceae family, which are propagated mainly in the southern region of Okayama Prefecture, were found among the atmospheric pollen. Scratch tests using the pollen extract from Taxodiaceae and Cupressaceae were performed on children with bronchial asthma. Forty (25%) and 30 (18.8%) of the 160 patients reacted positively to an allergen extract from the pollen grains of Japanese cedar (Cryptomeria japonica) and Japanese juniper, respectively.

  11. Sapwood area - leaf area relationships for coast redwood

    OpenAIRE

    Stancioiu, P T; O'Hara, K L

    2005-01-01

    Coast redwood (Sequoia sempervirens (D. Don) Endl.) trees in different canopy strata and crown positions were sampled to develop relationships between sapwood cross-sectional area and projected leaf area. Sampling occurred during the summers of 2000 and 2001 and covered tree heights ranging from 7.7 to 45.2 m and diameters at breast height ranging from 9.4 to 92.7 cm. Foliage morphology varied greatly and was stratified into five types based on needle type (sun or shade) and twig color. A str...

  12. A comparative study of modern and fossil cone scales and seeds of conifers: A geochemical approach

    Science.gov (United States)

    Artur, Stankiewicz B.; Mastalerz, Maria; Kruge, M.A.; Van Bergen, P. F.; Sadowska, A.

    1997-01-01

    Modern cone scales and seeds of Pinus strobus and Sequoia sempervirens, and their fossil (Upper Miocene, c. 6 Mar) counterparts Pinus leitzii and Sequoia langsdorfi have been studied using pyrolysis-gas chromatography/mass spectrometry (Py-GC/MS), electron-microprobe and scanning electron microscopy. Microscopic observations revealed only minor microbial activity and high-quality structural preservation of the fossil material. The pyrolysates of both modern genera showed the presence of ligno-cellulose characteristic of conifers. However, the abundance of (alkylated)phenols and 1,2-benzenediols in modern S. sempervirens suggests the presence of non-hydrolysable tannins or abundant polyphenolic moieties not previously reported in modern conifers. The marked differences between the pyrolysis products of both modern genera are suggested to be of chemosystematic significance. The fossil samples also contained ligno-cellulose which exhibited only partial degradation, primarily of the carbohydrate constituents. Comparison between the fossil cone scale and seed pyrolysates indicated that the ligno-cellulose complex present in the seeds is chemically more resistant than that in the cone scales. Principal component analysis (PCA) of the pyrolysis data allowed for the determination of the discriminant functions used to assess the extent of degradation and the chemosystematic differences between both genera and between cone scales and seeds. Elemental composition (C, O, S), obtained using electron-microprobe, corroborated the pyrolysis results. Overall, the combination of chemical, microscopic and statistical methods allowed for a detailed characterization and chemosystematic interpretations of modern and fossil conifer cone scales and seeds.

  13. Scalable Engineering of Quantum Optical Information Processing Architectures (SEQUOIA)

    Science.gov (United States)

    2016-12-13

    fast: recently, it was demonstrated experimentally that photonic cluster states can be produced deterministically by photon scattering off a lambda ...U. The CNOT gate operation corresponds to the sub- matrix of the logic states, shown in solid-color bars and marked with red axis labels. Plots (c

  14. La predicación dominicana del Rosario. El Rosario de la aurora de Zafra en el siglo XVIII (Dominican preaching of the rosary: The dawn rosary of Zafra in 18 th Century

    Directory of Open Access Journals (Sweden)

    Carlos José Romero Mensaque

    2016-01-01

    Full Text Available Resumen: El Rosario, signo de identidad misional de la Orden de Predicadores, desborda los cauces conventuales ya desde el siglo XVI al universalizarse el rezo y devoción. Los dominicos predican el Rosario en sendas misiones y fundan numerosas hermandades adscritas a la Orden en parroquias e iglesias diocesanas, pero ya en el siglo XVII el rezo avemariano rebasa incluso los espacios sagrados para ser predicado en las calles. El proceso culmina en el siglo XVIII con un protagonismo del pueblo en la predicación del rosario, asumiendo en gran parte la responsabilidad de la misión que comenzaran los dominicos. En el extremo de la Provincia Bética, Zafra se convierte en escenario de esta Misión Popular con el Rosario de la Aurora y su hermandad, una corporación claramente misional y asistencial, que no duda en dar mayoría de edad a la mujer en su gobierno.Abstract: The rosary is an important sign of missionary identity for the Dominican Order, whose use has not been limited to the convent since the 16th century when preach and devotion became universal. Dominic monks preach the rosary in all their missions and found several brotherhoods affiliated with the Order in parishes and diocesans churches, but in the 17th century the Hail Mary can be found outside sacred places, it is preached even in the streets. This process end up in the 18th century when common people take a bigger responsibility and continue with the mission started by Dominic monks. Zafra, situated at the limit of the Baetica Province, becomes the stage of this Popular Mission thanks to the dawn rosary and its brotherhood, which clearly was a corporation dedicated to the mission and the assistant of people in need. This brotherhood does not hesitate before giving majority of age to the women in their government, even though they faced a strong social exclusion.

  15. AHP 45: REVIEW: THE DAWN OF TIBET

    Directory of Open Access Journals (Sweden)

    Ivette M. Vargas-O'Bryan

    2017-03-01

    Full Text Available If you want to learn more about the pre-Buddhist heritage of Tibet and the Western Himalayas, one name stands out: John Vincent Bellezza. Unlike any other, we encounter a uniqueness in Bellezza's works, a breadth of detail, insight, and personal struggle that has been unsurpassed in archaeology and Tibetan Studies these days. Bellezza's numerous publications that include such groundbreaking works as Divine Dyads (1997, Calling Down the Gods (2005, the significant contributions of Zhang Zhung: Foundations of Civilization in Tibet (2008, Death and Beyond in Ancient Tibet, and the critical two volume set, Antiquities of Zhang Zhung (2010, have provided robust studies on Tibet's pre-Buddhist heritage in an unconventional style that at once incorporates his skills as an archaeologist with one of cultural historian, anthropologist, travel journalist, explorer, and storyteller.

  16. The Dawns of the Spanish Geo technic

    International Nuclear Information System (INIS)

    Serrano Gonzalez, A.

    2013-01-01

    From a personal perspective, there are analyzed the first steps of the spanish Geotechnical Engineering history understood as an academic discipline but also linked in a very directly way the profession. This evolution is not foreign to the own history of the Geneticist in other countries of our cultural or geographical environment. The contributions discover that our predecessors transmitted important achievements to the international community. The direct presence in the international congresses of that time of the spanish geo technicians is analysed. Three consecutive stages are distinguished, personalizing in each of them the participation of celebrated spanish Civil Engineers. (Author)

  17. Marketing. The Dawn of the fan.

    Science.gov (United States)

    Shepherd, Stuart

    2008-08-21

    The government and NHS are using websites such as YouTube and Facebook to communicate with the public. Trusts believe such websites help them keep in touch with younger people better than other methods. They are open to abuse with unofficial groups appearing in the name of NHS organisations.

  18. At the Dawn of Radio Communications

    Directory of Open Access Journals (Sweden)

    V. P. Samokhin

    2017-01-01

    Full Text Available A brief review of the history of radio communications, which were used before the advent of humanity tubes, in the context of the essays in the series "At the root of media", published in the "History of Technical Progress" section of the supplement to our journal "Science and Education". The review covers the main stages of the development of spark radio-telegraph systems, the creation of the first powerful arc and electric machine generators of non-stopping oscillations of the carrier frequency for radiotelephony and the detection features. The first experiments of Mahlon Loomis, scientific and technical achievements of James Maxwell, Henry Hertz, Eduard Branly, Alexander Popov, Oliver Lodge, Jagadish Bosch, Karl Brown, Lee de Forest, Louis Austin, Herman Simon, William Duddel, Valdemar Paulsen, Ernst Alexander, Valentin Vologdin, Semyon Eisenstein and other creators of the nascent radio engineering. Particular attention is paid to the intersections of their work with the work of Thomas Edison, Nikola Tesla, Guglielmo Marconi, Reginald Fessenden and other heroes of our essays.

  19. The dawn of X‐ray spectroscopy

    DEFF Research Database (Denmark)

    Gerward, Leif

    2013-01-01

    This paper describes a few episodes from the early days of X‐ray spectroscopy. It relies on contemporary publications, especially those by Barkla, Moseley, Siegbahn, and Compton. The paper addresses the subject from the vantage point of physics and should be of interest to the X‐ray spectroscopist...

  20. Determination of total Betta-activity and heavy metals in biomonitor species (phytomonitors) from the area of ITR-Sofia

    International Nuclear Information System (INIS)

    Dimitrov, S.; Yovchev, M.; Geleva, E.

    2010-01-01

    For the purposes of environmental assessment of the area around the Research reactor in Sofia, species from monitored control points, selected in a certain way (habitat, population, air and hydrogeological parameters) are examined. Samples from following phytomonitored species: Betula pendula (silver birch) popullus canadensis (Canadian populus), Quercus sp. (Oak), Dactilus glomerata (Cock's-foot), Abies alba (Silver Fir) and Sequoia sempervirens (Coast Redwood) were analyzed. The total beta activity was determined by radiometric analysis and heavy metals content was measured using X-ray fluorescence analysis. The results are discussed in terms of radiation monitoring program of INRNE (gamma-background, aerosols, surface and groundwater, soil, plants) and obtained values are compared with reference points in the country

  1. An individual-based growth and competition model for coastal redwood forest restoration

    Science.gov (United States)

    van Mantgem, Phillip J.; Das, Adrian J.

    2014-01-01

    Thinning treatments to accelerate coastal redwood forest stand development are in wide application, but managers have yet to identify prescriptions that might best promote Sequoia sempervirens (Lamb. ex D. Don) Endl. (redwood) growth. The creation of successful thinning prescriptions would be aided by identifying the underlying mechanisms governing how individual tree growth responds to competitive environments in coastal redwood forests. We created a spatially explicit individual-based model of tree competition and growth parameterized using surveys of upland redwood forests at Redwood National Park, California. We modeled competition for overstory trees (stems ≥ 20 cm stem diameter at breast height, 1.37 m (dbh)) as growth reductions arising from sizes, distances, and species identity of competitor trees. Our model explained up to half of the variation in individual tree growth, suggesting that neighborhood crowding is an important determinant of growth in this forest type. We used our model to simulate the effects of novel thinning prescriptions (e.g., 40% stand basal area removal) for redwood forest restoration, concluding that these treatments could lead to substantial growth releases, particularly for S. sempervirens. The results of this study, along with continued improvements to our model, will help to determine spacing and species composition that best encourage growth.

  2. Nuclear Magnetic Resonance characterization of traditional homeopathically manufactured copper (Cuprum metallicum) and plant (Gelsemium sempervirens) medicines and controls.

    Science.gov (United States)

    Van Wassenhoven, Michel; Goyens, Martine; Henry, Marc; Capieaux, Etienne; Devos, Philippe

    2017-11-01

    NMR proton relaxation is sensitive to the dynamics of the water molecule H 2 O, through the interaction of the spin of the proton ( 1 H) with external magnetic and electromagnetic fields. We measured dilution and potentization processes through measurements of 1 H spin-lattice T 1 and spin-spin T 2 relaxation times. In order to interpret the recorded fluctuations in T 1 - or T 2 -values, experimental data were linearized by investigating how the area under a fluctuating time = f(dilution) curve (dilution integral or DI) changes with dilution. Two kinds of fitting procedures were considered: chi-square fitting with a goodness-of-fit probability, and least absolute deviations criterion with Pearson's linear correlation coefficient. We showed that fluctuations are not attributable to random noise and/or experimental errors, evidencing a memory effect quantifiable by the slope of the DI = f(dilution) straight line. For all experiments, correlation coefficients were found to lie above 0.9999, against 0.999 for random noise. The discrimination between experimental slopes and slopes associated with random noise data was very good at a five-sigma level of confidence (i.e. probability 3 × 10 -7 ). Discrimination between experimental slopes at a five-sigma level was possible in most cases, with three exceptions: gelsemium aqua pura v gelsemium dilution (four-sigma); copper aqua pura v gelsemium aqua pura (four-sigma) and copper simple dilution v gelsemium simple dilution (three-sigma). All potentized samples show very good discrimination (at least nine-sigma level) against aqua pura, lactose or simple dilution. It was possible to transform the associated relaxation times into a molecular rotational correlation time τ c and an average spin-spin distance d. Our experiments thus point to a considerable slowing down of molecular movements (τ c  > 1300 ps or T = 224-225 K) around water molecules up to a distance of 3.7 Å, values. It was also possible to rule out other possible mechanisms of relaxation (diffusive motion, 17 O- 1 H relaxation or coupling with the electronic spin, S = 1, of dissolved dioxygen molecules). There is clear evidence that homeopathic solutions cannot be considered as pure water as commonly assumed. Instead, we have evidenced a clear memory effect upon dilution/potentization of a substance (water, lactose, copper, gelsemium) reflected by different rotational correlation times and average H⋯H distances. A possible explanation for such a memory effect may lie in the formation of mesoscopic water structures around nanoparticles and/or nanobubbles mediated by zero-point fluctuations of the vacuum electromagnetic field as suggested by quantum field theories. The existence of an Avogadro's 'wall' for homeopathically-prepared medicines is not supported by our data. Rather it appears that all dilutions have a specific material configuration determined by the potentized substance, also by the chemical nature of the containers, and dissolved gases and the electromagnetic environment. This sensitivity of homeopathically-prepared medicines to electromagnetic fields may be amplified by the highly non-linear processing routinely applied in the preparation of homeopathic medicines. Future work is needed in such directions. The time is now ripe for a demystification of the preparation of homeopathic remedies. Copyright © 2017 The Faculty of Homeopathy. Published by Elsevier Ltd. All rights reserved.

  3. Consistency of Self-Reported Neurocognitive Symptoms, Post-Traumatic Stress Disorder Symptoms, and Concussive Events From End of First Deployment to Veteran Health Administration Comprehensive Traumatic Brain Injury Evaluation by Operations Enduring Freedom/Iraqi Freedom/New Dawn Veterans.

    Science.gov (United States)

    Russo, Arthur C; Fingerhut, Esther C

    2017-03-01

    This study examined the consistency of self-reported symptoms and concussive events in combat veterans who reported experiencing concussive events. One hundred and forty, single deployed, Operation Enduring Freedom, Operation Iraqi Freedom and Operation New Dawn combat veterans with Veteran Health Administration (VHA) Comprehensive Traumatic Brain Injury Evaluations (CTBIE) and no post-deployment head injury were examined to assess consistency of self-reported (a) traumatic brain injury (TBI)-related symptoms, (b) post-traumatic stress disorder (PTSD)-related symptoms, and (c) TBI-related concussive events from soon after deployment to time of VHA CTBIE. Compared to their self-report of symptoms and traumatic events at the time of their Post-Deployment Health Assessment, at the time of their comprehensive VHA evaluation, subjects reported significantly greater impairment in concentration, decision making, memory, headache, and sleep. In addition, although half the subjects denied any PTSD symptoms post-deployment, approximately three quarters reported experiencing all four PTSD screening symptoms near the time of the VHA CTBIEs. At the latter time, subjects also reported significantly more TBI-related concussive events, as well as more post-concussive sequelae such as loss of consciousness immediately following these concussive events. Finally, although 84% reported a level of impairment so severe as to render all but the simplest activity doable, the vast majority simultaneously reported working and/or attending college. These findings raise questions regarding the accuracy of veteran self-report of both near and distant traumatic events, and argue for the inclusion of contemporaneous Department of Defense (DOD) records in veteran assessment and treatment planning. Published by Oxford University Press 2016. This work is written by (a) US Government employee(s) and is in the public domain in the US.

  4. 36 CFR 7.8 - Sequoia and Kings Canyon National Parks.

    Science.gov (United States)

    2010-07-01

    ... National Parks. (a) Dogs and cats. Dogs and cats are prohibited on any park land or trail except within one-fourth mile of developed areas which are accessible by a designated public automobile road. (b) Fishing. (1) Fishing restrictions, based on management objectives described in the parks' Resources Management...

  5. 76 FR 9537 - Sequoia National Forest; California; Piute Mountains Travel Management Plan

    Science.gov (United States)

    2011-02-18

    ... camping, hunting, sightseeing, horseback riding, hiking, rock climbing, rock hounding, and vegetation and... providing benefits equal to or better than the current condition. Alternatives being considered at this time...

  6. 76 FR 23335 - Wilderness Stewardship Plan/Environmental Impact Statement, Sequoia and Kings Canyon National...

    Science.gov (United States)

    2011-04-26

    ... compliance with Sec. 4(d)(5) of the Wilderness Act. The WSP will reevaluate existing wilderness-related plans... the Web site (to assist in reducing costs, the public is strongly encouraged to accept compact disks... available at any time. While you can ask us in your comment to withhold your personal identifying...

  7. The Marin Lab at the Dawn of Cognitive Neuropsychology.

    Science.gov (United States)

    Schwartz, Myrna F

    2015-09-01

    This essay discusses the intellectual developments in psychology, linguistics, and behavioral neurology that shaped Oscar Marin's approach to disorders of high cortical function. As Chief of Neurology at Baltimore City Hospitals in the 1970s, Dr Marin teamed with biopsychologist Eleanor Saffran and the author in seminal studies of acquired language disorders (aphasia) centering on core processes of syntax and semantics, and rejecting premature reductionism. The philosophical and methodological principles that motivated these studies are traced through the author's personal recollections and the published writings of the Marin lab. These principles came to be associated with the cognitive neuropsychology school of research and have important linkages to contemporary work in the neuroscience of aphasia and related cognitive disorders.

  8. Intelligent material systems - The dawn of a new materials age

    International Nuclear Information System (INIS)

    Rogers, C.A.

    1993-01-01

    The intelligent material system solution to such engineering problems as the design of a robotic arm borrows directly from biological analogs; materials that behave much as muscles do during contraction can be employed as induced strain actuators which work against the intrinsic structural impedance of the component. Unlike actual human arms, which are jointed, the intelligent structure may be a continuum. The adaptation of structural impedance may be regarded as the most fundamental and consequential concept in the field of intelligent material systems

  9. Defense.gov Special Report: Operation Odyssey Dawn

    Science.gov (United States)

    , and supporting Libyans' efforts for political change, said Secretary of State Hillary Rodham Clinton Clinton Urges Aid to Libya, Pressure on Gadhafi WASHINGTON, March 29, 2011 - The international community

  10. Mary E. Hall: Dawn of the Professional School Librarian

    Science.gov (United States)

    Alto, Teresa

    2012-01-01

    A century ago, a woman named Mary E. Hall convinced school leaders of the need for the professional school librarian--a librarian who cultivated a love of reading, academic achievement, and independent learning skills. After graduating from New York City's Pratt Institute Library School in 1895, Hall developed her vision for the high school…

  11. Solar water heaters in China: A new day dawning

    NARCIS (Netherlands)

    Han, Jingyi; Mol, A.P.J.; Lu, Y.

    2010-01-01

    Solar thermal utilization, especially the application of solar water heater technology, has developed rapidly in China in recent decades. Manufacturing and marketing developments have been especially strong in provinces such as Zhejiang, Shandong and Jiangsu. This paper takes Zhejiang, a relatively

  12. Dawn of the new everything a journey through virtual reality

    CERN Document Server

    Lanier, Jaron

    2017-01-01

    Virtual Reality has long been one of the dominant clichés of science fiction. Now Virtual Reality is a reality: those big headsets that make people look ridiculous, even while radiating startled delight; the place where war veterans overcome PTSD, surgeries are trialled, aircraft and cities are designed. But VR is far more interesting than any single technology, however spectacular. It is, in fact, the most effective device ever invented for researching what a human being actually is – and how we think and feel. More than thirty years ago, legendary computer scientist, visionary and artist Jaron Lanier pioneered its invention. Here, in what is likely to be one of the most unusual books you ever read, he blends scientific investigation, philosophical thought experiment and his memoir of a life lived at the centre of digital innovation to explain what VR really is: the science of comprehensive illusion; the extension of the intimate magic of earliest childhood into adulthood; a hint of what life would be li...

  13. South Africa. The dawn of the renewable energy industry

    Energy Technology Data Exchange (ETDEWEB)

    Forder, Stephen

    2012-07-01

    Procurement of renewable energy from Independent Power Producers is well underway in South Africa in a programme that targets 3,725 MW by 2015. Wind and solar feature prominently in the initial phase. (orig.)

  14. Cosmic dawn the search for the first stars and galaxies

    CERN Document Server

    Rhee, George

    2013-01-01

    The visible universe consists of stars and galaxies. One of the challenges of astronomy is to understand how galaxies and stars first came into existence over thirteen billion years ago. This book tells the story of our quest to solve this problem. Four hundred years after Galileo used his telescope to discover the  moons of Jupiter, we are using new telescopes and instruments to search for the first galaxies to form after the Big Bang. This book brings the reader to the current frontier of this subject and lays out some of the exciting developments we can expect in the years to come.

  15. The Dawning of the Ethics of Environmental Robots.

    Science.gov (United States)

    van Wynsberghe, Aimee; Donhauser, Justin

    2017-10-23

    Environmental scientists and engineers have been exploring research and monitoring applications of robotics, as well as exploring ways of integrating robotics into ecosystems to aid in responses to accelerating environmental, climatic, and biodiversity changes. These emerging applications of robots and other autonomous technologies present novel ethical and practical challenges. Yet, the critical applications of robots for environmental research, engineering, protection and remediation have received next to no attention in the ethics of robotics literature to date. This paper seeks to fill that void, and promote the study of environmental robotics. It provides key resources for further critical examination of the issues environmental robots present by explaining and differentiating the sorts of environmental robotics that exist to date and identifying unique conceptual, ethical, and practical issues they present.

  16. The Dawning of the Ethics of Environmental Robots

    NARCIS (Netherlands)

    Robbins-van Wynsberghe, A.L.; Donhauser, Justin

    2017-01-01

    Environmental scientists and engineers have been exploring research and monitoring applications of robotics, as well as exploring ways of integrating robotics into ecosystems to aid in responses to accelerating environmental, climatic, and biodiversity changes. These emerging applications of

  17. Diabetes Attitudes, Wishes and Needs second study (DAWN2™)

    DEFF Research Database (Denmark)

    Holt, Richard I G; Nicolucci, Antonio; Kovacs Burns, K

    2013-01-01

    across 17 countries participated in an online survey designed to assess diabetes healthcare provision, self-management and training. RESULTS: Between 61.4 and 92.9% of healthcare professionals felt that people with diabetes needed to improve various self-management activities; glucose monitoring (range......, 29.3-92.1%) had the biggest country difference, with a between-country variance of 20%. The need for a major improvement in diabetes self-management education was reported by 60% (26.4-81.4%) of healthcare professionals, with a 12% between-country variance. Provision of diabetes services differed...

  18. DAWN GRAND MAP CERES HYDROGEN MAP V1.0

    Data.gov (United States)

    National Aeronautics and Space Administration — A global map of the concentration of hydrogen within the regolith of asteroid 1 Ceres on twenty-degree quasi-equal-area pixels is provided. Hydrogen concentrations...

  19. DAWN GRAND MAP VESTA HYDROGEN ABUNDANCE V1.0

    Data.gov (United States)

    National Aeronautics and Space Administration — A global map of the abundance of hydrogen in micrograms/g within the regolith of asteroid 4 Vesta is provided for two-degree equal-angle pixels. Hydrogen abundances...

  20. Chatty, Dawn: Displacement and Dispossession in the Modern Middle East

    DEFF Research Database (Denmark)

    Mohns, Erik

    2011-01-01

    and resettlement with an anthropological account of life experiences of individual members of dispersed communities, Chatty allows the reader to inspect “how various peoples, forced to migrate into or within the Middle East, have survived, founded new communities, integrated, and generally exhibited remarkable...

  1. Paul Flory and the Dawn of Polymers as a Science

    Indian Academy of Sciences (India)

    all-hydrocarbon rubber with no unsaturation in the chain that ex- .... contradicts the prevalent view that measure of practical value of basic research lies in its success in ... and productive of results that are valid to the degree required by.

  2. ARTIFICIAL INTELLIGENCE IN SPORTS BIOMECHANICS: NEW DAWN OR FALSE HOPE?

    Directory of Open Access Journals (Sweden)

    Roger Bartlett

    2006-12-01

    Full Text Available This article reviews developments in the use of Artificial Intelligence (AI in sports biomechanics over the last decade. It outlines possible uses of Expert Systems as diagnostic tools for evaluating faults in sports movements ('techniques' and presents some example knowledge rules for such an expert system. It then compares the analysis of sports techniques, in which Expert Systems have found little place to date, with gait analysis, in which they are routinely used. Consideration is then given to the use of Artificial Neural Networks (ANNs in sports biomechanics, focusing on Kohonen self-organizing maps, which have been the most widely used in technique analysis, and multi-layer networks, which have been far more widely used in biomechanics in general. Examples of the use of ANNs in sports biomechanics are presented for javelin and discus throwing, shot putting and football kicking. I also present an example of the use of Evolutionary Computation in movement optimization in the soccer throw in, which predicted an optimal technique close to that in the coaching literature. After briefly overviewing the use of AI in both sports science and biomechanics in general, the article concludes with some speculations about future uses of AI in sports biomechanics.

  3. Salmon fishing by bears and the dawn of cooperative predation.

    Science.gov (United States)

    Stringham, Stephen F

    2012-11-01

    Although bears are an epitome of solitary predation, black (Ursus americanus) and brown bears (U. arctos) occasionally act in pairs to capture salmon (Onchorynchous spp.). I sought to identify conditions that promote pairing and how this relates to optimal foraging. This study on Alaskan black bears assessed whether each mode of fishing (solo vs. paired) occurs mainly where it is most efficient at harvesting salmon--that is, whether modal group size (1 vs. 2) is also optimal size. Not in this case. Pairing increased captures per attempt (benefit/cost ratio = profitability) by up to 47% and captures per minute by up to 5.2-fold. Yet, the ratio of paired versus solo fishing was significantly lower than either profitability or chance explains. Modal group size was 1, optimal size was 2. This discrepancy did not result from intervention by other current benefits and costs, but from unnecessary defensiveness toward any rapidly approaching conspecific, even though it was chasing salmon, not threatening. For bears to regularly hunt cooperatively, they would have to more readily habituate to agonistic-like predatory actions, communicate intentions from > 10 m apart, and assess situational variations in benefit/cost ratios for solo versus paired hunting. It would be revealing to discover how social carnivores overcame these challenges.

  4. Diabetes Attitudes, Wishes and Needs second study (DAWN2™)

    DEFF Research Database (Denmark)

    Kovacs Burns, K; Nicolucci, Antonio; Holt, Richard I G

    2013-01-01

    as a burden by 35.3% (range across countries 10.6-61.7%) of respondents. Over half of respondents [51.4% (22.5-76.0%)] rated their quality of life as 'good' or 'very good'. However, distress about the person with diabetes was high, with 61.3% (31.5-86.4%) worried about hypoglycaemia. The impact of diabetes...

  5. Clinton, Peck and Frost -- The dawn of North American boletology

    Science.gov (United States)

    Ernst E. Both; Beatriz. Ortiz-Santana

    2010-01-01

    George W. Clinton (a founder and first president of the Buffalo Society of Natural Sciences) launched the mycological career of Peck by obtaining for him the position of botanist of the New York State Cabinet of Natural History and he was responsible for the publication of Frost's "Boleti of New England." This paper discusses the interaction between Peck...

  6. ITER: Fusion research at the dawn of a new era

    International Nuclear Information System (INIS)

    Aymar, R.; Chuyanov, V.; Shimomura, Y.; Huguet, M.

