Cradle-to-gate life cycle impacts of redwood forest resource harvesting in northern California

Science.gov (United States)

Han-Sup Han; Elaine Oneil; Richard D. Bergman; Ivan L. Eastin; Leonard R. Johnson

2015-01-01

The first life cycle impact assessment for redwood (Sequoia sempervirens) forest management activities (i.e. a cradle-to-sawmill gate input) including the growing, harvesting, and hauling of redwood sawlogs to a sawmill was completed. In the stump-to-truck timber harvesting analysis, primary transport activities such as skidding and yarding consumed...

Biodegrading effects of some rot fungi on Pinus caribaea wood

African Journals Online (AJOL)

STORAGESEVER

2008-05-16

May 16, 2008 ... species of white-rot fungi; Corioliopsis polyzona and Pleurotus squarrosulus, and two species of brown- rot fungi; Lentinus ... The results indicated that biodegradation by rot fungi differs in intensity according to the fungus ..... wood of coast red wood Sequoia Sempervirens (D. Don). For. Prod. J. 33(5): 15-20 ...

Inbreeding depression in selfs of redwood

Science.gov (United States)

W. J. Libby; B. G. McCutchan; C. I. Millar

1981-01-01

Given the polyploid chromosome constitution of Sequoia sempervirens, there was reason to question whether it would exhibit inbreeding depression. Preliminary results from studies of self and related outcross families are reported as a guide to the selection of trees for redwood seed orchards and breeding-orchards. The data indicate that, compared to...

Bat use of remnant old-growth redwood stands

Science.gov (United States)

William J. Zielinski; Steven T. Gellman

1999-01-01

Most of the old-growth redwood (Sequoia sempervirens) in Calfornia has been cut; regenerating forests will probably never resemble those that were harvested, and what old growth remains on private land occurs in small, isolated remnant patches. The landscapes in which these stands occur differ so markedly from their original condition that their...

Aspen Characteristics - Sequoia National Forest [ds377

Data.gov (United States)

California Natural Resource Agency — The database represents point locations and associated stand assessment data collected within aspen stands in the Cannell Meadows Ranger District, Sequoia National...

Aspen Delineation - Sequoia National Forest [ds378

Data.gov (United States)

California Natural Resource Agency — The database represents delineations of aspen stands associated with stand assessment data (SEQUOIA_NF_PTS) collected in aspen stands in the Cannell Meadows Ranger...

Post-fire response of coast redwood one year after the Mendocino lightning complex fires

Science.gov (United States)

Robert B. Douglas; Tom. Bendurel

2012-01-01

Coast redwood (Sequoia sempervirens) forests have undergone significant changes over the past century and are now in state more conducive for wildfires. Because fires have been uncommon in redwood forests over the past 80 years, managers have limited data to make decisions about the post-fire environment. In June 2008, a series of lightning storms...

Life-cycle assessment of redwood decking in the United States with a comparison to three other decking materials

Science.gov (United States)

R. Bergman; H. Sup-Han; E. Oneil; I. Eastin

2013-01-01

The goal of the study was to conduct a life-cycle inventory (LCI) of California redwood (Sequoia sempervirens) decking that would quantify the critical environmental impacts of decking from cradle to grave. Using that LCI data, a life-cycle assessment (LCA) was produced for redwood decking. The results were used to compare the environmental footprint...

Black bear damage to northwestern conifers in California: a review

Science.gov (United States)

Kenneth O. Fulgham; Dennis Hosack

2017-01-01

A total of 789 black bear damaged trees were investigate over a multi-year period on 14 different study sites chosen on lands of four participating timber companies. The sites ranged from 30 to 50 years of age. Four different conifer species were found to have black bear damage: coastal redwood (Sequoia sempervirens (D. Don) Endl.), Douglas-fir (...

Coast redwood live crown and sapwood

Science.gov (United States)

John-Pascal Berrill; Jesse L. Deffress; Jessica M. Engle

2012-01-01

Understanding crown rise and sapwood taper will help meet management objectives such as producing long branch-free boles for clear wood and old-growth restoration, or producing sawlogs with a high proportion of heartwood. Coast redwood (Sequoia sempervirens) tree crown ratio data were collected 20 years after partial harvesting in a 65-year-old second growth stand....

Fungistatic Activity Of Essential Oils Extracted from Peumus boldus Mol., Laureliopsis philippiana (Looser Schodde and Laurelia sempervirens (Ruiz & Pav. Tul. (Chilean Monimiaceae Actividad Fungistática de Extractos de Aceites Asenciales de Peumus boldus Mol., Laureliopsis philippiana (Looser Schodde y Laurelia sempervirens (Ruiz & Pav. Tul. (Monimiaceae chilenas

Directory of Open Access Journals (Sweden)

Magalis Bittner

2009-03-01

Full Text Available Components of essential oils from the Chilean Monimiaceae, boldo (Peumus boldus Mol., tepa (Laureliopsis philippiana (Looser Schodde, and laurel (Laurelia sempervirens (Ruiz & Pav. Tul. were determined using Gas Chromatography- Mass Spectrometry (GCMS and fungistatic activity of the essential oils was tested against Rhizoctonia solani Kühn (Donk, Pythium irregulare Buisman, Ceratocystis pilifera (Fr. C. Moreau, Phragmidium violaceum (Schultz G. Winter, and Fusarium oxysporum Schltdl. The essential oils of the Monimiaceae species shared some common components; all three had the 3-carene, α-phellandrene, and α-pinene terpenes. L. philippiana and L. sempervirens also had safrole.The main components were ascaridol in P. boldus oil, 3-carene in L. philippiana, and safrole in L. sempervirens. The essential oil from L. sempervirens showed the highest fungistatic activity with significant differences in dose as well as exposure. P. violaceum was the most sensitive strain and P. irregulare the most resistant of all the essential oils (P. boldus extract affected growth by only 19%. Therefore, essential oils from these three plants could be used to control the fungal strains studied.Se determinaron los compuestos de aceites esenciales de Monimiaceae chilenas, boldo (Peumus boldus Mol., tepa (Laureliopsis philippiana (Looser Schodde, y laurel (Laurelia sempervirens (Ruiz & Pav. Tul. a través de cromatografía de gas con espectrometría de masas (CG-EM y se midió la actividad fungistática de los aceites sobre los hongos Rhizoctonia solani Kühn (Donk, Pythium irregulare Buisman, Ceratocystis pilifera (Fr. C. Moreau, Phragmidium violaceum (Schultz Winter y Fusarium oxysporum Schltdl. Los aceites esenciales de las especies de Monimiaceae tienen algunos compuestos en común; en las especies estudiadas se encontró que todos tenían los terpenos 3-careno, α-felandreno, y α-pineno. L. philippiana y L. sempervirens además tienen safrol. En cambio

Visual Impacts of Prescribed Burning on Mixed Conifer and Giant Sequoia Forests

Science.gov (United States)

Lin Cotton; Joe R. McBride

1987-01-01

Prescribed burning programs have evolved with little concern for the visual impact of burning and the potential prescribed burning can have in managing the forest scene. Recent criticisms by the public of the prescribed burning program at Sequoia National Park resulted in an outside review of the National Park fire management programs in Sequoia, Kings Canyon, and...

Biological and Management Implications of Fire-Pathogen Interactions in the Giant Sequoia Ecosystem

Science.gov (United States)

Douglas D. Piirto; John R. Parmeter; Fields W. Cobb; Kevin L. Piper; Amy C. Workinger; William J. Otrosina

1998-01-01

An overriding management goal for national parks is the maintenance or, where necessary, the restoration of natural ecological processes. In Sequoia-Kings Canyon and Yosemite National Parks, there is concern about the effects of fire suppression on the giant sequoia-mixed conifer forest ecosystem. The National Park Service is currently using prescribed fire management...

Air pollution effects on giant sequoia ecosystems.

Science.gov (United States)

P.R. Miller; Nancy Grulke; K.W. Stolte

1994-01-01

Giant sequoia [Sequoiadendron giganteum (Lindl.) Buchholz] groves are found entirely within the Sierra Nevada mixed-conifer type. Several of its companion tree species, mainly ponderosa pine (Pinus ponderosa Dougl. ex Laws.) and Jeffrey pine (P. jeffreyi Grev. & Balf.), show foliar injury after...

78 FR 66380 - Final Environmental Impact Statement for the Restoration of the Mariposa Grove of Giant Sequoias...

Science.gov (United States)

2013-11-05

... sequoia habitat, wetlands, and soundscapes within the Mariposa Grove, this alternative would relocate... for restoration of wetlands, soundscapes, and giant sequoia habitat within the Mariposa Grove by...

Estimating Leaf Water Potential of Giant Sequoia Trees from Airborne Hyperspectral Imagery

Science.gov (United States)

Francis, E. J.; Asner, G. P.

2015-12-01

Recent drought-induced forest dieback events have motivated research on the mechanisms of tree survival and mortality during drought. Leaf water potential, a measure of the force exerted by the evaporation of water from the leaf surface, is an indicator of plant water stress and can help predict tree mortality in response to drought. Scientists have traditionally measured water potentials on a tree-by-tree basis, but have not been able to produce maps of tree water potential at the scale of a whole forest, leaving forest managers unaware of forest drought stress patterns and their ecosystem-level consequences. Imaging spectroscopy, a technique for remote measurement of chemical properties, has been used to successfully estimate leaf water potentials in wheat and maize crops and pinyon-pine and juniper trees, but these estimates have never been scaled to the canopy level. We used hyperspectral reflectance data collected by the Carnegie Airborne Observatory (CAO) to map leaf water potentials of giant sequoia trees (Sequoiadendron giganteum) in an 800-hectare grove in Sequoia National Park. During the current severe drought in California, we measured predawn and midday leaf water potentials of 48 giant sequoia trees, using the pressure bomb method on treetop foliage samples collected with tree-climbing techniques. The CAO collected hyperspectral reflectance data at 1-meter resolution from the same grove within 1-2 weeks of the tree-level measurements. A partial least squares regression was used to correlate reflectance data extracted from the 48 focal trees with their water potentials, producing a model that predicts water potential of giant sequoia trees. Results show that giant sequoia trees can be mapped in the imagery with a classification accuracy of 0.94, and we predicted the water potential of the mapped trees to assess 1) similarities and differences between a leaf water potential map and a canopy water content map produced from airborne hyperspectral data, 2

Coping with gravity: the foliar water relations of giant sequoia.

Science.gov (United States)

Williams, Cameron B; Reese Næsborg, Rikke; Dawson, Todd E

2017-10-01

In tall trees, the mechanisms by which foliage maintains sufficient turgor pressure and water content against height-related constraints remain poorly understood. Pressure-volume curves generated from leafy shoots collected crown-wide from 12 large Sequoiadendron giganteum (Lindley) J. Buchholz (giant sequoia) trees provided mechanistic insights into how the components of water potential vary with height in tree and over time. The turgor loss point (TLP) decreased with height at a rate indistinguishable from the gravitational potential gradient and was controlled by changes in tissue osmotica. For all measured shoots, total relative water content at the TLP remained above 75%. This high value has been suggested to help leaves avoid precipitous declines in leaf-level physiological function, and in giant sequoia was controlled by both tissue elasticity and the balance of water between apoplasm and symplasm. Hydraulic capacitance decreased only slightly with height, but importantly this parameter was nearly double in value to that reported for other tree species. Total water storage capacity also decreased with height, but this trend essentially disappeared when considering only water available within the typical range of water potentials experienced by giant sequoia. From summer to fall measurement periods we did not observe osmotic adjustment that would depress the TLP. Instead we observed a proportional shift of water into less mobile apoplastic compartments leading to a reduction in hydraulic capacitance. This collection of foliar traits allows giant sequoia to routinely, but safely, operate close to its TLP, and suggests that gravity plays a major role in the water relations of Earth's largest tree species. © The Author 2017. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Patterns and correlates of giant sequoia foliage dieback during California’s 2012–2016 hotter drought

Science.gov (United States)

Stephenson, Nathan L.; Das, Adrian J.; Ampersee, Nicholas J.; Cahill, Kathleen G.; Caprio, Anthony C.; Sanders, John E.; Williams, A. Park

2018-01-01

Hotter droughts – droughts in which unusually high temperatures exacerbate the effects of low precipitation – are expected to increase in frequency and severity in coming decades, challenging scientists and managers to identify which parts of forested landscapes may be most vulnerable. In 2014, in the middle of California’s historically unprecedented 2012–2016 hotter drought, we noticed apparently drought-induced foliage dieback in giant sequoias (Sequoiadendron giganteum Lindl. [Buchholz]) in Sequoia and Kings Canyon national parks, California. Characteristics of the dieback were consistent with a controlled process of drought-induced senescence: younger (distal) shoots remained green while older (proximal) shoots were preferentially shed. As part of an ongoing interdisciplinary effort to understand and map sequoia vulnerability to hotter droughts, we reviewed historical records for evidence of previous foliage dieback events, surveyed dieback along trail corridors in eight sequoia groves, and analyzed tree-ring data from a high- and a low-foliage-dieback area. In sharp contrast to the greatly elevated mortality of other coniferous species found at low and middle elevations, we estimate that <1% of sequoias died during the drought. Foliage dieback was notably elevated in 2014 – the most severe single drought year in our 122-year record – but much lower in subsequent years. We found no historical records of similar foliage dieback during previous droughts. Dieback in 2014 was highly variable both within and among groves, ranging from virtually no dieback in some areas to nearly 50% in others. Dieback was highest (1) at low elevations, probably due to higher temperatures, reduced snowpack, and earlier snowmelt; (2) in areas of low adult sequoia densities, which likely reflect intrinsically more stressful sites; and (3) on steep slopes, probably reflecting reduced water availability. Average sequoia ring widths were narrower at the high-dieback than the

78 FR 16294 - Draft Environmental Impact Statement for Restoration of the Mariposa Grove of Giant Sequoias...

Science.gov (United States)

2013-03-14

... Environmental Impact Statement for Restoration of the Mariposa Grove of Giant Sequoias, Yosemite National Park, Madera, and Mariposa Counties, CA AGENCY: National Park Service, Interior. ACTION: Notice of availability... the Mariposa Grove of giant sequoias in Yosemite National Park. This Draft EIS presents three...

On the occurrence of nuclei in mature sieve elements.

Science.gov (United States)

Event, R F; Davis, J D; Tucker, C M; Alfieri, F J

1970-12-01

The secondary phloem of 3 species of the Taxodiaceae and 13 species of woody dicotyledons was examined for the occurrence of nuclei in mature sieve elements. Nuclei were found in all mature sieve cells of Metasequoia glyptostroboides, Sequoia sempervirens and Taxodium distichum, and in some mature sieve-tube members in 12 of the 13 species of woody dicotyledons. Except for nuclei of sieve cells undergoing cessation of function, the nuclei in mature sieve cells of M. glyptostroboides, S. sempervirens and T. distichum were normal in appearance. The occurrence and morphology of nuclei in mature sieve-tube members of the woody dicotyledons were quite variable. Only 3 species, Robinia pseudoacacia, Ulmus americana and Vitis riparia, contained some mature sieve elements with apparently normal nuclei.

Leaf to landscape responses of giant sequoia to hotter drought: An introduction and synthesis for the special section

Science.gov (United States)

Nydick, Koren R.; Stephenson, Nathan L.; Ambrose, Anthony R.; Asner, Gregory P.; Baxter, Wendy L.; Das, Adrian J.; Dawson, Todd E.; Martin, Roberta E.; Paz-Kagan, Tarin

2018-01-01

Hotter droughts are becoming more common as climate change progresses, and they may already have caused instances of forest dieback on all forested continents. Learning from hotter droughts, including where on the landscape forests are more or less vulnerable to these events, is critical to help resource managers proactively prepare for the future. As part of our Leaf to Landscape Project, we measured the response of giant sequoia, the world’s largest tree species, to the extreme 2012–2016 hotter drought in California. The project integrated leaf-level physiology measurements, crown-level foliage dieback surveys, and remotely sensed canopy water content (CWC) to shed light on mechanisms and spatial patterns in drought response. Here we summarize initial findings, present a conceptual model of drought response, and discuss management implications; details are presented in the other four articles of the special section on Giant Sequoias and Drought. Giant sequoias exhibited both leaf- and canopy-level responses that were effective in protecting whole-tree hydraulic integrity for the vast majority of individual sequoias. Very few giant sequoias died during the drought compared to other mixed conifer tree species; however, the magnitude of sequoia drought response varied across the landscape. This variability was partially explained by local site characteristics, including variables related to site water balance. We found that low CWC is an indicator of recent foliage dieback, which occurs when stress levels are high enough that leaf-level adjustments alone are insufficient for giant sequoias to maintain hydraulic integrity. CWC or change in CWC may be useful indicators of drought stress that reveal patterns of vulnerability to future hotter droughts. Future work will measure recovery from the drought and strengthen our ability to interpret CWC maps. Our ultimate goal is to produce giant sequoia vulnerability maps to help target management actions, such as

Management of Giant Sequoia on Mountain Home Demonstration State Forest

Science.gov (United States)

Norman J. Benson

1986-01-01

Established in 1946, the Mountain Home Demonstration State Forest, Tulare County, California, is managed by the California Department of Forestry. It is a multiple-use forest with recreation as its primary focus, although timber management has always played an important role. Giant sequoia (Sequoiadendron giganteum [Lindl. ] Buchholz) occurs in...

Communicating the role of science in managing giant sequoia groves

Science.gov (United States)

Douglas D. Pilrto; Robert R. Rogers; Mary Chislock Bethke

1997-01-01

Management of giant sequoia groves has been and continues to be a hotly debated issue. The debate has reached Congress, with all parties seeking resolution as to what constitutes an ecologically and publicly acceptable management approach. Determining the correct management approach and communicating that approach to the general public is the crux of the problem....

Sapwood area - leaf area relationships for coast redwood

OpenAIRE

Stancioiu, P T; O'Hara, K L

2005-01-01

Coast redwood (Sequoia sempervirens (D. Don) Endl.) trees in different canopy strata and crown positions were sampled to develop relationships between sapwood cross-sectional area and projected leaf area. Sampling occurred during the summers of 2000 and 2001 and covered tree heights ranging from 7.7 to 45.2 m and diameters at breast height ranging from 9.4 to 92.7 cm. Foliage morphology varied greatly and was stratified into five types based on needle type (sun or shade) and twig color. A str...