    2003-01-01

    Given the expected success of on-going negotiations on the Joint Implementing Agreement for ITER construction and operation, a new era is opening for experimentation with reactor-relevant physics integrated with key reactor technologies in a licensed nuclear environment. The ITER design, cost estimate and safety analysis are supported by a large body of validating physics and technology R and D. The main features of the design, and analysis of its performance, give confidence that it will fulfil its technical objectives and demonstrate the environmental attractiveness of fusion. This paper gives illustrative confirmation of these expectations and an update on the technical preparations for construction, as well as the status of negotiations. (author)

  7. Artificial intelligence in sports biomechanics: new dawn or false hope?

    Science.gov (United States)

    Bartlett, Roger

    2006-12-15

    This article reviews developments in the use of Artificial Intelligence (AI) in sports biomechanics over the last decade. It outlines possible uses of Expert Systems as diagnostic tools for evaluating faults in sports movements ('techniques') and presents some example knowledge rules for such an expert system. It then compares the analysis of sports techniques, in which Expert Systems have found little place to date, with gait analysis, in which they are routinely used. Consideration is then given to the use of Artificial Neural Networks (ANNs) in sports biomechanics, focusing on Kohonen self-organizing maps, which have been the most widely used in technique analysis, and multi-layer networks, which have been far more widely used in biomechanics in general. Examples of the use of ANNs in sports biomechanics are presented for javelin and discus throwing, shot putting and football kicking. I also present an example of the use of Evolutionary Computation in movement optimization in the soccer throw in, which predicted an optimal technique close to that in the coaching literature. After briefly overviewing the use of AI in both sports science and biomechanics in general, the article concludes with some speculations about future uses of AI in sports biomechanics. Key PointsExpert Systems remain almost unused in sports biomechanics, unlike in the similar discipline of gait analysis.Artificial Neural Networks, particularly Kohonen Maps, have been used, although their full value remains unclear.Other AI applications, including Evolutionary Computation, have received little attention.

  8. Electric utility preferred stock financing - twilight or new dawn?

    International Nuclear Information System (INIS)

    Klein, R.

    1991-01-01

    The tax laws have greatly diminished the importance of utility preferred stock. But with utility construction programs expected to rise, it is an opportune time to see if preferreds can be an attractive option again. As recently as 1980, preferred stock financing by electric utilities comprised 55% of all U.S. corporate preferred stock issued. By 1989, this percentage had declined to under 12%. In dollar amounts, electric utility preferred stock financing had decreased by two-thirds over the same time period. The author analyzes just why this decline occurred and what it portends for the future

  9. Dawn of small worlds dwarf planets, asteroids, comets

    CERN Document Server

    Moltenbrey, Michael

    2016-01-01

    This book gives a detailed introduction to the thousands and thousands of smaller bodies in the solar system. Written for interested laymen, amateur astronomers and students it describes the nature and origin of asteroids, dwarf planets and comets, and gives detailed information about their role in the solar system. The author nicely reviews the history of small-world-exploration and describes past, current and future space craft missions studying small worlds, and presents their results. Readers will learn that small solar system worlds have a dramatically different nature and appearance than the planets. Even though research activity on small worlds has increased in the recent past many of their properties are still in the dark and need further research.

  10. Communicating with Light: A New Dawn in the Information Age

    Science.gov (United States)

    Raible, Daniel

    2016-01-01

    You and I are living in a very special time; the age of Solar System exploration. Our Solar System is a complex masterpiece of which we knew so little from our ground-based observations. But within the span of a single lifetime, NASA has sent spacecraft to every planet and several moons, our first eyes to set upon undiscovered lands. Before we endeavored on this journey everything we knew of Pluto could have fit on a single file card, and now we downlink new data every day.

  11. The Dawn Of Gender Justice Against Discrimination - A Legal Paradigm

    Directory of Open Access Journals (Sweden)

    Sindhu Vijaya Kumar

    2011-06-01

    Full Text Available The Socio-economic rights are a vital aspect of human rights agenda for women. The slowstudy process and radical change in recognizing the rights of women to a greater extend has helped tobuild her own identity and withstand her rights against all discrimination. The feminist movementquestioned several discriminatory practices against women. However there was a need for revolutionto debar the discriminatory practice of status on the ground of gender. And revolution was created byfeminist movement. These Movements largely contributed by feminist writing recognized the need tosubdue the discriminatory practice of status. Feminist theory emerged from these feministmovements includes general theories and theories about the origins of inequality, economic injusticeand in some cases, about the social construction of sex and gender, in a variety of disciplines.Feminist activists have campaigned for women's rights as such, in contract, property, and voting,while also promoting women's rights from human right perspective. They have opposed domesticviolence sexual harassment and sexual assault, in economics they have advocated for workplacerights, including equal pay and opportunities for careers and to start businesses. Interventions ofnational and international legal instrument have added grace and recognized women’s right. All thisresulted in increase participation of women both in formal and informal job sector. However thejourney to heed her right did not end here; it was the beginning, the beginning to fight for hersurvival.

  12. Laboratory tests of headache disorders - Dawn of a new era?

    DEFF Research Database (Denmark)

    Schytz, Henrik Winther; Olesen, Jes

    2016-01-01

    secondary headaches. Background In this narrative review we present and discuss published tests that might be useful in phenotyping and/or diagnosis of long-lasting headache disorders such as migraine, tension-type headache, trigeminal autonomic cephalalgias, trigeminal neuralgia and persisting secondary...... headaches. Aim The palpometer test, quantitative sensory testing, nociceptive blink reflex and autonomic tests may be valuable to phenotype and/or diagnose subforms of migraine, tension-type headache, cluster headache, trigeminal neuralgia and medication-overuse headache. Provocation tests with glyceryl...... if well-reputed tertiary headache centers commence developing and implementing laboratory tests in order to improve the classification and treatment of headache patients....

  13. The Cosmic Dawn and Epoch of Reionisation with SKA

    NARCIS (Netherlands)

    Koopmans, L.; Pritchard, J.; Mellema, G.; Aguirre, J.; Ahn, K.; Barkana, R.; van Bemmel, I.; Bernardi, G.; Bonaldi, A.; Briggs, F.; de Bruyn, A. G.; Chang, T. C.; Chapman, E.; Chen, X.; Ciardi, B.; Dayal, P.; Ferrara, A.; Fialkov, A.; Fiore, F.; Ichiki, K.; Illiev, I. T.; Inoue, S.; Jelic, V.; Jones, M.; Lazio, J.; Maio, U.; Majumdar, S.; Mack, K. J.; Mesinger, A.; Morales, M. F.; Parsons, A.; Pen, U. L.; Santos, M.; Schneider, R.; Semelin, B.; de Souza, R. S.; Subrahmanyan, R.; Takeuchi, T.; Vedantham, H.; Wagg, J.; Webster, R.; Wyithe, S.; Datta, K. K.; Trott, C.

    2014-01-01

    Concerted effort is currently ongoing to open up the Epoch of Reionization (EoR) ($z\\sim$15-6) for studies with IR and radio telescopes. Whereas IR detections have been made of sources (Lyman-$\\alpha$ emitters, quasars and drop-outs) in this redshift regime in relatively small fields of view, no

  14. The Cosmic Dawn and Epoch of Reionisation with SKA

    NARCIS (Netherlands)

    Koopmans, L.; Pritchard, J.; Mellema, G.; Aguirre, J.; Ahn, K.; Barkana, R.; van Bemmel, I.; Bernardi, G.; Bonaldi, A.; Briggs, F.; de Bruyn, A. G.; Chang, T. C.; Chapman, E.; Chen, X.; Ciardi, B.; Dayal, P.; Ferrara, A.; Fialkov, A.; Fiore, F.; Ichiki, K.; Illiev, I. T.; Inoue, S.; Jelic, V.; Jones, M.; Lazio, J.; Maio, U.; Majumdar, S.; Mack, K. J.; Mesinger, A.; Morales, M. F.; Parsons, A.; Pen, U. L.; Santos, M.; Schneider, R.; Semelin, B.; de Souza, R. S.; Subrahmanyan, R.; Takeuchi, T.; Vedantham, H.; Wagg, J.; Webster, R.; Wyithe, S.; Datta, K. K.; Trott, C.

    2015-01-01

    Concerted effort is currently ongoing to open up the Epoch of Reionization (EoR) ($z\\sim$15-6) for studies with IR and radio telescopes. Whereas IR detections have been made of sources (Lyman-$\\alpha$ emitters, quasars and drop-outs) in this redshift regime in relatively small fields of view, no

  15. The Russian Armed Forces at the Dawn of the Millennium

    Science.gov (United States)

    2000-12-01

    authorities for the “limp” way they have approached these issues. As a statement of intent it cannot be faulted. It reminds me of Juan Carlos of Spain...no. 4, December 1999, pp. 1-53. 4. For details see the excellent study by Harry Gelman , “The Soviet Far East Buildup and Soviet Risk-Taking Against

  16. THE DAWNING OF THE STREAM OF AQUARIUS IN RAVE

    International Nuclear Information System (INIS)

    Williams, M. E. K.; Steinmetz, M.; De Jong, R. S.; Minchev, I.; Sharma, S.; Bland-Hawthorn, J.; Parker, Q. A.; Seabroke, G. M.; Helmi, A.; Freeman, K. C.; Binney, J.; Bienayme, O.; Campbell, R.; Fulbright, J. P.; Gibson, B. K.; Gilmore, G. F.; Grebel, E. K.; Munari, U.; Navarro, J. F.; Reid, W.

    2011-01-01

    We identify a new, nearby (0.5kpc ∼ 0 0 and -70 0 0 , with heliocentric line-of-sight velocities V los ∼ -200 km s -1 . The members are outliers in the radial velocity distribution, and the overdensity is statistically significant when compared to mock samples created with both the Besancon Galaxy model and newly developed code Galaxia. The metallicity distribution function and isochrone fit in the log g-T eff plane suggest that the stream consists of a 10 Gyr old population with [M/H] ∼ -1.0. We explore relations to other streams and substructures, finding that the stream cannot be identified with known structures: it is a new, nearby substructure in the Galaxy's halo. Using a simple dynamical model of a dissolving satellite galaxy, we account for the localization of the stream. We find that the stream is dynamically young and therefore likely the debris of a recently disrupted dwarf galaxy or globular cluster. The Aquarius stream is thus a specimen of ongoing hierarchical Galaxy formation, rare for being right in the solar suburb.

  17. MJMS at the Dawn of Its Electronic Era

    Science.gov (United States)

    Dewiputri, Wan Ilma; Mohamad, Irfan

    2011-01-01

    This special editorial assessed the recent developments in Malaysian Journal of Medical Sciences (MJMS) and examined the characteristics of the submission, peer review, and publication processes for MJMS. This retrospective analysis used information about the manuscripts submitted to MJMS during the one-year period (from 1 June 2010 to 31 May 2010) since the start of current online submission and review system (ScholarOne™ Manuscripts, Thomson Reuters). In addition, we also discussed the future directions of MJMS. Finally, we would like to recommend an annual internal audit for MJMS, which is very useful to monitor the growth of this journal progressively. PMID:22135566

  18. Cosmic Dawn: The First Star in the Universe

    Energy Technology Data Exchange (ETDEWEB)

    Abel, Tom

    2008-04-29

    What was the first thing in the Universe? A black hole or a star? How did it form? Even our biggest and best telescopes cannot tell us. Direct calculation with supercomputers, however, can. The first luminous objects in the Universe were very massive stars shining one million times as brightly as our sun. They died quickly and seeded the cosmos with the chemical elements necessary for life. One star at a time, galaxies started to assemble just one hundred million years after the Big Bang, and they are still growing now. Join Dr. Abel in a fascinating journey through the early universe, where he uses the latest computer animations of early star formation, supernovae explosions and the buildup of the first galaxies.

  19. The Globe of Science and Innovation at dawn

    CERN Multimedia

    Maximilien Brice

    2006-01-01

    CERN's exhibition centre 'the Globe of Science and Innovation' is seen just after sunrise. This wooden building was given to CERN in 2004 as a gift from the Swiss Confederation to mark 50 years since the Organisation's foundation.

  20. Heavy Ion Collisions at the dawn of the LHC era

    CERN Document Server

    Takahashi, J.

    2013-06-27

    This is a proceeding of the CERN Latin American School of High-Energy physics that took place in the beautiful city of Natal, northern Brazil, in March 2011. In this paper I present a review of the main topics associated with the study of Heavy Ion Collisions, intended for students starting or interested in the field. It is impossible to summarize in a few pages the large amount of information that is available today, after a decade of operations of the RHIC accelerator and the beginning of the LHC operations. Thus, I had to choose some of the results and theories in order to present the main ideas and goals. All results presented here are from publicly available references, but some of the discussions and opinions are my personal view, where I have made that clear in the text.

  1. When Consciousness Dawns: Confronting Homophobia with Turkish High School Students

    Science.gov (United States)

    Michell, Michael J.

    2009-01-01

    Turkey, like many Mediterranean and Middle Eastern cultures, is homosocial. Profoundly intimate, though nonsexual, relationships between members of the same gender predominate. In such cultures it is expected that male friends kiss one another on the cheek when greeting or saying goodbye, and it is common to see men walk arm-in-arm together, hold…

  2. Asthma in Latin America: the dawn of a new epidemic.

    Science.gov (United States)

    Pitrez, Paulo M; Stein, Renato T

    2008-10-01

    Asthma is a heterogeneous disease with high morbidity worldwide. Unlike the low prevalence of asthma and allergy found in many developing countries, especially in rural settings, its prevalence in Latin America is high. In these sites, nonatopic asthma seems to be the most common phenotype observed among school-age children. Therefore, it seems that asthma in Latin America has some particular characteristics that will be presented and discussed in this article. The prevalence of asthma-like symptoms in childhood is high in many populations studied in Latin America with similar frequencies to those reported in more developed countries. However, the mechanisms and risk factors associated with nonatopic asthma, which is the most prevalent phenotype in this region, have been scarcely studied. The better understanding of asthma phenotypes that prevail in Latin America and the investigation of determining factor studies may help establish new diagnostic and therapeutic approaches. These findings should affect public health policies for this new asthma epidemic through the combination of the atopic and nonatopic phenotypes. We hope that this article sheds some new light into these important and most relevant questions.

  3. Brazilian studies in Canada: dawn of a new era?

    Directory of Open Access Journals (Sweden)

    W. E. (Ted Hewitt

    2005-01-01

    Full Text Available Desde os dias sombrios do Bombardier - Embraer e do boicote da carne de gado brasileira no final dos anos 90, as relações entre Canadá e Brazil tiveram uma significante melhora. Isto pode ser verificado em vários setores, do acadêmico (como pode ser testemunhado pelo estabelecimento de uma cadeira como visitante de pesquisa em estudos Brasileiros,ao político (no crescente número de delegações de parlamentares brasileiras visitando o Canadá, ao econômico (evidenciado pela recente ascensão do investimento bilateral, especialmente em cimento, bebidas e aço e ao cultural (demonstrado no gosto canadense pela música, cerveja e comida brasileiras. Neste trabalho, nós examinamos se e como tais desenvolvimentos têm sido acompanhados por um aumento na pesquisa acadêmica canadense sobre o Brasil nos últimos anos, especialmente em setores de investigação menos tradicionais, tais como o da política e da economia. Concluímos o trabalho com uma avaliação das futuras necessidades e capacidades na área de Estudos Brasileiros neste país.

  4. Solar water heaters in China. A new day dawning

    International Nuclear Information System (INIS)

    Han, Jingyi; Mol, Arthur P.J.; Lu, Yonglong

    2010-01-01

    Solar thermal utilization, especially the application of solar water heater technology, has developed rapidly in China in recent decades. Manufacturing and marketing developments have been especially strong in provinces such as Zhejiang, Shandong and Jiangsu. This paper takes Zhejiang, a relatively affluent province, as a case study area to assess the performance of solar water heater utilization in China. The study will focus on institutional setting, economic and technological performance, energy performance, and environmental and social impact. Results show that China has greatly increased solar water heater utilization, which has brought China great economic, environmental and social benefits. However, China is confronted with malfeasant market competition, technical flaws in solar water heater products and social conflict concerning solar water heater installation. For further development of the solar water heater, China should clarify the compulsory installation policy and include solar water heaters into the current 'Home Appliances Going to the Countryside' project; most of the widely used vacuum tube products should be replaced by flat plate products, and the technology improvement should focus on anti-freezing and water saving; the resources of solar water heater market should be consolidated and most of the OEM manufacturers should evolve to ODM and OBM enterprises. (author)

  5. Light Dawns on Dark Gamma-ray Bursts

    Science.gov (United States)

    2010-12-01

    Gamma-ray bursts are among the most energetic events in the Universe, but some appear curiously faint in visible light. The biggest study to date of these so-called dark gamma-ray bursts, using the GROND instrument on the 2.2-metre MPG/ESO telescope at La Silla in Chile, has found that these gigantic explosions don't require exotic explanations. Their faintness is now fully explained by a combination of causes, the most important of which is the presence of dust between the Earth and the explosion. Gamma-ray bursts (GRBs), fleeting events that last from less than a second to several minutes, are detected by orbiting observatories that can pick up their high energy radiation. Thirteen years ago, however, astronomers discovered a longer-lasting stream of less energetic radiation coming from these violent outbursts, which can last for weeks or even years after the initial explosion. Astronomers call this the burst's afterglow. While all gamma-ray bursts [1] have afterglows that give off X-rays, only about half of them were found to give off visible light, with the rest remaining mysteriously dark. Some astronomers suspected that these dark afterglows could be examples of a whole new class of gamma-ray bursts, while others thought that they might all be at very great distances. Previous studies had suggested that obscuring dust between the burst and us might also explain why they were so dim. "Studying afterglows is vital to further our understanding of the objects that become gamma-ray bursts and what they tell us about star formation in the early Universe," says the study's lead author Jochen Greiner from the Max-Planck Institute for Extraterrestrial Physics in Garching bei München, Germany. NASA launched the Swift satellite at the end of 2004. From its orbit above the Earth's atmosphere it can detect gamma-ray bursts and immediately relay their positions to other observatories so that the afterglows could be studied. In the new study, astronomers combined Swift data with new observations made using GROND [2] - a dedicated gamma-ray burst follow-up observation instrument, which is attached to the 2.2-metre MPG/ESO telescope at La Silla in Chile. In doing so, astronomers have conclusively solved the puzzle of the missing optical afterglow. What makes GROND exciting for the study of afterglows is its very fast response time - it can observe a burst within minutes of an alert coming from Swift using a special system called the Rapid Response Mode - and its ability to observe simultaneously through seven filters covering both the visible and near-infrared parts of the spectrum. By combining GROND data taken through these seven filters with Swift observations, astronomers were able to accurately determine the amount of light emitted by the afterglow at widely differing wavelengths, all the way from high energy X-rays to the near-infrared. The astronomers used this information to directly measure the amount of obscuring dust that the light passed through en route to Earth. Previously, astronomers had to rely on rough estimates of the dust content [3]. The team used a range of data, including their own measurements from GROND, in addition to observations made by other large telescopes including the ESO Very Large Telescope, to estimate the distances to nearly all of the bursts in their sample. While they found that a significant proportion of bursts are dimmed to about 60-80 percent of the original intensity by obscuring dust, this effect is exaggerated for the very distant bursts, letting the observer see only 30-50 percent of the light [4]. The astronomers conclude that most dark gamma-ray bursts are therefore simply those that have had their small amount of visible light completely stripped away before it reaches us. "Compared to many instruments on large telescopes, GROND is a low cost and relatively simple instrument, yet it has been able to conclusively resolve the mystery surrounding dark gamma-ray bursts," says Greiner. Notes [1] Gamma-ray bursts lasting longer than two seconds are referred to as long bursts and those with a shorter duration are known as short bursts. Long bursts, which were observed in this study, are associated with the supernova explosions of massive young stars in star-forming galaxies. Short bursts are not well understood, but are thought to originate from the merger of two compact objects such as neutron stars. [2] The Gamma-Ray burst Optical and Near-infrared Detector (GROND) was designed and built at the Max-Planck Institute for Extraterrestrial Physics in collaboration with the Tautenburg Observatory, and has been fully operational since August 2007. [3] Other studies relating to dark gamma-ray bursts have been released. Early this year, astronomers used the Subaru Telescope to observe a single gamma-ray burst, from which they hypothesised that dark gamma-ray bursts may indeed be a separate sub-class that form through a different mechanism, such as the merger of binary stars. In another study published last year using the Keck Telescope, astronomers studied the host galaxies of 14 dark GRBs, and based on the derived low redshifts they infer dust as the likely mechanism to create the dark bursts. In the new work reported here, 39 GRBs were studied, including nearly 20 dark bursts, and it is the only study in which no prior assumptions have been made and the amount of dust has been directly measured. [4] Because the afterglow light of very distant bursts is redshifted due to the expansion of the Universe, the light that left the object was originally bluer than the light we detect when it gets to Earth. Since the reduction of light intensity by dust is greater for blue and ultraviolet light than for red, this means that the overall dimming effect of dust is greater for the more distant gamma-ray bursts. This is why GROND's ability to observe near-infrared radiation makes such a difference. More information This research is presented in a paper to appear in the journal Astronomy & Astrophysics on 16 December 2010 The team is composed of: J. Greiner (Max-Planck-Institut für extraterrestrische Physik [MPE], Germany), T. Krühler (MPE, Universe Cluster, Technische Universität München), S. Klose (Thüringer Landessternwarte, Germany), P. Afonso (MPE), C. Clemens (MPE), R. Filgas (MPE), D.H. Hartmann (Clemson University, USA), A. Küpcü Yoldaş¸ (University of Cambridge, UK), M. Nardini (MPE), F. Olivares E. (MPE), A. Rau (MPE), A. Rossi (Thüringer Landessternwarte, Germany), P. Schady (MPE), and A. Updike (Clemson University, USA) ESO, the European Southern Observatory, is the foremost intergovernmental astronomy organisation in Europe and the world's most productive astronomical observatory. It is supported by 14 countries: Austria, Belgium, the Czech Republic, Denmark, France, Finland, Germany, Italy, the Netherlands, Portugal, Spain, Sweden, Switzerland and the United Kingdom. ESO carries out an ambitious programme focused on the design, construction and operation of powerful ground-based observing facilities enabling astronomers to make important scientific discoveries. ESO also plays a leading role in promoting and organising cooperation in astronomical research. ESO operates three unique world-class observing sites in Chile: La Silla, Paranal and Chajnantor. At Paranal, ESO operates the Very Large Telescope, the world's most advanced visible-light astronomical observatory and VISTA, the world's largest survey telescope. ESO is the European partner of a revolutionary astronomical telescope ALMA, the largest astronomical project in existence. ESO is currently planning a 42-metre European Extremely Large optical/near-infrared Telescope, the E-ELT, which will become "the world's biggest eye on the sky".

  6. ITER: Fusion research at the dawn of a new era

    International Nuclear Information System (INIS)

    Aymar, R.

    2002-01-01

    Given the expected success of on-going negotiations on the Joint Implementing Agreement for ITER construction and operation, a new era is opening in which fusion laboratories will have more dependable external support where they follow programmes supporting fusion as an energy source. The ITER design, cost estimate and safety analysis are supported by a large body of validating physics and technology R and D. The main features of the design, and analysis of its performance, give confidence that it will fulfil its technical objectives and demonstrate the environmental attractiveness of fusion. This paper gives illustrative confirmation of these expectations and an update on the technical preparations for construction, as well as the status of negotiations. These show that ITER is the right next step, integrating the appropriate physics and technology, making the proper technical and financial compromise and being conducted within an international framework, to advance fusion towards the objective of becoming an energy source in the foreseeable future. (author)

  7. Social Studies. Dawn: The Birth of Selected Civilizations.

    Science.gov (United States)

    Cold, Ron

    The Quinmester world studies course for grades 7 through 9 investigates concepts of prehistory, culture, and civilization, offering an in depth understanding of the reasons why and how civilizations rise and fall. Emphasis is on comparing past and present civilizations. One major purpose of the course is for students to comprehend that…

  8. The Dawn of physics beyond the standard model

    CERN Multimedia

    Kane, Gordon

    2003-01-01

    "The Standard Model of particle physics is at a pivotal moment in its history: it is both at the height of its success and on the verge of being surpassed [...] A new era in particle physics could soon be heralded by the detection of supersymmetric particles at the Tevatron collider at Fermi National Accelerator Laboratory in Batavia, Ill." (8 pages)

  9. The thermal solar at the dawn of a necessary revolution

    International Nuclear Information System (INIS)

    Zebboudj, Idir

    2013-01-01

    This article proposes an overview of the difficult situation which the thermal solar sector is now facing in France (after a constant increase until 2008, its market keeps on shrinking and is not attractive enough). It discusses the implications and possible benefits the new thermal regulation (RT 2012) for new buildings could have for this energy, and whether it will be at the heart of the planned and expected energy transition. A new concept of water heater is presented which associates thermal solar and gas

  10. SPIDER: Probing the dawn of time from above the clouds

    Science.gov (United States)

    Moncelsi, Lorenzo; Spider Collaboration

    2017-11-01

    SPIDER is a balloon-borne microwave polarimeter designed to measure cosmological B-modes on degree angular scales in the presence of Galactic foregrounds. With six independent telescopes housing a total of 2000 detectors in the 90 GHz and 150 GHz frequency bands, SPIDER is the most instantaneously-sensitive CMB polarimeter deployed on the sky to date. SPIDER was successfully launched from McMurdo Station, Antarctica in January 2015 and acquired science data for 16 days. We cover the in-flight performance and present highlights from the ongoing data-analysis. After a successful recovery, the SPIDER team is planning the next flight, featuring one foreground-optimized channel at 280GHz, which will allow us constrain the primordial tensor-mode amplitude at the level of r < 0.03 (99% CL), in the presence of foregrounds.

  11. Probing individual sources during reionization and cosmic dawn ...

    Indian Academy of Sciences (India)

    40

    The emergence of first galaxies, quasars in the Universe is one of the significant .... Left panel: The differential brightness temperature profile around an isolated ..... The system noise (NS), HI fluctuations (HF) and the foregrounds (FG) all con-.

  12. The dawn of sustainable forestry in the South

    Science.gov (United States)

    James P. Barnett; Mason C. Carter

    2017-01-01

    In the late 19th century, virgin southern pine forests in the West Gulf Coast Region remained virtually untouched. After the Civil War, this land was made available by the government for homesteading and sale. Pine timberland was offered for sale at $1.25 per acre. Primarily northern lumbermen and land speculators purchased the land. Lumbering then became the economic...

  13. Homeotic shift at the dawn of the turtle evolution

    Science.gov (United States)

    Szczygielski, Tomasz

    2017-04-01

    All derived turtles are characterized by one of the strongest reductions of the dorsal elements among Amniota, and have only 10 dorsal and eight cervical vertebrae. I demonstrate that the Late Triassic turtles, which represent successive stages of the shell evolution, indicate that the shift of the boundary between the cervical and dorsal sections of the vertebral column occurred over the course of several million years after the formation of complete carapace. The more generalized reptilian formula of at most seven cervicals and at least 11 dorsals is thus plesiomorphic for Testudinata. The morphological modifications associated with an anterior homeotic change of the first dorsal vertebra towards the last cervical vertebra in the Triassic turtles are partially recapitulated by the reduction of the first dorsal vertebra in crown-group Testudines, and they resemble the morphologies observed under laboratory conditions resulting from the experimental changes of Hox gene expression patterns. This homeotic shift hypothesis is supported by the, unique to turtles, restriction of Hox-5 expression domains, somitic precursors of scapula, and brachial plexus branches to the cervical region, by the number of the marginal scute-forming placodes, which was larger in the Triassic than in modern turtles, and by phylogenetic analyses.

  14. Functional Ecology Effect Aspect Geographic on the Cypress (Cupresuss sempervirens L.var horizontalis) Growth in the Abbas Abad Behshahr Planting Stand

    International Nuclear Information System (INIS)

    Kalantari, H.; Fallah, A.; Hojjati, M.