High-resolution 3D simulations of NIF ignition targets performed on Sequoia with HYDRA

Science.gov (United States)

Marinak, M. M.; Clark, D. S.; Jones, O. S.; Kerbel, G. D.; Sepke, S.; Patel, M. V.; Koning, J. M.; Schroeder, C. R.

2015-11-01

Developments in the multiphysics ICF code HYDRA enable it to perform large-scale simulations on the Sequoia machine at LLNL. With an aggregate computing power of 20 Petaflops, Sequoia offers an unprecedented capability to resolve the physical processes in NIF ignition targets for a more complete, consistent treatment of the sources of asymmetry. We describe modifications to HYDRA that enable it to scale to over one million processes on Sequoia. These include new options for replicating parts of the mesh over a subset of the processes, to avoid strong scaling limits. We consider results from a 3D full ignition capsule-only simulation performed using over one billion zones run on 262,000 processors which resolves surface perturbations through modes l = 200. We also report progress towards a high-resolution 3D integrated hohlraum simulation performed using 262,000 processors which resolves surface perturbations on the ignition capsule through modes l = 70. These aim for the most complete calculations yet of the interactions and overall impact of the various sources of asymmetry for NIF ignition targets. This work was performed under the auspices of the Lawrence Livermore National Security, LLC, (LLNS) under Contract No. DE-AC52-07NA27344.

A comparative study of modern and fossil cone scales and seeds of conifers: A geochemical approach

Science.gov (United States)

Artur, Stankiewicz B.; Mastalerz, Maria; Kruge, M.A.; Van Bergen, P. F.; Sadowska, A.

1997-01-01

Modern cone scales and seeds of Pinus strobus and Sequoia sempervirens, and their fossil (Upper Miocene, c. 6 Mar) counterparts Pinus leitzii and Sequoia langsdorfi have been studied using pyrolysis-gas chromatography/mass spectrometry (Py-GC/MS), electron-microprobe and scanning electron microscopy. Microscopic observations revealed only minor microbial activity and high-quality structural preservation of the fossil material. The pyrolysates of both modern genera showed the presence of ligno-cellulose characteristic of conifers. However, the abundance of (alkylated)phenols and 1,2-benzenediols in modern S. sempervirens suggests the presence of non-hydrolysable tannins or abundant polyphenolic moieties not previously reported in modern conifers. The marked differences between the pyrolysis products of both modern genera are suggested to be of chemosystematic significance. The fossil samples also contained ligno-cellulose which exhibited only partial degradation, primarily of the carbohydrate constituents. Comparison between the fossil cone scale and seed pyrolysates indicated that the ligno-cellulose complex present in the seeds is chemically more resistant than that in the cone scales. Principal component analysis (PCA) of the pyrolysis data allowed for the determination of the discriminant functions used to assess the extent of degradation and the chemosystematic differences between both genera and between cone scales and seeds. Elemental composition (C, O, S), obtained using electron-microprobe, corroborated the pyrolysis results. Overall, the combination of chemical, microscopic and statistical methods allowed for a detailed characterization and chemosystematic interpretations of modern and fossil conifer cone scales and seeds.

Cosmic Dawn with WFIRST

Science.gov (United States)

Rhoads, James

Central objectives: WFIRST-AFTA has tremendous potential for studying the epoch of "Cosmic Dawn" the period encompassing the formation of the first galaxies and quasars, and their impact on the surrounding universe through cosmological reionization. Our goal is to ensure that this potential is realized through the middle stages of mission planning, culminating in designs for both WFIRST and its core surveys that meet the core objectives in dark energy and exoplanet science, while maximizing the complementary Cosmic Dawn science. Methods: We will consider a combined approach to studying Cosmic Dawn using a judicious mixture of guest investigator data analysis of the primary WFIRST surveys, and a specifically designed Guest Observer program to complement those surveys. The Guest Observer program will serve primarily to obtain deep field observations, with particular attention to the capabilities of WFIRST for spectroscopic deep fields using the WFI grism. We will bring to bear our years of experience with slitless spectroscopy on the Hubble Space Telescope, along with an expectation of JWST slitless grism spectroscopy. We will use this experience to examine the implications of WFIRST’s grism resolution and wavelength coverage for deep field observations, and if appropriate, to suggest potential modifications of these parameters to optimize the science return on WFIRST. We have assembled a team of experts specializing in (1) Lyman Break Galaxies at redshifts higher than 7 (2) Quasars at high redshifts (3) Lyman-alpha galaxies as probes of reionization (4) Theoretical simulations of high-redshift galaxies (5) Simulations of grism observations (6) post-processing analysis to find emission line galaxies and high redshift galaxies (7) JWST observations and calibrations. With this team we intend to do end-to-end simulations starting with halo populations and expected spectra of high redshift galaxies and finally extracting what we can learn about (a) reionization

Dawn: Testing Paradigms by Exploring Dichotomies

Science.gov (United States)

Russell, C. T.; Schmidt, B. E.; Wise, J.; Ristvey, J.; Raymond, C. A.

2010-12-01

NASA’s Dawn mission represents a series of “firsts” for major NASA missions. Dawn is the first major NASA science mission to use ion propulsion engines, allowing Dawn to be the first mission to orbit one target and then leave its gravity well to explore a second destination. Dawn is the first science mission to the main asteroid belt, reaching protoplanet Vesta in summer 2011, and will be the first mission to reach a “dwarf planet” when it arrives at Ceres in 2015. By targeting both Vesta and Ceres, Dawn explores two intriguing dichotomies in the solar system, that of the dry rocky planets and the wet icy bodies (Fire and Ice) and the dichotomy between planets and asteroids. Is there a clear dividing line here? Vesta, the second most massive asteroid, is a protoplanet: a round, mostly intact asteroid that bears more resemblance to a planet than to smaller asteroids. Vesta is also the likely parent body of the HED meteorites that richly populate Earth’s meteorite collections. It is possible to hold a piece of Vesta in your hands. From the HED meteorites, scientists have learned the Vesta is one of few differentiated asteroids. And from its spectrum, rich in basaltic minerals, it is known to be much like a mini-version of Earth’s Moon and Mercury. Vesta’s surface once was home to floods of lava not unlike those found still today on the Earth. Vesta is very similar to a terrestrial planet. Ceres is the giant of the asteroid belt with a hydrostatic shape that earns it a dwarf planet classification. Like its larger cousins, Ceres’ round shape suggests that the body may be differentiated, but due to its low density, Ceres’ interior is more like an icy moon of Jupiter. Beneath a relatively thin clay veneer probably lies an ice-rich mantle and rocky core, and even possibly a liquid ocean. With such enticing questions posed for Vesta and Ceres, Dawn will enable scientists and the public alike to explore how planets were born, how fire and ice have shaped

GRIP DOPPLER AEROSOL WIND LIDAR (DAWN) V1

Data.gov (United States)

National Aeronautics and Space Administration — The GRIP Doppler Aerosol WiNd Lidar (DAWN) Dataset was collected by the Doppler Aerosol WiNd (DAWN), a pulsed lidar, which operated aboard a NASA DC-8 aircraft...

Multiyear impacts of partial throughfall exclusion on Buxus sempervirens in a Mediterranean forest

Energy Technology Data Exchange (ETDEWEB)

Rodriguez-Calcerrada, J.; Letts, M. G.; Rolo, V.; Roset, S.; Rambal, S.

2013-09-01

Aim of study:We examined the impact of sustained partial throughfall exclusion on the functional performance of Buxus sempervirens L. in the understory of a Mediterranean evergreen forest. We further considered whether any impacts of throughfall exclusion were affected by light availability. Area of study: The study was conducted in the south of France. Material and methods: Several leaf physiological and branch structural traits were measured along a light gradient after seven years from the onset of a throughfall exclusion experiment (TEE). The results were analysed along with annual growth and survival data. Main results: Plant mortality was nil in both the throughfall exclusion and control treatments. Stem diameter growth was reduced by 39% in plants subjected to throughfall exclusion, but this difference was only significant at the p = 0.10 significance level. Leaf physiology remained unaffected by the TEE, but small changes were evident in branch structural traits in high light microsites following throughfall exclusion; branches had lower wood density in the TEE plot, and more biomass was partitioned to leaves relative to stems. Research highlights: These changes do not seem to reflect an acclimatory response that would enhance drought tolerance. Instead, we suggest that these drought effects might exacerbate vulnerability to xylem cavitation in the more open microsites. Reduced growth and increased vulnerability to drought may indicate an incipient decline in plant vitality following TEE. The extension of observations to the whole-plant level and longer periods will elucidate the consequences of these observations for plant fitness, and permit verification of the positive effect of shade on Buxus sempervirens under increased drought. (Author)

The Dawn Topography Investigation

Science.gov (United States)

Raymond, C. A.; Jaumann, R.; Nathues, A.; Sierks, H.; Roatsch, T.; Preusker, E; Scholten, F.; Gaskell, R. W.; Jorda, L.; Keller, H.-U.;

Dawn of Science

Indian Academy of Sciences (India)

Dawn of Science - The Healing Art. T Padmanabhan. Series Article Volume 15 Issue 10 October 2010 pp 870-874. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/015/10/0870-0874. Keywords. Surgery; Charaka Samhita; Hippocrates; acupuncture; Galen. Author Affiliations.

Dawn of Science

Indian Academy of Sciences (India)

identification has made several historians doubt whether Imhotep really existed; probably he is no more real than Viswakarma of. Indian epics. But the man who designed the pyramids does deserve a mention while describing the dawn of science. Moving lightly over a thousand years, we come across the next milestone ...

Dignity and Dawn: Libya’s Escalating Civil War

Directory of Open Access Journals (Sweden)

Daveed Gartenstein-Ross

2015-02-01

Full Text Available In this Research Paper, ICCT Associate Fellow Dr. Daveed Gartenstein-Ross and Nathaniel Barr provides a detailed examination of the armed conflict in Libya between the Operation Dignity and Libya Dawn military coalitions. The conflict erupted in May 2014, when Dignity leader Khalifa Hifter announced the launch of his campaign, which was aimed at ridding eastern Libya of Islamist militias, beginning with Benghazi. This offensive shattered a fragile status quo. Revolutionary forces concentrated in the city of Misrata and Islamist politicians perceived Hifter’s offensive as a direct affront and, following parliamentary elections that these factions lost, the Misrata-Islamist bloc announced the launch of the Libya Dawn offensive, aimed at driving pro-Dignity forces out of Tripoli. More broadly, the Dawn offensive was an effort to change facts on the ground in order to ensure that the Misrata-Islamist bloc retained political influence. The Dignity and Dawn offensives have contributed to the continuing political and geographic fragmentation of Libya. Libya now has two separate parliaments and governments, while much of the country has been carved into spheres of influence by warring factions. The Dignity-Dawn conflict has also caused a deterioration of security, which has played into the hands of a variety of violent non-state actors, including al-Qaeda and Islamic State affiliates that have capitalized on Libya’s security vacuum to establish bases of operation. This report provides a blow-by-blow account of the military conflict between Dignity and Dawn forces, then assesses the implications of the Libyan civil war on regional security and potential policy options for Western states.

Dawn at Vesta: testing the protoplanetary paradigm

Science.gov (United States)

Russell, C.T.; Raymond, C.A.; Coradini, A.; McSween, H.Y.; Zuber, M.T.; Nathues, A.; DeSanctis, Maria-Cristina; Jaumann, R.; Konopliv, A.S.; Preusker, F.; Asmar, S.W.; Park, R.S.; Gaskell, R.; Keller, H.U.; Mottola, S.; Roatsch, T.; Scully, J.E.C.; Smith, D.E.; Tricarico, P.; Toplis, M.J.; Christensen, U.R.; Feldman, W.C.; Lawrence, D.J.; McCoy, T.J.; Prettyman, T.H.; Reedy, R.C.; Sykes, M.E.; Titus, T.N.

2012-01-01

The Dawn spacecraft targeted 4 Vesta, believed to be a remnant intact protoplanet from the earliest epoch of solar system formation, based on analyses of howardite-eucrite-diogenite (HED) meteorites that indicate a differentiated parent body. Dawn observations reveal a giant basin at Vesta's south pole, whose excavation was sufficient to produce Vesta-family asteroids (Vestoids) and HED meteorites. The spatially resolved mineralogy of the surface reflects the composition of the HED meteorites, confirming the formation of Vesta's crust by melting of a chondritic parent body. Vesta's mass, volume, and gravitational field are consistent with a core having an average radius of 107 to 113 kilometers, indicating sufficient internal melting to segregate iron. Dawn's results confirm predictions that Vesta differentiated and support its identification as the parent body of the HEDs.

Dawn of Science

Indian Academy of Sciences (India)

Home; Journals; Resonance – Journal of Science Education; Volume 16; Issue 7. Dawn of Science-The Galilean World. T Padmanabhan. Series Article Volume 16 Issue 7 July 2011 pp 663-669. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/016/07/0663-0669. Keywords.

Dawn of Science

Indian Academy of Sciences (India)

Home; Journals; Resonance – Journal of Science Education; Volume 17; Issue 4. Dawn of Science - All was Light - 11. T Padmanabhan. Series Article Volume 17 Issue 4 April 2012 pp 324-329. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/017/04/0324-0329. Keywords.

The Enabling Use of Ion Propulsion on Dawn

Science.gov (United States)

Rayman, M.; Russell, C. T.; Raymond, C. A.; Mase, R. M.

2011-12-01

Dawn's mission to orbit both Vesta and Ceres is enabled by its use of ion propulsion. Even orbiting Vesta alone with conventional propulsion would have been unaffordable within the constraints of the Discovery Program, and orbiting both would have been impossible. In fact, no other spacecraft has been targeted to orbit two solar system destinations, which is only one of the many firsts that Dawn will achieve. The successful testing of ion propulsion on Deep Space 1 paved the way for Dawn not only to use the hardware with confidence but also to learn how to design the flight system and design the mission to take advantage of its capabilities. In addition to allowing Dawn to reach these two important targets, ion propulsion allows the spacecraft to accomplish significant changes in its orbit. Therefore, science observations of Vesta are planned from four different orbits, at varying altitudes and solar geometry. The use of ion propulsion results in a significant mission design effort since the trajectory is constantly being refined. This also creates a flexible mission architecture, which allows for optimization of the mission as conditions change. Solar electric ion propulsion is especially well suited to missions to the Main Asteroid Belt since solar energy is still a viable power source, whereas the size of the solar array needed beyond 3.5 AU is a potential limitation. Dawn has already surpassed the record for greatest propulsive velocity, but its greatest achievements will no doubt be the incredible bounty of science data enabled by this innovative flight system.

Meet EPA researcher Dawn King

Science.gov (United States)

Research microbiologist Dawn King works in EPA’s National Exposure Research Laboratory where she identifies and assesses the health risk of microbial pathogens in water. This is her researchers at work profile.

Effect of simulated dawn on quality of sleep – a community-based trial

Directory of Open Access Journals (Sweden)

Haukka Jari

2003-10-01

Full Text Available Abstract Background Morning light exposure administered as simulated dawn looks a promising method to treat Seasonal Affective Disorder, but it may moreover help with resetting the inaccurate organisation of body clock functions relative to sleep occurring in winter among people in general. Disturbances in sleep patterns are common and may compromise wellbeing even in the short term. Our hypothesis was that simulated dawn could improve the subjective quality of sleep during winter. Methods A community-based trial with 100 volunteer subjects provided with dawn simulators. Study period lasted for eight weeks, and subjects used the dawn simulators for two weeks at a time, each subject acting as his own control (ABAB-design. Main outcome measure was subjective quality of sleep recorded each morning with Groningen Sleep Quality Scale. Results 77 subjects completed the trial. Quality of sleep improved while subjects were using dawn simulator-devices (p = 0.001. The treatment became beneficial after six days' use of dawn simulator, but the effect did not last after the use was ceased. Conclusion Dawn simulation may help to improve the subjective quality of sleep, but the benefits are modest. Further research is needed to verify these findings and to elucidate the mechanism by which dawn simulation acts on the sleep-wake pattern.

Changes in gas exchange characteristics during the life span of giant sequoia: Implications for response to current and future concentrations of atmospheric ozone

Energy Technology Data Exchange (ETDEWEB)

Grulke, N.E.; Miller, P.R. (USDA Forest Service, Riverside, CA (United States))

Native stands of giant sequoia are being exposed to relatively high concentrations of atmospheric ozone produced in urban and agricultural areas upwind. The expected change in environmental conditions over the next 100 y is likely to be unprecendented in the life span (ca 2,500 y) of giant sequoia. Changes in the physiological responses of three age classes of giant sequoia (current year, 12 y and 25 y) to different concentrations of ozone were determined, and age-related differences in sensitivity to pollutants were assessed by examining physiological changes (gas exchange, water use efficiency) across the life span of giant sequoia. The CO[sub 2] exchange rate (CER) was greater in current year (12.1 [mu]mol CO[sub 2]/m[sup 2]s) and 2 year old seedlings (4.8 [mu]mol CO[sub 2]/m[sup 2]s) than in all older trees (average of 3.0 [mu]mol CO[sub 2]/m[sup 2]s). Dark respiration was highest for current year seedlings and was increased twofold in symptotic individuals exposed to elevated ozone concentrations. Stomatal conductance was greater in current-year and 2 year old seedlings (335 and 200 mmol H[sub 2]O/m[sup 2]s), respectively, than in all older trees (50 mmol H[sub 2]O/m[sup 2]s), indicating that the ozone concentration in substomatol cavities is higher in young seedlings than in older trees. Significant changes in water use efficiency occurred in trees between ages 5 and 20 years. It is concluded that giant sequoia seedlings are sensitive to atmospheric ozone until they are ca 5 y old. Low conductance, high water use efficiency, and compact mesophyll all contribute to a natural ozone tolerance, or defense, or both, in foliage of older trees. 11 refs., 1 fig., 1 tab.

Dawn Mission Education and Public Outreach: Science as Human Endeavor

Science.gov (United States)

Cobb, W. H.; Wise, J.; Schmidt, B. E.; Ristvey, J.