    2016-01-01

    Background and Objective: To evaluate the growth of cypress in different aspects (North West, West, Northeast and Southwest) is a pure planting stand in the area of Abbas Abad Behshar was considered. Method: Using the inventory network 75 × 100 m and a stratified random method, 50 samples plot 2 R (200 square meters) in different geographical aspects was carried out. In each sample plots, diameters and height of four trees were measured. Excel and SPSS statistical software and statistical analyses and necessary calculations were performed. Findings: The results showed that there are significant differences between amplitude with different aspects of growth. So that the highest diameter increment in the West aspect (0.53 cm) and the lowest in the North East aspect (0.479 cm) were observed. The maximum height growth in the West and South-West aspects (0.53 m) and the lowest was in the northwest aspect (0.49 m) and for average basal area growth, the highest growth in the West aspect was 0.87 m square per ha and lowest in the North west aspect was 0.76 square meters per hectare respectively. The average volume growth to age, respectively, in the aspect of West aspect (4 sylve per ha) and Northeast aspect (6.3 sylve per hectare) were the highest and lowest values.

  15. Mass production of 'Swan's Golden', Cupressus sempervirens by tissue culture and its radiation breeding. 2. Study on growth regulating substance to stimulate the elongation of shoot apex

    International Nuclear Information System (INIS)

    Suda, Hirokatsu

    1997-01-01

    Some species of 'Swan's Golden' have been propagated by means of grafting because propagation by cutting is difficult. However, not a few species of the plant are easily lodged, resulting that spreading of 'Swan's Golden' is difficult. Here, an investigation was made on growth regulating substances added into the basal medium in respects of their kinds and concentrations and also the kind of medium for successive culture. As the basal medium, SH medium supplemented with 4 g/l of gel-light and 3 g/l of carbon-powder was used. The optimum medium for the initiation of culture was the basal medium added with zeatin (Ze) and gibberellin (GA) and it was also suitable for successive culture after the 14 day. The medium added with Ze and benzyladenine (BA) or Ze alone was found to be most suitable for the culture after the 28 day. The concentration was optimum at 1 - 2.5 mg/l for either of these growth regulating substances. (M.N.)

  16. Carex sempervirens tussocks induce spatial heterogeneity in litter decomposition, but not in soil properties, in a subalpine grassland in the Central Alps

    Science.gov (United States)

    Fei-Hai Yu; Martin Schutz; Deborah S. Page-Dumroese; Bertil O. Krusi; Jakob Schneller; Otto Wildi; Anita C. Risch

    2011-01-01

    Tussocks of graminoids can induce spatial heterogeneity in soil properties in dry areas with discontinuous vegetation cover, but little is known about the situation in areas with continuous vegetation and no study has tested whether tussocks can induce spatial heterogeneity in litter decomposition. In a subalpine grassland in the Central Alps where vegetation cover is...

  17. Climatic and physiological effects on leaf and tree-ring stable isotopes in California redwoods

    Science.gov (United States)

    Ambrose, A. R.; Baxter, W.; Wong, C.; Dawson, T. E.; Carroll, A.; Voelker, S.

    2016-12-01

    Variation in the stable isotope composition of organic matter can provide important information about environmental change and biological responses to it. We analyzed the stable carbon (d13C) and oxygen (d18O) isotope ratios of leaves and of the cellulose from individual tree-rings of California's two redwood species to examine how these trees have responded to environmental variation and change in both time and space. Analyses of leaf d13C for both coast redwood (Sequoia sempervirens) and giant sequoia (Sequoiadendron giganteum) from throughout their geographical ranges show a marked gradient with tree height for trees of all sizes and ages but no clear difference among species or populations. The gradient is best explained by tree response to changes in both microenvironment and physiology that are known to change with height. In contrast, leaf d18O for both species showed no clear relationship with height but very clear differences between species and populations with giant sequoia displaying a much stronger inferred leaf-level response to the higher evaporative conditions present in the Sierra Nevada mountains as compared to the coast. Both species showed population-level differences with the driest and warmest sites most distinct from all of the others. Intra-annual analyses of d13C and d18O in tree-rings over a 21-year period (1974-1994) were also used to explore how climate and tree response to climate was recorded for both species. These analyses revealed unique (local) climatic effects and response to the climate for each species and population of both redwood species. Most pronounced was a significant increase in intrinsic Water Use Efficiency (iWUE) derived from d13C data over the study period in both species, and a distinct d18O response in relation to drought (e.g. 1976/1977) and to warmer days and nights and above-average precipitation (e.g., 1982-1985). Patterns of co-variation in d13C and d18O in both species suggest that during dry and also warm

  18. Preferences of Coptotermes formosanus Shiraki and Coptotermes gestroi (Wasmann (Blattodea: Rhinotermitidae among Three Commercial Wood Species

    Directory of Open Access Journals (Sweden)

    Nirmala K. Hapukotuwa

    2011-11-01

    Full Text Available The Formosan subterranean termite, Coptotermes formosanus Shiraki, and the Asian subterranean termite, Coptotermes gestroi (Wasmann, are both pests of wood in service in Hawaii and Florida. We conducted a laboratory study using method modified from those described in standard E1-09 of the American Wood Protection Association (AWPA 2009 to assess the termite resistance of three commercially available wood species used in regions of the USA where both termite species occur: Douglas fir, Pseudotsuga menziessii, southern yellow pine, Pinus spp. and redwood, Sequoia sempervirens. A multiple-choice (three-choice assay was used for four weeks (28 days in order to simulate field conditions of food choice and assess termite feeding preferences under 28 °C and 72–80% RH. 400 termites (360 workers: 40 soldiers were released into each test jar. Five replicates and two controls of each wood species were used with each termite species. Termite mortality was recorded at the end of the test; and wood wafers were oven-dried and weighed before and after termite exposure to determine the mass loss due to termite feeding, and rated visually on a 0 (failure to 10 (sound scale. There were significant differences in mean mass loss values among the three wood species and between two termite species. The mean mass loss value for redwood was significantly lower than Douglas fir and southern yellow pine with both termite species. However, C. formosanus showed increased feeding on Douglas fir and southern yellow pine compared to C. gestroi.

  19. Mortality and community changes drive sudden oak death impacts on litterfall and soil nitrogen cycling.

    Science.gov (United States)

    Cobb, Richard C; Eviner, Valerie T; Rizzo, David M

    2013-10-01

    Few studies have quantified pathogen impacts to ecosystem processes, despite the fact that pathogens cause or contribute to regional-scale tree mortality. We measured litterfall mass, litterfall chemistry, and soil nitrogen (N) cycling associated with multiple hosts along a gradient of mortality caused by Phytophthora ramorum, the cause of sudden oak death. In redwood forests, the epidemiological and ecological characteristics of the major overstory species determine disease patterns and the magnitude and nature of ecosystem change. Bay laurel (Umbellularia californica) has high litterfall N (0.992%), greater soil extractable NO3 -N, and transmits infection without suffering mortality. Tanoak (Notholithocarpus densiflorus) has moderate litterfall N (0.723%) and transmits infection while suffering extensive mortality that leads to higher extractable soil NO3 -N. Redwood (Sequoia sempervirens) has relatively low litterfall N (0.519%), does not suffer mortality or transmit the pathogen, but dominates forest biomass. The strongest impact of pathogen-caused mortality was the potential shift in species composition, which will alter litterfall chemistry, patterns and dynamics of litterfall mass, and increase soil NO3 -N availability. Patterns of P. ramorum spread and consequent mortality are closely associated with bay laurel abundances, suggesting this species will drive both disease emergence and subsequent ecosystem function. © 2013 The Authors. New Phytologist © 2013 New Phytologist Trust.

  20. Linking Forests and Fish: The Relationship Between Productivities of Salmonids and Forest Stands in Northern California

    Science.gov (United States)

    Wilzbach, P.; Frazey, S.

    2005-05-01

    Productivities of resident salmonid populations, upland, and riparian areas in 25 small watersheds of coastal northern California were estimated and compared to determine if: 1) upland site productivity predicted riparian site productivity; 2) either upland or riparian site productivity predicted salmonid productivity; and 3) other parameters explained more of the variance in salmonid productivity than upland or riparian site productivity. Salmonid productivity was indexed by total salmonid biomass, length of age 1 fish, and percent habitat saturation. Upland and riparian site productivities were estimated using site indices for redwood (Sequoia sempervirens) and red alder (Alnus rubra), respectively. Upland and riparian site indices were correlated, but neither factor contributed to the best approximating models of salmonid biomass or fish length at age one. Salmonid biomass was best described by a positive relationship with drainage area, and length at age was best described by a positive relationship with percent of riparian hardwoods. Percent habitat saturation was not well described by any of the models constructed. Lack of a relationship between upland conifer and salmonid productivity suggests that management of land for timber productivity and component streams for salmonid production in these sites will require separate, albeit integrated, strategies.

  1. Regeneration Dynamics of Coast Redwood, a Sprouting Conifer Species: A Review with Implications for Management and Restoration

    Directory of Open Access Journals (Sweden)

    Kevin L. O’Hara

    2017-04-01

    Full Text Available Coast redwood (Sequoia sempervirens (Lamb. ex. D. Don Endl. is unique among conifer species because of its longevity, the great sizes of individual trees, and its propensity to reproduce through sprouts. Timber harvesting in the native redwood range along the coast of the western United States has necessitated restoration aimed to promote old forest structures to increase the total amount of old forest, the connectivity between old forests, and to enhance the resiliency of these ecosystems. After disturbance or harvest, healthy redwood stumps sprout vigorously, often producing dozens of sprouts within two years of disturbance. These sprouts form highly aggregated spatial patterns because they are clustered around stumps that may number less than 50 ha−1. Thinning of sprouts can accelerate individual tree growth, providing an effective restoration strategy to accelerate formation of large trees and old forest structures or increase stand growth for timber production. However, management, including restoration activities, is a contentious issue throughout the native range of redwood because of the history of overexploitation of this resource and perceptions that overexploitation is continuing. This paper reviews the science of early stand dynamics in coast redwood and their implications for restoration and other silvicultural strategies.

  2. Plant Uptake of Atmospheric Carbonyl Sulfide in Coast Redwood Forests

    Science.gov (United States)

    Campbell, J. E.; Whelan, M. E.; Berry, J. A.; Hilton, T. W.; Zumkehr, A.; Stinecipher, J.; Lu, Y.; Kornfeld, A.; Seibt, U.; Dawson, T. E.; Montzka, S. A.; Baker, I. T.; Kulkarni, S.; Wang, Y.; Herndon, S. C.; Zahniser, M. S.; Commane, R.; Loik, M. E.

    2017-12-01

    The future resilience of coast redwoods (Sequoia sempervirens) is now of critical concern due to the detection of a 33% decline in California coastal fog over the 20th century. However, ecosystem-scale measurements of photosynthesis and stomatal conductance are challenging in coast redwood forests, making it difficult to anticipate the impacts of future changes in fog. To address this methodological problem, we explore coastal variations in atmospheric carbonyl sulfide (COS or OCS), which could potentially be used as a tracer of these ecosystem processes. We conducted atmospheric flask campaigns in coast redwood sites, sampling at surface heights and in the canopy ( 70 m), at the University of California Landels-Hill Big Creek Reserve and Big Basin State Park. We simulated COS atmosphere-biosphere exchange with a high-resolution 3-D model to interpret these data. Flask measurements indicated a persistent daytime drawdown between the coast and the downwind forest (45 ± 6 ppt COS) that is consistent with the expected relationship between COS plant uptake, stomatal conductance, and gross primary production. Other sources and sinks of COS that could introduce noise to the COS tracer technique (soils, anthropogenic activity, nocturnal plant uptake, and surface hydrolysis on leaves) are likely to be small relative to daytime COS plant uptake. These results suggest that COS measurements may be useful for making ecosystem-scale estimates of carbon, water, and energy exchange in coast redwood forests.

  3. Sudden Oak Death-Induced Tanoak Mortality in Coast Redwood Forests: Current and Predicted Impacts to Stand Structure

    Directory of Open Access Journals (Sweden)

    Kevin L. O’Hara

    2010-08-01

    Full Text Available Tanoak (Notholithocarpus densiflorus syn. Lithocarpus densiflorus is one of the most widespread and abundant associates of coast redwood (Sequoia sempervirens, but little is known about the structural relationships between these two species. Knowledge of such relationships is essential for a thorough understanding of the impacts of sudden oak death (caused by the exotic pathogen Phytophthora ramorum, which is currently decimating tanoak populations throughout the redwood range. In this study, we utilized a stratified plot design and a stand reconstruction technique to assess structural impacts, at present and in the future, of this emerging disease. We found that residual trees in diseased plots were more aggregated than trees in unaffected plots, and we predicted that the loss of tanoak will lead to the following short-term changes: greater average diameter, height, height-to-live-crown, and crown length, as well as an increase in average nearest neighbor differences for diameter, height, and crown length. In addition, plots lacking tanoak (living or dead—as compared to plots with tanoak—exhibited greater average diameter and increased nearest neighbor differences with regard to diameter, height, and crown length. We also conducted a preliminary exploration of how sudden oak death-induced structural changes compare with typical old-growth characteristics, and how this disease may affect the structure of old-growth forests.

  4. The right tree for the job? perceptions of species suitability for the provision of ecosystem services.

    Science.gov (United States)

    Smaill, Simeon J; Bayne, Karen M; Coker, Graham W R; Paul, Thomas S H; Clinton, Peter W

    2014-04-01

    Stakeholders in plantation forestry are increasingly aware of the importance of the ecosystem services and non-market values associated with forests. In New Zealand, there is significant interest in establishing species other than Pinus radiata D. Don (the dominant plantation species) in the belief that alternative species are better suited to deliver these services. Significant risk is associated with this position as there is little objective data to support these views. To identify which species were likely to be planted to deliver ecosystem services, a survey was distributed to examine stakeholder perceptions. Stakeholders were asked which of 15 tree attributes contributed to the provision of five ecosystem services (amenity value, bioenergy production, carbon capture, the diversity of native habitat, and erosion control/water quality) and to identify which of 22 candidate tree species possessed those attributes. These data were combined to identify the species perceived most suitable for the delivery of each ecosystem service. Sequoia sempervirens (D.Don) Endl. closely matched the stakeholder derived ideotypes associated with all five ecosystem services. Comparisons to data from growth, physiological and ecological studies demonstrated that many of the opinions held by stakeholders were inaccurate, leading to erroneous assumptions regarding the suitability of most candidate species. Stakeholder perceptions substantially influence tree species selection, and plantations established on the basis of inaccurate opinions are unlikely to deliver the desired outcomes. Attitudinal surveys associated with engagement campaigns are essential to improve stakeholder knowledge, advancing the development of fit-for-purpose forest management that provides the required ecosystem services.

  5. Structure and Composition of Old-Growth and Unmanaged Second-Growth Riparian Forests at Redwood National Park, USA

    Directory of Open Access Journals (Sweden)

    Christopher R. Keyes

    2014-02-01

    Full Text Available Restoration of second-growth riparian stands has become an important issue for managers of redwood (Sequoia sempervirens [D. Don] Endl. forest reserves. Identifying differences between old-growth and second-growth forest vegetation is a necessary step in evaluating restoration needs and targets. The objective of this study was to characterize and contrast vegetation structure and composition in old-growth and unmanaged second-growth riparian forests in adjacent, geomorphologically similar watersheds at Redwood National Park. In the old-growth, redwood was the dominant overstory species in terms of stem density, basal area, and importance values. Second-growth was dominated by red alder (Alnus rubra Bong., Douglas-fir (Pseudotsuga menziesii [Mirbel] Franco, and redwood. Understory species were similar in both forests, with several key differences: Oxalis oregana Nutt. and Trillium ovatum Pursh had greater importance values in the old-growth, and Vaccinium parvifolium Sm., Dryopteris spp. and sedges Carex spp. had greater importance values in the second-growth. Notable differences in structure and composition suggest that restoration practices such as thinning could expedite the acquisition of old-growth characteristics in second-growth riparian forests.

  6. 76 FR 14068 - Notice of Inventory Completion: U.S. Department of Agriculture, Forest Service, Sequoia National...

    Science.gov (United States)

    2011-03-15

    ..., University of California at Berkeley, Berkeley, CA, for research and storage. While conducting NAGPRA... ethnographic study. Ethnographic data places the CA-KER-14 site close to the village hamlets of the Tubatulabal... in Yokut territory) compose the Tubatulabal (Smith 1978). Burial customs based on ethnographic data...

  7. 78 FR 78326 - Revision of the Land Management Plans for the Inyo, Sierra and Sequoia National Forests

    Science.gov (United States)

    2013-12-26

    ... posted to the Region 5 Web site at http://www.fs.usda.gov/main/r5/landmanagement/planning . The Forest..., U.S. Forest Service, Ecosystem Planning Staff, 1323 Club Drive, Vallejo, CA 94592. Comments or...-8823. Individuals who use telecommunication devices for the deaf (TDD) may call the Federal Information...

  8. The Bachelor of Arts: Slipping into the Twilight or Facing a New Dawn?

    Science.gov (United States)

    Gannaway, Deanne

    2015-01-01

    Undergraduate students have historically engaged with the humanities and social sciences through the Bachelor of Arts (BA) degree programme. Recent experiences suggest that the relevance and the value of the degree to the modern world is now being challenged: populist press questions the value of the humanities to the modern knowledge economy;…

  9. The universal machine from the dawn of computing to digital consciousness

    CERN Document Server

    Watson, Ian

    2012-01-01

    In less than a human lifetime, computers are transforming economies and societies like no other human invention. This book looks past technology to introduce comuputing pioneers: Babbage, Turing, Wozniak and Jobs, Bill Gates, Tim Berners-Lee, Mark Zuckerberg.

  10. Ultrafast, laser-based, x-ray science: the dawn of atomic-scale cinematography

    International Nuclear Information System (INIS)

    Barty, C.P.J.

    2000-01-01

    The characteristics of ultrafast chirped pulse amplification systems are reviewed. Application of ultrafast chirped pulse amplification to the generation of femtosecond, incoherent, 8-keV line radiation is outlined and the use of femtosecond laser-based, x-rays for novel time-resolved diffraction studies of crystalline dynamics with sub-picosecond temporal resolution and sub-picometer spatial resolution is reviewed in detail. Possible extensions of laser-based, x-ray technology and evaluation of alternative x-ray approaches for time-resolved studies of the atomic scale dynamics are given. (author)

  11. Mega sporting events: A poisoned chalice or a new dawn for low- and middle-income

    Directory of Open Access Journals (Sweden)

    Mark Tomlinson

    2011-06-01

    Full Text Available Mega sporting events in South Africa, which has the largest number of HIV-positive people in the world, and India, with 1.8 million deaths of children under 5 each year and 52 million stunted children, raise questions about the effective and, as importantly, the moral imperative of spending billions of dollars to host a sporting event. From a health perspective, selling alcohol and debt tarnishes further the notion of any intangible benefits of mega events to low- and middle-income countries.

  12. [The dawn of radiotherapy, between strokes of genius, dramas and controversies].

    Science.gov (United States)

    Cosset, J-M

    2016-10-01

    Radiotherapy is 120 years old. A few months only after the discoveries of Roentgen, Becquerel and Marie and Pierre Curie, a few scientists tried to use the newly discovered rays to treat patients. The question of the name of the first "radiation therapist" remains debated. Although often proposed, Emil Grubbé from Chicago seems to have been disqualified. Leopold Freund from Vienna treated a benign cutaneous lesion. Finally, Victor Despeignes from Lyon appears to be the most serious candidate, having treated in 1896 a gastric cancer, and obtaining a very significant tumour regression. The pioneers of radiotherapy paid a heavy tribute to the development of the specialty; a number of them appears on the - most probably incomplete - list of 352 names engraved on the monument dedicated to the "radiation martyrs" in Hamburg. We must keep in mind that it is only within a few years that a handful of brilliant pioneers built the foundations on which radiotherapy could emerge. Copyright © 2016 Société française de radiothérapie oncologique (SFRO). Published by Elsevier SAS. All rights reserved.

  13. Nuclear dawn F. E. Simon and the race for atomic weapons in World War II

    CERN Document Server

    McRae, Kenneth D

    2014-01-01

    This book provides a rounded biography of Franz (later Sir Francis) Simon, his early life in Germany, his move to Oxford in 1933, and his experimental contributions to low temperature physics approximating absolute zero. After 1939 he switched his research to nuclear physics, and is credited with solving the problem of uranium isotope separation by gaseous diffusion for the British nuclear programme Tube Alloys. The volume is distinctive for its inclusion of source materials not available to previous researchers, such as Simon's diary and his correspondence with his wife, and for a fresh, well-informed insider voice on the five-power nuclear rivalry of the war years. The work also draws on a relatively mature nuclear literature to attempt a comparison and evaluation of the five nuclear rivals in wider political and military context, and to identify the factors, or groups of factors, that can explain the results.

  14. Artificial Hair: By the Dawn to Automatic Biofibre® Hair Implant

    Directory of Open Access Journals (Sweden)

    Maria Roccia

    2017-12-01

    In 1995 the European Union (UE recognised the artificial hair implant as a legitimate medical treatment and outlined the rules related to that procedure. In 1996, biocompatible fibres (Biofibre® produced by Medicap® Italy were approved by the UE Authorities and by the Australian Therapeutic Goods Administration (TGA as medical devices for hair implant. An effective medical protocol was developed during the following years to provide correct guidelines for appropriate treatment, and to reduce possible related complications. Automatic Biofibre® hair implant represents the last achievement in this hair restoration technique with significant advantages for the patients.

  15. The receptor binding domain of MERS-CoV: The dawn of vaccine and treatment development

    Directory of Open Access Journals (Sweden)

    Nan Zhou

    2014-03-01

    Full Text Available The newly emerged Middle East respiratory syndrome coronavirus (MERS-CoV is becoming another “SARS-like” threat to the world. It has an extremely high death rate (∼50% as there is no vaccine or efficient therapeutics. The identification of the structures of both the MERS-CoV receptor binding domain (RBD and its complex with dipeptidyl peptidase 4 (DPP4, raises the hope of alleviating this currently severe situation. In this review, we examined the molecular basis of the RBD-receptor interaction to outline why/how could we use MERS-CoV RBD to develop vaccines and antiviral drugs.

  16. Strong Stellar-driven Outflows Shape the Evolution of Galaxies at Cosmic Dawn

    Energy Technology Data Exchange (ETDEWEB)

    Fontanot, Fabio; De Lucia, Gabriella [INAF—Astronomical Observatory of Trieste, via G.B. Tiepolo 11, I-34143 Trieste (Italy); Hirschmann, Michaela [Sorbonne Universités, UPMC-CNRS, UMR7095, Institut d’Astrophysique de Paris, F-75014 Paris (France)

    2017-06-20

    We study galaxy mass assembly and cosmic star formation rate (SFR) at high redshift (z ≳ 4), by comparing data from multiwavelength surveys with predictions from the GAlaxy Evolution and Assembly (gaea) model. gaea implements a stellar feedback scheme partially based on cosmological hydrodynamical simulations, which features strong stellar-driven outflows and mass-dependent timescales for the re-accretion of ejected gas. In previous work, we have shown that this scheme is able to correctly reproduce the evolution of the galaxy stellar mass function (GSMF) up to z ∼ 3. We contrast model predictions with both rest-frame ultraviolet (UV) and optical luminosity functions (LFs), which are mostly sensitive to the SFR and stellar mass, respectively. We show that gaea is able to reproduce the shape and redshift evolution of both sets of LFs. We study the impact of dust on the predicted LFs, and we find that the required level of dust attenuation is in qualitative agreement with recent estimates based on the UV continuum slope. The consistency between data and model predictions holds for the redshift evolution of the physical quantities well beyond the redshift range considered for the calibration of the original model. In particular, we show that gaea is able to recover the evolution of the GSMF up to z ∼ 7 and the cosmic SFR density up to z ∼ 10.

  17. STAR FORMATION AND DUST OBSCURATION AT z ∼ 2: GALAXIES AT THE DAWN OF DOWNSIZING

    International Nuclear Information System (INIS)

    Pannella, M.; Carilli, C. L.; Owen, F. N.; Strazzullo, V.; Daddi, E.; Aussel, H.; McCracken, H. J.; Mellier, Y.; Renzini, A.; Civano, F.; Koekemoer, A. M.; Schinnerer, E.; Scoville, N.; Smolcic, V.; Salvato, M.; Taniguchi, Y.; Kneib, J. P.; Ilbert, O.; Thompson, D.; Willott, C. J.

    2009-01-01

    We present first results of a study aimed to constrain the star formation rate (SFR) and dust content of galaxies at z ∼ 2. We use a sample of BzK-selected star-forming galaxies, drawn from the Cosmic Evolution Survey, to perform a stacking analysis of their 1.4 GHz radio continuum as a function of different stellar population properties, after cleaning the sample from contamination by active galactic nuclei. Dust unbiased SFRs are derived from radio fluxes assuming the local radio-IR correlation. The main results of this work are: (1) specific star formation rate (SSFR)s are constant over about 1 dex in stellar mass and up to the highest stellar mass probed, (2) the dust attenuation is a strong function of galaxy stellar mass with more massive galaxies being more obscured than lower mass objects, (3) a single value of the UV extinction applied to all galaxies would lead to a gross underestimate of the SFR in massive galaxies, (4) correcting the observed UV luminosities for dust attenuation based on the Calzetti recipe provides results in very good agreement with the radio derived ones, (5) the mean SSFR of our sample steadily decreases by a factor of ∼4 with decreasing redshift from z = 2.3 to 1.4 and a factor of ∼40 down the local universe. These empirical SFRs would cause galaxies to dramatically overgrow in mass if maintained all the way to low redshifts; we suggest that this does not happen because star formation is progressively quenched, likely starting from the most massive galaxies.

  18. The dawn of paraconsistency: Russia's logical thought in the turn of XX century

    Directory of Open Access Journals (Sweden)

    Valentin A. Bazhanov

    2011-06-01

    Full Text Available The paper deals with the factors which enabled N. A. Vasiliev to put forward in 1910 - 12 the idea of logics free of the laws of contradiction and excluded middle, the idea of metalogic and to construct his imaginary logic as novel non-classical system. It is shown that background of Vasiliev's ideas lies deeply in Russia's culture and particular approach to logical discourse. Several Russian scholars expressed ideas similar to Vasiliev's though not in such explicit form. This period might be called the prehistory of paraconsistency. Real history of paraconsistency starts with N.C.A. da Costa's works.

  19. The dawn of a new era in onco-cardiology: The Kumamoto Classification.

    Science.gov (United States)

    Sueta, Daisuke; Tabata, Noriaki; Akasaka, Tomonori; Yamashita, Takayoshi; Ikemoto, Tomokazu; Hokimoto, Seiji

    2016-10-01

    The term "onco-cardiology" has been used in reference to cardiotoxicity in the treatment of malignant disease. In actual clinical situations, however, cardiovascular disease (CVD) associated with malignant disease and the concurrence of atherosclerotic disease with malignant disease are commonly observed, complicating the course of treatment. Patients with malignant disease associated with coronary artery disease often die from the cardiovascular disease, so it is essential to classify these disease states. Additionally, the prevalence of these classifications makes it easy to manage patients with malignant disease and coronary artery disease. We divided the broad field of onco-cardiology into 4 classifications based on clinical scenarios (CSs): CS1 represents the so-called paraneoplastic syndrome. CS2 represents cardiotoxicity during treatment of malignant diseases. CS3 represents the concurrence of atherosclerotic disease with malignant disease, and CS4 represents cardiovascular disease with benign tumors. This classification facilitates the management of patients with malignant disease and coronary artery disease by promoting not only the primary but also the secondary prevention of CVD. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  20. A basal dinosaur from the dawn of the dinosaur era in southwestern Pangaea.

    Science.gov (United States)

    Martinez, Ricardo N; Sereno, Paul C; Alcober, Oscar A; Colombi, Carina E; Renne, Paul R; Montañez, Isabel P; Currie, Brian S

    2011-01-14

    Upper Triassic rocks in northwestern Argentina preserve the most complete record of dinosaurs before their rise to dominance in the Early Jurassic. Here, we describe a previously unidentified basal theropod, reassess its contemporary Eoraptor as a basal sauropodomorph, divide the faunal record of the Ischigualasto Formation with biozones, and bracket the formation with (40)Ar/(39)Ar ages. Some 230 million years ago in the Late Triassic (mid Carnian), the earliest dinosaurs were the dominant terrestrial carnivores and small herbivores in southwestern Pangaea. The extinction of nondinosaurian herbivores is sequential and is not linked to an increase in dinosaurian diversity, which weakens the predominant scenario for dinosaurian ascendancy as opportunistic replacement.

  1. Dawning of Herpetological Conservation and Biology: A special welcome to your new journal

    Science.gov (United States)

    Bury, R. Bruce; McCallum, Malcolm L.; Trauth, Stanley E.; Saumure, Raymond A.

    2006-01-01

    Inception of a new journal in herpetology is a rare event. The first discussion of developing a journal with an emphasis on natural history and conservation occurred among a subset of us (McCallum, others), while at the 2005 joint annual meeting of the SSAR/HL/ASIH in Tampa, Florida. Some of the initial questions we posed for a new herpetological journal were as follows: (1) is there a need; (2) audience; and (3) support? If any one of these did not exist, then the concept should be abandoned or modified. We critically examined these questions through discussions with many individuals and informal surveys performed on the Partners in Amphibian and Reptile Conservation (PARC) listserver (parc@listserv.uga.edu) and other forums. Early on, it was obvious to us that there was strong demand for an outlet serving natural history, field ecology and conservation studies, especially descriptive investigations and management case studies that appeared to lack a home in other journals. The road traveled since those discussions has been fast paced, culminating in this 2006 launch of Herpetological Conservation and Biology (HCB).

  2. From improvement towards enhancement : A regenesis of environmental law at the dawn of the anthropocene

    NARCIS (Netherlands)

    Somsen, Han; Brownsword, Roger; Young, Karen; Scotford, Eloise

    2016-01-01

    This paper discusses a host of what mostly are still isolated ad hoc technology-driven initiatives, usually in support of human (rights) imperatives, which effectively endeavour to engineer and re-engineer living and non-living environments in ways that have no natural, legal or historical

  3. From the Dawn of Humanity to the 21st Century: Creativity as an Enduring Survival Skill

    Science.gov (United States)

    Puccio, Gerard J.

    2017-01-01

    While the scientific investigation into creativity is a recent phenomenon, creative thinking has always been a crucial feature of humanity. The ability to creatively solve problems enabled early humans to survive and laid the foundation for the creative imagination that has resulted in our modern society. While most humans no longer face physical…

  4. SPIRAL2 at GANIL: At the Dawn of a New Era

    International Nuclear Information System (INIS)

    Gales, S.

    2010-01-01

    The exploration of unknown region of the nuclear mass chart, in particular, the neutron rich side, raised new and challenging physics issues in the understanding of nuclei far from stability. The physics of weakly bound systems, the appearance of shell quenching, the interface with astrophysical problems prompted the study of new generation of ''Rad ioactive Beam Facilities'' with high luminosity and the development of associated new experimental tools.GANIL presently offers unique opportunities in nuclear physics and many other fields. With the construction of SPIRAL2 over the next few years, GANIL is in a good position to retain its world-leading capability even though it faces strong competition from new and upgraded ISOL and fragmentation facilities. As selected by the ESFRI committee, the next generation of ISOL facility in Europe is represented by the SPIRAL2 project to be built at GANIL (Caen, France). SPIRAL2 is based on a high power, CW, superconducting LINAC, delivering 5 mA of deuteron beams at 40 MeV (200 KW) directed on a C converter+ Uranium target and producing therefore more 10 13 fissions/s. The expected radioactive beams intensities in the mass range from A = 60 to A = 140, will surpass by two order of magnitude any existing facilities in the world. These unstable atoms will be available at energies between few KeV/n to 15 MeV/n. The same driver will accelerate high intensity (100* A to 1 mA), heavier ions (Ar up to Xe) at maximum energy of 14 MeV/n.In applied areas SPIRAL2 is considered as a powerful variable energy neutron source. The Neutrons For Science collaboration (NFS) is proposing a physics program on fission induced by fast neutrons as well as fusion studies on materials.Under the 7FP program of European Union called 'Preparatory phase', the SPIRAL2 project has been granted a budget of about 4 MEuro to build up an international consortium around this new venture. Regarding the future physics program a call for Letter of intents has been launched in Oct 2006 and 8 large International collaborations has been built up around new instruments for SPIRAL2. The status of the construction of SPIRAL2 accelerator and technical R and D programs for physics instrumentation (detectors, spectrometers) in collaboration with EU and International partners will be presented.

  5. The ATLAS Liquid Argon Calorimeters At The Dawn Of LHC Run-2

    CERN Document Server

    Camincher, Clement; The ATLAS collaboration

    2015-01-01

    The Liquid Argon Calorimeters are key sub-detectors of ATLAS. They are essential to detect and measure the properties of electrons, photons and are also crucial for jets and missing transverse energy measurements. During the LHC shutdown in 2013-2014, the hardware and the software have been optimized to improve their reliability. The first collisions allows to assess the performance of the detector in the LHC Run-2 real conditions. In view of the next LHC Run in 2020, an upgrade of the level-1 trigger system is also under test. A status at the restart of the LHC Run-2 is presented in this document.

  6. Cone Beam Computed Tomography-Dawn of A New Imaging Modality in Orthodontics

    Science.gov (United States)

    Mamatha, J; Chaitra, K R; Paul, Renji K; George, Merin; Anitha, J; Khanna, Bharti

    2015-01-01

    Today, we are in a world of innovations, and there are various diagnostics aids that help to take a decision regarding treatment in a well-planned way. Cone beam computed tomography (CBCT) has been a vital tool for imaging diagnostic tool in orthodontics. This article reviews case reports during orthodontic treatment and importance of CBCT during the treatment evaluation. PMID:26225116

  7. Dusk/dawn atmospheric asymmetries on tidally-locked satellites: O2 at Europa

    Science.gov (United States)

    Oza, Apurva V.; Johnson, Robert E.; Leblanc, François

    2018-05-01

    We use a simple analytic model to examine the effect of the atmospheric source properties on the spatial distribution of a volatile in a surface-bounded atmosphere on a satellite that is tidally-locked to its planet. Spatial asymmetries in the O2 exosphere of Europa observed using the Hubble Space Telescope appear to reveal on average a dusk enhancement in the near-surface ultraviolet auroral emissions. Since the hop distances in these ballistic atmospheres are small, we use a 1-D mass conservation equation to estimate the latitudinally-averaged column densities produced by suggested O2 sources. Although spatial asymmetries in the plasma flow and in the surface properties certainly affect the spatial distribution of the near-surface aurora, the dusk enhancements at Europa can be understood using a relatively simple thermally-dependent source. Such a source is consistent with the fact that radiolytically produced O2 permeates their porous regoliths and is not so sensitive to the local production rate from ice. The size of the shift towards dusk is determined by the ratio of the rotation rate and atmospheric loss rate. A thermally-dependent source emanating from a large reservoir of O2 permeating Europa's icy regolith is consistent with the suggestion that its subsurface ocean might be oxidized by subduction of such radiolytic products.

  8. At the dawn of delegation? Experiences and attitudes of general practitioners in Germany - a questionnaire survey.

    Science.gov (United States)

    Goetz, Katja; Kornitzky, Anna; Mahnkopf, Janis; Steinhäuser, Jost

    2017-12-19

    In the future, 'delegation' as task shifting from general practitioners (GPs) to non-physicians will be important in primary care. Therefore, the aim of this study was to evaluate the attitudes towards the concept of task shifting and to identify predictors of a positive attitude towards task shifting from the perspective of GPs. This cross-sectional questionnaire study analysed attitudes towards the concept of task shifting and delegated tasks from the perspective of GPs who were recruited in the German federal state of Schleswig-Holstein. Descriptive statistics and binary regression analyses were computed to identify potential predictors of a positive attitude towards task shifting. Out of 1538 questionnaires distributed, 577 GP questionnaires were returned (response rate: 37.5%). A total of 53.2% of the respondents were male, and 37.3% were female. A positive attitude regarding task shifting was shown by 49% of the participating GPs. The highest level of agreement (95.2%) was found for time savings with task shifting, and a lower agreement (39%) was found regarding the lack of clarity concerning the responsibilities and legal aspects with regards to task shifting. The most frequently delegated tasks were recording electrocardiograms and measuring blood glucose levels. A positive attitude towards task shifting was positively associated with higher job satisfaction and a need for qualified staff. Our sample of GPs for this study was very open-minded towards the concept of task shifting. Germany is just beginning this delegation, but the implementation of task shifting depends on different aspects, such as legal requirements, adequate payment and qualified staff. Finally, there is a need for continuing professional development in primary care teams, especially for non-clinical practice staff.

  9. Radiation Backgrounds at Cosmic Dawn: X-Rays from Compact Binaries

    Science.gov (United States)

    Madau, Piero; Fragos, Tassos

    2017-05-01

    We compute the expected X-ray diffuse background and radiative feedback on the intergalactic medium (IGM) from X-ray binaries prior to and during the epoch of reionization. The cosmic evolution of compact binaries is followed using a population synthesis technique that treats separately neutron stars and black hole binaries in different spectral states and is calibrated to reproduce the observed X-ray properties of galaxies at z ≲ 4. Together with an updated empirical determination of the cosmic history of star formation, recent modeling of the stellar mass-metallicity relation, and a scheme for absorption by the IGM that accounts for the presence of ionized H II bubbles during the epoch of reionization, our detailed calculations provide refined predictions of the X-ray volume emissivity and filtered radiation background from “normal” galaxies at z ≳ 6. Radiative transfer effects modulate the background spectrum, which shows a characteristic peak between 1 and 2 keV. Because of the energy dependence of photoabsorption, soft X-ray photons are produced by local sources, while more energetic radiation arrives unattenuated from larger cosmological volumes. While the filtering of X-ray radiation through the IGM slightly increases the mean excess energy per photoionization, it also weakens the radiation intensity below 1 keV, lowering the mean photoionization and heating rates. Numerical integration of the rate and energy equations shows that the contribution of X-ray binaries to the ionization of the bulk IGM is negligible, with the electron fraction never exceeding 1%. Direct He I photoionizations are the main source of IGM heating, and the temperature of the largely neutral medium in between H II cavities increases above the temperature of the cosmic microwave background (CMB) only at z ≲ 10, when the volume filling factor of H II bubbles is already ≳0.1. Therefore, in this scenario, it is only at relatively late epochs that neutral intergalactic hydrogen may be observable in 21 cm emission against the CMB.

  10. From the Dawn of Nuclear Physics to the First Atomic Bombs

    Science.gov (United States)

    Woolbright, Stephen; Schumacher, Jacob; Michonova-Alexova, Ekaterina

    2014-03-01

    This work gives a fresh look at the major discoveries leading to nuclear fission within the historical perspective. The focus is on the main contributors to the discoveries in nuclear physics, leading to the idea of fission and its application to the creation of the atomic bombs used at the end of the World War II. The present work is a more complete review on the history of the nuclear physics discoveries and their application to the atomic bomb. In addition to the traditional approach to the topic, focusing mainly on the fundamental physics discoveries in Europe and on the Manhattan Project in the United States, the nuclear research in Japan is also emphasized. Along with that, a review of the existing credible scholar publications, providing evidence for possible atomic bomb research in Japan, is provided. Proper credit is given to the women physicists, whose contributions had not always been recognized. Considering the historical and political situation at the time of the scientific discoveries, thought-provoking questions about decision-making, morality, and responsibility are also addressed. The work refers to the contributions of over 20 Nobel Prize winners. EM-A is grateful to Prof. Walter Grunden and to Prof. Emeritus Shadahiko Kano, Prof. Emeritus Monitori Hoshi for sharing their own notes, documents, and references, and to CCCU for sponsoring her participation in the 2013 Nuclear Weapons Seminar in Japan.

  11. DAWN GRAND MAP CERES SMOOTHED HYDROGEN MAP V1.0

    Data.gov (United States)

    National Aeronautics and Space Administration — A smoothed, global map of the concentration of hydrogen within the regolith of asteroid 1 Ceres on two-degree equal-angle pixels is provided. Hydrogen concentrations...

  12. The German energy industry in the 21. century dawn of a new era?

    International Nuclear Information System (INIS)

    Kasper, K.J.

    2000-01-01

    Having crossed the threshold into the new millennium the power utilities business finds itself confronted by new challenges. In worldwide terms the uppermost objective is, while taking due account of climatic factors and of the obligations resulting from the various World Climate Conferences held so far, to ensure a sufficient and reliable supply of energy for the world's growing population. The gap between the supply of energy and the demand for energy must be closed. In European terms the situation looks a little different. The supply structure is excellent - characterized more by over-capacity than energy shortage. As a result of the liberalization process that has started, the European power utilities have undergone vital changes. Market influences on the power utilities corporations are massive. Fusions and takeovers are the order of the day. The German power business, like others in Europe, is feeling the effects of these two aspects. Also, at national level in Germany, there is the attempt to reach a new energy consensus. An agreement was reached on the 14. of June 2000 between the German federal government and the power utilities. This laid down regulations on the future operation of German nuclear power plants and the disposal of spent fuel elements - to apply up until the government's planned withdrawal from nuclear power. However, the politicians have yet to answer the question of how, in the long term, a sensibly balanced German energy mix might look. There is not as yet - nor in the foreseeable future is there likely to be - an energy consensus in Germany supported by all social and political groups. The respective approaches and ideas differ too widely. The failure, in the so-called 'Energy dialog 2000', of political parties, environmental organizations, and representatives from industry to achieve any results that might point the way forward and tell us where we are heading shows this all too clearly. (author)

  13. A golden age or a false dawn? Energy efficiency in UK competitive energy markets

    International Nuclear Information System (INIS)

    Eyre, N.

    1998-01-01

    Liberalisation of energy markets may affect the prospects for energy efficiency in a variety of ways. Downward pressure on prices will reduce incentives for efficiency and the end of a supply monopoly makes more difficult mandating demand side management programmes. On the other hand, the removal of price controls could end some regulatory disincentives, and liberalisation enables suppliers to market energy efficiency bundled with energy units. The overall effects of liberalisation for energy efficiency are therefore complex. This paper focuses on the effects of liberalisation on those characteristics of energy markets which underpin long-term energy inefficiency. These barriers to energy efficiency have been shown to arise from fundamental features of traditional utility markets - notably centralisation, commoditization and the complexity of demand side investment. The extent to which these will be altered in liberalised markets in the UK is considered. It is concluded that some important market imperfections are not addressed by competition in the supply of energy commodities. However, more fundamental changes may in the longer term encourage more differentiation in supply markets, in which there could be higher priority for energy efficiency. The policy measures which might encourage the process are discussed. (author)

  14. Traumatic Brain Injury and Hyperbaric Oxygen Therapy Dawn of a New Day

    Science.gov (United States)

    2017-09-07

    0 ... 7251 Mir-ID I 0 M.fll 73a Ocl- cll I 0 Mlr-C& 𔃻JIB ,.,..Ill 0 0 Mir-OS 𔄂 Mir-ID I 0 Mir-DI 15151 Jul .. 0 0 llOw-OI 7ll50 Jul.(J7 0 0...2ATA 2.4ATA • percent Increased circulating stem cells and better cognitive performance in traumatic brain injury subjects following hyperbaric...CD34+ bone-marrowderived stem /progenitor cells (SPCs) following HB02 • Heyboer showed a potential dose-response relation in CD34+ and CD45-dim, with

  15. Music Audiences 3.0: Concert-Goers’ Psychological Motivations at the Dawn of Virtual Reality

    Directory of Open Access Journals (Sweden)

    Jean-Philippe Charron

    2017-05-01

    Full Text Available Reviewing consumers’ motivations to attend performances in a continuously evolving social and technological context is essential because live concerts generate an important and growing share of revenues for the music industry. Evolving fans’ preferences and technological innovations constantly alter the way music is distributed and consumed. In a marketing 3.0 era, what consumers do with music is becoming more significant than simply owning or listening to a song. These changes are not only blurring the lines between production and consumption (i.e., co-creation, but also distorting the concept of live attendance altogether. Although mediated performances typically lack presence and authenticity, recent advances in immersive technologies, such as spherical videos and virtual reality goggles, could represent a new form of experiencing live music.

  16. Music Audiences 3.0: Concert-Goers' Psychological Motivations at the Dawn of Virtual Reality.

    Science.gov (United States)

    Charron, Jean-Philippe

    2017-01-01

    Reviewing consumers' motivations to attend performances in a continuously evolving social and technological context is essential because live concerts generate an important and growing share of revenues for the music industry. Evolving fans' preferences and technological innovations constantly alter the way music is distributed and consumed. In a marketing 3.0 era, what consumers do with music is becoming more significant than simply owning or listening to a song. These changes are not only blurring the lines between production and consumption (i.e., co-creation), but also distorting the concept of live attendance altogether. Although mediated performances typically lack presence and authenticity, recent advances in immersive technologies, such as spherical videos and virtual reality goggles, could represent a new form of experiencing live music.

  17. NASA's Origins and the Dawn of the Space Age. No. 10; Monographs in Aerospace History

    Science.gov (United States)

    Portree, David S. F.

    1998-01-01

    The twenty page narrative describes historical circumstances around Sputnik, the International Geophysical Year (IGY) and the formation of NASA from NACA in 1957-1958. Appendices include reproductions of relevant historical documents.

  18. Missileer: The Dawn, Decline, and Reinvigoration of America’s Intercontinental Ballistic Missile Operators

    Science.gov (United States)

    2017-06-01

    senior captains and field grade officers to operate and manage space systems. Over a two-decade period, it became the norm for approximately 80...will continue to present the same personnel challenges that have existed since the early 1960s. The operational norms established by Minuteman... capped B-2 numbers, cancelled small-ICBM program, ended W- 88 warhead production 24 Mar - Open Skies Treaty Allows for reciprocal unarmed aerial

  19. The Gateway to Cosmic Dawn: A Low Frequency Radio Telescope for the Deep Space Gateway

    Science.gov (United States)

    Tauscher, K.; Burns, J. O.; Monsalve, R.; Rapetti, D.

    2018-02-01

    We suggest that, with a suitable antenna and receiver, the Deep Space Gateway can be used to measure the highly redshifted, global 21-cm signal from neutral hydrogen, a spectral imprint of the history of the universe onto cosmic background radiation.

  20. Medical tourism and reproductive outsourcing: the dawning of a new paradigm for healthcare.

    Science.gov (United States)

    Jones, C A; Keith, L G

    2006-01-01

    Medical tourism, a term that also can be used to describe medical outsourcing, is characterized by travel away from one's home region to procure treatment in another. It may take one of two forms: obligatory or elective. The former occurs when necessary treatments are unavailable or illegal in the place of origin. The latter includes elective and medically indicated procedures that, although available at the place of origin, may be delivered more quickly or in a more cost-effective manner in another location. Reproductive outsourcing is a special form of medical tourism that has quickly become an important area of present-day medicine because the changes of the last four decades have left all but the most advanced fertility centers breathless as they try to adjust their treatment protocols in effective and ethical manners. Legal and policy limitations have created a global environment where, in a rising number of instances, individuals and couples must travel elsewhere to procure fertility procedures that are unavailable back home. With low cost airfares to and from America, a growing number of "medical cartographers" have set out to map which places are the "best" (in terms of cost, effectiveness and timeliness), for what procedures, and for whom. On the other hand, physicians, legal experts and policy makers have only begun to shape how government and health care agencies should formally guide or regulate medical tourism. In doing so, a number of factors may challenge the limits of ethics, policy and legality in this most important trend in modern medicine.

  1. Ten Propositions Regarding Space Power: The Dawn of a Space Force

    Science.gov (United States)

    2006-01-01

    perspective, space contributions z 97will account for an estimated $209 billion in 1947- 1950-T 1960-T 1970- 1980- 1990- the 2006 global economy. 2 4 50 60...Assessmu~t o ational awareiess, rhe transportation industry, A{,OaO{ dampaigns in 2010 and financial markers. 7TN PWOPSOI()S ] JWARII ’G SPA(E POWER 71...red, manner thot pmvteets one vital secnty intei blue, anI gray forces. The goal is rapid, acca - ests. We wil deter theati to our intrets, anid rate

  2. The Dawn of Nuclear Photonics with Laser-based Gamma-rays

    International Nuclear Information System (INIS)

    Barty, C.J.

    2011-01-01

    A renaissance in nuclear physics is occurring around the world because of a new kind of incredibly bright, gamma-ray light source that can be created with short pulse lasers and energetic electron beams. These highly Mono-Energetic Gamma-ray (MEGa-ray) sources produce narrow, laser-like beams of incoherent, tunable gamma-rays and are enabling access and manipulation of the nucleus of the atom with photons or so called 'Nuclear Photonics'. Just as in the early days of the laser when photon manipulation of the valence electron structure of the atom became possible and enabling to new applications and science, nuclear photonics with laser-based gamma-ray sources promises both to open up wide areas of practical isotope-related, materials applications and to enable new discovery-class nuclear science. In the United States, the development of high brightness and high flux MEGa-ray sources is being actively pursued at the Lawrence Livermore National Laboratory in Livermore (LLNL), California near San Francisco. The LLNL work aims to create by 2013 a machine that will advance the state of the art with respect to source the peak brightness by 6 orders of magnitude. This machine will create beams of 1 to 2.3 MeV photons with color purity matching that of common lasers. In Europe a similar but higher photon energy gamma source has been included as part of the core capability that will be established at the Extreme Light Infrastructure Nuclear Physics (ELI-NP) facility in Magurele, Romania outside of Bucharest. This machine is expected to have an end point gamma energy in the range of 13 MeV. The machine will be co-located with two world-class, 10 Petawatt laser systems thus allowing combined intense-laser and gamma-ray interaction experiments. Such capability will be unique in the world. In this talk, Dr. Chris Barty from LLNL will review the state of the art with respect to MEGa-ray source design, construction and experiments and will describe both the ongoing projects around the world as well some of the exciting applications that these machines will enable. The optimized interaction of short-duration, pulsed lasers with relativistic electron beams (inverse laser-Compton scattering) is the key to unrivaled MeV-scale photon source monochromaticity, pulse brightness and flux. In the MeV spectral range, such Mono-Energetic Gamma-ray (MEGa-ray) sources can have many orders of magnitude higher peak brilliance than even the world's largest synchrotrons. They can efficiently perturb and excite the isotope-specific resonant structure of the nucleus in a manner similar to resonant laser excitation of the valence electron structure of the atom.

  3. Nietzsche’s New Dawn : Educating students to strive for better in a dynamic professional world

    NARCIS (Netherlands)

    H. Joosten (Henriëtta)

    2015-01-01

    markdownabstractAbstract Professional higher education is expected to educate large numbers of students to become innovative professionals within a time frame of three or four years. A mission impossible? Not necessarily, according to Henriëtta Joosten who is a philosopher as well as a teacher.

  4. Dawning of Hope: Practice of and Reflections on Indigenous Teacher Education in Taiwan

    Science.gov (United States)

    Chen, Shanhua

    2016-01-01

    Teachers more familiar with students' culture tend to use culturally relevant teaching methods to smooth students' learning. Most pre-service teachers in Taiwan lack sufficient training for multicultural competence to enable them to embrace indigenous students' culture and appropriate teaching approaches. In 2013, the Education Act for Indigenous…

  5. A Mitochondrial Paradigm of Metabolic and Degenerative Diseases, Aging, and Cancer: A Dawn for Evolutionary Medicine

    Science.gov (United States)

    Wallace, Douglas C.

    2005-01-01

    Life is the interplay between structure and energy, yet the role of energy deficiency in human disease has been poorly explored by modern medicine. Since the mitochondria use oxidative phosphorylation (OXPHOS) to convert dietary calories into usable energy, generating reactive oxygen species (ROS) as a toxic by-product, I hypothesize that mitochondrial dysfunction plays a central role in a wide range of age-related disorders and various forms of cancer. Because mitochondrial DNA (mtDNA) is present in thousands of copies per cell and encodes essential genes for energy production, I propose that the delayed-onset and progressive course of the age-related diseases results from the accumulation of somatic mutations in the mtDNAs of post-mitotic tissues. The tissue-specific manifestations of these diseases may result from the varying energetic roles and needs of the different tissues. The variation in the individual and regional predisposition to degenerative diseases and cancer may result from the interaction of modern dietary caloric intake and ancient mitochondrial genetic polymorphisms. Therefore the mitochondria provide a direct link between our environment and our genes and the mtDNA variants that permitted our forbears to energetically adapt to their ancestral homes are influencing our health today. PMID:16285865

  6. Enhanced Global Signal of Neutral Hydrogen Due to Excess Radiation at Cosmic Dawn

    Science.gov (United States)

    Feng, Chang; Holder, Gilbert

    2018-05-01

    We revisit the global 21 cm signal calculation incorporating a possible radio background at early times, and find that the global 21 cm signal shows a much stronger absorption feature, which could enhance detection prospects for future 21 cm experiments. In light of recent reports of a possible low-frequency excess radio background, we propose that detailed 21 cm calculations should include a possible early radio background.

  7. Extracorporeal Organ Support following Trauma: The Dawn of a New Era in Combat Casualty Critical Care

    Science.gov (United States)

    2013-01-01

    liver support has undergone significant technological advances. The Food and Drug Administration approved (December 2012) the Molecular Adsorbent Re...Williams & Wilkins Copyright © 2013 Lippincott Williams & Wilkins. Unauthorized reproduction of this article is prohibited. encephalopathy caused by...chronic liver disease decompen- sation. The Extracorporeal Liver Assist Device (ELAD) pro- vides continuous extracorporeal liver support with

  8. Competing Visions for Consumer Engagement in the Dawn of the Trump Administration.

    Science.gov (United States)

    Hwang, Ann; Garrett, Danielle; Miller, Michael

    Two different models of consumer engagement use largely the same language but represent 2 distinct paradigms: the first focuses on patients as partners in health care decision making and the second focuses on financial incentives/penalties for patients. While the 2 paradigms coexist to some degree, they have different implications particularly for populations with complex health and social needs. For these populations, financial barriers can undermine the ability to recognize and promote patients as partners in a system of integrated, coordinated care. We describe these 2 competing visions and their adoption to date and offer our assessment of future directions for consumer engagement.

  9. Heavy-ion collisions at the dawn of the large hadron collider era

    International Nuclear Information System (INIS)

    Takahashi, J.

    2011-01-01

    In this paper I present a review of the main topics associated with the study of heavy-ion collisions, intended for students starting or interested in the field. It is impossible to summarize in a few pages the large amount of information that is available today, after a decade of operations of the Relativistic Heavy Ion Collider and the beginning of operations at the Large Hadron Collider. Thus, I had to choose some of the results and theories in order to present the main ideas and goals. All results presented here are from publicly available references, but some of the discussions and opinions are my personal view, where I have made that clear in the text (author)

  10. Quasars at the Cosmic Dawn: effects on Reionization properties in cosmological simulations

    Science.gov (United States)

    Garaldi, Enrico; Compostella, Michele; Porciani, Cristiano

    2018-05-01

    We study a model of cosmic reionization where quasars (QSOs) are the dominant source of ionizing photons at all relevant epochs. We employ a suite of adaptive hydrodynamical simulations post-processed with a multi-wavelength Monte Carlo radiative-transfer code and calibrate them in order to accurately reproduce the observed quasar luminosity function and emissivity evolution. Our results show that the QSO-only model fails in reproducing key observables linked to the Helium reionization, as the temperature evolution of the inter-galactic medium (IGM) and the HeII effective optical depth in synthetic Lyα spectra. Nevertheless, we find hints that an increased quasar contribution can explain recent measurements of a large inhomogeneity in the IGM at redshift z ~ 5. Finally, we devise a method capable of constraining the QSOs contribution to the reionization from the properties of the HeII Lyα forest at z ~ 3.5.