2012-12-01

Dawn Education and Public Outreach strives to reach diverse learners using multi-disciplinary approaches. In-depth professional development workshops in collaboration with NASA's Discovery Program, MESSENGER and Stardust-NExT missions focusing on STEM initiatives that integrate the arts have met the needs of diverse audiences and received excellent evaluations. Another collaboration on NASA ROSES grant, Small Bodies, Big Concepts, has helped bridge the learning sequence between the upper elementary and middle school, and the middle and high school Dawn curriculum modules. Leveraging the Small Bodies, Big Concepts model, educators experience diverse and developmentally appropriate NASA activities that tell the Dawn story, with teachers' pedagogical skills enriched by strategies drawn from NSTA's Designing Effective Science Instruction. Dawn mission members enrich workshops by offering science presentations to highlight events and emerging data. Teachers' awareness of the process of learning new content is heightened, and they use that experience to deepen their science teaching practice. Activities are sequenced to enhance conceptual understanding of big ideas in space science and Vesta and Ceres and the Dawn Mission 's place within that body of knowledge Other media add depth to Dawn's resources for reaching students. Instrument and ion engine interactives developed with the respective science team leads help audiences engage with the mission payload and the data each instrument collects. The Dawn Dictionary, an offering in both audio as well as written formats, makes key vocabulary accessible to a broader range of students and the interested public. Further, as Dawn E/PO has invited the public to learn about mission objectives as the mission explored asteroid Vesta, new inroads into public presentations such as the Dawn MissionCast tell the story of this extraordinary mission. Asteroid Mapper is the latest, exciting citizen science endeavor designed to invite the

[Correlation study between obesity and dawn phenomenon in patients with type 2 diabetes].

Science.gov (United States)

Guo, Zhenhong; Xu, Jie; Wang, Jingyu; Han, Fei; Zhang, Yi; Yang, X iaoyun; Yang, Shaohua; Chang, Bai; Yang, Juhong; Shan, Chunyan; Chen, Liming; Chang, Baocheng; Xu, Yanguang

2016-01-01

To investigate the correlation between the frequency of dawn phenomenon and obesity in patients with type 2 diabetes. This study was conducted in 98 patients with type 2 diabetes admitted to the Metabolic Disease Hospital of Tianjin Medical University from 2011 to 2014. The subjects were divided into 3 groups according to BMI: the normal weight (BMI 18.5-23.9 kg/m(2), n = 30), the overweight(BMI 24-27.9 kg/m(2), n = 33)and the obesity (BMI ≥ 28.0 kg/m(2), n = 35). All participants underwent continuous glucose monitoring for 72 h. Fasting plasma glucose(FPG), insulin and C-peptide were tested. Frequency of dawn phenomenon among the 3 groups was calculated, and the correlations between dawn phenomenon and its related factors were analyzed. The frequency of dawn phenomenon in type 2 diabetes increased with the increase of BMI in the 3 groups (P obesity groups, respectively. The dawn phenomenon was positively correlated with BMI (r = 0.424, P fasting C-peptide (r = 0.254, P 0.05). The dawn phenomenon is closely associated with obesity and insulin resistance. The frequency of dawn phenomenon increases with BMI.

Skin tests of pollen grains of taxodiaceae and cupressaceae in children with bronchial asthma.

Science.gov (United States)

Midoro-Horiuti, T; Nouno, S; Seino, Y

1992-10-01

Atmospheric cedar pollen in the southern region of Okayama Prefecture (situated in south-western Japan) has been counted since 1988. Pollen of different species of the Taxodiaceae family (Cryptomeria japonica, Sequoia sempervirens and Metasequoia glyptostroboides) and Japanese juniper (Juniperus rigida) in the Cupressaceae family, which are propagated mainly in the southern region of Okayama Prefecture, were found among the atmospheric pollen. Scratch tests using the pollen extract from Taxodiaceae and Cupressaceae were performed on children with bronchial asthma. Forty (25%) and 30 (18.8%) of the 160 patients reacted positively to an allergen extract from the pollen grains of Japanese cedar (Cryptomeria japonica) and Japanese juniper, respectively.

Using Dawn to Observe SEP Events Past 2 AU

Science.gov (United States)

Villarreal, M. N.; Russell, C. T.; Prettyman, T. H.

2017-12-01

The launch of the STEREO spacecraft provided much insight into the longitudinal and radial distribution of solar energetic particles (SEPs) relative to their origin site. However, almost all of the observations of SEP events have been made exclusively near 1 AU. The Dawn mission, which orbited around Vesta before arriving at Ceres, provides an opportunity to analyze these events at much further distances. Although Dawn's Gamma Ray and Neutron Detector (GRaND) is not optimized for SEP characterization, it is sensitive to protons greater than 4 MeV, making it capable of detecting a solar energetic particle event in its vicinity. Solar energetic particles in this area of the solar system are important as they are believed to cause sputtering at bodies such as Ceres and comets (Villarreal et al., 2017; Wurz et al., 2015). In this study, we use Dawn's GRaND data from 2011-2015 when Dawn was at distances between 2-3 AU. We compare the SEP events seen by Dawn with particle measurements at 1 AU using STEREO, Wind, and ACE to understand how the SEP events evolved past 1 AU.References: Villarreal, M. N., et al. (2017), The dependence of the Cerean exosphere on solar energetic particle events, Astrophys. J. Lett., 838, L8.Wurz, P. et al. (2015), Solar wind sputtering of dust on the surface of 67P/Churyumov-Gerasimenko, A&A, 583, A22.

Dawn Mission Update

Science.gov (United States)

Sykes, M. V.; Russell, C. T.; Coradini, A.; Christensen, U.; de Sanctis, M. C.; Feldman, W. C.; Jaumann, R.; Keller, U.; Konopliv, A. S.; McCord, T. B.; McFadden, L. A.; McSween, H. Y.; Mottola, S.; Neukum, G.; Pieters, C. M.; Prettyman, T. H.; Raymond, C. A.; Smith, D. E.; Williams, B. G.; Wise, J.; Zuber, M. T.

2004-11-01

Dawn, the ninth Discovery mission, will be the first spacecraft to rendezvous with two solar system bodies, the main belt asteroids Vesta and Ceres. This is made possible by utilizing ion propulsion to reach its targets and to maneuver into (and depart) orbits about these bodies. Vesta and Ceres are two terrestrial protoplanets that have survived since the earliest epoch of the solar system and will provide important insights into planet building processes and their evolution under very different circumstances, with and without water. Dawn carries a double framing camera, a visible and infrared mapping spectrometer, and a gamma ray and neutron detector. At Vesta our studies will include the volcanic emplacement of basalts, its differentiation, the possible exposure of its interior near the south pole. At Ceres our studies will include the role of water in its evolution, hydration processes on its surface, and the possible existence of a subsurface ocean. The mission has passed its critical design review and is scheduled to be launched in June 2006 with arrival at Vesta in 2011 and Ceres in 2015. Operation strategies will be presented. Groundbased observations of Vesta, Ceres, and Vesta family members over broad wavelengths, periods and phases will play an important role in detailed mission planning.

Drug Abuse Warning Network (DAWN-2006)

Data.gov (United States)

U.S. Department of Health & Human Services — The Drug Abuse Warning Network (DAWN) is a nationally representative public health surveillance system that has monitored drug related emergency department (ED)...

Drug Abuse Warning Network (DAWN-2005)

Data.gov (United States)

U.S. Department of Health & Human Services — The Drug Abuse Warning Network (DAWN) is a nationally representative public health surveillance system that has monitored drug related emergency department (ED)...

Drug Abuse Warning Network (DAWN-2007)

Data.gov (United States)

U.S. Department of Health & Human Services — The Drug Abuse Warning Network (DAWN) is a nationally representative public health surveillance system that has monitored drug related emergency department (ED)...

Drug Abuse Warning Network (DAWN-2004)

Data.gov (United States)

U.S. Department of Health & Human Services — The Drug Abuse Warning Network (DAWN) is a nationally representative public health surveillance system that has monitored drug related emergency department (ED)...

Drug Abuse Warning Network (DAWN-2009)

Data.gov (United States)

U.S. Department of Health & Human Services — The Drug Abuse Warning Network (DAWN) is a nationally representative public health surveillance system that has monitored drug related emergency department (ED)...

Drug Abuse Warning Network (DAWN-2010)

Data.gov (United States)

U.S. Department of Health & Human Services — The Drug Abuse Warning Network (DAWN) is a nationally representative public health surveillance system that has monitored drug related emergency department (ED)...

Drug Abuse Warning Network (DAWN-2008)

Data.gov (United States)

U.S. Department of Health & Human Services — The Drug Abuse Warning Network (DAWN) is a nationally representative public health surveillance system that has monitored drug related emergency department (ED)...

Drug Abuse Warning Network (DAWN-2011)

Data.gov (United States)

U.S. Department of Health & Human Services — The Drug Abuse Warning Network (DAWN) is a nationally representative public health surveillance system that has monitored drug related emergency department (ED)...

76 FR 75558 - Environmental Impact Statement for Restoration of the Mariposa Grove of Giant Sequoias, Yosemite...

Science.gov (United States)

2011-12-02

... tree. Fire plays an important role in giant sequoia ecology, creating canopy openings and releasing soil nutrients needed for seedling establishment. Fire scars on the trees indicate that fires occurred... and sites within the Grove include the parking areas, gift shop, ticket booth, tram staging area...

The Dawn of Vesta Science

Science.gov (United States)

Garner, Charles E.; Rayman, Marc D.; Brophy, John R.; Mikes, Steven C.

2011-01-01

The Dawn mission is part of NASA's Discovery Program and has as its goal the scientific exploration of the two most massive main-belt asteroids, Vesta and Ceres. The Dawn spacecraft was launched from the Cape Canaveral Air Force Station on September 27, 2007 on a Delta-II 7925H-9.5 (Delta-II Heavy) rocket that placed the 1218-kg spacecraft onto an Earth-escape trajectory. On-board the spacecraft is an ion propulsion system (IPS) developed at the Jet Propulsion Laboratory which will provide a total ?V of 11.3 km/s for the heliocentric transfer to Vesta, orbit capture at Vesta, transfer between Vesta science orbits, departure and escape from Vesta, heliocentric transfer to Ceres, orbit capture at Ceres, and transfer between Ceres science orbits. Fullpower thrusting from December 2007 through October 2008 was used to successfully target a Mars gravity assist flyby in February 2009 that provided an additional ?V of 2.6 km/s. Deterministic thrusting for the heliocentric transfer to Vesta resumed in June 2009 and concluded with orbit capture at Vesta on July 16, 2011. An additional 210 hours of IPS thrusting was used to enter the first Vesta science orbit, called Survey orbit, on August 3, 2011 at an altitude of approximately 2,735 km. To date the IPS has been operated for 23,621 hours, consumed approximately 252 kg of xenon, and provided a delta-V of approximately 6.7 km/s. The IPS performance characteristics are very close to the expected performance based on analysis and testing performed pre-launch. The only significant issue in over the almost four years of IPS operations in flight was the temporary failure of a valve driver board in the Digital Control and Interface Unit-1 (DCIU-1), resulting in a loss of thrust of approximately 29 hours. Thrusting operations resumed after switching to DCIU-2, and power cycling conducted after orbit capture restored DCIU-1 to full functionality. After about three weeks of Survey orbit operations the IPS will be used to transfer the

Red Dawn: Characterizing Iron Oxide Minerals in Atmospheric Dust

Science.gov (United States)

Yauk, K.; Ottenfeld, C. F.; Reynolds, R. L.; Goldstein, H.; Cattle, S.; Berquo, T. S.; Moskowitz, B. M.

2012-12-01

Atmospheric dust is comprised of many components including small amounts of iron oxide minerals. Although the iron oxides make up a small weight percent of the bulk dust, they are important because of their roles in ocean fertilization, controls on climate, and as a potential health hazard to humans. Here we report on the iron oxide mineralogy in dust from a large dust storm, dubbed Red Dawn, which engulfed eastern Australia along a 3000 km front on 23 September 2009. Red Dawn originated from the lower Lake Eyre Basin of South Australia, western New South Wales (NSW) and southwestern Queensland and was the worst dust storm to have hit the city of Sydney in more than 60 years. Dust samples were collected from various locations across eastern Australia (Lake Cowal, Orange, Hornsby, Sydney) following the Red Dawn event. Our dust collection provides a good opportunity to study the physical and mineralogical properties of iron oxides from Red Dawn using a combination of reflectance spectroscopy, Mössbauer spectroscopy (MB), and magnetic measurements. Magnetization measurements from 20-400 K reveal that magnetite/maghemite, hematite and goethite are present in all samples with magnetite occurring in trace amounts (effects (d< 100 nm). Finally, we compared reflectance with a magnetic parameter (hard isothermal remanent magnetization, HIRM) for ferric oxide abundance to assess the degree to which ferric oxide in these samples might absorb solar radiation. In samples for which both parameters were obtained, HIRM and average reflectance over the visible wavelengths are correlated as a group (r2=0.24). These results indicate that the ferric oxide minerals in Red Dawn dust absorb solar radiation. Much of this ferric oxide occurs likely as grain coatings of nanohematite and nanogoethite, thereby providing high surface area to enhance absorption of solar radiation.

Determination of total Betta-activity and heavy metals in biomonitor species (phytomonitors) from the area of ITR-Sofia

International Nuclear Information System (INIS)

Dimitrov, S.; Yovchev, M.; Geleva, E.

2010-01-01

For the purposes of environmental assessment of the area around the Research reactor in Sofia, species from monitored control points, selected in a certain way (habitat, population, air and hydrogeological parameters) are examined. Samples from following phytomonitored species: Betula pendula (silver birch) popullus canadensis (Canadian populus), Quercus sp. (Oak), Dactilus glomerata (Cock's-foot), Abies alba (Silver Fir) and Sequoia sempervirens (Coast Redwood) were analyzed. The total beta activity was determined by radiometric analysis and heavy metals content was measured using X-ray fluorescence analysis. The results are discussed in terms of radiation monitoring program of INRNE (gamma-background, aerosols, surface and groundwater, soil, plants) and obtained values are compared with reference points in the country

Tracing Cosmic Dawn

Science.gov (United States)

Fialkov, Anastasia

2018-05-01

Observational effort is on the way to probe the 21-cm of neutral hydrogen from the epochs of Reionization and Cosmic Dawn. Our current poor knowledge of high redshift astrophysics results in a large uncertainty in the theoretically predicted 21-cm signal. A recent parameter study that is highlighted here explores the variety of 21-cm signals resulting from viable astrophysical scenarios. Model-independent relations between the shape of the signal and the underlying astrophysics are discussed. Finally, I briefly note on possible alternative probes of the high redshift Universe, specifically Fast Radio Bursts.

Antiprotozoal Activity of Buxus sempervirens and Activity-Guided Isolation of O-tigloylcyclovirobuxeine-B as the Main Constituent Active against Plasmodium falciparum

Directory of Open Access Journals (Sweden)

Julia B. Althaus

2014-05-01

Full Text Available Buxus sempervirens L. (European Box, Buxaceae has been used in ethnomedicine to treat malaria. In the course of our screening of plant extracts for antiprotozoal activity, a CH2Cl2 extract from leaves of B. sempervirens showed selective in vitro activity against Plasmodium falciparum (IC50 = 2.79 vs. 20.2 µg/mL for cytotoxicity against L6 rat cells. Separation of the extract by acid/base extraction into a basic and a neutral non-polar fraction led to a much more active and even more selective fraction with alkaloids while the fraction of non-polar neutral constituents was markedly less active than the crude extract. Thus, the activity of the crude extract could clearly be attributed to alkaloid constituents. Identification of the main triterpene-alkaloids and characterization of the complex pattern of this alkaloid fraction was performed by UHPLC/+ESI-QTOF-MS analyses. ESI-MS/MS target-guided larger scale preparative separation of the alkaloid fraction was performed by ‘spiral coil-countercurrent chromatography’. From the most active subfraction, the cycloartane alkaloid O-tigloylcyclovirobuxeine-B was isolated and evaluated for antiplasmodial activity which yielded an IC50 of 0.455 µg/mL (cytotoxicity against L6 rat cells: IC50 = 9.38 µg/mL. O-tigloylcyclovirobuxeine-B is thus most significantly responsible for the high potency of the crude extract.

Experimental neuropharmacology of Gelsemium sempervirens: Recent advances and debated issues.

Science.gov (United States)

Bellavite, Paolo; Bonafini, Clara; Marzotto, Marta

Gelsemium sempervirens L. (Gelsemium) is traditionally used for its anxiolytic-like properties and its action mechanism in laboratory models are under scrutiny. Evidence from rodent models was reported suggesting the existence of a high sensitivity of central nervous system to anxiolytic power of Gelsemium extracts and Homeopathic dilutions. In vitro investigation of extremely low doses of this plant extract showed a modulation of gene expression of human neurocytes. These studies were criticized in a few commentaries, generated a debate in literature and were followed by further experimental studies from various laboratories. Toxic doses of Gelsemium cause neurological signs characterized by marked weakness and convulsions, while ultra-low doses or high Homeopathic dilutions counteract seizures induced by lithium and pilocarpine, decrease anxiety after stress and increases the anti-stress allopregnanolone hormone, through glycine receptors. Low (non-Homeopathic) doses of this plant or its alkaloids decrease neuropathic pain and c-Fos expression in mice brain and oxidative stress. Due to the complexity of the matter, several aspects deserve interpretation and the main controversial topics, with a focus on the issues of high dilution pharmacology, are discussed and clarified. Copyright © 2017 Transdisciplinary University, Bangalore and World Ayurveda Foundation. Published by Elsevier B.V. All rights reserved.