  11. A new Miocene baleen whale from Peru deciphers the dawn of cetotheriids

    Science.gov (United States)

    Marx, Felix G.; Lambert, Olivier; de Muizon, Christian

    2017-09-01

    Cetotheriidae are an iconic, nearly extinct family of baleen whales (Mysticeti) with a highly distinct cranial morphology. Their origins remain a mystery, with even the most archaic species showing a variety of characteristic features. Here, we describe a new species of archaic cetotheriid, Tiucetus rosae, from the Miocene of Peru. The new material represents the first mysticete from the poorly explored lowest portion of the highly fossiliferous Pisco Formation (allomember P0), and appears to form part of a more archaic assemblage than observed at the well-known localities of Cerro Colorado, Cerro los Quesos, Sud-Sacaco and Aguada de Lomas. Tiucetus resembles basal plicogulans (crown Mysticeti excluding right whales), such as Diorocetus and Parietobalaena, but shares with cetotheriids a distinct morphology of the auditory region, including the presence of an enlarged paroccipital concavity. The distinctive morphology of Tiucetus firmly places Cetotheriidae in the context of the poorly understood `cetotheres' sensu lato, and helps to resolve basal relationships within crown Mysticeti.

  12. MCNP capabilities at the dawn of the 21st century: Neutron-gamma applications

    International Nuclear Information System (INIS)

    Selcow, E.C.; McKinney, G.W.

    2000-01-01

    The Los Alamos National Laboratory Monte Carlo N-Particle radiation transport code, MCNP, has become an international standard for a wide spectrum of neutron-gamma radiation transport applications. These include nuclear criticality safety, radiation shielding, nuclear safeguards, nuclear well-logging, fission and fusion reactor design, accelerator target design, detector design and analysis, health physics, medical radiation therapy and imaging, radiography, decontamination and decommissioning, and waste storage and disposal. The latest version of the code, MCNP4C, was released to the Radiation Safety Information Computational Center (RSICC) in February 2000.This paper described the new features and capabilities of the code, and discusses the specific applicability to neutron-gamma problems. We will also discuss the future directions for MCNP code development, including rewriting the code in Fortran 90

  13. From dusk till dawn: nocturnal and diurnal pollination in the epiphyte Tillandsia heterophylla (Bromeliaceae).

    Science.gov (United States)

    Aguilar-Rodríguez, P A; Krömer, T; García-Franco, J G; MacSwiney G, M C

    2016-01-01

    In order to compare the effectiveness of diurnal and nocturnal pollinators, we studied the reproductive biology and pollinators of Tillandsia heterophylla E. Morren, an epiphytic tank bromeliad endemic to southeastern Mexico. Since anthesis in T. heterophylla is predominantly nocturnal but lasts until the following day, we hypothesised that this bromeliad would receive visits from both diurnal and nocturnal visitors, but that nocturnal visitors would be the most effective pollinators, since they arrive first to the receptive flower, and that bats would be the most frequent nocturnal visitors, given the characteristics of the nectar. Flowering of T. heterophylla began in May and lasted until July. The species is fully self-compatible, with an anthesis that lasts for ca. 15-16 h. Mean volume of nectar produced per flower was 82.21 μl, with a mean sugar concentration of 6.33%. The highest volume and concentration of nectar were found at 20:00 h, with a subsequent decline in both to almost zero over the following 12-h period. T. heterophylla has a generalist pollination system, since at least four different morphospecies of visitors pollinate its flowers: bats, moths, hummingbirds and bees. Most of the pollinating visits corresponded to bats and took place in the early evening, when stigma receptivity had already begun; making bats the probable pollinator on most occasions. However, diurnal pollinators may be important as a 'fail-safe' system by which to guarantee the pollination of T. heterophylla. © 2015 German Botanical Society and The Royal Botanical Society of the Netherlands.

  14. Yoshiki Hotta and the dawn of zebrafish molecular neurogenetics in Japan.

    Science.gov (United States)

    Higashijima, Shin-Ichi; Okamoto, Hitoshi

    2012-03-01

    Abstract: After coming back to Japan to work in the Department of Physics at the University of Tokyo, Yoshiki Hotta spent a year or so on searching for behavioral mutants of goldfish. Although this endeavor did not succeed, he remained an adamant supporter of the development of zebrafish research in Japan. Here we review how his support helped zebrafish neurogenetics in Japan gain a unique position in the world research community.

  15. Radiation Backgrounds at Cosmic Dawn: X-Rays from Compact Binaries

    Energy Technology Data Exchange (ETDEWEB)

    Madau, Piero [Department of Astronomy and Astrophysics, University of California, 1156 High Street, Santa Cruz, CA 95064 (United States); Fragos, Tassos [Geneva Observatory, University of Geneva, Chemin des Maillettes 51, 1290 Sauverny (Switzerland)

    2017-05-01

    We compute the expected X-ray diffuse background and radiative feedback on the intergalactic medium (IGM) from X-ray binaries prior to and during the epoch of reionization. The cosmic evolution of compact binaries is followed using a population synthesis technique that treats separately neutron stars and black hole binaries in different spectral states and is calibrated to reproduce the observed X-ray properties of galaxies at z ≲ 4. Together with an updated empirical determination of the cosmic history of star formation, recent modeling of the stellar mass–metallicity relation, and a scheme for absorption by the IGM that accounts for the presence of ionized H ii bubbles during the epoch of reionization, our detailed calculations provide refined predictions of the X-ray volume emissivity and filtered radiation background from “normal” galaxies at z ≳ 6. Radiative transfer effects modulate the background spectrum, which shows a characteristic peak between 1 and 2 keV. Because of the energy dependence of photoabsorption, soft X-ray photons are produced by local sources, while more energetic radiation arrives unattenuated from larger cosmological volumes. While the filtering of X-ray radiation through the IGM slightly increases the mean excess energy per photoionization, it also weakens the radiation intensity below 1 keV, lowering the mean photoionization and heating rates. Numerical integration of the rate and energy equations shows that the contribution of X-ray binaries to the ionization of the bulk IGM is negligible, with the electron fraction never exceeding 1%. Direct He i photoionizations are the main source of IGM heating, and the temperature of the largely neutral medium in between H ii cavities increases above the temperature of the cosmic microwave background (CMB) only at z ≲ 10, when the volume filling factor of H ii bubbles is already ≳0.1. Therefore, in this scenario, it is only at relatively late epochs that neutral intergalactic hydrogen may be observable in 21 cm emission against the CMB.

  16. Democratic Dawn? Civil Society and Elections in Myanmar 2010–2012

    Directory of Open Access Journals (Sweden)

    Michael Lidauer

    2012-01-01

    Full Text Available While the general elections in Myanmar in November 2010 were widely condemned, both national and international actors approached the by-elections of April 2012 as a political rite-de-passage to improve relations between the government and the opposition inside, and between the former pariah state and the international community outside the country. An undercurrent to the government-led transition process from an authoritarian to a formally more democratic regime was the development of a politically oriented civil society that found ways to engage in the electoral process. This article describes the emerging spaces of election-related civil society activism in the forms of civic and voter education, national election observation, and election-related agency in the media. Noting that, in particular, election observation offers connections for civil society to regional and international debates, the paper draws preliminary conclusions about further developments ahead of the general elections in Myanmar expected for 2015.

  17. Adrenocortical carcinoma: the dawn of a new era of genomic and molecular biology analysis.

    Science.gov (United States)

    Armignacco, R; Cantini, G; Canu, L; Poli, G; Ercolino, T; Mannelli, M; Luconi, M

    2018-05-01

    Over the last decade, the development of novel and high penetrance genomic approaches to analyze biological samples has provided very new insights in the comprehension of the molecular biology and genetics of tumors. The use of these techniques, consisting of exome sequencing, transcriptome, miRNome, chromosome alteration, genome, and epigenome analysis, has also been successfully applied to adrenocortical carcinoma (ACC). In fact, the analysis of large cohorts of patients allowed the stratification of ACC with different patterns of molecular alterations, associated with different outcomes, thus providing a novel molecular classification of the malignancy to be associated with the classical pathological analysis. Improving our knowledge about ACC molecular features will result not only in a better diagnostic and prognostic accuracy, but also in the identification of more specific therapeutic targets for the development of more effective pharmacological anti-cancer approaches. In particular, the specific molecular alteration profiles identified in ACC may represent targetable events by the use of already developed or newly designed drugs enabling a better and more efficacious management of the ACC patient in the context of new frontiers of personalized precision medicine.

  18. Strong Stellar-driven Outflows Shape the Evolution of Galaxies at Cosmic Dawn

    International Nuclear Information System (INIS)

    Fontanot, Fabio; De Lucia, Gabriella; Hirschmann, Michaela

    2017-01-01

    We study galaxy mass assembly and cosmic star formation rate (SFR) at high redshift (z ≳ 4), by comparing data from multiwavelength surveys with predictions from the GAlaxy Evolution and Assembly (gaea) model. gaea implements a stellar feedback scheme partially based on cosmological hydrodynamical simulations, which features strong stellar-driven outflows and mass-dependent timescales for the re-accretion of ejected gas. In previous work, we have shown that this scheme is able to correctly reproduce the evolution of the galaxy stellar mass function (GSMF) up to z ∼ 3. We contrast model predictions with both rest-frame ultraviolet (UV) and optical luminosity functions (LFs), which are mostly sensitive to the SFR and stellar mass, respectively. We show that gaea is able to reproduce the shape and redshift evolution of both sets of LFs. We study the impact of dust on the predicted LFs, and we find that the required level of dust attenuation is in qualitative agreement with recent estimates based on the UV continuum slope. The consistency between data and model predictions holds for the redshift evolution of the physical quantities well beyond the redshift range considered for the calibration of the original model. In particular, we show that gaea is able to recover the evolution of the GSMF up to z ∼ 7 and the cosmic SFR density up to z ∼ 10.

  19. A dawning demand for a new cannabis policy: A study of Swedish online drug discussions.

    Science.gov (United States)

    Månsson, Josefin

    2014-07-01

    This study examines how online discussions on drug policy are formulating an oppositional cannabis discourse in an otherwise prohibitionist country like Sweden. The focus of the paper is to identify demands for an alternative cannabis policy as well as analysing how these demands are linked to governance. The empirical material is 56 discussion-threads from the online message-board Flashback Forum that were active during the first eight months of 2012. Discourse theory was used to locate the discourse, and governmentality theory was used to locate the political belonging of the discourse. On Flashback Forum demands for a new cannabis policy are articulated in opposition to Swedish prohibitionist discourse. The oppositional discourse is constructed around the nodal points cannabis, harm, state and freedom that fill legalisation/decriminalisation/liberalisation with meaning. The nodal points are surrounded by policy demands that get their meaning through the particular nodal. These demands originate from neo-liberal and welfarist political rationalities. Neo-liberal and welfarist demands are mixed, and participants are simultaneously asking for state and individual approaches to handle the cannabis issue. Swedish online discourse on cannabis widens the scope beyond the confines of drug policy to broader demands such as social justice, individual choice and increased welfare. These demands are not essentially linked together and many are politically contradictory. This is also significant for the discourse; it is not hegemonised by a political ideology. The discourse is negotiated between the neo-liberal version of an alternative policy demanding individual freedom, and the welfarist version demanding social responsibility. This implies the influence of the heritage from the social-democratic discourse, centred on state responsibility, which have been dominating Swedish politics in modern times. Consequently, this study refutes that the demand for a new cannabis policy is strictly neo-liberal. Copyright © 2014 Elsevier B.V. All rights reserved.

  20. Music Audiences 3.0: Concert-Goers’ Psychological Motivations at the Dawn of Virtual Reality

    Science.gov (United States)

    Charron, Jean-Philippe

    2017-01-01

    Reviewing consumers’ motivations to attend performances in a continuously evolving social and technological context is essential because live concerts generate an important and growing share of revenues for the music industry. Evolving fans’ preferences and technological innovations constantly alter the way music is distributed and consumed. In a marketing 3.0 era, what consumers do with music is becoming more significant than simply owning or listening to a song. These changes are not only blurring the lines between production and consumption (i.e., co-creation), but also distorting the concept of live attendance altogether. Although mediated performances typically lack presence and authenticity, recent advances in immersive technologies, such as spherical videos and virtual reality goggles, could represent a new form of experiencing live music. PMID:28588528

  1. The rise of homosexuality and the dawn of communism in Hong Kong film: 1993-1998.

    Science.gov (United States)

    Grossman, A

    2000-01-01

    I have designed this essay as a general overview of the self-evident trend towards queer subject matter in the past decade in Hong Kong film, a trend that not only coincides historically with the 1997 handover to the Mainland but also frequently comes equipped with parent-child relationships that can be read as allegories for the colony's future as the "child" to its mother country. Queerness in HK films has both alternated between and combined indigenous forms of queerness and the imported Western variety; by charting courses through internationalized concepts of homosexuality, HK films have posited their queerness not only as an existential allegory of (post)colonialism but also as a claim (or hope) for a utopian sexuality cum utopian international politics.

  2. A New Dawn for the Second Sex : Women's Freedom Practices in World Perspective

    NARCIS (Netherlands)

    Vintges, K.

    2017-01-01

    To what extent is Simone de Beauvoir's study The Second Sex still relevant? From her work it emerges that patriarchy is a many-headed monster. Over the past decades, various heads of this monster have been slayed: important breakthroughs have been achieved by and for women in law, politics, and

  3. Patient and provider perceptions of care for diabetes: results of the cross-national DAWN Study

    DEFF Research Database (Denmark)

    Peyrol, Mark; Rubin, Richard R.; Lauritzen, Torsten

    2006-01-01

    the relationships between outcomes and both country and respondent characteristics, and the interaction between these two factors. Results Providers rated chronic-care systems and remuneration for chronic care as mediocre. Patients reported that ease of access to care was high, but not without financial barriers....... Patients reported moderate levels of collaboration among providers, and providers indicated that several specialist disciplines were not readily available to them. Patients reported high levels of collaboration with providers in their own care. Provider endorsement of primary prevention strategies for type...... 2 diabetes was high. Patients with fewer socio-economic resources and more diabetes complications had lower access (and/or higher barriers) to care and lower quality of patient–provider collaboration. Countries differed significantly for all outcomes, and the relationships between respondent...

  4. Effects of artificial dawn on subjective ratings of sleep inertia and dim light melatonin onset

    NARCIS (Netherlands)

    Gimenez, Marina C.; Hessels, Martijn; van de Werken, Maan; de Vries, Bonnie; Beersma, Domien G. M.; Gordijn, Marijke C. M.

    2010-01-01

    The timing of work and social requirements has a negative impact on performance and well-being of a significant proportion of the population in our modern society due to a phenomenon known as social jetlag. During workdays, in the early morning, late chronotypes, in particular, suffer from a

  5. Salute to the sun: a new dawn in yoga therapy for breast cancer.

    Science.gov (United States)

    Galliford, Melissa; Robinson, Stephanie; Bridge, Pete; Carmichael, MaryAnn

    2017-09-01

    Interest in the application of yoga for health benefits in western medicine is growing rapidly, with a significant rise in publications. The purpose of this systematic review is to determine whether the inclusion of yoga therapy to the treatment of breast cancer can improve the patient's physical and psychosocial quality of life (QoL). A search of peer reviewed journal articles published between January 2009 and July 2014 was conducted. Studies were included if they had more than 15 study participants, included interventions such as mindfulness-based stress reduction (MBSR) or yoga therapy with or without comparison groups and had stated physical or psychological outcomes. Screening identified 38 appropriate articles. The most reported psychosocial benefits of yoga therapy were anxiety, emotional and social functioning, stress, depression and global QoL. The most reported physical benefits of yoga therapy were improved salivary cortisol readings, sleep quality and lymphocyte apoptosis. Benefits in these areas were linked strongly with the yoga interventions, in addition to significant improvement in overall QoL. The evidence supports the use of yoga therapy to improve the physical and psychosocial QoL for breast cancer patients with a range of benefits relevant to radiation therapy. Future studies are recommended to confirm these benefits. Evidence-based recommendations for implementation of a yoga therapy programme have been derived and included within this review. Long-term follow-up is necessary with these programmes to assess the efficacy of the yoga intervention in terms of sustainability and patient outcomes. © 2017 The Authors. Journal of Medical Radiation Sciences published by John Wiley & Sons Australia, Ltd on behalf of Australian Society of Medical Imaging and Radiation Therapy and New Zealand Institute of Medical Radiation Technology.

  6. Sdgs and the Dawning of a New Globally Empowered Era of Women's Health and Wellbeing

    OpenAIRE

    Adenike Bitto

    2015-01-01

    September 25, 2015 marked a global watershed, as world leaders from 193 countries adopted the 2030 Agenda for Sustainable Development. It will apply valuable lessons learned from recently completed strategies of the fifteen-year Millennium Development Goals. This paper focuses on women's health and wellbeing, covered in all 17 Sustainable Development Goals, but emphasized in the fifth - "Gender equality and women's empowerment." After careful and thoughtful consideration of how the new goal m...

  7. The Dawns of the Spanish Geo technic; Los albores de la Geotecnia espanola

    Energy Technology Data Exchange (ETDEWEB)

    Serrano Gonzalez, A.

    2013-06-01

    From a personal perspective, there are analyzed the first steps of the spanish Geotechnical Engineering history understood as an academic discipline but also linked in a very directly way the profession. This evolution is not foreign to the own history of the Geneticist in other countries of our cultural or geographical environment. The contributions discover that our predecessors transmitted important achievements to the international community. The direct presence in the international congresses of that time of the spanish geo technicians is analysed. Three consecutive stages are distinguished, personalizing in each of them the participation of celebrated spanish Civil Engineers. (Author)

  8. A new day dawns: women without oestrogen or is a balance best?

    International Nuclear Information System (INIS)

    Jordan, V Craig

    2002-01-01

    Building on the 30-year success story with tamoxifen, the question now is whether one agent can be used for treatment and prevention or should new medicines be targeted to specific applications? The early results with anastrozole suggest it could replace tamoxifen for treatment and should be tested as a preventive. Unfortunately, long-term testing of aromatase inhibitors will be required to avoid concerns about osteoporosis, Alzheimer's disease and coronary heart disease. Most importantly, the knowledge gained with tamoxifen has resulted in a new generation of selective oestrogen receptor modulators that can be used to prevent osteoporosis, breast cancer and uterine cancer. It is now clear that strategies utilising aromatase inhibitors and selective oestrogen receptor modulators will provide much needed options for individualised treatments

  9. Acoustic resonance at the dawn of life: musical fundamentals of the psychoanalytic relationship.

    Science.gov (United States)

    Pickering, Judith

    2015-11-01

    This paper uses a case vignette to show how musical elements of speech are a crucial source of information regarding the patient's emotional states and associated memory systems that are activated at a given moment in the analytic field. There are specific psychoacoustic markers associated with different memory systems which indicate whether a patient is immersed in a state of creative intersubjective relatedness related to autobiographical memory, or has been triggered into a traumatic memory system. When a patient feels immersed in an atmosphere of intersubjective mutuality, dialogue features a rhythmical and tuneful form of speech featuring improvized reciprocal imitation, theme and variation. When the patient is catapulted into a traumatic memory system, speech becomes monotone and disjointed. Awareness of such acoustic features of the traumatic memory system helps to alert the analyst that such a shift has taken place informing appropriate responses and interventions. Communicative musicality (Malloch & Trevarthen 2009) originates in the earliest non-verbal vocal communication between infant and care-giver, states of primary intersubjectivity. Such musicality continues to be the primary vehicle for transmitting emotional meaning and for integrating right and left hemispheres. This enables communication that expresses emotional significance, personal value as well as conceptual reasoning. © 2015, The Society of Analytical Psychology.

  10. The clinical rationale for MRI-guided radiotherapy : the dawn of a new era

    NARCIS (Netherlands)

    Kerkhof, E.M.

    2010-01-01

    Current radiotherapy treatment machines use the treatment beam or the integrated cone-beam computed tomography (CBCT) functionality for patient positioning based on bony structures or implanted tumour markers. The University Medical Center Utrecht, in cooperation with Elekta and Philips, is

  11. American Carrier Air Power at the Dawn of a New Century

    Science.gov (United States)

    2005-01-01

    Systems, Office of the Secretary of Defense (Operational Test and Evaluation); then–Commander Calvin Craig, OPNAV N81; Captain Kenneth Neubauer and...TACP Tactical Air Control Party TARPS Tactical Air Reconnaissance Pod System TCS Television Camera System TLAM Tomahawk Land-Attack Missile TST Time...store any video imagery acquired by the aircraft’s systems, including the TARPS pod, the pilot’s head-up display (HUD), the Television Camera System (TCS

  12. Star-Forming Galaxies at the Cosmic Dawn = Stervormende sterrenstelsels tijdens het kosmische ochtendgloren

    NARCIS (Netherlands)

    Smit, Renske

    2015-01-01

    The question of how the first stars formed and assembled into galaxies lies at the frontier of modern astrophysics. The study of these first sources of cosmic illumination was transformed by the installation of new instrumentation aboard the Hubble Space Telescope during one of the final Space

  13. Ultrafast, laser-based, x-ray science: the dawn of atomic-scale cinematography

    Energy Technology Data Exchange (ETDEWEB)

    Barty, C.P.J. [University of California, Department of Applied Mechanics and Engineering Science, Urey Hall, Mali Code 0339, San Diego, La Jolla, CA (United States)

    2000-03-01

    The characteristics of ultrafast chirped pulse amplification systems are reviewed. Application of ultrafast chirped pulse amplification to the generation of femtosecond, incoherent, 8-keV line radiation is outlined and the use of femtosecond laser-based, x-rays for novel time-resolved diffraction studies of crystalline dynamics with sub-picosecond temporal resolution and sub-picometer spatial resolution is reviewed in detail. Possible extensions of laser-based, x-ray technology and evaluation of alternative x-ray approaches for time-resolved studies of the atomic scale dynamics are given. (author)

  14. SPIRAL2 at GANIL: At the Dawn of a New Era

    Science.gov (United States)

    Gales, S.

    2010-04-01

    The exploration of unknown region of the nuclear mass chart, in particular, the neutron rich side, raised new and challenging physics issues in the understanding of nuclei far from stability. The physics of weakly bound systems, the appearance of shell quenching, the interface with astrophysical problems prompted the study of new generation of "Rad ioactive Beam Facilities" with high luminosity and the development of associated new experimental tools. GANIL presently offers unique opportunities in nuclear physics and many other fields. With the construction of SPIRAL2 over the next few years, GANIL is in a good position to retain its world-leading capability even though it faces strong competition from new and upgraded ISOL and fragmentation facilities. As selected by the ESFRI committee, the next generation of ISOL facility in Europe is represented by the SPIRAL2 project to be built at GANIL (Caen, France). SPIRAL2 is based on a high power, CW, superconducting LINAC, delivering 5 mA of deuteron beams at 40 MeV (200 KW) directed on a C converter+ Uranium target and producing therefore more 1013 fissions/s. The expected radioactive beams intensities in the mass range from A = 60 to A = 140, will surpass by two order of magnitude any existing facilities in the world. These unstable atoms will be available at energies between few KeV/n to 15 MeV/n. The same driver will accelerate high intensity (100* A to 1 mA), heavier ions (Ar up to Xe) at maximum energy of 14 MeV/n. In applied areas SPIRAL2 is considered as a powerful variable energy neutron source. The Neutrons For Science collaboration (NFS) is proposing a physics program on fission induced by fast neutrons as well as fusion studies on materials. Under the 7FP program of European Union called*Preparatory phase*, the SPIRAL2 project has been granted a budget of about 4 M€ to build up an international consortium around this new venture. Regarding the future physics program a call for Letter of intents has been launched in Oct 2006 and 8 large International collaborations has been built up around new instruments for SPIRAL2. The status of the construction of SPIRAL2 accelerator and technical R&D programs for physics instrumentation (detectors, spectrometers) in collaboration with EU and International partners will be presented.

  15. A new dawn for androgens: Novel lessons from 11-oxygenated C19 steroids.

    Science.gov (United States)

    Pretorius, Elzette; Arlt, Wiebke; Storbeck, Karl-Heinz

    2017-02-05

    The abundant adrenal C19 steroid 11β-hydroxyandrostenedione (11OHA4) has been written off as a dead-end product of adrenal steroidogenesis. However, recent evidence has demonstrated that 11OHA4 is the precursor to the potent androgenic 11-oxygenated steroids, 11-ketotestosterone and 11-ketodihydrotestosterone, that bind and activate the human androgen receptor similarly to testosterone and DHT. The significance of this discovery becomes apparent when considering androgen dependent diseases such as castration resistant prostate cancer and diseases associated with androgen excess, e.g. congenital adrenal hyperplasia and polycystic ovary syndrome. In this review we describe the production and metabolism of 11-oxygenated steroids. We subsequently discuss their androgenic activity and highlight the putative role of these androgens in disease states. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  16. Health at the dawn of development: the thought of Abraham Horwitz

    OpenAIRE

    Pires-Alves, Fernando A.; Maio, Marcos Chor

    2015-01-01

    The article explores the ideas of Pan American Health Organization director Abraham Horwitz on the relations between health and development at the time the Alliance for Progress was established, in 1961. Taking development discourse as a public philosophy of international cooperation, the discussion centers on how Horwitz worked to mediate between health and development. Horwitz endeavored to establish arguments that highlighted the importance of social policy, especially in health; he also s...

  17. Health at the dawn of development: the thought of Abraham Horwitz

    Directory of Open Access Journals (Sweden)

    Fernando A. Pires-Alves

    2015-03-01

    Full Text Available The article explores the ideas of Pan American Health Organization director Abraham Horwitz on the relations between health and development at the time the Alliance for Progress was established, in 1961. Taking development discourse as a public philosophy of international cooperation, the discussion centers on how Horwitz worked to mediate between health and development. Horwitz endeavored to establish arguments that highlighted the importance of social policy, especially in health; he also strove to reach different audiences and drew connections between elements like health, illness, and labor productivity, without ignoring the humanistic considerations so dear to the public health tradition

  18. Health at the dawn of development: the thought of Abraham Horwitz.

    Science.gov (United States)

    Pires-Alves, Fernando A; Maio, Marcos Chor

    2015-01-01

    The article explores the ideas of Pan American Health Organization director Abraham Horwitz on the relations between health and development at the time the Alliance for Progress was established, in 1961. Taking development discourse as a public philosophy of international cooperation, the discussion centers on how Horwitz worked to mediate between health and development. Horwitz endeavored to establish arguments that highlighted the importance of social policy, especially in health; he also strove to reach different audiences and drew connections between elements like health, illness, and labor productivity, without ignoring the humanistic considerations so dear to the public health tradition.

  19. DAWN GRAND MAP CERES TPE NEUTRON COUNTS V1.0

    Data.gov (United States)

    National Aeronautics and Space Administration — A global map thermal+epithermal neutron counting rates binned on twenty-degree quasi-equal-area pixels is provided. The map was determined from a time series of the...

  20. The dawn of chelonian research: turtles between comparative anatomy and embryology in the 19th century.

    Science.gov (United States)

    MacCord, Kate; Caniglia, Guido; Moustakas-Verho, Jacqueline E; Burke, Ann C

    2015-05-01

    Many evo-devo studies of the turtle's shell draw hypotheses and support from historical sources. The groundbreaking works of Cuvier, Geoffroy St. Hilaire, Carus, Rathke, Owen, and others are being revived in modern research, and their centuries-old understanding of the turtle's shell reconsidered. In the works of these eminent biologists of the 19th century, comparative anatomy and embryology of turtle morphology set the stage for future studies in developmental biology, histology, and paleontology. Given the impact that these works still make on modern research, it is important to develop a thorough appreciation of previous authors, regarding how they arrived at their conclusions (i.e., what counted as evidence?), whether there was debate amongst these authors about shell development (i.e., what counted as an adequate explanation?), and even why these men, some of the most powerful and influential thinkers and anatomists of their day, were concerned with turtles. By tracing and exposing the context and content of turtle shell studies in history, our aim is to inform modern debates about the evolution and development of the turtle's shell. © 2014 Wiley Periodicals, Inc.