Bioactivity of Peumus boldus Molina, Laurelia sempervirens (Ruiz & Pav. Tul. and Laureliopsis philippiana (Looser Schodde (Monimiacea essential oils against Sitophilus zeamais Motschulsky

Directory of Open Access Journals (Sweden)

Carmen Herrera-Rodríguez

2015-09-01

Full Text Available The maize weevil (Sitophilus zeamais Motschulsky is one of most important pest of stored seeds worldwide, but its current control method is based on the use of synthetic insecticides, usually leading to undesirable problems such as insecticide residues on treated food, human intoxications, and insect resistance development. Therefore the search of friendly alternative methods is required. The aim of this study was to assess, under laboratory conditions, the insecticidal properties of Peumus boldus Molina, Laurelia sempervirens (Ruiz & Pav. Tul., and Laureliopsis philippiana (Looser Schodde essential oils against S. zeamais. The phytochemical analysis of the three essential oils showed 1,8-cineole, safrole and methyleugenol as the common components; all of them documented with insecticidal activity from essential oils from other plant species. The highest toxicity (100% mortality of these three oils acting as a contact insecticide was observed at 24 h exposure at 4% concentration. The estimated LC50 values for P. boldus, L. sempervirens, and L. philippiana were 0.37, 1.02, and 0.28 μL g-1, respectively. Peumus boldus exhibited the highest fumigant activity with 100% adult mortality at 30 μL oil L-1 air. At ≥ 0.5% (v/w concentration, all essential oils showed repellent activity. These three essential oils showed a promissory insecticidal activity against the maize weevil.

Moon Search Algorithms for NASA's Dawn Mission to Asteroid Vesta

Science.gov (United States)

Memarsadeghi, Nargess; Mcfadden, Lucy A.; Skillman, David R.; McLean, Brian; Mutchler, Max; Carsenty, Uri; Palmer, Eric E.

2012-01-01

A moon or natural satellite is a celestial body that orbits a planetary body such as a planet, dwarf planet, or an asteroid. Scientists seek understanding the origin and evolution of our solar system by studying moons of these bodies. Additionally, searches for satellites of planetary bodies can be important to protect the safety of a spacecraft as it approaches or orbits a planetary body. If a satellite of a celestial body is found, the mass of that body can also be calculated once its orbit is determined. Ensuring the Dawn spacecraft's safety on its mission to the asteroid Vesta primarily motivated the work of Dawn's Satellite Working Group (SWG) in summer of 2011. Dawn mission scientists and engineers utilized various computational tools and techniques for Vesta's satellite search. The objectives of this paper are to 1) introduce the natural satellite search problem, 2) present the computational challenges, approaches, and tools used when addressing this problem, and 3) describe applications of various image processing and computational algorithms for performing satellite searches to the electronic imaging and computer science community. Furthermore, we hope that this communication would enable Dawn mission scientists to improve their satellite search algorithms and tools and be better prepared for performing the same investigation in 2015, when the spacecraft is scheduled to approach and orbit the dwarf planet Ceres.

The penalty of a long, hot summer. Photosynthetic acclimation to high CO2 and continuous light in "living fossil" conifers.

Science.gov (United States)

Osborne, Colin P; Beerling, David J

2003-10-01

Deciduous forests covered the ice-free polar regions 280 to 40 million years ago under warm "greenhouse" climates and high atmospheric pCO2. Their deciduous habit is frequently interpreted as an adaptation for minimizing carbon losses during winter, but experiments with "living fossils" in a simulated warm polar environment refute this explanation. Measured carbon losses through leaf abscission of deciduous trees are significantly greater than losses through winter respiration in evergreens, yet annual rates of primary productivity are similar in all species. Here, we investigate mechanisms underlying this apparent paradox by measuring the seasonal patterns of leaf photosynthesis (A) under pCO2 enrichment in the same trees. During spring, A increased significantly in coastal redwood (Sequoia sempervirens), dawn redwood (Metasequoia glyptostroboides), and swamp cypress (Taxodium distichum) at an elevated pCO2 of 80 Pa compared with controls at 40 Pa. However, strong acclimation in Rubisco carboxylation capacity (Vc,max) completely offset the CO2 response of A in all species by the end of 6 weeks of continuous illumination in the simulated polar summer. Further measurements demonstrated the temporary nature of acclimation, with increases in Vc,max during autumn restoring the CO2 sensitivity of A. Contrary to expectations, the acclimation of Vc,max was not always accompanied by accumulation of leaf carbohydrates, but was associated with a decline in leaf nitrogen in summer, suggesting an alteration of the balance in plant sources and sinks for carbon and nitrogen. Preliminary calculations using A indicated that winter carbon losses through deciduous leaf abscission and respiration were recovered by 10 to 25 d of canopy carbon fixation during summer, thereby explaining the productivity paradox.

The Penalty of a Long, Hot Summer. Photosynthetic Acclimation to High CO2 and Continuous Light in “Living Fossil” Conifers1

Science.gov (United States)

Osborne, Colin P.; Beerling, David J.

2003-01-01

Deciduous forests covered the ice-free polar regions 280 to 40 million years ago under warm “greenhouse” climates and high atmospheric pCO2. Their deciduous habit is frequently interpreted as an adaptation for minimizing carbon losses during winter, but experiments with “living fossils” in a simulated warm polar environment refute this explanation. Measured carbon losses through leaf abscission of deciduous trees are significantly greater than losses through winter respiration in evergreens, yet annual rates of primary productivity are similar in all species. Here, we investigate mechanisms underlying this apparent paradox by measuring the seasonal patterns of leaf photosynthesis (A) under pCO2 enrichment in the same trees. During spring, A increased significantly in coastal redwood (Sequoia sempervirens), dawn redwood (Metasequoia glyptostroboides), and swamp cypress (Taxodium distichum) at an elevated pCO2 of 80 Pa compared with controls at 40 Pa. However, strong acclimation in Rubisco carboxylation capacity (Vc,max) completely offset the CO2 response of A in all species by the end of 6 weeks of continuous illumination in the simulated polar summer. Further measurements demonstrated the temporary nature of acclimation, with increases in Vc,max during autumn restoring the CO2 sensitivity of A. Contrary to expectations, the acclimation of Vc,max was not always accompanied by accumulation of leaf carbohydrates, but was associated with a decline in leaf nitrogen in summer, suggesting an alteration of the balance in plant sources and sinks for carbon and nitrogen. Preliminary calculations using A indicated that winter carbon losses through deciduous leaf abscission and respiration were recovered by 10 to 25 d of canopy carbon fixation during summer, thereby explaining the productivity paradox. PMID:12972654

Dawn song in natural and artificial continuous day: Light pollution affects songbirds at high latitudes.

Science.gov (United States)

Derryberry, Elizabeth P

2017-10-01

In Focus: Da Silva, A., & Kempenaers, B. (2017). Singing from North to South: Latitudinal variation in timing of dawn singing under natural and artificial light conditions. Journal of Animal Ecology, 86, 1286-1297. doi: 10.1111/1365-2656.12739 Satellite images of the world at night show bright dots connected by glowing lines crisscrossing the globe. As these connect-the-dots become brighter and expand into more and more remote regions, much of the flora and fauna of the world are experiencing evolutionarily unprecedented levels of light at night. Light cues are essential to most physiological and behavioural processes, and so the need to measure the effects of light pollution on these processes is critical. In this issue, Da Silva and Kempenaers take on this task using an important reproductive behaviour in songbirds-dawn song. The geographic, temporal and taxonomic breadth of sampling in this study allows for a close examination of a potentially complex interaction between light pollution and natural variation in the behaviour of dawn singing across latitude, season and species. Their extensive dataset highlights complexity in how songbirds respond to light pollution. Although light pollution has a strong effect on the timing of dawn song, not all songbirds respond the same way to light pollution, and the effects of light pollution vary with changes in natural light levels. Early dawn singers show more flexibility in the timing of dawn song across the season and across latitudes than late dawn singers, and also appear less affected by light pollution at high latitudes than are late dawn singers. These findings suggest that not all songbirds are responding to artificial continuous daylight as they do to natural continuous daylight, highlighting the general need to measure the fitness effects of light pollution. © 2017 The Author. Journal of Animal Ecology © 2017 British Ecological Society.

Monte Carlo simulation of the resolution volume for the SEQUOIA spectrometer

Directory of Open Access Journals (Sweden)

Granroth G.E.

2015-01-01

Full Text Available Monte Carlo ray tracing simulations, of direct geometry spectrometers, have been particularly useful in instrument design and characterization. However, these tools can also be useful for experiment planning and analysis. To this end, the McStas Monte Carlo ray tracing model of SEQUOIA, the fine resolution fermi chopper spectrometer at the Spallation Neutron Source (SNS of Oak Ridge National Laboratory (ORNL, has been modified to include the time of flight resolution sample and detector components. With these components, the resolution ellipsoid can be calculated for any detector pixel and energy bin of the instrument. The simulation is split in two pieces. First, the incident beamline up to the sample is simulated for 1 × 1011 neutron packets (4 days on 30 cores. This provides a virtual source for the backend that includes the resolution sample and monitor components. Next, a series of detector and energy pixels are computed in parallel. It takes on the order of 30 s to calculate a single resolution ellipsoid on a single core. Python scripts have been written to transform the ellipsoid into the space of an oriented single crystal, and to characterize the ellipsoid in various ways. Though this tool is under development as a planning tool, we have successfully used it to provide the resolution function for convolution with theoretical models. Specifically, theoretical calculations of the spin waves in YFeO3 were compared to measurements taken on SEQUOIA. Though the overall features of the spectra can be explained while neglecting resolution effects, the variation in intensity of the modes is well described once the resolution is included. As this was a single sharp mode, the simulated half intensity value of the resolution ellipsoid was used to provide the resolution width. A description of the simulation, its use, and paths forward for this technique will be discussed.

Ceres' Geophysical Evolution Inferred from Dawn Data

Science.gov (United States)

Castillo-Rogez, Julie; Bowling, Timothy; Ermakov, Anton I.; Fu, Roger; Park, Ryan; Raymond, Carol; De Sanctis, Maria Cristina; Ammannito, Eleonora; Ruesch, Ottaviano; Prettyman, Thomas H.; Y McSween, Harry; Toplis, Michael J.; Russell, Christopher T.; Dawn Team

2016-10-01

If Ceres formed as an ice-rich body, as suggested by its low density and the detection of ammoniated phyllosilicates [1], then it should have differentiated an ice-dominated shell, analogous to large icy satellites [2]. Instead, Dawn observations revealed an enrichment of Ceres' shell in strong materials, either a rocky component and/or salts and gas hydrates [3, 4, 5, 6]. We have explored several scenarios for the emplacement of Ceres' surface. Endogenic processes cannot account for its overall homogeneity. Instead we suggest that Ceres differentiated an icy shell upon freezing of its early ocean that was removed as a consequence of frequent exposure by impacting after the dwarf planet migrated from a cold accretional environment to the warmer outer main belt (or when the solar nebula dissipated, if Ceres formed in situ). This scenario implies that Ceres' current surface represents the interface between the original ice shell and the top of the frozen ocean, a region that is extremely rich chemistry-wise, as illustrated by the mineralogical observations returned by Dawn [7]. Thermal modeling shows that the shell could remain warm over the long term and offer a setting for the generation of brines that may be responsible for the emplacement of Ahuna Mons [8] and Occator's bright spots [7] on an otherwise homogeneous surface [9]. An important implication is that Ceres' surface offers an analog for better understanding the deep interior and chemical evolution of large ice-rich bodies.References: [1] De Sanctis et al., Nature, 2015; [2] McCord and Sotin, Journal of Geophysical Research, 2005; [3] Park et al., Nature, 2016 (in press); [4] Hiesinger et al., Science (submitted); [5] Bland et al., Nature Geoscience, 2016 (in press); [6] Fu et al., AGU Fall Meeting, 2015 [7] De Sanctis et al., Nature, 2016 (in press); [8] Ruesch et al., Science, in revision; [9] Ammannito et al., Science, 2016 (accepted).Acknowledgements: Part of this work is being carried out at the Jet

An individual-based growth and competition model for coastal redwood forest restoration

Science.gov (United States)

van Mantgem, Phillip J.; Das, Adrian J.

2014-01-01

Thinning treatments to accelerate coastal redwood forest stand development are in wide application, but managers have yet to identify prescriptions that might best promote Sequoia sempervirens (Lamb. ex D. Don) Endl. (redwood) growth. The creation of successful thinning prescriptions would be aided by identifying the underlying mechanisms governing how individual tree growth responds to competitive environments in coastal redwood forests. We created a spatially explicit individual-based model of tree competition and growth parameterized using surveys of upland redwood forests at Redwood National Park, California. We modeled competition for overstory trees (stems ≥ 20 cm stem diameter at breast height, 1.37 m (dbh)) as growth reductions arising from sizes, distances, and species identity of competitor trees. Our model explained up to half of the variation in individual tree growth, suggesting that neighborhood crowding is an important determinant of growth in this forest type. We used our model to simulate the effects of novel thinning prescriptions (e.g., 40% stand basal area removal) for redwood forest restoration, concluding that these treatments could lead to substantial growth releases, particularly for S. sempervirens. The results of this study, along with continued improvements to our model, will help to determine spacing and species composition that best encourage growth.

Comparative study of two coniferous species (Pinus pinaster Aiton and Cupressus sempervirens L. var. dupreziana [A. Camus] Silba) essential oils: chemical composition and biological activity

OpenAIRE

Amri, Ismail; Hanana, Mohsen; Gargouri, Samia; Jamoussi, Bassem; Hamrouni, Lamia

2013-01-01

Maritime pine (Pinus pinaster Aiton) and Saharan cypress (Cupressus sempervirens L. var. dupreziana [A. Camus] Silba) are two cone-bearing seed coniferous woody plants. The chemical composition of their essential oils, isolated from needles and leaves by hydrodistillation, was analyzed with gas chromatography (GC) and gas chromatography mass spectrometry (GC/MS). A total of 66 and 28 compounds were identified, which represented 99.5% and 98.9% of total pine and cypress oils, respectively. Pin...

Drug Abuse Warning Network US (DAWN-NS-1994)

Data.gov (United States)

U.S. Department of Health & Human Services — The Drug Abuse Warning Network (DAWN) survey is designed to capture data on emergency department (ED) episodes that are induced by or related to the use of an...

Drug Abuse Warning Network US (DAWN-NS-1997)

Data.gov (United States)

U.S. Department of Health & Human Services — The Drug Abuse Warning Network (DAWN) survey is designed to capture data on emergency department (ED) episodes that are induced by or related to the use of an...

Demography of the California spotted owl in the Sierra National Forest and Sequoia/Kings Canyon National Parks

Science.gov (United States)

George N. Steger; Thomas E. Munton; Kenneth D. Johnson; Gary P. Eberlein

2002-01-01

Nine years (1990–1998) of demographic data on California spotted owls (Strix occidentalis occidentalis) in two study areas on the western slopes of the Sierra Nevada—one in the Sierra National Forest (SNF), the other in Sequoia/Kings Canyon National Parks (SNP)—are summarized. Numbers of territorial owls fluctuated from 85 to 50 in SNF and 80 to 58...

The effect of low- and high-power microwave irradiation on in vitro grown Sequoia plants and their recovery after cryostorage.

Science.gov (United States)

Halmagyi, A; Surducan, E; Surducan, V

2017-09-01

Two distinct microwave power levels and techniques have been studied in two cases: low-power microwave (LPM) irradiation on in vitro Sequoia plants and high-power microwave (HPM) exposure on recovery rates of cryostored (-196°C) Sequoia shoot apices. Experimental variants for LPM exposure included: (a) in vitro plants grown in regular conditions (at 24 ± 1°C during a 16-h light photoperiod with a light intensity of 39.06 μEm -2 s -1 photosynthetically active radiation), (b) in vitro plants grown in the anechoic chamber with controlled environment without microwave irradiation, and (c) in vitro plants grown in the anechoic chamber with LPM irradiation for various times (5, 15, 30, 40 days). In comparison to control plants, significant differences in shoot multiplication and growth parameters (length of shoots and roots) were observed after 40 days of LPM exposure. An opposite effect was achieved regarding the content of total soluble proteins, which decreased with increasing exposure time to LPM. HPM irradiation was tested as a novel rewarming method following storage in liquid nitrogen. To our knowledge, this is the first report using this type of rewarming method. Although, shoot tips subjected to HPM exposure showed 28% recovery following cryostorage compared to 44% for shoot tips rewarmed in liquid medium at 22 ± 1 °C, we consider that the method represent a basis and can be further improved. The results lead to the overall conclusion that LPM had a stimulating effect on growth and multiplication of in vitro Sequoia plants, while the HPM used for rewarming of cryopreserved apices was not effective to achieve high rates of regrowth after liquid nitrogen exposure.

Cosmological Structure Formation: From Dawn till Dusk

DEFF Research Database (Denmark)

Heneka, Caroline Samantha

Cosmology has entered an era where a plethora data is available on structure formation to constrain astrophysics and underlying cosmology. This thesis strives to both investigate new observables and modeling of the Epoch of Reionization, as well as to constrain dark energy phenomenology with mass......Cosmology has entered an era where a plethora data is available on structure formation to constrain astrophysics and underlying cosmology. This thesis strives to both investigate new observables and modeling of the Epoch of Reionization, as well as to constrain dark energy phenomenology...... with massive galaxy clusters, traveling from the dawn of structure formation, when the first galaxies appear, to its dusk, when a representative part of the mass in the Universe is settled in massive structures. This hunt for accurate constraints on cosmology is complemented with the demonstration of novel...... Bayesian statistical tools and kinematical constraints on dark energy. Starting at the dawn of structure formation, we study emission line fluctuations, employing semi-numerical simulations of cosmological volumes of their line emission, in order to cross-correlate fluctuations in brightness. This cross...

The highest-ranking rooster has priority to announce the break of dawn

OpenAIRE

Shimmura, Tsuyoshi; Ohashi, Shosei; Yoshimura, Takashi

2015-01-01

The ?cock-a-doodle-doo? crowing of roosters, which symbolizes the break of dawn in many cultures, is controlled by the circadian clock. When one rooster announces the break of dawn, others in the vicinity immediately follow. Chickens are highly social animals, and they develop a linear and fixed hierarchy in small groups. We found that when chickens were housed in small groups, the top-ranking rooster determined the timing of predawn crowing. Specifically, the top-ranking rooster always start...

Natural entrainment without dawn and dusk : The case of the European ground squirrel (Spermophilus citellus)

NARCIS (Netherlands)

Hut, RA; van Oort, BEH; Daan, S; Oort, Bob E.H. van

Observational data collected in the field and in enclosures show that diurnal, burrow-dwelling European ground squirrels (Spermophilus citellus) never were above ground during twilight at dawn or at dusk. The animals emerged on average 4.02 h (SD = 0.45) after civil twilight at dawn and retreated in

4 Vesta in Color: High Resolution Mapping from Dawn Framing Camera Images

Science.gov (United States)

Reddy, V.; LeCorre, L.; Nathues, A.; Sierks, H.; Christensen, U.; Hoffmann, M.; Schroeder, S. E.; Vincent, J. B.; McSween, H. Y.; Denevi, B. W.;

Surface Mineralogy Mapping of Ceres from the Dawn Mission

Science.gov (United States)

McCord, T. B.; Zambon, F.