  1. Millennium-scale crossdating and inter-annual climate sensitivities of standing California redwoods.

    Science.gov (United States)

    Carroll, Allyson L; Sillett, Stephen C; Kramer, Russell D

    2014-01-01

    Extremely decay-resistant wood and fire-resistant bark allow California's redwoods to accumulate millennia of annual growth rings that can be useful in biological research. Whereas tree rings of Sequoiadendron giganteum (SEGI) helped formalize the study of dendrochronology and the principle of crossdating, those of Sequoia sempervirens (SESE) have proven much more difficult to decipher, greatly limiting dendroclimatic and other investigations of this species. We overcame these problems by climbing standing trees and coring trunks at multiple heights in 14 old-growth forest locations across California. Overall, we sampled 1,466 series with 483,712 annual rings from 120 trees and were able to crossdate 83% of SESE compared to 99% of SEGI rings. Standard and residual tree-ring chronologies spanning up to 1,685 years for SESE and 1,538 years for SEGI were created for each location to evaluate crossdating and to examine correlations between annual growth and climate. We used monthly values of temperature, precipitation, and drought severity as well as summer cloudiness to quantify potential drivers of inter-annual growth variation over century-long time series at each location. SESE chronologies exhibited a latitudinal gradient of climate sensitivities, contrasting cooler northern rainforests and warmer, drier southern forests. Radial growth increased with decreasing summer cloudiness in northern rainforests and a central SESE location. The strongest dendroclimatic relationship occurred in our southernmost SESE location, where radial growth correlated negatively with dry summer conditions and exhibited responses to historic fires. SEGI chronologies showed negative correlations with June temperature and positive correlations with previous October precipitation. More work is needed to understand quantitative relationships between SEGI radial growth and moisture availability, particularly snowmelt. Tree-ring chronologies developed here for both redwood species have

  2. Estimation the remaining service-lifetime of wooden structure of geothermal cooling tower

    Directory of Open Access Journals (Sweden)

    Effendi Tri Bahtiar

    2017-06-01

    Full Text Available Similar with other construction materials, wood strength is decreasing when applied by long term loading. Wooden cooling tower structure at Star Energy Geothermal (Wayang Windu Ltd was built in 1998 and it should be evaluated to avoid sudden structural failure. Evaluation conducted through several steps: wood species identification, the physical and mechanical properties testing, and estimation for remaining service-lifetime by generating mathematical models derived from creep test and reduction of cross sectional area of the wood. Identification result that the wood are redwood (Sequoia sempervirens and Douglas fir (Pseudotsuga menziesii. The wood density value has degraded from the surface until 0.25 cm depth. Strength characteristics of the wood have considerably decreased, but the allowable stress for bending, tension parallel to grain, and shear were still higher than NDS2005 requirements. The allowable stress for compression parallel to grain was slightly lower than NDS, while compression perpendicular to grain was much lower. Average modulus of elasticity reduces become lower than the value stated by the code, but the minimum value of modulus of elasticity (Emin of redwood was still higher than the code value, while Emin of Douglas fir is slightly lower. Then, in accordance with those findings, the construction would not failure yet but the deformation and vibration will occur in higher rate than design planning. This research develops mathematical models for estimating the remaining service-lifetime of the wooden cooling tower structure in geothermal power plant based on the wood performance in resisting long term loading and its deterioration rate. The deterioration rate of wood member of cooling tower structure at Star Energy Geothermal (Wayang Windu Ltd is 0.0147 cm depth per year, so equation for the residual service life estimation is σlaterσtoday=bh2(b−0.0147T(h−0.0147T2, and σlater must be lower than allowable stress.

  3. Water-use responses of ‘living fossil’ conifers to CO2 enrichment in a simulated Cretaceous polar environment

    Science.gov (United States)

    Llorens, Laura; Osborne, Colin P.; Beerling, David J.

    2009-01-01

    Background and Aims During the Mesozoic, the polar regions supported coniferous forests that experienced warm climates, a CO2-rich atmosphere and extreme seasonal variations in daylight. How the interaction between the last two factors might have influenced water use of these conifers was investigated. An experimental approach was used to test the following hypotheses: (1) the expected beneficial effects of elevated [CO2] on water-use efficiency (WUE) are reduced or lost during the 24-h light of the high-latitude summer; and (2) elevated [CO2] reduces plant water use over the growing season. Methods Measurements of leaf and whole-plant gas exchange, and leaf-stable carbon isotope composition were made on one evergreen (Sequoia sempervirens) and two deciduous (Metasequoia glyptostroboides and Taxodium distichum) ‘living fossil’ coniferous species after 3 years' growth in controlled-environment simulated Cretaceous Arctic (69°N) conditions at either ambient (400 µmol mol−1) or elevated (800 µmol mol−1) [CO2]. Key Results Stimulation of whole-plant WUE (WUEP) by CO2 enrichment was maintained over the growing season for the three studied species but this pattern was not reflected in patterns of WUE inferred from leaf-scale gas exchange measurements (iWUEL) and δ13C of foliage (tWUEL). This response was driven largely by increased rates of carbon uptake, because there was no overall CO2 effect on daily whole-plant transpiration or whole-plant water loss integrated over the study period. Seasonal patterns of tWUEL differed from those measured for iWUEL. The results suggest caution against over simplistic interpretations of WUEP based on leaf isotopic composition. Conclusions The data suggest that the efficiency of whole-tree water use may be improved by CO2 enrichment in a simulated high-latitude environment, but that transpiration is relatively insensitive to atmospheric CO2 in the living fossil species investigated. PMID:19447810

  4. Water-use responses of 'living fossil' conifers to CO2 enrichment in a simulated Cretaceous polar environment.

    Science.gov (United States)

    Llorens, Laura; Osborne, Colin P; Beerling, David J

    2009-07-01

    During the Mesozoic, the polar regions supported coniferous forests that experienced warm climates, a CO(2)-rich atmosphere and extreme seasonal variations in daylight. How the interaction between the last two factors might have influenced water use of these conifers was investigated. An experimental approach was used to test the following hypotheses: (1) the expected beneficial effects of elevated [CO(2)] on water-use efficiency (WUE) are reduced or lost during the 24-h light of the high-latitude summer; and (2) elevated [CO(2)] reduces plant water use over the growing season. Measurements of leaf and whole-plant gas exchange, and leaf-stable carbon isotope composition were made on one evergreen (Sequoia sempervirens) and two deciduous (Metasequoia glyptostroboides and Taxodium distichum) 'living fossil' coniferous species after 3 years' growth in controlled-environment simulated Cretaceous Arctic (69 degrees N) conditions at either ambient (400 micromol mol(-1)) or elevated (800 micromol mol(-1)) [CO(2)]. Stimulation of whole-plant WUE (WUE(P)) by CO(2) enrichment was maintained over the growing season for the three studied species but this pattern was not reflected in patterns of WUE inferred from leaf-scale gas exchange measurements (iWUE(L)) and delta(13)C of foliage (tWUE(L)). This response was driven largely by increased rates of carbon uptake, because there was no overall CO(2) effect on daily whole-plant transpiration or whole-plant water loss integrated over the study period. Seasonal patterns of tWUE(L) differed from those measured for iWUE(L). The results suggest caution against over simplistic interpretations of WUE(P) based on leaf isotopic composition. The data suggest that the efficiency of whole-tree water use may be improved by CO(2) enrichment in a simulated high-latitude environment, but that transpiration is relatively insensitive to atmospheric CO(2) in the living fossil species investigated.

  5. Millennium-scale crossdating and inter-annual climate sensitivities of standing California redwoods.

    Directory of Open Access Journals (Sweden)

    Allyson L Carroll

    Full Text Available Extremely decay-resistant wood and fire-resistant bark allow California's redwoods to accumulate millennia of annual growth rings that can be useful in biological research. Whereas tree rings of Sequoiadendron giganteum (SEGI helped formalize the study of dendrochronology and the principle of crossdating, those of Sequoia sempervirens (SESE have proven much more difficult to decipher, greatly limiting dendroclimatic and other investigations of this species. We overcame these problems by climbing standing trees and coring trunks at multiple heights in 14 old-growth forest locations across California. Overall, we sampled 1,466 series with 483,712 annual rings from 120 trees and were able to crossdate 83% of SESE compared to 99% of SEGI rings. Standard and residual tree-ring chronologies spanning up to 1,685 years for SESE and 1,538 years for SEGI were created for each location to evaluate crossdating and to examine correlations between annual growth and climate. We used monthly values of temperature, precipitation, and drought severity as well as summer cloudiness to quantify potential drivers of inter-annual growth variation over century-long time series at each location. SESE chronologies exhibited a latitudinal gradient of climate sensitivities, contrasting cooler northern rainforests and warmer, drier southern forests. Radial growth increased with decreasing summer cloudiness in northern rainforests and a central SESE location. The strongest dendroclimatic relationship occurred in our southernmost SESE location, where radial growth correlated negatively with dry summer conditions and exhibited responses to historic fires. SEGI chronologies showed negative correlations with June temperature and positive correlations with previous October precipitation. More work is needed to understand quantitative relationships between SEGI radial growth and moisture availability, particularly snowmelt. Tree-ring chronologies developed here for both redwood

  6. Forest restoration at Redwood National Park: exploring prescribed fire alternatives to second-growth management: a case study

    Science.gov (United States)

    Engber, Eamon; Teraoka, Jason; van Mantgem, Phillip J.

    2017-01-01

    Almost half of Redwood National Park is comprised of second-growth forests characterized by high stand density, deficient redwood composition, and low understory biodiversity. Typical structure of young redwood stands impedes the recovery of old-growth conditions, such as dominance of redwood (Sequoia sempervirens (D. Don) Endl.), distinct canopy layers and diverse understory vegetation. Young forests are commonly comprised of dense, even-aged Douglas-fir (Pseudotsuga menziesii (Mirb.) Franco) and redwood stump sprouts, with simple canopy structure and little understory development. Moreover, many of these young stands are believed to be vulnerable to disturbance in the form of drought, disease and fire. Silvicultural practices are increasingly being employed by conservation agencies to restore degraded forests throughout the coast redwood range; however, prescribed fire treatments are less common and potentially under-utilized as a restoration tool. We present an early synthesis from three separate management-scale prescribed fire projects at Redwood National Park spanning 1to 7 years post-treatment. Low intensity prescribed fire had minimal effect on overstory structure, with some mortality observed in trees smaller than 30 cm diameter. Moderate to high intensity fire may be required to reduce densities of larger Douglas-fir, the primary competitor of redwood in the Park’s second growth forests. Fine woody surface fuels fully recovered by 7 years post-burn, while recruitment of larger surface fuels was quite variable. Managers of coastal redwood ecosystems will benefit by having a variety of tools at their disposal for forest restoration and management.

  7. Redwoods, restoration, and implications for carbon budgets

    Science.gov (United States)

    Madej, Mary Ann

    2010-01-01

    The coast redwoods (Sequoia sempervirens) of California have several unique characteristics that influence interactions between vegetation and geomorphic processes. Case studies, using a combination of in-channel wood surveys and an air photo inventory of landslides, illustrate current conditions in a redwood-dominated watershed undergoing restoration work, and the influence of wood loading and landslides on the carbon budget. Redwood trees have extremely large biomass (trunk wood volumes of 700 to 1000 m3) and are very decay-resistant; consequently, they have a large and persistent influence on in-channel wood loading. Large wood surveys indicate high wood loading in streams in uncut forests (0.3-0.5 m3/m2 of channel), but also show that high wood loading can persist in logged basin with unlogged riparian buffers because of the slow decay of fallen redwoods. Through a watershed restoration program, Redwood National Park increases in-channel wood loading in low-order streams, but the effectiveness of this technique has not yet been tested by a large flood. Another unique characteristic of redwood is its ability to resprout from basal burls after cutting, so that root strength may not decline as sharply following logging as in other types of forests. An air photo inventory of landslides following a large storm in 1997 indicated: 1) that in the Redwood Creek watershed the volume of material displaced by landslides in harvested areas was not related to the time elapsed since logging, suggesting that the loss of root strength was not a decisive factor in landslide initiation, 2) landslide production on decommissioned logging roads was half that of untreated roads, and 3) landslides removed an estimated 28 Mg of organic carbon/km2 from hillslopes. The carbon budget of a redwood-dominated catchment is dominated by the vegetative component, but is also influenced by the extent of mass movement, erosion control work, and in-channel storage of wood.

  8. Mass production of `Swan`s Golden`, Cupressus sempervirens by tissue culture and its radiation breeding. 2. Study on growth regulating substance to stimulate the elongation of shoot apex

    Energy Technology Data Exchange (ETDEWEB)

    Suda, Hirokatsu [Tokyo Metropolitan Isotope Research Center (Japan)

    1997-09-01

    Some species of `Swan`s Golden` have been propagated by means of grafting because propagation by cutting is difficult. However, not a few species of the plant are easily lodged, resulting that spreading of `Swan`s Golden` is difficult. Here, an investigation was made on growth regulating substances added into the basal medium in respects of their kinds and concentrations and also the kind of medium for successive culture. As the basal medium, SH medium supplemented with 4 g/l of gel-light and 3 g/l of carbon-powder was used. The optimum medium for the initiation of culture was the basal medium added with zeatin (Ze) and gibberellin (GA) and it was also suitable for successive culture after the 14 day. The medium added with Ze and benzyladenine (BA) or Ze alone was found to be most suitable for the culture after the 28 day. The concentration was optimum at 1 - 2.5 mg/l for either of these growth regulating substances. (M.N.)

  9. 76 FR 60452 - In the Matter of: Bahram Maghazehe, a.k.a. Benjamin Maghazehe, a.k.a. Ben Maghazehe, 154 Sequoia...

    Science.gov (United States)

    2011-09-29

    ...-installation and removal of the equipment from the U.S. hospital and the export of the equipment from the...). Maghazehe had knowledge that a U.S. hospital was discarding the oncology system and that a company in Iran... States. For purposes of this paragraph, servicing means installation, maintenance, repair, modification...

  10. False Dawn of a Solar Age: A History of Solar Heating and Power During the Energy Crisis, 1973-1986

    Science.gov (United States)

    Scavo, Jordan Michael

    The unfolding of the energy crisis in the early 1970s brought solar to the fore as a topic for national discussion. National dialogues about solar power and national energy policy were one way that Americans interpreted their present and envisioned their nation's future. Yet, policy makers and the general public considered alternative energies, including solar, largely based on the economic conditions of their eras, considerations that, at least until the Reagan era, often transcended political ideologies and parties. Energy prices and the emerging political expediency of replacing fossil fuels were the primary drivers in shaping federal energy policies and public interest during this era. Enthusiasm for solar power often corresponded to the market price of petroleum. By the late 1970s, a lot of people believed the same. Amid growing public enthusiasm, President Carter eventually came out strongly in favor of solar energy, mounting solar panels on the White House and unveiling a plan to procure 20% of the nation's energy from the sun by the year 2000. During the 1960s and 1970s, Americans changed their energy values in response to concerns over environmentalism and the antinuclear movement. Pollution, environmental disasters, and energy crises during the 1960s and 1970s brought terms like "clean energy" and "renewable energy" into the national lexicon, and solar often served as the most prominent symbol of those ideas. At the same time, advocates presented solar as a stark contrast to nuclear: solar energy made life on earth possible; nuclear energy made it perilous. Science fiction and futurism shaped the American popular imagination through its presentation of solar technology. Each genre suffused the other and ingrained in the American national consciousness a sense of grandiose wonderment about the potential for solar energy, a potential that often did not match the contemporary applications for solar technology. The emergence of solar industries alarmed oil corporations and utilities. Several of these companies embarked on a concerted public misinformation campaign designed to downplay the potential of solar energy, and these actions undermined the development of the nascent solar industries. Solar heating equipment relied on federal stimulus to compete in the market. Yet, federal support for research and development, commercialization, and market facilitation withered under the Reagan administration. Solar occupied a point of convergence for several of Reagan's targets: solar represented Carter, represented big government intervention in the market, and represented environmentalism. Reagan's administration reduced solar funding, redirected and reorganized solar agencies, and repressed solar information. By the early 1980s, Carter's 20% solar goal was dead, and, as a result, the nation's efforts toward developing solar energy were set back decades.

  11. Alvorecer de uma nova ciência: a medicina tropicalista baiana The dawning of a new science

    Directory of Open Access Journals (Sweden)

    Pedro Motta de Barros

    1997-11-01

    Full Text Available No século XIX, o saber e o ensino médico e a assistência clínica, de caráter especulativo e elitista, entram em choque, no Brasil, com novas teorias da doença e do cuidado médico baseadas na parasitologia, bacteriologia e anatomopatologia e numa clínica experimental orientada para enfermidades tropicais dos pobres. O novo referencial teórico e social, que influi na política pública de saúde, entra em decadência quando é apropriado pela ideologia da inferioridade racial e cultural da população de origem africana. Duas novas disciplinas - antropologia física criminal e medicina legal - geram conhecimentos inéditos nos meios intelectuais e, ao mesmo tempo, são funcionais à ordem dominante, dando curso forçado a princípios e dispositivos de que a mesma elite usa para se perpetuar no poder. Essa construção híbrida é o legado de barbárie à civilização atual.Medicine in 19th-century Brazil was a scientific field where traditional knowledge, academic teaching, and clinical care found themselves clashing with new theories of illness and medical care underpinned by pioneer disciplines like parasitology, bacteriology, and anatomopatbology and an experimental clinical practice focused on tropical diseases which afflict the poor. This new set of theoretical and social references which affected public health-care policy saw its decadence when it was appropriated by an ideology that argued that the Afro-Brazilian population was racially and culturally inferior. Two new disciplines- criminal physical anthropology and legal medicine- contributed to the development of specialized knowledge within intellectual circles. At the same time, they were placed at the service of the ruling order, reinforcing principles and devices that the elite utilized to keep itself in power. This hybrid structure constitutes the legacy of barbarianism which is sundering today's civilization.

  12. Processing two-dimensional X-ray diffraction and small-angle scattering data in DAWN 2.

    Science.gov (United States)

    Filik, J; Ashton, A W; Chang, P C Y; Chater, P A; Day, S J; Drakopoulos, M; Gerring, M W; Hart, M L; Magdysyuk, O V; Michalik, S; Smith, A; Tang, C C; Terrill, N J; Wharmby, M T; Wilhelm, H

    2017-06-01

    A software package for the calibration and processing of powder X-ray diffraction and small-angle X-ray scattering data is presented. It provides a multitude of data processing and visualization tools as well as a command-line scripting interface for on-the-fly processing and the incorporation of complex data treatment tasks. Customizable processing chains permit the execution of many data processing steps to convert a single image or a batch of raw two-dimensional data into meaningful data and one-dimensional diffractograms. The processed data files contain the full data provenance of each process applied to the data. The calibration routines can run automatically even for high energies and also for large detector tilt angles. Some of the functionalities are highlighted by specific use cases.

  13. The Dawn of Criminal Law, Regulation of Punitive Power in the Sumerian, Akk adian and Semite Codes

    Directory of Open Access Journals (Sweden)

    Ramiro J. García Falconí

    2016-06-01

    Full Text Available General and special Law, the regulation of the punitive power appeared since the first codings known in the history of mankind, being clear their religious character, their sacrifice logic, and the violence element that permeate to it. This punitive matrix is found in both Sumerian and Akkadian Codes, as in the later Jewish legislation, in which violence and sacredness fuse. The Talion Law already makes its appearance, as well as the structures on which the Inquisitorial System will be later built, and some traits that survive until today.

  14. Precision medicine and personalising therapy in pulmonary hypertension: seeing the light from the dawn of a new era.

    Science.gov (United States)

    Savale, Laurent; Guignabert, Christophe; Weatherald, Jason; Humbert, Marc

    2018-06-30

    Pulmonary hypertension (PH) and pulmonary arterial hypertension (PAH) include different cardiopulmonary disorders in which the interaction of multiple genes with environmental and behavioural factors modulates the onset and the progression of these severe conditions. Although the development of therapeutic agents that modulate abnormalities in three major pathobiological pathways for PAH has revolutionised our approach to the treatment of PAH, the long-term survival rate remains unsatisfactory. Accumulating evidence has underlined that clinical outcomes and responses to therapy in PAH are modified by multiple factors, including genetic variations, which will be different for each individual. Since precision medicine, also known as stratified medicine or personalised medicine, aims to better target intervention to the individual while maximising benefit and minimising harm, it has significant potential advantages. This article aims to assemble and discuss the different initiatives that are currently underway in the PH/PAH fields together with the opportunities and prospects for their use in the near future. Copyright ©ERS 2018.

  15. Implications of conspecific background noise for features of blue tit, Cyanistes caeruleus , communication networks at dawn

    DEFF Research Database (Denmark)

    Poesel, Angelika; Dabelsteen, Torben; Pedersen, Simon Boel

    2007-01-01

    Abstract  Communication among animals often comprises several signallers and receivers within the signal's transmission range. In such communication networks, individuals can extract information about differences in relative performance of conspecifics by eavesdropping on their signalling...... interactions. In songbirds, information can be encoded in the timing of signals, which either alternate or overlap, and both male and female receivers may utilise this information when engaging in territorial interactions or making reproductive decisions, respectively. We investigated how conspecific...... may potentially constrain the perception of singing patterns and may constitute costs for eavesdroppers. On the other hand, signallers may position themselves strategically and privatise their interactions....

  16. The End of Work: The Decline of the Global Labor Force and the Dawn of the Post-Market Era.

    Science.gov (United States)

    Rifkin, Jeremy

    This book explores the global economic and social changes that will likely occur as continued technological advancements (especially in the field of computer science) reduce the number of workers needed to produce the goods and services needed by the global population. The book is divided into five sections. Section 1 presents an overview of the…

  17. Geologic Mapping of the Ac-H-6 Quadrangle of Ceres from Nasa's Dawn Mission: Compositional Changes

    Science.gov (United States)

    Krohn, Katrin; Jaumann, Ralf; Tosi, Federico; Nass, Andrea; Otto, Katharina A.; Schulzeck, Franziska; Stephan, Katrin; Wagner, Roland J.; Williams, David A.; Buczkowski, Debra L.; Mest, Scott C.; Scully, Jennifer E. C.; von der Gathen, Isabel; Kersten, Elke; Matz, Klaus-Dieter; Pieters, Carle M.; Preusker, Frank; Roatsch, Thomas; De Sanctis, Maria Cristina; Zambon, Francesca

    2016-04-01

    Cereś surface is affected by numerous impact craters and some of them show features such as channels or multiple flow events forming a smooth, less cratered surface, indicating possible post-impact resurfacing [1,2]. Flow features occur on several craters on Ceres such as Haulani, Ikapati, Occator, Jarimba and Kondos in combination with smooth crater floors [3,4], appearing as extended plains, ponded material, lobate flow fronts and in the case of Haulani lobate flows originating from the crest of the central ridge [3] partly overwhelming the mass wasting deposits from the rim. Haulanís crater flanks are also affected by multiple flow events radiating out from the crater and partly forming breakages. Flows occur as fine-grained lobes with well-defined margins and as smooth undifferentiated streaky flows covering the adjacent surface. Thus, adjacent craters are covered by flow material. Occator also exhibits multiple flows but in contrast to Haulani, the flows originating from the center overwhelm the mass wasting deposits from the rim [4]. The flows have a "bluish" signature in the FC color filters ratio. Channels occur at relatively fresh craters. They also show the "bluish" signature like the flows and plains. Only few channels occur at older "reddish" craters. They are relatively fresh incised into flow features or crater ejecta. Most are small, narrow and have lobated lobes with predominant distinctive flow margins. The widths vary between a few tens of meters to about 3 km. The channels are found on crater flanks as well as on the crater floors. The occurrence of flow features indicates viscous material on the surface. Those features could be formed by impact melt. However, impact melt is produced during the impact, assuming similar material properties as the ejecta it is expected to have nearly the same age as the impact itself, but the flows and plains are almost free of craters, thus, they seem to be much younger than the impact itself. In addition, the source of impact melt flows is diffusely distributed but many of the observed flows originate from district sources in the crater interior and the flows, however, are well defined. The compositional differences derived from the color ratio and possible time variable effects related to cryo-processes either volcanic or glacial [1,2]. Furthermore, the suggestion of an occurrence ice within the Cerean crust [5] as well as possible salts incorporated into a regolith layer [4,5,6] indicates similar geological processes as seen on other icy bodies. Some lobate flow-like deposits on Ganymede such as at Sippar Sulcus are suggested to be formed by volcanic eruptions creating a channel and flow, and cutting down into the surface forming a depression. Thus, an endogenic formation process cannot be excluded. References: [1] Jaumann R. et al. (2015) EPSC X, Abstract #2015-83. [2] Jaumann R. et al. (2015) AGU, Abstract #P42A-05. [3] Krohn K. et al. (2016) LPSC XLVII, this issue. [4] Jaumann R. et al. (2016) LPSC XLVII, this issue. [5] McCord T.B. and Sotin C. (2005) J. Geophys. Res., 110, E05009. [6] Castillo-Rogez J.C. and McCord T.B. (2010) Icarus 203, 443-459.

  18. PENGARUH PRODUCT PLACEMENT VOLVO DI DALAM FILM TWILIGHT SAGA: BREAKING DAWN PART 1 & PART 2 TERHADAP BRAND RECALL

    Directory of Open Access Journals (Sweden)

    Ghygha Yunus Widya Prasetya

    2013-07-01

    Full Text Available Movie scenes have become attractive means for many industries to present their products without enforced impression. Through careful designed product placement strategy, Twilight movie became the perfect promotional media for Volvo in promoting their products. Volvo is one of the premium automotive brands under the auspices of Indomobil. This well-known brand always put and positions their product merely for the target premium. Product placement is an example of a hybrid message or an attempt to influence audience at an affordable cost. Some benefits in advertising through product placement are a lot of audiences see the products so that the brand awareness and the products’ credibility would significantly increase. In conclusion, consumer’s behavior in recognizing and remembering a product might be affected by their vision, hearing, and admiration.

  19. Probing the Dawn of Galaxies at z ~ 9-12 : New Constraints from HUDF12/XDF and CANDELS data

    NARCIS (Netherlands)

    Oesch, P.A.; Bouwens, R.J.; Illingworth, G.D.; Labbé, I.; Franx, M.; Dokkum, van P.G.; Trenti, M.; Stiavelli, M.; Gonzalez, V.; Magee, D.

    2013-01-01

    We present a comprehensive analysis of z {gt} 8 galaxies based on ultra-deep WFC3/IR data. We exploit all the WFC3/IR imaging over the Hubble Ultra-Deep Field from the HUDF09 and the new HUDF12 program, in addition to the HUDF09 parallel field data, as well as wider area imaging over GOODS-South.

  20. Probing the Dawn of Galaxies at z ~{} 9-12 : New Constraints from HUDF12/XDF and CANDELS data

    NARCIS (Netherlands)

    Oesch, P.; Bouwens, R.J.; Illingworth, G.; Labbé, I.F.L.; Franx, M.; Dokkum, P.; Trenti, M.; Stiavelli, M.; Gonzalez, V.; Magee, D.

    2013-01-01

    We present a comprehensive analysis of z {gt} 8 galaxies based on ultra-deep WFC3/IR data. We exploit all the WFC3/IR imaging over the Hubble Ultra-Deep Field from the HUDF09 and the new HUDF12 program, in addition to the HUDF09 parallel field data, as well as wider area imaging over GOODS-South.