2017-12-01

Ceres' surface composition is of special interest because it is a window into the interior state and the past evolution of this dwarf planet. Disk-integrated telescopic spectral observations indicated that Ceres' surface is hydroxylated, similar to but not exactly the same as some of the carbonaceous chondrite classes of meteorites. Furthermore, Ceres' bulk density is low, indicating significant water content. The Dawn mission in orbit around Ceres, provided a new and larger set of observations on the mineralogy, molecular and elemental composition, and their distributions in association with surface features and geology. A set of articles was prepared, from which this presentation is derived, that is the first treatment of the entire surface composition of Ceres using the complete High Altitude Mapping Orbit (HAMO) Dawn Ceres data set and the calibrations from all the Dawn instruments. This report provides a current and comprehensive view of Ceres' surface composition and integrates them into general conclusions. Ceres' surface composition shows a fairly uniform distribution of NH4- and Mg-phyllosilicates, carbonates, mixed with a dark component. The widespread presence of phyllosilicates, and salts on Ceres' surface is indicative of the presence of aqueous alteration processes, which involved the whole dwarf planet. There is also likely some contamination by low velocity infall, as seen on Vesta, but it is more difficult to distinguish this infall from native Ceres material, unlike for the Vesta case.

Dawn chorus variation in East-Asian tropical montane forest birds and its ecological and morphological correlates

NARCIS (Netherlands)

Chen, W.-M.; Lee, Y.-F.; Tsai, C.-F.; Yao, C.-T.; Chen, Y.-H.; Li, S.-H.; Kuo, Y.-M.

2015-01-01

Many birds in breeding seasons engage in vigorous dawn singing that often turns to a prominent chorus. We examined dawn chorus variation of avian assemblages in a tropical montane forest in Taiwan and tested the hypothesis that onset sequence is affected by eye sizes, foraging heights, and diet of

Paradigms and Paradoxes: Dawn at Vesta

Science.gov (United States)

Raymond, Carol; Russell, Christopher; Mittlefehldt, David

2014-05-01

While confirming the paradigm of Vesta as the parent body of the HED meteorites, measurements by Dawn have discovered many unexpected aspects of the vestan surface. First, an olivine layer was not found in the bottom of the large basin near the south pole of Vesta where excavation of the mantle was thought to have occurred. In fact, while patches of olivine have been found in the north, it is rare on the surface. Secondly, while Vesta has little gravity and appears to have completely differentiated, it is not completely dry. Morphological evidence from the walls and floors of some craters suggest transient fluid flows and pits formed by devolatization, implying a substantial amount of accessible water. The question is, did this water derive from internal or external sources? Thirdly, transport of material to the surface of Vesta from elsewhere in the asteroid belt appears as dark material buried near the top of the regolith of Vesta. This may have arrived in a single large impact and been spread around the surface and buried, later to be re-excavated. However, this is not the only scenario possible for the source of this material. Meteoritical evidence from howardites shows that debris from multiple types of impactors are present in the vestan regolith. In short, Dawn's observations of Vesta have been both reassuring but unsettling at the same time.

[Role of growth hormone in the pathogenesis of dawn phenomenon in IDDM].

Science.gov (United States)

Mimura, A; Kageyama, S; Itoh, K; Miura, J; Kurata, H; Yokoyama, J; Ikeda, Y

1992-06-20

The early morning hyperglycemia of diabetic patients has been commonly referred to as the "dawn phenomenon". Recently the nocturnal surges of growth hormone (GH) have been suggested as an important factor in the pathogenesis of the dawn phenomenon. In order to reassess the role of the nocturnal GH secretion in the dawn phenomenon, seven C-peptide negative diabetic patients were studied during 48hr-feedback control using a closed-loop insulin infusion device (Biostator). They received oral sleeping medication only on the first night (control) and sleeping medication with anticholinergic agent (pirenzepine 75mg) on the second night, and blood glucose, insulin requirements, GH and cortisol concentrations during 0000hr and 0700hr were measured. The peak of sleep-induced GH secretions was markedly suppressed by pirenzepine in comparison with the control night (19.8 +/- 3.7 vs. 3.0 +/- 1.2ng/ml; p less than 0.05). Insulin requirements during 0500hr and 0700hr were suppressed significantly by pirenzepine (3.0 +/- 0.2 vs. 2.0 +/- 0.2U/2hr; p less than 0.05). Insulin infusion ratio, i.e. insulin requirements during 0500hr and 0700hr divided by those during 0000hr and 0200hr, was decreased by pirenzepine (2.2 +/- 0.3 vs. 1.5 +/- 0.2; p less than 0.05). There were no significant differences in blood glucose and cortisol concentrations whether or not the anticholinergic agent was given. In conclusion, these results have shown that an anticholinergic agent may be useful in the management of insulin-treated patients with marked dawn phenomenon.

Instituto SEQUOIA : Um serviço privado,  multidisciplinar e de cuidado aos idosos SEQUOIA Institute: A multidisciplinary private service for the care of senior citizens L’Institut SEQUOIA : Un service privé multidisciplinaire pour les soins des personnes du troisième âge Instituto SEQUOIA : Un servicio privado y multidisciplinario de atención a las personas de la tercera edad

Directory of Open Access Journals (Sweden)

Anelise Fonseca

2011-10-01

Full Text Available Population aging is a reality all over the world, requiring a change in the way care is perceived and resources are divided for different age groups. In Brazil, current indicators and projections place the country among those with the highest number of elderly people. By contrast, there is a shortage of action plans and inter- and multi-disciplinary teams, as well as public policies and professionals, focusing on the elderly, in part as a consequence of an accelerated aging process in developing countries. Within this context, the SEQUOIA Institute (IS was created to attend to this process by monitoring the overall health of patients. The institute's routine work includes clinical actions, team meetings, socialization projects and lectures. The IS features a 10% yearly growth in medical assistance, a 20% rise in psychological treatments, and a 50% increase in lecture attendance.Le vieillissement de la population est un phénomène mondial qui exige de revoir la façon dont sont perçus les soins et dont sont divisées les ressources en fonction des différentes tranches d’âge. Les indicateurs et les projections actuels montrent que le Brésil est le pays qui compte la plus grande proportion de personnes âgées. Et pourtant, les plans d’action, les équipes inter- et pluridisciplinaires, mais aussi les politiques publiques et les professionnels spécialistes des questions liées aux personnes âgées sont en nombre insuffisant, notamment en raison d’un processus de vieillissement accéléré dans les pays en développement. C’est dans ce contexte qu’a été créé l’Institut SEQUOIA (IS, dont la mission consiste à gérer ce processus en effectuant un suivi de la santé générale des patients. Les principales tâches de l’institut incluent études cliniques, réunions d’équipes, projets impliquant des débats et conférences. L’IS affiche une croissance annuelle de 10 % dans le secteur de l’assistance médicale, de 20

High-resolution Ceres Low Altitude Mapping Orbit Atlas derived from Dawn Framing Camera images

Science.gov (United States)

Roatsch, Th.; Kersten, E.; Matz, K.-D.; Preusker, F.; Scholten, F.; Jaumann, R.; Raymond, C. A.; Russell, C. T.

2017-06-01

The Dawn spacecraft Framing Camera (FC) acquired over 31,300 clear filter images of Ceres with a resolution of about 35 m/pxl during the eleven cycles in the Low Altitude Mapping Orbit (LAMO) phase between December 16 2015 and August 8 2016. We ortho-rectified the images from the first four cycles and produced a global, high-resolution, uncontrolled photomosaic of Ceres. This global mosaic is the basis for a high-resolution Ceres atlas that consists of 62 tiles mapped at a scale of 1:250,000. The nomenclature used in this atlas was proposed by the Dawn team and was approved by the International Astronomical Union (IAU). The full atlas is available to the public through the Dawn Geographical Information System (GIS) web page [http://dawngis.dlr.de/atlas] and will become available through the NASA Planetary Data System (PDS) (http://pdssbn.astro.umd.edu/).

Early birds are sexy: male age, dawn song and extrapair paternity in blue tits, Cyanistes (formerly Parus) caeruleus

DEFF Research Database (Denmark)

Poesel, Angelika; Kunc, H.P.; Foerster, K.

2006-01-01

Sexual selection theory predicts that signals reflecting the relative quality of individuals should be used in mate choice. Females could base their choice of copulation partners on male secondary sexual traits that honestly signal male age, as predicted by the age-based indicator mechanism....... Studies have shown that female blue tits prefer older males and that aspects of dawn song reflect male quality, but it remains unknown whether dawn song characteristics correlate with male age. We compared dawn song characteristics of second-year (SY) and older (ASY) male blue tits (cross......-sectional analysis), and tested for age-related changes within individuals (longitudinal analysis) and differential overwinter survival of SY males. We further investigated the relation between dawn song and paternity gain and loss. We found that ASY male blue tits began to sing earlier relative to sunrise than did...

Evidence for ground-ice occurrence on asteroid Vesta using Dawn bistatic radar observations

Science.gov (United States)

Palmer, E. M.; Heggy, E.; Kofman, W. W.

2017-12-01

From 2011 to 2012, the Dawn spacecraft orbited asteroid Vesta, the first of its two targets in the asteroid belt, and conducted the first bistatic radar (BSR) experiment at a small-body, during which Dawn's high-gain communications antenna is used to transmit radar waves that scatter from Vesta's surface toward Earth at high incidence angles just before and after occultation of the spacecraft behind the asteroid. Among the 14 observed mid-latitude forward-scatter reflections, the radar cross section ranges from 84 ± 8 km2 (near Saturnalia Fossae) to 3,588 ± 200 km2 (northwest of Caparronia crater), implying substantial spatial variation in centimeter- to decimeter-scale surface roughness. The compared distributions of surface roughness and subsurface hydrogen concentration [H]—measured using data from Dawn's BSR experiment and Gamma Ray and Neutron Spectrometer (GRaND), respectively—reveal the occurrence of heightened subsurface [H] with smoother terrains that cover tens of square kilometers. Furthermore, unlike on the Moon, we observe no correlation between surface roughness and surface ages on Vesta—whether the latter is derived from lunar or asteroid-flux chronology [Williams et al., 2014]—suggesting that cratering processes alone are insufficient to explain Vesta's surface texture at centimeter-to-decimeter scales. Dawn's BSR observations support the hypothesis of transient melting, runoff and recrystallization of potential ground-ice deposits, which are postulated to flow along fractures after an impact, and provide a mechanism for the smoothing of otherwise rough, fragmented impact ejecta. Potential ground-ice presence within Vesta's subsurface was first proposed by Scully et al. [2014], who identified geomorphological evidence for transient water flow along several of Vesta's crater walls using Dawn Framing Camera images. While airless, differentiated bodies such as Vesta and the Moon are thought to have depleted their initial volatile content

Preparing for Dawn's Mission at Ceres: Challenges and Opportunities in the Exploration of a Dwarf Planet

Science.gov (United States)

Rayman, Marc D.; Mase, Robert A.

2014-01-01

After escaping from Vesta in 2012, Dawn is continuing its 2.5-year flight to dwarf planet Ceres. Investigating this second destination promises to provide a view of an intriguing world of ice and rock, likely displaying fascinating geology entirely unlike any body yet orbited by a spacecraft. Dawn spends the significant majority of the time thrusting with its ion propulsion system to deliver the 3.6 km/s required to rendezvous with Ceres. Meanwhile, the operations team has developed the sequences that will be used there. Following orbit capture in March 2015, Dawn will fly to a series of four circular polar science orbits. The orbits, ranging from about 13,500 km to 375 km in altitude, are designed to optimize the scientific observations. The overall strategy for exploring Ceres is based strongly on the extremely successful 16 months of Vesta operations, during which Dawn met or exceeded all of its objectives. Nevertheless, the loss of two of the spacecraft's four reaction wheels has necessitated some important changes. Based on a very productive hydrazine conservation campaign in the interplanetary cruise and the development of new hydrazine-efficient methods of operating at Ceres, there is good reason to expect that Dawn will be able to accomplish all of its objectives regardless of the health of the reaction wheels. This paper describes the progress in traveling to Ceres as well as the plans for exploring this giant, icy world.

Laboratory evaluation of the Sequoia Scientific LISST-ABS acoustic backscatter sediment sensor

Science.gov (United States)

Snazelle, Teri T.

2017-12-18

Sequoia Scientific’s LISST-ABS is an acoustic backscatter sensor designed to measure suspended-sediment concentration at a point source. Three LISST-ABS were evaluated at the U.S. Geological Survey (USGS) Hydrologic Instrumentation Facility (HIF). Serial numbers 6010, 6039, and 6058 were assessed for accuracy in solutions with varying particle-size distributions and for the effect of temperature on sensor accuracy. Certified sediment samples composed of different ranges of particle size were purchased from Powder Technology Inc. These sediment samples were 30–80-micron (µm) Arizona Test Dust; less than 22-µm ISO 12103-1, A1 Ultrafine Test Dust; and 149-µm MIL-STD 810E Silica Dust. The sensor was able to accurately measure suspended-sediment concentration when calibrated with sediment of the same particle-size distribution as the measured. Overall testing demonstrated that sensors calibrated with finer sized sediments overdetect sediment concentrations with coarser sized sediments, and sensors calibrated with coarser sized sediments do not detect increases in sediment concentrations from small and fine sediments. These test results are not unexpected for an acoustic-backscatter device and stress the need for using accurate site-specific particle-size distributions during sensor calibration. When calibrated for ultrafine dust with a less than 22-µm particle size (silt) and with the Arizona Test Dust with a 30–80-µm range, the data from sensor 6039 were biased high when fractions of the coarser (149-µm) Silica Dust were added. Data from sensor 6058 showed similar results with an elevated response to coarser material when calibrated with a finer particle-size distribution and a lack of detection when subjected to finer particle-size sediment. Sensor 6010 was also tested for the effect of dissimilar particle size during the calibration and showed little effect. Subsequent testing revealed problems with this sensor, including an inadequate temperature

First detection of global dawn-dusk ionospheric current intensities using Ampere's integral law on Orsted orbits

DEFF Research Database (Denmark)

Stauning, P.; Primdahl, Fritz

2000-01-01

-to-dusk ionospheric current is found to be proportional to the gee-effective solar wind electric field and is around 1 million ampere for a typical solar wind electric field of 2 mV/m. Dividing the Ampere integral into semi-orbit parts has enabled us to show that the hemispherical total current intensities depend......The magnetic measurements by the Orsted satellite in noon-midnight orbits have enabled the derivation of the global dawn-dusk oriented ionospheric currents from an Ampere's law closed loop line integral of the geomagnetic vector field along the satellite track. The globally integrated dawn...... on the respective polar cap conductivities, which relate to the daily and seasonally varying solar illumination. The more illuminated hemisphere conveys up to three times more current from dawn to dusk than does the less illuminated....

Parallel computing of a climate model on the dawn 1000 by domain decomposition method

Science.gov (United States)

Bi, Xunqiang

1997-12-01

In this paper the parallel computing of a grid-point nine-level atmospheric general circulation model on the Dawn 1000 is introduced. The model was developed by the Institute of Atmospheric Physics (IAP), Chinese Academy of Sciences (CAS). The Dawn 1000 is a MIMD massive parallel computer made by National Research Center for Intelligent Computer (NCIC), CAS. A two-dimensional domain decomposition method is adopted to perform the parallel computing. The potential ways to increase the speed-up ratio and exploit more resources of future massively parallel supercomputation are also discussed.

ORIGIN: metal creation and evolution from the cosmic dawn

NARCIS (Netherlands)

den Herder, J.W.; Piro, L.; Ohashi, T.; Kouveliotou, C.; Hartmann, D.H.; Kaastra, J.S.; Amati, L.; Andersen, M.I.; Arnaud, M.; Atteia, J.-L.; Bandler, S.; Barbera, M.; Barcons, X.; Barthelmy, S.; Basa, S.; Basso, S.; de Boer, M.; Branchini, E.; Branduardi-Raymont, G.; Borgani, S.; Boyarsky, A.; Brunetti, G.; Budtz-Jorgensen, C.; Burrows, D.; Butler, N.; Campana, S.; Caroli, E.; Ceballos, M.; Christensen, F.; Churazov, E.; Comastri, A.; Colasanti, L.; Cole, R.; Content, R.; Corsi, A.; Costantini, E.; Conconi, P.; Cusumano, G.; de Plaa, J.; De Rosa, A.; Del Santo, M.; Di Cosimo, S.; De Pasquale, M.; Doriese, R.; Ettori, S.; Evans, P.; Ezoe, Y.; Ferrari, L.; Finger, H.; Figueroa-Feliciano, T.; Friedrich, P.; Fujimoto, R.; Furuzawa, A.; Fynbo, J.; Gatti, F.; Galeazzi, M.; Gehrels, N.; Gendre, B.; Ghirlanda, G.; Ghisellini, G.; Gilfanov, M.; Giommi, P.; Girardi, M.; Grindlay, J.; Cocchi, M.; Godet, O.; Guedel, M.; Haardt, F.; Hartog, R.; Hepburn, I.; Hermsen, W.; Hjorth, J.; Hoekstra, H.; Holland, A.; Hornstrup, A.; van der Horst, A.; Hoshino, A.; in 't Zand, J.; Irwin, K.; Ishisaki, Y.; Jonker, P.; Kitayama, T.; Kawahara, H.; Kawai, N.; Kelley, R.; Kilbourne, C.; de Korte, P.; Kusenko, A.; Kuvvetli, I.; Labanti, M.; Macculi, C.; Maiolino, R.; Mas Hesse, M.; Matsushita, K.; Mazzotta, P.; McCammon, D.; Méndez, M.; Mignani, R.; Mineo, T.; Mitsuda, K.; Mushotzky, R.; Molendi, S.; Moscardini, L.; Natalucci, L.; Nicastro, F.; O'Brien, P.; Osborne, J.; Paerels, F.; Page, M.; Paltani, S.; Pedersen, K.; Perinati, E.; Ponman, T.; Pointecouteau, E.; Predehl, P.; Porter, S.; Rasmussen, A.; Rauw, G.; Röttgering, H.; Roncarelli, M.; Rosati, P.; Quadrini, E.; Ruchayskiy, O.; Salvaterra, R.; Sasaki, S.; Sato, K.; Savaglio, S.; Schaye, J.; Sciortino, S.; Shaposhnikov, M.; Sharples, R.; Shinozaki, K.; Spiga, D.; Sunyaev, R.; Suto, Y.; Takei, Y.; Tanvir, N.; Tashiro, M.; Tamura, T.; Tawara, Y.; Troja, E.; Tsujimoto, M.; Tsuru, T.; Ubertini, P.; Ullom, J.; Ursino, E.; Verbunt, F.; van de Voort, F.; Viel, M.; Wachter, S.; Watson, D.; Weisskopf, M.; Werner, N.; White, N.; Willingale, R.; Wijers, R.; Yamasaki, N.; Yoshikawa, K.; Zane, S.