  1. Men's childbearing desires and views of the male role in Europe at the dawn of the 21st century

    Directory of Open Access Journals (Sweden)

    Jürgen Dorbritz

    2008-11-01

    Full Text Available The development of modern family patterns of the past decades has been accompanied by substantial changes in social norms, values and gender relations. There is theoretical support for the assumption that the persistence of low fertility levels across Europe is likely to be linked to the incomplete gender revolution, more specifically to the lack of, or only limited changes in the male gender role as opposed to women's role. In order to have a deeper understanding of the development of fertility, we aim to shed more light on the impact of men's role orientation on their fertility intentions in this study. Our analyses include men aged 20-44 years in eight countries: Austria, Estonia, East Germany, West Germany, Italy, Lithuania, the Netherlands and Poland. The data are extracted from the Population Policy Acceptance Study of the early 2000s. Examining within-country differences, we find that men with egalitarian attitudes seem to have higher fertility aspirations than their traditional counterparts in contemporary Europe. This is supported by both the descriptive and the multivariate analyses. The picture is somewhat less conclusive though when we focus on country-rankings by intended family size and by the prevalence of egalitarian versus traditional attitudes.

  2. New dawn for electricity? EU policy and the changing decision space for electricity production in Sweden; a CANES Working Paper

    Energy Technology Data Exchange (ETDEWEB)

    Nilsson, Maans

    2009-11-15

    The European Union has taken an increasing interest in governing the energy sector in its Member States. However, EU still competes with national-level policies as well as sectoral organizational fields with sticky institutions, norms and knowledge. Therefore, despite its high ambitions in the energy field, for instance in the promotion of renewables and market reform, it is not clear whether the EU really exerts a strong influence, and if there is such an influence, the processes of influence and 'filtering' through to national political and industrial structures are not well understood. This paper examines a recent strategic change amongst national actors in Sweden in the energy sector; the decision space for investment in electricity. It examines the influence of European policy change, national political and policy change and organizational field-level developments on this decision space. It finds that European policy has rarely been very coercive, partly because Sweden has been a forerunner both on electricity market reform and renewable energy promotion, but that its influence is notable both directly through its emissions trading directive and more indirectly through signalling its intentions and long-term goals. Still, it appears that domestic developments, both cognitive and normative structures in the organizational field, and national policy change remain more instrumental determinants of the changed decision space. (Author)

  3. Dual-acting of Hybrid Compounds - A New Dawn in the Discovery of Multi-target Drugs: Lead Generation Approaches.

    Science.gov (United States)

    Abdolmaleki, Azizeh; Ghasemi, Jahan B

    2017-01-01

    Finding high quality beginning compounds is a critical job at the start of the lead generation stage for multi-target drug discovery (MTDD). Designing hybrid compounds as selective multitarget chemical entity is a challenge, opportunity, and new idea to better act against specific multiple targets. One hybrid molecule is formed by two (or more) pharmacophore group's participation. So, these new compounds often exhibit two or more activities going about as multi-target drugs (mtdrugs) and may have superior safety or efficacy. Application of integrating a range of information and sophisticated new in silico, bioinformatics, structural biology, pharmacogenomics methods may be useful to discover/design, and synthesis of the new hybrid molecules. In this regard, many rational and screening approaches have followed by medicinal chemists for the lead generation in MTDD. Here, we review some popular lead generation approaches that have been used for designing multiple ligands (DMLs). This paper focuses on dual- acting chemical entities that incorporate a part of two drugs or bioactive compounds to compose hybrid molecules. Also, it presents some of key concepts and limitations/strengths of lead generation methods by comparing combination framework method with screening approaches. Besides, a number of examples to represent applications of hybrid molecules in the drug discovery are included. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.

  4. [Pre-eclampsia prevention in 2018 in general population and in lupic women: At the dawn of a personalized medicine?

    Science.gov (United States)

    de Moreuil, C; Fauchais, A-L; Merviel, P; Tremouilhac, C; Le Moigne, E; Pasquier, E; Pan-Petesch, B; Lacut, K

    2018-06-19

    Pre-eclampsia prevention represents a major public health issue, as this vasculo-placental disorder generates a great burden of foeto-maternal morbi-mortality. Aspirin has proved its efficacy in primary and secondary pre-eclampsia prevention, especially when it is given at 150mg per day bedtime before 15 weeks of gestation to high-risk women. In the English trial ASPRE, high-risk women were identified by an algorithm taking into account angiogenic biomarkers ascertained at the end of first trimester of pregnancy. This article focuses on physiopathological mechanisms and risk factors of pre-eclampsia and on the interest of early angiogenic biomarkers dosing during pregnancy, for the assessment of pre-eclampsia risk. Unlike Great Britain or Israel, cost-effectiveness of this algorithm in general population has not been assessed in France. Finally, systemic lupus erythematous is at high risk of vasculo-placental disorders. Although few studies of angiogenic biomarkers dosing during lupus pregnancies identified a correlation between high sFlt1 levels at the end of first trimester and subsequent onset of severe vasculo-placental disorders, with a very good negative predictive value of sFtl1. Angiogenic biomarkers ascertainment for screening of vasculo-placental disorders in pregnant women with systemic lupus erythematous could allow targeting at best women needing an aspirin treatment and a closer monitoring. Copyright © 2018 Société Nationale Française de Médecine Interne (SNFMI). Published by Elsevier Masson SAS. All rights reserved.

  5. Sloan Digital Sky Survey Standard Star Catalog for Stripe 82: The Dawn of Industrial 1% Optical Photometry

    National Research Council Canada - National Science Library

    Ivezic, Zeljko; Smith, J. A; Miknaitis, Gajus; Lin, Huan; Tucker, Douglas; Lupton, Robert H; Gunn, James E; Knapp, Gillian R; Strauss, Michael A; Sesar, Branimir

    2007-01-01

    ... (at least four per band, with a median of 10) in the ugriz system. The catalog includes 1.01 million nonvariable unresolved objects from the equatorial stripe 82 in the right ascension range and with the corresponding r-band...

  6. Deployment Surveillance Summary, U.S. Army Operation Iraqi Freedom/Operation New Dawn/Operation Enduring Freedom, 2010

    Science.gov (United States)

    2012-12-10

    bases, and proper sliding technique education for softball and baseball sliding injuries. (31) (e) Mouthguard use in sports activities where there...95. 31. Pollack K, Canham-Chervak M, Gazal-Carvalho C, Jones B, Baker S. 2005. Interventions to prevent softball related injuries: a review of

  7. Worker radiation doses in the United States at the dawn of the atomic era (1940--1960)

    International Nuclear Information System (INIS)

    Strom, D.J.; Smith, M.H.; Swinth, K.L.; Pettengill, H.J.

    1994-06-01

    Radiation doses to workers at the Manhattan Engineer District (MED) and US Atomic Energy Commission (AEC) sites due to external irradiation during 1940--1960 are reviewed. Categorized radiation dose data were available from AEC annual reports for some years. Annual individual radiation dose data for ten MED/AEC sites for all years were available from the US Department of Energy's (DOE) Comprehensive Epidemiologic Data Resource (CEDR). These data are combined to produce an estimate of external collective dose equivalent to 172,000 person-rems (1720 person-Sv) for 1940--1960. During this period there were 41 overexposures, 19 criticality incidents, and 3 deaths due to acute radiation syndrome among several hundred thousand workers

  8. [Psychosocial rehabilitation at the dawn of the 21st century: II: Therapeutic or rehabilitative modalities and institutional disposition].

    Science.gov (United States)

    Gasset, François; Orita, Alina; Spagnoli, Dany; Pomini, Valentino; Rabia, Sophie; Ducret, Michel; Veillon, Henri; Cucchia, Anne-Therèse

    2004-04-01

    The main goal of psychosocial rehabilitation is to compensate the vulnerability underlying psychiatric disorders through intermediate institutions when the persistence and recurrence of these disorders have led to social and professional exclusion. Intermediate institutions refer to services which allow transition between the state of dependence on the hospital to the state of relative autonomy in social community. Psychosocial rehabilitation is a comprehensive approach which link the type of interventions: treatment, rehabilitation and support integrated in multimodal and individualized programs. A study of the out-patients followed by the rehabilitation unit of the psychiatric department in Lausanne has shown that provision of services is divided into 60% for rehabilitation, 20% for treatment and 20% for support independently of the psychiatric disorders. The implementation of these programs necessitates institutional support from psychiatric hospital to outpatient clinics through different types of facilities in order to offer a medical and psychosocial device of rehabilitation into the community.

  9. Provisioning the Ritual Neolithic Site of Kfar HaHoresh, Israel at the Dawn of Animal Management.

    Science.gov (United States)

    Meier, Jacqueline S; Goring-Morris, A Nigel; Munro, Natalie D

    2016-01-01

    It is widely agreed that a pivotal shift from wild animal hunting to herd animal management, at least of goats, began in the southern Levant by the Middle Pre-Pottery Neolithic B period (10,000-9,500 cal. BP) when evidence of ritual activities flourished in the region. As our knowledge of this critical change grows, sites that represent different functions and multiple time periods are needed to refine the timing, pace and character of changing human-animal relationships within the geographically variable southern Levant. In particular, we investigate how a ritual site was provisioned with animals at the time when herd management first began in the region. We utilize fauna from the 2010-2012 excavations at the mortuary site of Kfar HaHoresh-the longest continuous Pre-Pottery Neolithic B faunal sequence in the south Levantine Mediterranean Hills (Early-Late periods, 10,600-8,700 cal. BP). We investigate the trade-off between wild and domestic progenitor taxa and classic demographic indicators of management to detect changes in hunted animal selection and control over herd animal movement and reproduction. We find that ungulate selection at Kfar HaHoresh differs from neighboring sites, although changes in dietary breadth, herd demographics and body-size data fit the regional pattern of emerging management. Notably, wild ungulates including aurochs and gazelle are preferentially selected to provision Kfar HaHoresh in the PPNB, despite evidence that goat management was underway in the Mediterranean Hills. The preference for wild animals at this important site likely reflects their symbolic significance in ritual and mortuary practice.

  10. Space Educational Opportunities and Outreach Activities at the Dawn of the 21st Century. A European Students Perspective

    Science.gov (United States)

    Ferretti, S.; Robinson, D.; Manfletti, C.; Amadori, K.; Boccalatte, A.; Alessandrini, M.; Bedogna, P.; Corradi, P.; Marcuccio, M.

    2002-01-01

    Taking part in space activities and participating in the development and growth of space project has now become an undeniable reality. Thanks to academic institutions and outreach activities space enthusiasts can engage in numerous and diverse yet unique opportunities. The ESA Outreach Office sees students of every background taking part in its activities. This unique mixture of students of diverse nationalities enthusiastically co-operating ensures the program's interdisciplinarity. The added value of such an environment to the programs is significant and must not be forgotten. The friendship that blossom, and lose with which cultural and language barriers are overcome during the time spent working on the projects offered to university student and young professionals are invaluable. The purpose of this abstract is to give our perspective to the space community and to the general public on the importance of developing a space culture. The academic value of the space research projects mainly in which the authors have participated, the importance of such projects for the future of European relations and personal and social development through experience of international teams are topics that will be addressed. The activities discussed are : Attending sessions of congresses around the world, making contacts of major companies and players in the space sector, dealing of topics such as space engineering, policy and law, life sciences, business and finance, satellite applications, the exhilaration of floating in zero-g, the interdisciplinary, international and intercultural approach, the chance of quickly learning about many new concepts are just some of the marvellous experiences and opportunities that these programs offer. Reaching out to the general public is the second purpose of these unique activities.Images, photos and reports can seep into every house thanks to the great instrument that is the media, thus informing almost everyone about the activities and projects growing in the space arena. Newspapers, magazines and scientific publications are extra ordinarily powerful tools that can spread space news. Internet gives everyone the possibility of accessing an immense range of information regarding space flights, space stations, discoveries and new and old projects. Public events and congresses are also effective in approaching the general public and increasing its involvement in the space world. These media contacts are encouraged by the ESA Outreach Office, Euravia association and ISU, and students involve the respective countries as much as possible. This paper aims to show how these media have been used and have lead to the creation of a strong network bringing European universities and organisations together. The experiences have been life changing for the authors. They have succeeded in bringing culturally different young scientists together from across Europe (East Europe and Russia) to strive for a common goal and to better understand space sciences and the next generation technology. It is these experiences that have allowed a deeper understanding of those interpersonal interactions occurring within diverse European teams. Young professionals will no longer work in a country alone but in an European arena and this change makes such understanding essential for the future of Space industry.

  11. Twilight of dawn or of evening? A century of research methods in the Journal of Applied Psychology.

    Science.gov (United States)

    Cortina, Jose M; Aguinis, Herman; DeShon, Richard P

    2017-03-01

    We offer a critical review and synthesis of research methods in the first century of the Journal of Applied Psychology. We divide the chronology into 6 periods. The first emphasizes the first few issues of the journal, which, in many ways, set us on a methodological course that we sail to this day, and then takes us through the mid-1920s. The second is the period through World War II, in which we see the roots of modern methodological concepts and techniques, including a transition from a discovery orientation to a hypotheticodeductive model orientation. The third takes us through roughly 1970, a period in which many of our modern-day practices were formed, such as reliance on null hypothesis significance testing. The fourth, from 1970 through 1989, sees an emphasis on the development of measures of critical constructs. The fifth takes us into the present, which is marked by greater plurality regarding data-analytic approaches. Finally, we offer a glimpse of possible and, from our perspective, desirable futures regarding research methods. Specifically, we highlight the need to conduct replications; study the exceptional and not just the average; improve the quality of the review process, particularly regarding methodological issues; emphasize design and measurement issues; and build and test more specific theories. (PsycINFO Database Record (c) 2017 APA, all rights reserved).

  12. The dawn of the information age in least developed countries (LDCs: lessons learned from four case studies

    Directory of Open Access Journals (Sweden)

    Robert M. Bichler

    2008-12-01

    On the micro level the project aims to investigate the users’ demographics, their habits of ICT use, as well as the barriers and opportunities for the citizens emerging from the upcoming information age. The findings from the macro and the micro level will be correlated on the basis of the five dimensions of society (ecological, political, cultural, economical and technological to assess the state of the art and to formulate strategies to counter the current eColonialism tendencies and to foster a sustainable implementation of ICTs in LDCs.

  13. Climatic Crisis: Place, Taste and Race in Hardy Wilson’s 'Dawn of a New Civilization' (1929

    Directory of Open Access Journals (Sweden)

    Deborah van der Plaat

    2013-10-01

    Full Text Available In 1929, the Australian architect and author William Hardy Wilson (1881–1950 identified architectural practice within Australia as degenerate and in decline. He attributed this regression not to changing tastes or styles but to the increasing number of native-born architects and their long-term exposure to a subtropical or tropical climate. Wilson believed that Australia’s warmer climates negatively affected the nation’s future capacity for innovation and invention and the development of national style. Central to Wilson’s thesis was the proposition that climate was the primary determinant of artistic agency. The importance of this idea was twofold. First, it enabled Wilson to develop a critique of the White Australia policies which were introduced in 1901 and which grew in influence in the early decades of twentieth-century Australia. Second, it helped Wilson to locate Australian architectural practice within a global theory of civilisation. In documenting the crisis that Wilson saw within the architecture of Australia, the paper considers this aspect of his work in detail for the first time.

  14. Mental stress as consequence and cause of vision loss: the dawn of psychosomatic ophthalmology for preventive and personalized medicine.

    Science.gov (United States)

    Sabel, Bernhard A; Wang, Jiaqi; Cárdenas-Morales, Lizbeth; Faiq, Muneeb; Heim, Christine

    2018-06-01

    The loss of vision after damage to the retina, optic nerve, or brain has often grave consequences in everyday life such as problems with recognizing faces, reading, or mobility. Because vision loss is considered to be irreversible and often progressive, patients experience continuous mental stress due to worries, anxiety, or fear with secondary consequences such as depression and social isolation. While prolonged mental stress is clearly a consequence of vision loss, it may also aggravate the situation. In fact, continuous stress and elevated cortisol levels negatively impact the eye and brain due to autonomous nervous system (sympathetic) imbalance and vascular dysregulation; hence stress may also be one of the major causes of visual system diseases such as glaucoma and optic neuropathy. Although stress is a known risk factor, its causal role in the development or progression of certain visual system disorders is not widely appreciated. This review of the literature discusses the relationship of stress and ophthalmological diseases. We conclude that stress is both consequence and cause of vision loss. This creates a vicious cycle of a downward spiral, in which initial vision loss creates stress which further accelerates vision loss, creating even more stress and so forth. This new psychosomatic perspective has several implications for clinical practice. Firstly, stress reduction and relaxation techniques (e.g., meditation, autogenic training, stress management training, and psychotherapy to learn to cope) should be recommended not only as complementary to traditional treatments of vision loss but possibly as preventive means to reduce progression of vision loss. Secondly, doctors should try their best to inculcate positivity and optimism in their patients while giving them the information the patients are entitled to, especially regarding the important value of stress reduction. In this way, the vicious cycle could be interrupted. More clinical studies are now needed to confirm the causal role of stress in different low vision diseases to evaluate the efficacy of different anti-stress therapies for preventing progression and improving vision recovery and restoration in randomized trials as a foundation of psychosomatic ophthalmology.

  15. Artificial night lighting rather than traffic noise affects the daily timing of dawn and dusk singing in common European songbirds

    NARCIS (Netherlands)

    Da Silva, Arnaud; Samplonius, Jelmer Menno; Schlicht, Emmi; Valcu, Mihai; Kempenaers, Bart

    2014-01-01

    It is well established that artificial night lighting can influence animal orientation, but there is less information about its effects on other behaviors. Previous work suggested that light pollution can affect both seasonal and daily patterns of behavior. The aim of our study was to investigate

  16. Mesocosm-Scale Experimental Quantification of Plant-Fungi Associations on Carbon Fluxes and Mineral Weathering

    Science.gov (United States)

    Andrews, M. Y.; Palmer, B.; Leake, J. R.; Banwart, S. A.; Beerling, D. J.

    2009-12-01

    The rise of land plants in the Paleozoic is classically implicated as driving lower atmospheric CO2 levels through enhanced weathering of Ca and Mg bearing silicate minerals. However, this view overlooks the fact that plants coevolved with associated mycorrhizal fungi over this time, with many of the weathering processes usually ascribed to plants actually being driven by the combined activities of roots and mycorrhizal fungi. Here we present initial results from a novel mesocosm-scale laboratory experiment designed to allow investigation of plant-driven carbon flux and mineral weathering at different soil depths under ambient (400 ppm) and elevated (1500 ppm) atmospheric CO2. Four species of plants were chosen to address evolutionary trends in symbiotic mycorrhizal association and rooting depth on biologically driven silicate weathering under the different CO2 regimes. Gymnosperms were used to investigate potential differences in weathering capabilities of two fungal symbioses: Sequoia sempervirens and Metasequoia glyptostroboides (arbuscular mycorrhizal, AM) and Pinus sylvestris (ectomycorrhizal, EM), and the shallow rooted ancient fern, Osmunda regalis, used to provide a contrast to the three more deeply rooted trees. Plants were grown in a cylindrical mesocosm with four horizontal inserts at each depth. These inserts are a mesh-covered dual-core unit whereby an inner core containing silicate minerals can be rotated within an outer core. The mesh excludes roots from the cylinders allowing fungal-rock pairings to be examined at each depth. Each core contains either basalt or granite, each with severed (rotated cores) or intact (static cores) mycorrhizae. This system provides a unique opportunity to examine the ability of a plant to weather minerals with and without its symbiotic fungi. Preliminary results indicate marked differences in nutritional and water requirements, and response to elevated CO2 between the species. The bulk solution chemistries (p

  17. Forest Resources of the Caucasian Black Sea Coast: Problems and Prospects of Rational Use

    Directory of Open Access Journals (Sweden)

    S. M. Bebia

    2015-02-01

    Full Text Available More than 70 % of the Caucasian Black Sea Coast (CBSC forests grow in mountainous conditions of the Colchis phytogeographical province and perform primary environmental functions. In these forests for a long period of time excessively intense logging has been in practice, which caused serious damage to their health. The main issues of forestry here are the introduction of effective methods of harvesting, using rational technology in logging operations, restoring native forest types at past logging sites, increasing the productivity and sustainability of forests on the bioecological biogeocenotical level, and preserving the riparian-protective role of forests. In the article, the author analyzes the results of many years of research in forests of the CBSC, that consider the question of condition of forests, peculiarity the multifunctional values and priority direction forestry in them. The author also considers the basic conformity of structure and com-position of forest stands, and presents evidence about the natural renewal of logging sites in fir and beech forests. It has been established that high intensity selective logging more than 50 % canopy cover and bringing the stand after logging 0.5 and below leads to degradation of forests, except for the possibility of natural regeneration felling areas for over 70 years. The study substantiates the effectiveness of selective forms of forest management in the uneven-aged stands and the importance of a multi-purpose and sustainable use of forest resources. The study emphasizes the need for a rational technology of logging operations and silvicultural demands strict compliance with the development of cutting areas and suggests ways to improve the productivity of forests, using introduced valuable tree species. For example, Sequoia sempervirens Endl. in the plantings of forest monocultures on the Abkhazian Research Forest Experimental Station (Ochamchira at age of 50 years forms a valuable timber of

  18. The relationship between perceptions of wilderness character and attitudes toward management intervention to adapt biophysical resources to a changing climate and nature restoration at Sequoia and Kings Canyon National Parks

    Science.gov (United States)

    Alan Watson; Steve Martin; Neal Christensen; Gregg Fauth; Dan Williams

    2015-01-01

    In a recent national survey of federal wilderness managers, respondents identified the high priority need for scientific information about public attitudes toward biophysical intervention to adapt to climate change and attitudes of the public toward restoration of natural conditions. In a survey of visitors to one National Park wilderness in California, visitors...

  19. Global Linear Instability at the Dawn of its 4th Decade: A List of Challenges (A Practical Guide on how to Contain the Euphoria and Avoid the Oversell)

    OpenAIRE

    Theofilis, Vassilios; Gómez, F.; Paredes Gonzalez, Pedro; Le Clainche Martínez, Soledad; Hermanns Navarro, Miguel

    2011-01-01

    Global linear instability theory is concerned with the temporal or spatial development of small-amplitude perturbations superposed upon laminar steady or time-periodic threedimensional flows, which are inhomogeneous in two (and periodic in one) or all three spatial directions.1 The theory addresses flows developing in complex geometries, in which the parallel or weakly nonparallel basic flow approximation invoked by classic linear stability theory does not hold. As such, global linear theory ...

  20. When the "twilight of justice" meets the "dawn of nanotechnology": A critique of transhumanism and the technological imperative in the light of George Grant's moral philosophy

    Science.gov (United States)

    Rosales, Janna Metcalfe

    This dissertation examines how contemporary Western ethical perspectives frame moral judgements about technologies intended to expand or enhance human abilities. Of particular interest are technological advances that involve nanotechnology, a realm of technoscience that seeks the precise control of matter through deliberately designing structures, devices, and processes with novel and useful properties at the molecular scale. In this thesis I analyze trends in the emerging dialogue about the social and ethical implications of nanotechnology. There is growing awareness that technological "progress" should not outpace critical reflection over the means and ends of those advances, but I argue that there is a tension between the role of ethics and the practice of technoscience. By ethics I mean ongoing public discussion that contemplates what it means to live a "good life" and that maintains limits to human actions. By contrast, the practice of technoscience appears to be guided by the "technological imperative" which holds that we can only know what is good by first figuring out what is possible. Despite concerted interdisciplinary efforts to address the broad range of ethical issues posed by nanotechnology's proposed goals, the prevailing tone of the current discussion tends to reveal what I call a "technoprogressive" bias, or the belief that technological development is a primary way to improve the human estate and that it leads inevitably to cumulative progress. However, because technoprogressive commentary on nanotechnology focuses on concerns that are framed mainly in terms of risk assessment, cost-benefit analyses, and utilitarian principles, technoprogressive ethics overlooks crucial ethical questions of a different nature, questions that deal with the limits of human action, the nature of justice, and the meaning of being human. To analyze the implications of technoprogressive ethics, I employ the moral philosophy of Canadian thinker George Grant because he articulates an underrepresented yet valuable critique of Western society's relationship with technology. Grant speaks for a type of transcendental moral realism that challenges the primacy of the technological imperative, insisting that justice ultimately must be grounded upon non-negotiable limits, and that there are objective norms to which human freedom and human self-assertion have to answer.

  1. Emergency Department Visits for Drug-Related Suicide Attempts Involving Antidepressants by Adolescents and Young Adults: 2004 to 2008. The DAWN Report

    Science.gov (United States)

    Substance Abuse and Mental Health Services Administration, 2011

    2011-01-01

    In 2008, adolescents made 23,124 visits to the emergency department (ED) for drug-related suicide attempts, and young adults made 38,036 such visits; of these visits, 23.0 percent (5,312 visits) among adolescents and 17.6 percent (6,700 visits) among young adults involved antidepressants. Among ED visits for suicide attempts involving…

  2. Monitoring of Individual Needs in Diabetes (MIND)-2 Follow-up data from the cross-national Diabetes Attitudes, Wishes, and Needs (DAWN) MIND study

    NARCIS (Netherlands)

    Snoek, F.J.; Kersch, N.Y.A.; Eldrup, E.; Harman-Boehm, I.; Hermanns, N.; Kokoszka, A.; Matthews, D.R.; McGuire, B.E.; Pibernik-Okanovic, M.; Singer, J.; de Wit, M.; Skovlund, S.E.

    2012-01-01

    OBJECTIVE - To test the effects of implementing computer-assisted Monitoring of Individual Needs in Diabetes (MIND) in routine diabetes care on psychological status and glycemic control, identify predictors of poor psychological outcomes, and evaluate care providers' experiences. RESEARCH DESIGN AND

  3. 21CMMC with a 3D light-cone: the impact of the co-evolution approximation on the astrophysics of reionisation and cosmic dawn.

    Science.gov (United States)

    Greig, Bradley; Mesinger, Andrei

    2018-03-01

    We extend 21CMMC, a Monte Carlo Markov Chain sampler of 3D reionisation simulations, to perform parameter estimation directly on 3D light-cones of the cosmic 21cm signal. This brings theoretical analysis closer to the tomographic 21-cm observations achievable with next generation interferometers like HERA and the SKA. Parameter recovery can therefore account for modes which evolve with redshift/frequency. Additionally, simulated data can be more easily corrupted to resemble real data. Using the light-cone version of 21CMMC, we quantify the biases in the recovered astrophysical parameters if we use the 21cm power spectrum from the co-evolution approximation to fit a 3D light-cone mock observation. While ignoring the light-cone effect under most assumptions will not significantly bias the recovered astrophysical parameters, it can lead to an underestimation of the associated uncertainty. However significant biases (˜few - 10 σ) can occur if the 21cm signal evolves rapidly (i.e. the epochs of reionisation and heating overlap significantly) and: (i) foreground removal is very efficient, allowing large physical scales (k {≲} 0.1 Mpc-1) to be used in the analysis or (ii) theoretical modelling is accurate to within ˜10 per cent in the power spectrum amplitude.

  4. Nietzsche’s New Dawn / Nietzsches nieuwe dageraad : Educating students to strive for better in a dynamic professional world / studenten leren streven naar beter in een dynamische beroepspraktijk

    NARCIS (Netherlands)

    H. (Henriëtta) Joosten

    2015-01-01

    Professional higher education is expected to educate large numbers of students to become innovative professionals within a time frame of three or four years. A mission impossible? Not necessarily, according to Henriëtta Joosten who is a philosopher as well as a teacher. She uses the experimental,

  5. Psychosocial problems and barriers to improved diabetes management: results of the Cross-National Diabetes Attitudes, Wishes and Needs (DAWN) Study

    NARCIS (Netherlands)

    Peyrot, M.; Rubin, R.R.; Lauritzen, T.; Snoek, F.J.; Matthews, D.R.; Skovlund, S.E.