2012-01-01

ORIGIN is a proposal for the M3 mission call of ESA aimed at the study of metal creation from the epoch of cosmic dawn. Using high-spectral resolution in the soft X-ray band, ORIGIN will be able to identify the physical conditions of all abundant elements between C and Ni to red-shifts of z = 10,

ORIGIN : Metal creation and evolution from the cosmic dawn

NARCIS (Netherlands)

den Herder, Jan-Willem; Piro, Luigi; Ohashi, Takaya; Kouveliotou, Chryssa; Hartmann, Dieter H.; Kaastra, Jelle S.; Amati, L.; Andersen, M. I.; Arnaud, M.; Attéia, J.-L.; Bandler, S.; Barbera, M.; Barcons, X.; Barthelmy, S.; Basa, S.; Basso, S.; Boer, M.; Branchini, E.; Branduardi-Raymont, G.; Borgani, S.; Boyarsky, A.; Brunetti, G.; Budtz-Jorgensen, C.; Burrows, D.; Butler, N.; Campana, S.; Caroli, E.; Ceballos, M.; Christensen, F.; Churazov, E.; Comastri, A.; Colasanti, L.; Cole, R.; Content, R.; Corsi, A.; Costantini, E.; Conconi, P.; Cusumano, G.; de Plaa, J.; De Rosa, A.; Del Santo, M.; Di Cosimo, S.; De Pasquale, M.; Doriese, R.; Ettori, S.; Evans, P.; Ezoe, Y.; Ferrari, L.; Finger, H.; Figueroa-Feliciano, T.; Friedrich, P.; Fujimoto, R.; Furuzawa, A.; Fynbo, J.; Gatti, F.; Galeazzi, M.; Gehrels, N.; Gendre, B.; Ghirlanda, G.; Ghisellini, G.; Gilfanov, M.; Giommi, P.; Girardi, M.; Grindlay, J.; Cocchi, M.; Godet, O.; Guedel, M.; Haardt, F.; den Hartog, R.; Hepburn, I.; Hermsen, W.; Hjorth, J.; Hoekstra, H.; Holland, A.; Hornstrup, A.; van der Horst, A.; Hoshino, A.; in't Zand, J.; Irwin, K.; Ishisaki, Y.; Jonker, P.; Kitayama, T.; Kawahara, H.; Kawai, N.; Kelley, R.; Kilbourne, C.; de Korte, P.; Kusenko, A.; Kuvvetli, I.; Labanti, M.; Macculi, C.; Maiolino, R.; Hesse, M. Mas; Matsushita, K.; Mazzotta, P.; McCammon, D.; Méndez, M.; Mignani, R.; Mineo, T.; Mitsuda, K.; Mushotzky, R.; Molendi, S.; Moscardini, L.; Natalucci, L.; Nicastro, F.; O'Brien, P.; Osborne, J.; Paerels, F.; Page, M.; Paltani, S.; Pedersen, K.; Perinati, E.; Ponman, T.; Pointecouteau, E.; Predehl, P.; Porter, S.; Rasmussen, A.; Rauw, G.; Röttgering, H.; Roncarelli, M.; Rosati, P.; Quadrini, E.; Ruchayskiy, O.; Salvaterra, R.; Sasaki, S.; Sato, K.; Savaglio, S.; Schaye, J.; Sciortino, S.; Shaposhnikov, M.; Sharples, R.; Shinozaki, K.; Spiga, D.; Sunyaev, R.; Suto, Y.; Takei, Y.; Tanvir, N.; Tashiro, M.; Tamura, T.; Tawara, Y.; Troja, E.; Tsujimoto, M.; Tsuru, T.; Ubertini, P.; Ullom, J.; Ursino, E.; Verbunt, F.; van de Voort, F.; Viel, M.; Wachter, S.; Watson, D.; Weisskopf, M.; Werner, N.; White, N.; Willingale, R.; Wijers, R.; Yamasaki, N.; Yoshikawa, K.; Zane, S.

2012-01-01

ORIGIN is a proposal for the M3 mission call of ESA aimed at the study of metal creation from the epoch of cosmic dawn. Using high-spectral resolution in the soft X-ray band, ORIGIN will be able to identify the physical conditions of all abundant elements between C and Ni to red-shifts of z = 10,

Chemical Mixing Model and K-Th-Ti Systematics and HED Meteorites for the Dawn Mission

Science.gov (United States)

Usui, T.; McSween, H. Y., Jr.; Mittlefehldt, D. W.; Prettyman, T. H.

2009-01-01

The Dawn mission will explore 4 Vesta, a large differentiated asteroid believed to be the parent body of the howardite, eucrite and diogenite (HED) meteorite suite. The Dawn spacecraft carries a gamma-ray and neutron detector (GRaND), which will measure the abundances of selected elements on the surface of Vesta. This study provides ways to leverage the large geochemical database on HED meteorites as a tool for interpreting chemical analyses by GRaND of mapped units on the surface of Vesta.

SEQUOIA Institute: A multidisciplinary private service for the care of senior citizens L’Institut SEQUOIA : Un service privé multidisciplinaire pour les soins des personnes du troisième âge Instituto SEQUOIA : Un servicio privado y multidisciplinario de atención a las personas de la tercera edad

Directory of Open Access Journals (Sweden)

Anelise Fonseca

2011-10-01

Full Text Available Population aging is a reality all over the world, requiring a change in the way care is perceived and resources are divided for different age groups. In Brazil, current indicators and projections place the country among those with the highest number of elderly people. By contrast, there is a shortage of action plans and inter- and multi-disciplinary teams, as well as public policies and professionals, focusing on the elderly, in part as a consequence of an accelerated aging process in developing countries. Within this context, the SEQUOIA Institute (IS was created to attend to this process by monitoring the overall health of patients. The institute's routine work includes clinical actions, team meetings, socialization projects and lectures. The IS features a 10% yearly growth in medical assistance, a 20% rise in psychological treatments, and a 50% increase in lecture attendance.Le vieillissement de la population est un phénomène mondial qui exige de revoir la façon dont sont perçus les soins et dont sont divisées les ressources en fonction des différentes tranches d’âge. Les indicateurs et les projections actuels montrent que le Brésil est le pays qui compte la plus grande proportion de personnes âgées. Et pourtant, les plans d’action, les équipes inter- et pluridisciplinaires, mais aussi les politiques publiques et les professionnels spécialistes des questions liées aux personnes âgées sont en nombre insuffisant, notamment en raison d’un processus de vieillissement accéléré dans les pays en développement. C’est dans ce contexte qu’a été créé l’Institut SEQUOIA (IS, dont la mission consiste à gérer ce processus en effectuant un suivi de la santé générale des patients. Les principales tâches de l’institut incluent études cliniques, réunions d’équipes, projets impliquant des débats et conférences. L’IS affiche une croissance annuelle de 10 % dans le secteur de l’assistance médicale, de 20

Modeling mountain pine beetle habitat suitability within Sequoia National Park

Science.gov (United States)

Nguyen, Andrew

Understanding significant changes in climate and their effects on timber resources can help forest managers make better decisions regarding the preservation of natural resources and land management. These changes may to alter natural ecosystems dependent on historical and current climate conditions. Increasing mountain pine beetle (MBP) outbreaks within the southern Sierra Nevada are the result of these alterations. This study better understands MPB behavior within Sequoia National Park (SNP) and model its current and future habitat distribution. Variables contributing to MPB spread are vegetation stress, soil moisture, temperature, precipitation, disturbance, and presence of Ponderosa (Pinus ponderosa) and Lodgepole (Pinus contorta) pine trees. These variables were obtained using various modeled, insitu, and remotely sensed sources. The generalized additive model (GAM) was used to calculate the statistical significance of each variable contributing to MPB spread and also created maps identifying habitat suitability. Results indicate vegetation stress and forest disturbance to be variables most indicative of MPB spread. Additionally, the model was able to detect habitat suitability of MPB with a 45% accuracy concluding that a geospatial driven modeling approach can be used to delineate potential MPB spread within SNP.

Exploring Vesta's Surface Roughness and Dielectric Properties Using VIR Spectrometer and Bistatic Radar Observations by the Dawn Mission

Science.gov (United States)

Palmer, E. M.; Heggy, E.; Capria, M. T.; Tosi, F.; Kofman, W. W.; Russell, C. T.

2014-12-01

Multiple lines of evidence from NASA's Dawn mission suggest transient volatile presence at the surface of asteroid Vesta. Radar remote sensing is a useful technique for the investigation of volatile content at the surface and shallow subsurface, but requires the use of accurate dielectric and topographic models in order to deconvolve the effect of surface roughness from the total observed radar backscatter. Toward this end, we construct a dielectric model for the dry, volatile-poor case of Vesta's surface to represent average surface conditions, and to assess the expected average range of dielectric properties due to known variations in mineralogy, temperature, and density as inferred from Dawn VIR data. We employ dielectric studies of lunar samples to serve as a suitable analog to the Vestan regolith, and in the case of 10-wavelength penetration depth of X-band frequency radar observations, our model yields ɛ' from 2.5 to 2.6 from the night to dayside of Vesta, and tan δ from 0.011 to 0.014. Our estimation of ɛ' corresponds to specular surface reflectivity of ~0.05. In addition to modeling, we have also conducted an opportunistic bistatic radar (BSR) experiment at Vesta using the communications antennas aboard Dawn and on Earth. In this configuration, Dawn transmits a continuous radar signal toward the Earth while orbiting Vesta. As the Dawn spacecraft passes behind Vesta (entering an occultation), the line of sight between Dawn and Earth intersects Vesta's surface, resulting in a reflection of radar waves from the surface and shallow subsurface, which are then received on Earth for analysis. The geometry of the Dawn BSR experiment results in high incidence angles on Vesta's surface, and leads to a differential Doppler shift of only a few 10s of Hz between the direct signal and the surface echo. As a consequence, this introduces ambiguity in the measurement of bandwidth and peak power of each surface echo. We report our interpretations of each surface echo in

A new dawn for plant mitochondrial NAD(P)H dehydrogenases

DEFF Research Database (Denmark)

Møller, I.M.

2002-01-01

The expression of complex I and two homologues of bacterial and yeast NADH dehydrogenases, NDA and NDB, have been studied in potato leaf mitochondria. The mRNA level of NDA is completely light dependent and shows a diurnal rhythm with a sharp maximum just after dawn. NDA protein quantity and inte...

The dawn of freudism

Directory of Open Access Journals (Sweden)

Renato Barilli

2013-02-01

Full Text Available The author is a follower of the so called cultural materialism, which invites us to put the incoming of a new technology at the origin of each cultural age. A big rupture  arrived at the end of the 18th century, when scientists (as Galvani and Volta realized the first discoveries concerning electromagnetism. Such discoveries led to establish that matter is mainly energy, so opening a path which had to reach  the audacious conclusions due to Einstein’s relativism. But at the same time some writers and visual artists (Blake, Goethe, Alfieri, Foscolo, Leopardi discovered that a corresponding energy exists also into each of us. By this way they anticipated on a psychological level the intuitions  which should come from  Freud and his psychoanalisis. So we may conclude that at the end of i8th century there was a kind  of dawn both of technetronic era  and  of psychoanalysis.

The highest-ranking rooster has priority to announce the break of dawn.

Science.gov (United States)

Shimmura, Tsuyoshi; Ohashi, Shosei; Yoshimura, Takashi

2015-07-23

The "cock-a-doodle-doo" crowing of roosters, which symbolizes the break of dawn in many cultures, is controlled by the circadian clock. When one rooster announces the break of dawn, others in the vicinity immediately follow. Chickens are highly social animals, and they develop a linear and fixed hierarchy in small groups. We found that when chickens were housed in small groups, the top-ranking rooster determined the timing of predawn crowing. Specifically, the top-ranking rooster always started to crow first, followed by its subordinates, in descending order of social rank. When the top-ranking rooster was physically removed from a group, the second-ranking rooster initiated crowing. The presence of a dominant rooster significantly reduced the number of predawn crows in subordinates. However, the number of crows induced by external stimuli was independent of social rank, confirming that subordinates have the ability to crow. Although the timing of subordinates' predawn crowing was strongly dependent on that of the top-ranking rooster, free-running periods of body temperature rhythms differed among individuals, and crowing rhythm did not entrain to a crowing sound stimulus. These results indicate that in a group situation, the top-ranking rooster has priority to announce the break of dawn, and that subordinate roosters are patient enough to wait for the top-ranking rooster's first crow every morning and thus compromise their circadian clock for social reasons.

Nature of the "Orange" Material on Vesta From Dawn

Science.gov (United States)

LeCorre, L.; Reddy, V.; Schmedemann, N.; Becker, K. J.; OBrien, D. P.; Yamashita, N.; Peplowski, P. N.; Prettyman, T. H.; Li, J.-Y.; Coultis, E. A.;

Zero to Integration in Eight Months, the Dawn Ground Data System Engineering Challange

Science.gov (United States)

Dubon, Lydia P.

2006-01-01

The Dawn Project has presented the Ground Data System (GDS) with technical challenges driven by cost and schedule constraints commonly associated with National Aeronautics and Space Administration (NASA) Discovery Projects. The Dawn mission consists of a new and exciting Deep Space partnership among: the Jet Propulsion Laboratory (JPL), responsible for project management and flight operations; Orbital Sciences Corporation (OSC), spacecraft builder and responsible for flight system test and integration; and the University of California, at Los Angeles (UCLA), responsible for science planning and operations. As a cost-capped mission, one of Dawn s implementation strategies is to leverage from both flight and ground heritage. OSC's ground data system is used for flight system test and integration as part of the flight heritage strategy. Mission operations, however, are to be conducted with JPL s ground system. The system engineering challenge of dealing with two heterogeneous ground systems emerged immediately. During the first technical interchange meeting between the JPL s GDS Team and OSC's Flight Software Team, August 2003, the need to integrate the ground system with the flight software was brought to the table. This need was driven by the project s commitment to enable instrument engineering model integration in a spacecraft simulator environment, for both demonstration and risk mitigation purposes, by April 2004. This paper will describe the system engineering approach that was undertaken by JPL's GDS Team in order to meet the technical challenge within a non-negotiable eight-month schedule. Key to the success was adherence to an overall systems engineering process and fundamental systems engineering practices: decomposition of the project request into manageable requirements; definition of a structured yet flexible development process; integration of multiple ground disciplines and experts into a focused team effort; in-process risk management; and aggregation

Light pollution alters the phenology of dawn and dusk singing in common European songbirds.

Science.gov (United States)

Da Silva, Arnaud; Valcu, Mihai; Kempenaers, Bart

2015-05-05

Artificial night lighting is expanding globally, but its ecological consequences remain little understood. Animals often use changes in day length as a cue to time seasonal behaviour. Artificial night lighting may influence the perception of day length, and may thus affect both circadian and circannual rhythms. Over a 3.5 month period, from winter to breeding, we recorded daily singing activity of six common songbird species in 12 woodland sites, half of which were affected by street lighting. We previously reported on analyses suggesting that artificial night lighting affects the daily timing of singing in five species. The main aim of this study was to investigate whether the presence of artificial night lighting is also associated with the seasonal occurrence of dawn and dusk singing. We found that in four species dawn and dusk singing developed earlier in the year at sites exposed to light pollution. We also examined the effects of weather conditions and found that rain and low temperatures negatively affected the occurrence of dawn and dusk singing. Our results support the hypothesis that artificial night lighting alters natural seasonal rhythms, independently of other effects of urbanization. The fitness consequences of the observed changes in seasonal timing of behaviour remain unknown.

Use of Cumulative Degradation Factor Prediction and Life Test Result of the Thruster Gimbal Assembly Actuator for the Dawn Flight Project

Science.gov (United States)

Lo, C. John; Brophy, John R.; Etters, M. Andy; Ramesham, Rajeshuni; Jones, William R., Jr.; Jansen, Mark J.

2009-01-01

The Dawn Ion Propulsion System is the ninth project in NASA s Discovery Program. The Dawn spacecraft is being developed to enable the scientific investigation of the two heaviest main-belt asteroids, Vesta and Ceres. Dawn is the first mission to orbit two extraterrestrial bodies, and the first to orbit a main-belt asteroid. The mission is enabled by the onboard Ion Propulsion System (IPS) to provide the post-launch delta-V. The three Ion Engines of the IPS are mounted on Thruster Gimbal Assembly (TGA), with only one engine operating at a time for this 10-year mission. The three TGAs weigh 14.6 kg.

The dawn of gravitational wave astronomy

CERN Multimedia

CERN. Geneva

2016-01-01

On Sep 14 2015, gravitational waves were for the first time detected directly. This observation by the LIGO interferometric detectors marks the dawn of a new era in our observational study of the cosmos as a qualitatively new window to its exploration has been opened. This talk reviews some of the fundamental concepts of gravitational waves and the methodology employed for their observation. The first event, dubbed GW150914, and the properties of its source, as inferred from the observation, will be discussed. The talk concludes with a selected set of the most important topics where we expect gravitational-wave observations to deepen and either challenge or confirm our present understanding of the laws and the history of our universe.

Dawn- Dusk Auroral Oval Oscillations Associated with High- Speed Solar Wind

Science.gov (United States)

Liou, Kan; Sibeck, David G.

2018-01-01

We report evidence of global-scale auroral oval oscillations in the millihertz range, using global auroral images acquired from the Ultraviolet Imager on board the decommissioned Polar satellite and concurrent solar wind measurements. On the basis of two events (15 January 1999 and 6 January 2000) studied, it is found that (1) quasi-periodic auroral oval oscillations (approximately 3 megahertz) can occur when solar wind speeds are high at northward or southward interplanetary magnetic field turning, (2) the oscillation amplitudes range from a few to more than 10 degrees in latitudes, (3) the oscillation frequency is the same for each event irrespective of local time and without any azimuthal phase shift (i.e., propagation), (4) the auroral oscillations occur in phase within both the dawn and dusk sectors but 180 degrees out of phase between the dawn and dusk sectors, and (5) no micropulsations on the ground match the auroral oscillation periods. While solar wind conditions favor the growth of the Kelvin-Helmholtz (K-H) instability on the magnetopause as often suggested, the observed wave characteristics are not consistent with predictions for K-H waves. The in-phase and out-of-phase features found in the dawn-dusk auroral oval oscillations suggest that wiggling motions of the magnetotail associated with fast solar winds might be the direct cause of the global-scale millihertz auroral oval oscillations. Plain Language Summary: We utilize global auroral image data to infer the motion of the magnetosphere and show, for the first time, the entire magnetospheric tail can move east-west in harmony like a windsock flapping in wind. The characteristic period of the flapping motion may be a major source of global long-period ULF (Ultra Low Frequency) waves, adding an extra source of the global mode ULF waves.

In-Flight Operation of the Dawn Ion Propulsion System: Status at One Year from the Vesta Rendezvous

Science.gov (United States)

Garner, Charles E.; Rayman, Marc D.

2010-01-01

The Dawn mission, part of NASA's Discovery Program, has as its goal the scientific exploration of the two most massive main-belt asteroids, Vesta and Ceres. The Dawn spacecraft was launched from Cape Canaveral Air Force Station on September 27, 2007 on a Delta-II 7925H-9.5 (Delta-II Heavy) rocket that placed the 1218 kg spacecraft into an Earth-escape trajectory. On-board the spacecraft is an ion propulsion system (IPS) developed at the Jet Propulsion Laboratory which will provide most of the delta V needed for heliocentric transfer to Vesta, orbit capture at Vesta, transfer among Vesta science orbits, departure and escape from Vesta, heliocentric transfer to Ceres, orbit capture at Ceres, and transfer among Ceres science orbits. The Dawn ion thruster [I thought we only called it a thruster. Both terms are used in the paper, but I think a replacement of every occurrence of "engine" with "thruster" would be clearer.] design is based on the design validated on NASA's Deep Space 1 (DS1) mission. However, because of the very substantial (11 km/s) delta V requirements for this mission Dawn requires two engines to complete its mission objectives. The power processor units (PPU), digital control and interface units (DCIU) slice boards and the xenon control assembly (XCA) are derivatives of the components used on DS1. The DCIUs and thrust gimbal assemblies (TGA) were developed at the Jet Propulsion Laboratory. The spacecraft was provided by Orbital Sciences Corporation, Sterling, Virginia, and the mission is managed by and operated from the Jet Propulsion Laboratory. Dawn partnered with Germany, Italy and Los Alamos National Laboratory for the science instruments. The mission is led by the principal investigator, Dr. Christopher Russell, from the University of California, Los Angeles. The first 80 days after launch were dedicated to the initial checkout of the spacecraft followed by cruise to Mars. Cruise thrusting leading to a Mars gravity assist began on December 17

Preliminary Results from Initial Investigations of Ceres' Cratering Record from Dawn Imaging Data

Science.gov (United States)

Schmedemann, Nico; Michael, Gregory; Ivanov, Boris A.; Kneissl, Thomas; Neesemann, Adrian; Hiesinger, Harald; Jaumann, Ralf; Raymond, Carol A.; Russell, Christopher T.

2015-04-01

The highly successful Dawn mission [1] finished data collection at Vesta in 2012 and is now on its way to the dwarf planet Ceres. According to the current Ceres approach timeline of the Dawn mission, the ground resolution of the Dawn FC camera [2] will be about 10 times better than Hubble data [3] at the time of the presentation of this work. This may allow for identification of craters about 15 km in diameter. Initial mapping of sample areas may provide enough information of the cratering record in order to compare it with the theoretical Ceres crater production function we present at the 46th LPSC conference (March 16-20, 2015, The Woodlands, Texas) [4]. Our preliminary crater production function for Ceres is derived from the assumption of an icy crust just below a thin surface layer of dust [5], and a projectile population that is very similar to the one that impacted the Moon [6]. In order to scale the lunar cratering record to Ceres we use the Ivanov scaling laws [7], which allow for crater scaling based on parameters that can be derived from observations. The lunar-like approach gave reasonable good results for the crater production function on the asteroids Vesta, Ida, Lutetia and Gaspra [8]. Since the lunar surface is of basaltic composition, the correct scaling between the different materials is challenging. One crucial parameter is the transition diameter from simple to complex craters. Based on the simple to complex transition diameter on Iapetus, an icy satellite of Saturn, we expect this transition at about 12 km crater size at Ceres. This value may be slightly different due to the different temperatures at Ceres and Iapetus. If the simple to complex transition is observed at much larger diameters, the reason could be a substantial fraction of rock in the shallow subsurface of Ceres. In an ice-rich surface material high relaxation rates may also be expected that could change the shape of the crater production function. A thorough geological mapping

Cultural Appropriation in Games : A Comparative Study Between Far Cry 3 (2012), Overwatch (2016) and Horizon Zero Dawn (2017)

OpenAIRE

Svensson, Tova

2017-01-01

This thesis is a comparative study between Far Cry 3 (2012), Overwatch (2016) and Horizon Zero Dawn (2017) to determine how game developers appropriate minority cultures in character design. The character designs are compared to the cultures of origin to determine whether they have been appropriated and to what extent. Far Cry 3 appropriates Maori and Samoan cultures, Horizon Zero Dawn appropriates native American cultures, and Overwatch appropriates both Maori and native American cultures. A...

Impacts of fire management on aboveground tree carbon stocks in Yosemite and Sequoia & Kings Canyon National Parks

Science.gov (United States)

Matchett, John R.; Lutz, James A.; Tarnay, Leland W.; Smith, Douglas G.; Becker, Kendall M.L.; Brooks, Matthew L.

2015-01-01

Forest biomass on Sierra Nevada landscapes constitutes one of the largest carbon stocks in California, and its stability is tightly linked to the factors driving fire regimes. Research suggests that fire suppression, logging, climate change, and present management practices in Sierra Nevada forests have altered historic patterns of landscape carbon storage, and over a century of fire suppression and the resulting accumulation in surface fuels have been implicated in contributing to recent increases in high severity, stand-replacing fires. For over 30 years, fire management at Yosemite (YOSE) and Sequoia & Kings Canyon (SEKI) national parks has led the nation in restoring fire to park landscapes; however, the impacts on the stability and magnitude of carbon stocks have not been thoroughly examined.

First observations of Ceres by VIR on Dawn mission

Science.gov (United States)

De Sanctis, M. Cristina; Ammannito, Eleonora; Fonte, Sergio; Magni, Gianfranco; Capaccioni, Fabrizio; Capria, M. Teresa; Raymond, Carol. A.; Russell, Christopher T.

2015-04-01

The Dawn spacecraft [1] is now approaching Ceres, the second of its targets. Ceres represents the key to understand some important points relative to the role of the protoplanet size and the water content in the evolution of these bodies. Ceres is thought to be differentiated, and hydrated minerals were proposed to exist on its surface [2,3,4]. Its low density [3] associated with the presence of transient water vapour, suggests a high content of ice inside the body and on its surface. Ceres seems to have been subject to differentiation and hydrothermal activity, and might host a liquid subsurface layer even today. Dawn is equipped with a Visible and InfraRed Mapping Spectrometer (VIR-MS) [5]. VIR-MS is an imaging spectrometer coupling high spectral and spatial resolution in the VIS (0.25-1 micron) and IR (0.95-5 micron) spectral ranges. The surface composition of Ceres is poorly understood through its nearly featureless visible spectrum. Its visible reflectance spectrum has a steep UV absorption edge that begins at a relatively short wavelength, around 0.4 micron, unlike many C-type asteroids where the UV drop-off begins around 0.6 to 0.7 micron[6]. The near-IR spectrum has a strong absorption band centered at about 3-micron. The absorption features in the 3-micron region were attributed to structural water in clay minerals [7,8] but could also be ammoniated clays [9]. [10] reported the discovery of carbonates and iron-rich clays from measurements of weak 3-micron features, and the results are consistent with the mid-IR spectra of clay minerals. On approach to Ceres, Dawn will obtain images and hyperspectral . VIR data, with resolution larger than Hubble images will reveal the first details of the Ceres' surface composition. Here we report about the first data obtained by VIR during its approach to Ceres. Acknowledgments VIR is funded by the Italian Space Agency-ASI and was developed under the leadership of INAF-Istituto di Astrofisica e Planetologia Spaziali, Rome

The Square Kilometre Array Epoch of Reionisation and Cosmic Dawn Experiment

Science.gov (United States)

Trott, Cathryn M.

2018-05-01

The Square Kilometre Array (SKA) Epoch of Reionisation and Cosmic Dawn (EoR/CD) experiments aim to explore the growth of structure and production of ionising radiation in the first billion years of the Universe. Here I describe the experiments planned for the future low-frequency components of the Observatory, and work underway to define, design and execute these programs.

A radar study of emigratory flight and layer formation by insects at dawn over southern Britain.

Science.gov (United States)

Reynolds, D R; Smith, A D; Chapman, J W

2008-02-01

Radar observations have consistently shown that high-altitude migratory flight in insects generally occurs after mass take-off at dusk or after take-off over a more extended period during the day (in association with the growth of atmospheric convection). In this paper, we focus on a less-studied third category of emigration - the 'dawn take-off' - as recorded by insect-monitoring radars during the summer months in southern England. In particular, we describe occasions when dawn emigrants formed notable layer concentrations centred at altitudes ranging from ca. 240 m to 700 m above ground, very probably due to the insects responding to local temperature maxima in the atmosphere, such as the tops of inversions. After persisting for several hours through the early morning, the layers eventually merged into the insect activity building up later in the morning (from 06.00-08.00 h onwards) in conjunction with the development of daytime convection. The species forming the dawn layers have not been positively identified, but their masses lay predominantly in the 16-32 mg range, and they evidently formed a fauna quite distinct from that in flight during the previous night. The displacement and common orientation (mutual alignment) characteristics of the migrants are described.

The location of the open-closed magnetic field line boundary in the dawn sector auroral ionosphere

Directory of Open Access Journals (Sweden)

J. A. Wild

2004-11-01

Full Text Available As a measure of the degree of coupling between the solar wind-magnetosphere-ionosphere systems, the rate at which the size of the polar cap (the region corresponding to ionospheric termini of open magnetic flux tubes varies is of prime importance. However, a reliable technique by which the extent of the polar cap might be routinely monitored has yet to be developed. Current techniques provide particularly ambiguous indications of the polar cap boundary in the dawn sector. We present a case study of space- and ground-based observations of the dawn-sector auroral zone and attempt to determine the location of the polar cap boundary using multi-wavelength observations of the ultraviolet aurora (made by the IMAGE FUV imager, precipitating particle measurements (recorded by the FAST, DMSP, and Cluster 1 and 3 satellites, and SuperDARN HF radar observations of the ionospheric Doppler spectral width boundary. We conclude that in the dawn sector, during the interval presented, neither the poleward edge of the wideband auroral UV emission (140-180nm nor the Doppler spectral width boundary were trustworthy indicators of the polar cap boundary location, while narrow band UV emissions in the range 130-140nm appear to be much more reliable.

Measurements of the global 21-cm signal from the Cosmic Dawn

Science.gov (United States)

Bernardi, Gianni

2018-05-01

The sky-averaged (global) 21-cm signal is a very promising probe of the Cosmic Dawn, when the first luminous sources were formed and started to shine in a substantially neutral intergalactic medium. I here report on the status and early result of the Large-Aperture Experiment to Detect the Dark Age that focuses on observations of the global 21-cm signal in the 16 <~ z <~ 30 range.

A simple model describing the nonlinear dynamics of the dusk/dawn asymmetry in the high-latitude thermospheric flow

Science.gov (United States)

Gundlach, J. P.; Larsen, M. F.; Mikkelsen, I. S.

1988-01-01

A simple nonlinear, axisymmetric, shallow-water numerical model has been used to study the asymmetry in the neutral flow between the dusk and dawn sides of the auroral oval. The results indicate that the Coriolis force and the curvature terms are nearly in balance on the evening side and require only a small pressure gradient to effect adjustment. The result is smaller neutral velocities near dawn and larger velocities near dusk than would be the case for a linearized treatment. A consequence is that more gravity wave energy is produced on the morning side than on the evening side.

The loss of essential oil components induced by the Purge Time in the Pressurized Liquid Extraction (PLE) procedure of Cupressus sempervirens.

Science.gov (United States)

Dawidowicz, Andrzej L; Czapczyńska, Natalia B; Wianowska, Dorota

2012-05-30

The influence of different Purge Times on the effectiveness of Pressurized Liquid Extraction (PLE) of volatile oil components from cypress plant matrix (Cupressus sempervirens) was investigated, applying solvents of diverse extraction efficiencies. The obtained results show the decrease of the mass yields of essential oil components as a result of increased Purge Time. The loss of extracted components depends on the extrahent type - the greatest mass yield loss occurred in the case of non-polar solvents, whereas the smallest was found in polar extracts. Comparisons of the PLE method with Sea Sand Disruption Method (SSDM), Matrix Solid-Phase Dispersion Method (MSPD) and Steam Distillation (SD) were performed to assess the method's accuracy. Independent of the solvent and Purge Time applied in the PLE process, the total mass yield was lower than the one obtained for simple, short and relatively cheap low-temperature matrix disruption procedures - MSPD and SSDM. Thus, in the case of volatile oils analysis, the application of these methods is advisable. Copyright © 2012 Elsevier B.V. All rights reserved.

Mersin-Aydıncık İlçesi Anıt Dallı Servileri (Cupressus sempervirens L. var. horizontalis (Mill. Gord.

Directory of Open Access Journals (Sweden)

R. ÖZÇELİK

2009-04-01

Full Text Available Ülkemizde bugüne kadar bir çok anıt ağaç ve meşcerenin tespiti yapılmıştır. Bu çalışmada, Mersin ili Aydıncık İlçesindeki; çap, boy, yaş, tepe çapı (somut özellikler ve Mistik özellikleri (soyut özellikler nedeniyle anıt ağaç niteliği taşıyan iki adet Dallı Servi (Cupresus sempervirens L. var. horizontalis (Mill. Gord. tanıtılmıştır. Bu iki ağaç, şimdiye kadar anıt ağaç olarak tescili yapılmış en uzun boylu servi bireyleridir. Bu nedenle; doğal, kültürel ve estetik değere sahip bu doğal varlıkların korunması gerekmektedir.

Effects of artificial dawn on sleep inertia, skin temperature, and the awakening cortisol response

NARCIS (Netherlands)

van de Werken, Maan; Gimenez, Marina C.; de Vries, Bonnie; Beersma, Domien G. M.; van Someren, Eus J. W.; Gordijn, Marijke C. M.

P>The effect of artificial dawn during the last 30 min of sleep on subsequent dissipation of sleep inertia was investigated, including possible involvement of cortisol and thermoregulatory processes. Sixteen healthy subjects who reported difficulty with waking up participated in random order in a

Vesta and Ceres as Seen by Dawn

Science.gov (United States)

Russell, C. T.; Nathues, A.; De Sanctis, M. C.; Prettyman, T. H.; Konopliv, A. S.; Park, R. S.; Jaumann, R.; McSween, H. Y., Jr.; Raymond, C. A.; Pieters, C. M.; McCord, T. B.; Marchi, S.; Schenk, P.; Buczkowski, D.

2015-12-01

Ceres and Vesta are the most massive bodies in the main asteroid belt. They have witnessed 4.6 Ga of solar system history. Dawn's objective is to interview these two witnesses. These bodies are relatively simple protoplanets, with a modest amount of thermal evolution and geochemical alteration. They are our best archetypes of the early building blocks of the terrestrial planets. In particular siderophile elements in the Earth's core were probably first segregated in Vesta-like bodies, and its water was likely first condensed in Ceres-like bodies. Vesta has provided copious meteorites for geochemical analysis. This knowledge was used to infer the constitution of the parent body. Dawn verified that Vesta was consistent with being that body, confirming the geochemical inferences from these samples on the formation and evolution of the solar system. Ceres has not revealed itself with a meteoritic record nor an asteroid family. While the surface is scarred with craters, it is probable that the ejecta from the crater-forming events created little competent material from the icy crust and any such ejected material that reached Earth might have disintegrated upon entry into the Earth's atmosphere. Ceres' surface differs greatly from Vesta's. Plastic or fluidized mass wasting is apparent as are many irregularly shaped craters, including many polygonal crater forms. There are many central-pit craters possibly caused by volatilization of the crust in the center of the impact. There are many central-peak craters but are these due to rebound or pingo-like formation processes? Bright spots, possibly salt deposits, dot the landscape, evidence of fluvial processes beneath the crust. Observations of the largest region of bright spots may suggest sublimation from the surface of the bright area, consistent with Herschel water vapor observations. Ceres is not only the most massive body in the asteroid belt but also possibly the most active occupant of the main belt.

Ceres Photometry and Albedo from Dawn Framing Camera Images

Science.gov (United States)

Schröder, S. E.; Mottola, S.; Keller, H. U.; Li, J.-Y.; Matz, K.-D.; Otto, K.; Roatsch, T.; Stephan, K.; Raymond, C. A.; Russell, C. T.

2015-10-01

The Dawn spacecraft is in orbit around dwarf planet Ceres. The onboard Framing Camera (FC) [1] is mapping the surface through a clear filter and 7 narrow-band filters at various observational geometries. Generally, Ceres' appearance in these images is affected by shadows and shading, effects which become stronger for larger solar phase angles, obscuring the intrinsic reflective properties of the surface. By means of photometric modeling we attempt to remove these effects and reconstruct the surface albedo over the full visible wavelength range. Knowledge of the albedo distribution will contribute to our understanding of the physical nature and composition of the surface.