    2005-01-01

    Aims: To examine patient- and provider-reported psychosocial problems and barriers to effective self-care and resources for dealing with those barriers. Methods: Cross-sectional study using face-to-face or telephone interviews with diabetic patients and health-care providers in 13 countries in Asia,

  6. The urge to exhibit: the Egyptian and Etruscan Museums in the Vatican at the dawn of a nationalist era in Europe (1815-1840)

    NARCIS (Netherlands)

    Hoijtink, M.

    2008-01-01

    The Musei Gregoriano Etrusco and Egizio in the Vatican were opened in the 1830s. The auctor intellectualis of these museums was Pius VII and the conceptualisation can be attributed to Antonio Canova who foresaw the Vatican collections as a future ‘Museum of the World’. The author compares these and

  7. Deployment Surveillance Summary, U.S. Army Operation Iraqi Freedom/Operation New Dawn/Operation Enduring Freedom, 2011. Injury Prevention Report

    Science.gov (United States)

    2012-12-10

    d) Breakaway bases, recessed bases, and proper sliding technique education for softball and baseball sliding injuries.(31) (e...327. 31. Pollack K, Canham-Chervak M, Gazal-Carvalho C, Jones B, Baker S. 2005. Interventions to prevent softball related injuries: a review

  8. Molecular Pathology and Personalized Medicine: The Dawn of a New Era in Companion Diagnostics-Practical Considerations about Companion Diagnostics for Non-Small-Cell-Lung-Cancer.

    Science.gov (United States)

    Plönes, Till; Engel-Riedel, Walburga; Stoelben, Erich; Limmroth, Christina; Schildgen, Oliver; Schildgen, Verena

    2016-01-15

    Companion diagnostics (CDx) have become a major tool in molecular pathology and assist in therapy decisions in an increasing number of various cancers. Particularly, the developments in lung cancer have been most impressing in the last decade and consequently lung cancer mutation testing and molecular profiling has become a major business of diagnostic laboratories. However, it has become difficult to decide which biomarkers are currently relevant for therapy decisions, as many of the new biomarkers are not yet approved as therapy targets, remain in the status of clinical studies, or still have not left the experimental phase. The current review is focussed on those markers that do have current therapy implications, practical implications arising from the respective companion diagnostics, and thus is focused on daily practice.

  9. “A good deal about California does not, on its own preferred terms, add up”: Joan Didion between Dawning Apocalypse and Retrogressive Utopia

    Directory of Open Access Journals (Sweden)

    Eva-Sabine Zehelein

    2011-09-01

    Full Text Available Joan Didion’s depiction of the American West and California is colored by an idiosyncratic sensitivity to her surroundings, intertwined with a sentimental-retrogressive image of the nature, history, character, and meaning of the West as a cultural topos. Her New Journalism-like observations of California are always closely linked to her own self and psyche, are seismographs of her own confusions, of moments of disorientation, insecurity, and loss. Didion is therefore one of those exceptional writers, who, in her fictionalized reportages, comments on American reality, ideas, and her own predicament. Identity and landscape fuse into an auto-psychoanalysis, which at the same time reveals a great deal about the American condition, its constantly strained relationship between rhetoric or auto-mythology and lived reality. This article draws primarily on Slouching Towards Bethlehem (1968 and Where I Was From (2003, but also on After Henry (1992 and The White Album (1979, to illustrate these points.

  10. “A good deal about California does not, on its own preferred terms, add up”: Joan Didion between Dawning Apocalypse and Retrogressive Utopia

    OpenAIRE

    Eva-Sabine Zehelein

    2011-01-01

    Joan Didion’s depiction of the American West and California is colored by an idiosyncratic sensitivity to her surroundings, intertwined with a sentimental-retrogressive image of the nature, history, character, and meaning of the West as a cultural topos. Her New Journalism-like observations of California are always closely linked to her own self and psyche, are seismographs of her own confusions, of moments of disorientation, insecurity, and loss. Didion is therefore one of those exceptional ...

  11. Molecular Pathology and Personalized Medicine: The Dawn of a New Era in Companion Diagnostics—Practical Considerations about Companion Diagnostics for Non-Small-Cell-Lung-Cancer

    Directory of Open Access Journals (Sweden)

    Till Plönes

    2016-01-01

    Full Text Available Companion diagnostics (CDx have become a major tool in molecular pathology and assist in therapy decisions in an increasing number of various cancers. Particularly, the developments in lung cancer have been most impressing in the last decade and consequently lung cancer mutation testing and molecular profiling has become a major business of diagnostic laboratories. However, it has become difficult to decide which biomarkers are currently relevant for therapy decisions, as many of the new biomarkers are not yet approved as therapy targets, remain in the status of clinical studies, or still have not left the experimental phase. The current review is focussed on those markers that do have current therapy implications, practical implications arising from the respective companion diagnostics, and thus is focused on daily practice.

  12. The Dawning of a New Day for the Southwest: A History of the Tulsa District Corps of Engineers 1939-1971

    Science.gov (United States)

    1975-01-01

    maneuverings- shenanigans in local straight talk-were deemed necessary at times to bring about certain results , that is here, too. It is the...Pinkey, Executive Vice President, made the financial records, correspondence, minutes of membership meetings, minutes of meetings of the Board of...it financially and sending represen- tatives to its annual meetings. Muskogee leaders seem also to have supported the Rivers and Harbors Congress

  13. Feeding behaviour in a ‘basal’ tortoise provides insights on the transitional feeding mode at the dawn of modern land turtle evolution

    Directory of Open Access Journals (Sweden)

    Nikolay Natchev

    2015-08-01

    Full Text Available Almost all extant testudinids are highly associated with terrestrial habitats and the few tortoises with high affinity to aquatic environments are found within the genus Manouria. Manouria belongs to a clade which forms a sister taxon to all remaining tortoises and is suitable as a model for studying evolutionary transitions within modern turtles. We analysed the feeding behaviour of Manouria emys and due to its phylogenetic position, we hypothesise that the species might have retained some ancestral features associated with an aquatic lifestyle. We tested whether M. emys is able to feed both in aquatic and terrestrial environments. In fact, M. emys repetitively tried to reach submerged food items in water, but always failed to grasp them—no suction feeding mechanism was applied. When feeding on land, M. emys showed another peculiar behaviour; it grasped food items by its jaws—a behaviour typical for aquatic or semiaquatic turtles—and not by the tongue as generally accepted as the typical feeding mode in all tortoises studied so far. In M. emys, the hyolingual complex remained retracted during all food uptake sequences, but the food transport was entirely lingual based. The kinematical profiles significantly differed from those described for other tortoises and from those proposed from the general models on the function of the feeding systems in lower tetrapods. We conclude that the feeding behaviour of M. emys might reflect a remnant of the primordial condition expected in the aquatic ancestor of the tortoises.

  14. Quarantine as a public health measure against an emerging infectious disease: syphilis in Zurich at the dawn of the modern era (1496–1585

    Directory of Open Access Journals (Sweden)

    Gall, Gabriella Eva Cristina

    2016-06-01

    Full Text Available Syphilis is considered as one of the most devastating sexually transmitted diseases in human history. Based on historical records, the (German for spread through Europe after 1495 and shared symptoms with what we know today as syphilis. Many cities took measures to protect their population. Here, transliterations of archival documents from the 15 and 16 century (provided in the appendix are used to trace the steps taken by the governing authorities in Zurich to deal with this emerging infectious disease. One of the central measures taken by the city was to establish a quarantine facility referred to as the The city doctors, including the well-known physician and naturalist Conrad Gessner, oversaw the obligatory quarantine and treatment of patients with symptoms. Treatment could range from better nutrition, herbal remedies and skin ointments to aggressive heat therapy and “smoking”. Furthermore, the affliction was suspected as a sexually acquired disease, hence prostitutes and infected foreigners were extradited from the city. Meanwhile, the church used its social influence to promote a more “Christian” behavior. In several respects, the public health measures taken in the 16 century against a new and menacing epidemic do not diverge in their basic rationale from approaches used during the 20 century and today.

  15. The World Database for Pediatric and Congenital Heart Surgery: The Dawn of a New Era of Global Communication and Quality Improvement in Congenital Heart Disease.

    Science.gov (United States)

    St Louis, James D; Kurosawa, Hiromi; Jonas, Richard A; Sandoval, Nestor; Cervantes, Jorge; Tchervenkov, Christo I; Jacobs, Jeffery P; Sakamoto, Kisaburo; Stellin, Giovanni; Kirklin, James K

    2017-09-01

    The World Society for Pediatric and Congenital Heart Surgery was founded with the mission to "promote the highest quality comprehensive cardiac care to all patients with congenital heart disease, from the fetus to the adult, regardless of the patient's economic means, with an emphasis on excellence in teaching, research, and community service." Early on, the Society's members realized that a crucial step in meeting this goal was to establish a global database that would collect vital information, allowing cardiac surgical centers worldwide to benchmark their outcomes and improve the quality of congenital heart disease care. With tireless efforts from all corners of the globe and utilizing the vast experience and invaluable input of multiple international experts, such a platform of global information exchange was created: The World Database for Pediatric and Congenital Heart Disease went live on January 1, 2017. This database has been thoughtfully designed to produce meaningful performance and quality analyses of surgical outcomes extending beyond immediate hospital survival, allowing capture of important morbidities and mortalities for up to 1 year postoperatively. In order to advance the societal mission, this quality improvement program is available free of charge to WSPCHS members. In establishing the World Database, the Society has taken an essential step to further the process of global improvement in care for children with congenital heart disease.

  16. [The examination of men's wits by Juan Huarte de San Juan, and the dawn of the neurobiology of intelligence in the Spanish renaissance].

    Science.gov (United States)

    Martín-Araguz, A; Bustamante-Martínez, C

    The Spanish renaissance doctor Juan Huarte de San Juan (1529-1588) was the author of a unique and immortal work, The Examination of Men's Wits, the edition princeps of which was printed in Baeza in 1575. Since then it has been reprinted at least 80 times and translated into seven languages, which makes it the most influential Spanish contribution to medicine ever published. In this paper we review the unjustly little-known figure of Huarte as the founder of Neuropsychology, and we also analyse his works from a historical and neuroscientific point of view. Huarte's writings deal with the problem of the organic relations between the brain and understanding, and accept the possible influences exerted by temper on the will within the field of the Neurobiology of Intelligence. Thus, over four centuries ago Huarte became the founder of Differential or Physiological Psychology, Neuropsychology, Eugenics and Career Guidance. Huarte's work not only played a fundamental role in the history and development of the body of neuroscientific knowledge, but has also been a clear (although not always cited) influence on scientists, philosophers and men of letters such as Alarcón, Bacon, Cabanis, Cervantes (whose Don Quixote was inspired by him), Charron, Chomsky, Gall, Goethe, Hume, Kant, Kretchmer, Lessing, Lope de Vega, Montaigne, Montesquieu, Nietzsche, Quevedo, Rousseau, Schopenhauer, Thomasius, Tirso de Molina and Ziegler. In the middle of the 16th century, Huarte and his Examination of Men's Wits, together with the works of the naturalist philosophers Gómez Pereira (Antoniana Margarita, 1554) and Miguel Sabuco (New Philosophy, 1587), constituted the prestigious triumvirate of Spanish Renaissance scholars who, for the first time in history, contemplated the workings of the brain from a point of view that had more to do with science than the supernatural.

  17. Characterization of Cypress Wood for Kraft Pulp Production

    Directory of Open Access Journals (Sweden)

    António J. A. Santos

    2014-06-01

    Full Text Available Wood samples of Cupressus arizonica, C. lusitanica, and C. sempervirens were evaluated for chemical, anatomical, and pulp characteristics as raw material for pulp production. Two 17-year-old trees per species were harvested, and wood samples were taken at a height of 2 m. Wood chips from Pinus pinaster (Portugal and P. sylvestris (Finland were used as references. C. arizonica differed from C. lusitanica and C. sempervirens with significantly lower (p < 0.05 tracheid diameter and wall thickness in the earlywood. The total extractives contents were 3.9%, 3.3%, and 2.5% for C. lusitanica, C. sempervirens, and C. arizonica, respectively, lower than the 5.1% for P. pinaster and 4.5% for P. sylvestris. Klason lignin content ranged from 33.0 to 35.6%, higher than the 28.0 to 28.7% for the pinewoods. The kraft pulp yields for C. arizonica, C. lusitanica, and C. sempervirens were 37.7%, 36.7%, and 38.7%, respectively, with kappa numbers of 32.0, 31.6, and 28.7, respectively; the yield values were 40.8% and 42.8%, with kappa numbers of 23.4 and 21.0, for P. pinaster and P. sylvestris, respectively. The cypress species are clearly different from pine in relation to wood pulping behavior. Among the cypress, C. sempervirens provided the best pulping results.

  18. 76 FR 13944 - Approval and Promulgation of Air Quality Implementation Plans; State of California; Regional Haze...

    Science.gov (United States)

    2011-03-15

    ... Wilderness; 14. Emigrant Wilderness; 15. Hoover Wilderness; 16. Yosemite National Park; 17. Ansel Adams... monitor) Ansel Adams WA, Kaiser WA, John 15.5 14.9 13.6 7.1 2200 Muir WA (KAIS monitor)......... Sequoia...

  19. Taliraps on koristatud ja müüdudki / Lii Sammler

    Index Scriptorium Estoniae

    Sammler, Lii, 1963-

    2014-01-01

    Esimest korda talirapsiga viljelusvõistlusel osalenud Väätsa Agro ja Karinu PM OÜ panustasid sordile DK 'Sequoia' ja esialgsetel andmetel korjati kuiva seemet 4-5 tonni ümber hektarilt. Vestlusest agronoomidega

  20. AcEST: BP917160 [AcEST

    Lifescience Database Archive (English)

    Full Text Available sequoia glyptostroboides PE=2 SV=1 Length = 319 Score = ...jct: 64 GRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGSILFEETLY 121 >tr|Q8LK59|Q8LK59_METGY Fructose-bisphosphate aldolase OS=Meta

  1. Information needs for natural fire management planning

    Science.gov (United States)

    Parsons, David; Bancroft, Larry; Nichols, Thomas; Stohlgren, Thomas

    1985-01-01

    The development and implementation of an effective natural fire management program require a clear definition of goals and objectives, an ever-expanding information base, and effective program evaluation. Examples are given from Sequoia and Kings Canyon National Parks.

  2. The WHO Tobacco Convention: A New Dawn in the Implementation of International Health Instrument? Comment on "The Legal Strength of International Health Instruments - What It Brings to Global Health Governance?"

    Science.gov (United States)

    Durojaye, Ebenezer

    2017-07-05

    The Tobacco Convention was adopted by the World Health Organization (WHO) in 2003. Nikogosian and Kickbusch examine the five potential impacts of the Tobacco Convention and its Protocol on public health. These include the adoption of the Convention would seem to unlock the treaty-making powers of WHO; the impact of the Convention in the global health architecture has been phenomenal globally; the Convention has facilitated the adoption of further instruments to strengthen its implementation at the national level; the Convention has led to the adoption of appropriate legal framework to combat the use of tobacco at the national level and that the impact of the Convention would seem to go beyond public health but has also led to the adoption of the Protocol to Eliminate Illicit Trade in Tobacco. However, the article by Nikogosian and Kickbusch would seem to overlook some of the challenges that may militate against the effective implementation of international law, including the Tobacco Convention, at the national level. © 2018 The Author(s); Published by Kerman University of Medical Sciences. This is an open-access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.

  3. Business, State and Public Policies in Brazil: New trends at the dawn of a new Millennium Empresariado, estado y políticas públicas en Brasil: nuevas tendencias en el umbral del nuevo milenio

    Directory of Open Access Journals (Sweden)

    Eli DINIZ

    2010-10-01

    Full Text Available The article examines the scope and depth of the changes in Brazil since the 1980s, when the transition to democracy and the implementation of market reforms came to the forefront of the public agenda. Through a comparison between the 1980s and 1990s, the article examines developments in the economic order and social structure of Brazil with particular emphasis on political and institutional changes. With this aim, the paper looks specifically at the style of public management, the nature of the decision-making process, and the channels of statesociety interaction as well as the mechanisms for access to the decision-making centres. Finally, the article assesses the changes and relative importance of strategic actors in the new capitalist order.El artículo evalúa el alcance y la profundidad de las transformaciones desencadenadas en Brasil a partir de la década de los años 80, cuando la instauración de la democracia y la ejecución de las reformas orientadas al mercado asumen el primer plano de la agenda pública. Mediante un contraste entre las décadas de los 80 y 90, este trabajo enfatiza los cambios en el orden económico y en la organización social del país, destancando las modificaciones de naturaleza política e institucional. Y para ello analiza particularmente el estilo de gestión pública, la naturaleza del proceso de toma de decisiones, las formas de articulación entre Estado y sociedad, así como los canales de acceso a los centros de decisión. Por último, se abordan las transformaciones en el peso relativo y en el papel de los actores estratégicos del nuevo orden capitalista en construcción.

  4. Development of polymorphic genic-SSR markers by cDNA library sequencing in boxwood, Buxus spp. (Buxaceae)

    Science.gov (United States)

    Genic microsatellites or simple sequence repeat (genic-SSR) markers were developed in boxwood (Buxus taxa) for genetic diversity analysis, identification of taxa, and to facilitate breeding. cDNA libraries were developed from mRNA extracted from leaves of Buxus sempervirens ‘Vardar Valley’ and seque...

  5. 78 FR 11899 - Notice of Realty Action: Direct Sale of Public Land in San Mateo County, CA

    Science.gov (United States)

    2013-02-20

    ... California Nonprofit Corporation, for the appraised fair market value. The total appraised value of both... Sempervirens Fund for the appraised fair market value of $420,000. Parcel No. 2 T. 8 S., R. 4 W., Sec. 9, NE\\1... appraised fair market value of $450,000. The areas described aggregate 80 acres, more or less, in Santa...

  6. Chemical and biological characterization of phytotoxins produced by Diplodia species, fungi involved in forest plants diseases

    OpenAIRE

    Masi, Marco

    2013-01-01

    In recent years, numerous studies have been initiated in order to understand what are the microorganisms involved in forest plants diseases and the role played by phytotoxins produced in the pathogenesis processes. The aim of the present thesis was to study the fungi and the phytotoxins associated with canker disease of the Italian cypress (Cupressus sempervirens L.) and the branch dieback of juniper (Juniperus phoenicea L.) which are plant diseases with noteworthy social and economical impli...

  7. 75 FR 15721 - Back Bay National Wildlife Refuge, City of Virginia Beach, VA

    Science.gov (United States)

    2010-03-30

    ... advance scheduling, group educational opportunities. Outdoor facilities are open daily dawn to dusk... during January 2002. Meetings were advertised locally through news releases, paid [[Page 15722...

  8. Chemical Composition and Antimicrobial Activities of Essential Oils of Some Coniferous Plants Cultivated in Egypt.

    Science.gov (United States)

    Ibrahim, Taghreed A; El-Hela, Atef A; El-Hefnawy, Hala M; Al-Taweel, Areej M; Perveen, Shagufta

    2017-01-01

    Family Cupressaceae is the largest coniferous plant family. Essential oils of many species belonging to family Cupressaceae are known to have several biological activities specially antimicrobial activity. The essential oils from aerial parts of Calocedrus decurrens Torr., Cupressus sempervirens stricta L. and Tetraclinis articulata (Vahl) Mast. were prepared by hydrodistillation. The chemical composition of the essential oils has been elucidated by gas chromatography-mass spectroscopy analysis. The prepared essential oils were examined against selected species of Gram-positive, Gram-negative bacteria and Candida species. Broth dilution methods were used to detect minimum inhibitory concentration (MIC), minimum bactericidal concentration (MBC) and minimum fungicidal concentration (MFC). Sixteen compounds were identified in the essential oils of both Calocedrus decurrens and Cupressus sempervirens L. and fifteen compounds were identified in the essential oil of Tetraclinis articulata . δ-3-Carene (43.10%), (+)-Cedrol (74.03%) and Camphor (21.23%) were the major constituents in the essential oils of Calocedrus decurrens , Cupressus sempervirens L. and Tetraclinis articulata , respectively. The essential oils showed strong antimicrobial activities against the selected microorganisms in concentration range 0.02 3- 3.03 µL/mL. This study could contribute to the chemotaxonomic characterization of family Cupressaceae. In addition, it proved that the essential oils under investigation possess potential antimicrobial properties.

  9. Magnetic record associated with tree ring density: Possible climate proxy

    Czech Academy of Sciences Publication Activity Database

    Kletetschka, Günther; Pruner, Petr; Venhodová, Daniela; Kadlec, Jaroslav

    2007-01-01

    Roč. 8, - (2007), s. 1-11 ISSN 1467-4866 Institutional research plan: CEZ:AV0Z3013912 Keywords : palaeo-climatic indicator * sequoia tree * magnetic properties Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.842, year: 2007

  10. Annosus Root disease of Western Conifers (FIDL)

    Science.gov (United States)

    Craig L. Schmitt; John R. Parmeter; John T. Kliejunas

    2000-01-01

    Annosus root disease is found on all western conifer species but is of most concern on true firs, hemlocks, and pines. Incense cedar, coast redwood and sequoia are sometimes infected in California. Western juniper is infected throughout its range. Annosus is common and causes extensive decay in old-growth western and mountain hemlock stands. Many mixed conifer stands...

  11. Changing conditions on wilderness campsites: Seven case studies of trends over 13 to 32 years

    Science.gov (United States)

    David N. Cole

    2013-01-01

    This report brings together seven case studies of trends in the number and condition of wilderness campsites over periods ranging from 13 to 32 years. Case examples come from five mountainous wilderness areas in the western United States: Sequoia-Kings Canyon Wilderness in California, the Eagle Cap Wilderness in Oregon, the Frank Church-River of No Return Wilderness in...

  12. AcEST: DK962439 [AcEST

    Lifescience Database Archive (English)

    Full Text Available sequoia glyptostroboides PE=2 SV=1 Length = 319 Score = 261 bits (667), Expect = 3e...GLASRSAAYYQQGARFAK 183 Query: 637 WRTVV 651 WRTVV Sbjct: 184 WRTVV 188 >tr|Q8LK59|Q8LK59_METGY Fructose-bisphosphate aldolase OS=Meta

  13. Policy Evaluation: Use of the PSB-Aptitude Test as an Admission Requirement for the LVN Program.

    Science.gov (United States)

    Firstman, Aranga

    A study was conducted to assess the use of the Psychological Services Bureau's Aptitude Test for Practical Nursing (PSB Aptitude Test) as an entrance requirement for the licensed vocational nurse (LVN) program at College of the Sequoias. The study sought to determine whether the PSB Aptitude Test was a valid indicator of success in the LVN…

  14. Fostering personal relationships with the wild: Oral history's role in recreation management

    Science.gov (United States)

    Alison Steiner; Daniel R. Williams

    2017-01-01

    Sequoia and Kings Canyon National Parks (SEKI) encompass much of central California's most stunning scenery. Dramatic peaks and passes, perennial snowfields, remote lake basins, alpine meadows, steep canyons, and shockingly big trees characterize the more than 800,000 acres of wild land that lie within the parks. Drought-resistant chaparral and blue oak woodlands...

  15. The impact of normative message types on off-trail hiking

    Science.gov (United States)

    P.L. Winter

    2006-01-01

    Depreciative activities and high annual visitation levels threaten the health and sustainability of the giant Sequoia. Signage is one route to managing visitor behavior. Research suggests a two-by-two conceptualization of normative messages in signs. Messages may present the "ought" (injunctive) or the "is" (descriptive) of behavior and may be...

  16. High Sierra Ecosystems: The Role of Fish Stocking in Amphibian Declines

    Science.gov (United States)

    Kathleen Matthews

    2003-01-01

    With a rich diversity of aquatic habitats, including deep lakes, shallow ponds, and rushing streams, Dusy Basinin Sequoia-Kings Canyon National Parks typifies the high Sierra ecosystem where mountain yellow-legged frogs usually thrive. Yet throughout the Sierra, aquatic ecologist Kathleen Matthews found entire water basins empty of these amphibians. Comprehensive...

  17. Targeting Androgen Receptor in Breast Cancer: Enzalutamide as a Novel Breast Cancer Therapeutic

    Science.gov (United States)

    2016-09-01

    Publications, Abstracts, and Presentations: Papers: Dawn R. Cochrane, Sebastian Bernales, Britta M. Jacobsen, Diana M. Cittelly, Erin N. Howe, Nicholas C...Dawn R. Cochrane, Sebastian Bernales, Britta M. Jacobsen, Diana M. Cittelly, Erin N. Howe, Nicholas C. D’Amato, Nicole S. Spoelstra, Annie Jean

  18. Pop / Tristan Priimägi

    Index Scriptorium Estoniae

    Priimägi, Tristan, 1976-

    2007-01-01

    Heliplaatidest: Pink Floyd "The Piper At The Gates Of Dawn", Build An Ark "Dawn", Underworld "Oblivion with Bells", Mum "Go Go Smear the Poison Ivy", Himsa "Summon in Thunder", Öökülm "Välk selgest taevast", Queen "Queen Rock Montreal", Rosta Aknad "Rosta Aknad"

  19. Seasonal patterns in the nocturnal distributionand behavior of the mesopelagic fish Maurolicus muelleri at high latitudes

    KAUST Repository

    Prihartato, Perdana; Aksnes, Dag L.; Kaartvedt, Stein

    2015-01-01

    'midnight sinking', followed by a dawn ascent before a return to the daytime habitat. Light levels were ∼1 order of magnitude lower during the dawn ascent than for ascent in the afternoon, with the latter terminating before fish reached upper layers on ∼1

  20. THE PHOTOGRAPHIC AND ITS MEDIATORY SYSTEM: ARTISTIC, TECHNICAL AND COMMERCIAL VALUES AT THE DAWN OF PHOTOGRAPHY = LO FOTOGRÁFICO Y EL SISTEMA MEDIADOR. VALORES ARTÍSTICOS, TÉCNICOS Y COMERCIALES EN LOS INICIOS DE LA FOTOGRAFÍA

    Directory of Open Access Journals (Sweden)

    Núria Fernández Rius

    2014-02-01

    Full Text Available The analysis of the agents that took part in the invention, promotion and broadcasting of photography in the XIX century -photographers, politics, scientists, intellectuals and artists- permit us to reconstruct the photography’s space. These agents, their practices, spaces, institutions and relations constitute a mediation system, which participated actively in the construction of photographic value as a cultural product of modernity. However, the most relevant fact is that we can analyse it as a privileged subject to study for understanding the capacity of artistic practice to suit the needs of modern society. The permanent tension and dialogue among the aesthetic, scientific, technical and commercial appreciation, places photography in an unprecedented space between formal valorisation -next to the institutions and norms of the world of high culture- and the utilitarian logic -close to the patterns of progress and democratic access to the culture-. Thus, it is possible to suggest a theory of mediation for cultural products of modernity: intermediaries influence the construction of the value at the same time that they reveal the state of the cultural object and the needs of the society that consumes it.El análisis de los agentes que participaron en la invención, promoción y difusión de la fotografía en el siglo XIX - fotógrafos, políticos, científicos, intelectuales y artistas-  permite reconstruir el espacio de lo fotográfico. Estos agentes, sus prácticas, espacios, instituciones y relaciones constituyeron un sistema mediador que participó de manera activa en la construcción del valor de la fotografía como producto cultural de la modernidad. No obstante, lo más relevante es que se presenta a la investigación científica como un objeto de estudio privilegiado para comprender la capacidad que tuvo la práctica fotográfica para adaptarse a las necesidades de la sociedad moderna. La constante tensión y diálogo entre la apreciación estética, científico, técnica y comercial, sitúa a la fotografía en un espacio inédito entre la valoración formal -cercano a las instituciones y a las normas del mundo de la alta cultura- y la lógica utilitaria -cercana a los patrones de progreso y acceso democrático a la cultura-. De esta manera, es posible plantear una teoría de la mediación para los productos culturales de la modernidad: los intermediarios influyen en la construcción del valor a la vez que revelan el estado del objeto cultural y las necesidades de la sociedad que lo consume.