A new DAWN: Improving the psychosocial management of diabetes

Directory of Open Access Journals (Sweden)

Richard I. G. Holt

2013-01-01

Full Text Available Aims: The second Diabetes Attitudes, Wishes and Needs (DAWN-2 study assessed psychosocial issues and health-care provision of people with diabetes, their family members and health-care professionals. Materials and Methods: Participants completed an online, telephone or in-person survey designed to assess health-related quality-of-life, self-management, attitudes/beliefs, social support and priorities for improving diabetes care as well as health-care provision and the impact of diabetes on family life. Results: A total of 8596 adults with diabetes, 2057 family members of people with diabetes and 4785 health-care professionals across 17 countries completed the survey. There were significant between country differences, but no one country′s outcomes were consistently better or worse than others. A high proportion of people with diabetes reported likely depression (13.8% and poor quality-of-life (12.2%. Diabetes had a negative impact on many aspects of life, including relationships with family/friends and physical health. A third of family members did not know how to help the person with diabetes, but wanted to be more involved in their care. Many health-care professionals indicated that major improvements were needed across a range of areas including health-care organization, resources for diabetes prevention, earlier diagnosis and treatment and psychological support. Conclusions: DAWN-2 is a multinational, multidisciplinary systematic study that compared unmet needs of people with diabetes and those who care for them in 17 countries across four continents. Its findings should facilitate innovative efforts to improve self-management and psychosocial support in diabetes, with the aim of reducing the burden of disease. The implications for India are discussed.

PHASE ANGLE EFFECTS ON 3 μm ABSORPTION BAND ON CERES: IMPLICATIONS FOR DAWN MISSION

Energy Technology Data Exchange (ETDEWEB)

Takir, D.; Reddy, V.; Sanchez, J. A.; Corre, L. Le [Planetary Science Institute, 1700 E Fort Lowell Road, Suite 106, Tucson, AZ 85719 (United States); Hardersen, P. S. [Department of Space Studies, University of North Dakota, Grand Forks, ND 58202 (United States); Nathues, A., E-mail: dtakir@psi.edu [Max-Planck-Institute for Solar System Research, Justus-von-Liebig-Weg 3, D-37077 Göttingen (Germany)

2015-05-01

Phase angle-induced spectral effects are important to characterize since they affect spectral band parameters such as band depth and band center, and therefore skew mineralogical interpretations of planetary bodies via reflectance spectroscopy. Dwarf planet (1) Ceres is the next target of NASA’s Dawn mission, which is expected to arrive in 2015 March. The visible and near-infrared mapping spectrometer (VIR) on board Dawn has the spatial and spectral range to characterize the surface between 0.25–5.0 μm. Ceres has an absorption feature at 3.0 μm due to hydroxyl- and/or water-bearing minerals. We analyzed phase angle-induced spectral effects on the 3 μm absorption band on Ceres using spectra measured with the long-wavelength cross-dispersed (LXD: 1.9–4.2 μm) mode of the SpeX spectrograph/imager at the NASA Infrared Telescope Facility. Ceres LXD spectra were measured at different phase angles ranging from 0.°7 to 22°. We found that the band center slightly increases from 3.06 μm at lower phase angles (0.°7 and 6°) to 3.07 μm at higher phase angles (11° and 22°), the band depth decreases by ∼20% from lower phase angles to higher phase angles, and the band area decreases by ∼25% from lower phase angles to higher phase angles. Our results will have implications for constraining the abundance of OH on the surface of Ceres from VIR spectral data, which will be acquired by Dawn starting spring 2015.

PHASE ANGLE EFFECTS ON 3 μm ABSORPTION BAND ON CERES: IMPLICATIONS FOR DAWN MISSION

International Nuclear Information System (INIS)

Takir, D.; Reddy, V.; Sanchez, J. A.; Corre, L. Le; Hardersen, P. S.; Nathues, A.

2015-01-01

Phase angle-induced spectral effects are important to characterize since they affect spectral band parameters such as band depth and band center, and therefore skew mineralogical interpretations of planetary bodies via reflectance spectroscopy. Dwarf planet (1) Ceres is the next target of NASA’s Dawn mission, which is expected to arrive in 2015 March. The visible and near-infrared mapping spectrometer (VIR) on board Dawn has the spatial and spectral range to characterize the surface between 0.25–5.0 μm. Ceres has an absorption feature at 3.0 μm due to hydroxyl- and/or water-bearing minerals. We analyzed phase angle-induced spectral effects on the 3 μm absorption band on Ceres using spectra measured with the long-wavelength cross-dispersed (LXD: 1.9–4.2 μm) mode of the SpeX spectrograph/imager at the NASA Infrared Telescope Facility. Ceres LXD spectra were measured at different phase angles ranging from 0.°7 to 22°. We found that the band center slightly increases from 3.06 μm at lower phase angles (0.°7 and 6°) to 3.07 μm at higher phase angles (11° and 22°), the band depth decreases by ∼20% from lower phase angles to higher phase angles, and the band area decreases by ∼25% from lower phase angles to higher phase angles. Our results will have implications for constraining the abundance of OH on the surface of Ceres from VIR spectral data, which will be acquired by Dawn starting spring 2015

Insights from the correlation of the preliminary Geologic and Mineralogic maps of Vesta from the Dawn mission data

Science.gov (United States)

Frigeri, A.; De Sanctis, M. C.; Ammannito, E.; Yingst, R. A.; Mest, S.; Garry, B.; Magni, G.; Palomba, E.; Petro, N.; Tosi, F.; Williams, D.; Zambon, F.; Jaumann, R.; Pieters, C. M.; Raymond, C. A.; Russell, C. T.

2012-04-01

The Dawn mission to Vesta has greatly improved the quality and resolution of data available to explore the asteroid. Prior to the Dawn mission the best data available was the one from Hubble Space Telescope with a maximum resolution of 50 km per pixel. The survey phase of the mission has pushed spatial resolution up to about 100 meters per pixel by the Framing Camera on-board Dawn, and 700 meters per pixel for the VIR spectrometer, spanning the spectral range from the visible to infrared at 0.25-1 μm and 1-5 μm. The frames of the FC and VIR have been processed and mosaicked. A preliminary Geologic map has been produced by mapping units and structures over the FC mosaic and the DTM derived from stereo processing of visible imagery. We will present some examples of correlation between the preliminary geologic and VIR-derived mineralogic maps. The Dawn mission team is using Geographic Information System tools for locating frames and for data exchange among the team. The use of GIS tools and data formats significantly improves our ability to create and interpret geologic maps, and also improves the interoperability of high level data products among the instruments' team. VIR data have been synthesized into a series of spectral indicators that give indications on the mineralogical composition and the physical state of the surface. We ingested in GIS the the preliminary geologic map as units and structures and we projected the mosaics of spectral indicators in a common coordinate reference system. The first spectral indicators we started to look at were the Band Depth computed on pyroxene Band II and the Band Center also computed on Band II. The comparison of the preliminary geologic map and the mosaics of spectral indicators extracted from VIR data show promising aspects on both the geologic and mineralogic aspects. Geologic units are made up of bodies of rock that are interpreted to have been formed by a particular process or set of related processes over a discrete

Attività sperimentale di agricoltura di precisione su vigneto Confronto tra i sensori Mapir Survey2 e Parrot Sequoia

Directory of Open Access Journals (Sweden)

Simone Kartsiotis

2018-01-01

Full Text Available This report presents a comparison via field-testing between Parrot Sequoia and Mapir Survey2 multispectral cameras. Both sensors are commonly used in precision farming activities conducted by micro-RPAS (drones, thanks to their small size and light weight. The experimental activity was performed in summer on the vineyards of the Savignola Paolina agricultural holding in Tuscany. The sensors were taken on board the EXOS drone, a hexacopter developed by Zephyr S.r.l. company and specifically designed for precision farming operations. Good and bad qualities for each cameras are examined by a comprehensive approach, starting from technical specifications and continuing with a comparison of the results obtained on field. All the activity was performed by a partnership between the companies DroneBee and Zephyr S.r.l. .

Ceres: Dawn visits a Warm Wet Planet

Science.gov (United States)

McCord, T. B.; Combe, J. P.

2014-12-01

Ceres likely contains considerable water, has differentiated, and formed a hydrated silicate core and water mantle. There were major dimensional, thermal and chemical changes over its history, making it more a planet than an asteroid. These factors created the present day body, which the Dawn misson will visit next March. I will summarize our current understanding of Ceres and suggest what Dawn will find. A major uncertainty is how processes, such as aqueous mineralization, impact and cratering, infall of external material, mixing, and viscous relaxation of surface features have altered the formation materials and surface, hiding Ceres' secrets. Ceres' bulk density of 2100 kg/m3, suggest major water content. Modeling of Ceres' thermodynamic evolution for different times of accretion, assuming several radioactive heating scenarios, produces results ranging from a dry Vestal-like object (earlier, hotter formation) to retention and melting of the ice and differentiation of silicates from liquid water. Mixing of liquid water and silicates leads to exothermic hydration reactions, formation of a core and a liquid mantle. Large dimensional changes are associated. A crust stays frozen but founders at times due to gravitational instability, dimensional changes and impacts. The liquid mantle freezes from top, down, but a layer of salty liquid water probably exists today near the core. Hydrated silicates from the initial differentiation would likely dehydrate near the core center due to temperature and pressure. From observations, only subdued spatial albedo and color variations are observed at UV and IR wavelengths on Ceres' surface at the scale possible from Earth (~50-100 km) and an oblate spheroid shape is found, consistent with a differentiated body. Compositional evidence includes the long known similarity of Ceres' albedo and visual-IR reflectance spectrum to those for carbonaceous chondrite meteorites. Thus, the surface is likely made of carbon-bearing, hydroxolated

Operations Odyssey Dawn and Unified Protector: Another Win for Warden s Theory

Science.gov (United States)

2014-12-04

the aircraft aimed at armoured vehicles just outside Benghazi. At night, US Navy ships and Royal Navy submarine HMS Triumph launched 112 Tomahawk...the vicinity of Zintan: 3 tanks, 1 anti-aircraft weapon system and 1 armoured vehicles were destroyed. In the vicinity of Brega: 1 building was... demographic groups) to be sympathetic and helpful in a variety of ways.”95 For Operations Odyssey Dawn and Unified Protector, the objective was

In-Flight Operation of the Dawn Ion Propulsion System Through Survey Science Orbit at Ceres

Science.gov (United States)

Garner, Charles E.; Rayman, Marc D.

2015-01-01

The Dawn mission, part of NASA's Discovery Program, has as its goal the scientific exploration of the two most massive main-belt objects, Vesta and Ceres. The Dawn spacecraft was launched from the Cape Canaveral Air Force Station on September 27, 2007 on a Delta-II 7925H- 9.5 (Delta-II Heavy) rocket that placed the 1218-kg spacecraft onto an Earth-escape trajectory. On-board the spacecraft is an ion propulsion system (IPS) developed at the Jet Propulsion Laboratory which will provide a total delta V of 11 km/s for the heliocentric transfer to Vesta, orbit capture at Vesta, transfer between Vesta science orbits, departure and escape from Vesta, heliocentric transfer to Ceres, orbit capture at Ceres, and transfer between Ceres science orbits. Full-power thrusting from December 2007 through October 2008 was used to successfully target a Mars gravity assist flyby in February 2009 that provided an additional delta V of 2.6 km/s. Deterministic thrusting for the heliocentric transfer to Vesta resumed in June 2009 and concluded with orbit capture at Vesta on July 16, 2011. From July 2011 through September 2012 the IPS was used to transfer to all the different science orbits at Vesta and to escape from Vesta orbit. Cruise for a rendezvous with Ceres began in September 2012 and concluded with the start of the approach to Ceres phase on December 26, 2015, leading to orbit capture on March 6, 2015. Deterministic thrusting continued during approach to place the spacecraft in its first science orbit, called RC3, which was achieved on April 23, 2015. Following science operations at RC3 ion thrusting was resumed for twenty-five days leading to arrival to the next science orbit, called survey orbit, on June 3, 2015. The IPS will be used for all subsequent orbit transfers and trajectory correction maneuvers until completion of the primary mission in approximately June 2016. To date the IPS has been operated for over 46,774 hours, consumed approximately 393 kg of xenon, and provided

ORIGIN: Metal Creation and Evolution from the Cosmic Dawn

DEFF Research Database (Denmark)

Herder, J. W. den; Piro, L.; Ohashi, T.

2011-01-01

, and beyond. The mission will answer questions such as: When were the first metals created? How does the cosmic metal content evolve? Where do most of the metals reside in the Universe? What is the role of metals in structure formation and evolution? To reach out to the early Universe ORIGIN will use Gamma......ORIGIN is a proposal for the M3 mission call of ESA aimed at the study of metal creation from the epoch of cosmic dawn. Using high-spectral resolution in the soft X-ray band, ORIGIN will be able to identify the physical conditions of all abundant elements between C and Ni to red-shifts of z=10...

Dawn-dusk asymmetry in particles of solar wind origin within the magnetosphere

Directory of Open Access Journals (Sweden)

T. J. Stubbs

2001-01-01

Full Text Available Solar wind/magnetosheath plasma in the magnetosphere can be identified using a component that has a higher charge state, lower density and, at least soon after their entry into the magnetosphere, lower energy than plasma from a terrestrial source. We survey here observations taken over 3 years of He2+ ions made by the Magnetospheric Ion Composition Sensor (MICS of the Charge and Mass Magnetospheric Ion Composition Experiment (CAMMICE instrument aboard POLAR. The occurrence probability of these solar wind ions is then plotted as a function of Magnetic Local Time (MLT and invariant latitude (7 for various energy ranges. For all energies observed by MICS (1.8–21.4 keV and all solar wind conditions, the occurrence probabilities peaked around the cusp region and along the dawn flank. The solar wind conditions were filtered to see if this dawnward asymmetry is controlled by the Svalgaard-Mansurov effect (and so depends on the BY component of the interplanetary magnetic field, IMF or by Fermi acceleration of He2+ at the bow shock (and so depends on the IMF ratio BX /BY . It is shown that the asymmetry remained persistently on the dawn flank, suggesting it was not due to effects associated with direct entry into the magnetosphere. This asymmetry, with enhanced fluxes on the dawn flank, persisted for lower energy ions (below a "cross-over" energy of about 23 keV but reversed sense to give higher fluxes on the dusk flank at higher energies. This can be explained by the competing effects of gradient/curvature drifts and the convection electric field on ions that are convecting sunward on re-closed field lines. The lower-energy He2+ ions E × B drift dawnwards as they move earthward, whereas the higher energy ions curvature/ gradient drift towards dusk. The convection electric field in the tail is weaker for northward IMF. Ions then need less energy to drift to the dusk flank, so that the cross-over energy, at which the asymmetry changes sense, is reduced

Gender Bias in The Rural Community as Reflected in Minfong Ho’s Sing to The Dawn

Directory of Open Access Journals (Sweden)

Hermanus Wahyaka

2017-01-01

Full Text Available This study aims at identifying the evidences of gender-biased behaviour and actions and at finding the possible reasons why those gender-biased behaviour and actions happen within the life of the rural community as depicted in the novel. The problems, therefore, are formulated as follows: 1. What are the evidences of gender-biased behaviour and actions experienced by the major female characters of Ho’sSing to the Dawn?and 2. Why do the gender-biased behaviour and actions occur within the life of the rural communityas in Ho’sSing to the Dawn? This study is a library research. The primary source is the novel itself, Sing to the Dawn. The secondary sources are obtained from several relevant books related to literary theories such as the critical approach, the theory of gender, the theory of society, and the review of Thai society. In order to relate the gender bias and a certain community, the socio-cultural approach is used to examine the novel. This study found that gender biased behaviour and actions committed by the male characters towards the major female characters manifest in several manners; they are subordination of women, mental violence, violent intention, physical violence, sex role stereotyping, and marginalization. The possible reasons enabling the manifestation of gender biased behaviour and actions committed by the male characters towards the major female characters are cultural construction on women subordination, cultural construction on sex roles stereotyping as the result of patriarchal system, religious misinterpretation, and poverty.   DOI: https://doi.org/10.24071/llt.2012.150205

Reconciling the dawn-dusk asymmetry in Mercury's exosphere with the micrometeoroid impact directionality

OpenAIRE

Pokorný, Petr; Sarantos, Menelaos; Janches, Diego

2017-01-01

Combining dynamical models of dust from Jupiter Family Comets and Halley-type Comets, we demonstrate that the seasonal variation of the dust/meteoroid environment at Mercury is responsible for producing the dawn-dusk asymmetry in Mercury's exosphere observed by the MESSENGER spacecraft. Our latest models, calibrated recently from ground-based and space-borne measurements, provide unprecedented statistics that enable us to study the longitudinal and latitudinal distribution of meteoroids impac...

Machine Learning Applied to Dawn/VIR data of Vesta in view of MERTIS/BepiColombo.

Science.gov (United States)

Helbert, J.; D'Amore, M.; Le Scaon, R.; Maturilli, A.; Palomba, E.; Longobardo, A.; Hiesinger, H.

2016-12-01

Remote sensing spectroscopy is one of the most commonly used technique in planetary science and for recent instruments producing huge amount of data, classic methods could fails to unlock the full scientific potential buried in the measurements. We explored several Machine Learning techniques: multi-step clustering method is developed, using an image segmentation method, a stream algorithm, and hierarchical clustering. The MErcury Radiometer and Thermal infrared Imaging Spectrometer (MERTIS) is part of the payload of the Mercury Planetary Orbiter spacecraft of the ESA-JAXA BepiColombo mission. MERTIS's scientific goals are to infer rock-forming minerals, to map surface composition, and to study surface temperature variations on Mercury. The NASA mission DAWN carry a suites of instruments aimed at understanding the two most massive objects in the main asteroid belt: Vesta and Ceres. DAWN has already successfully completed the exploration of Vesta in September 2012 and it is now in the last phase of the mission around Ceres. To cope with the stream of data that will be delivered by MERTIS, we developed an algorithm that could aggregate new data as they come in during the mission giving the scientist a guide for the most interesting and new discovery on Mercury. The DAWN/VESTA VIR data is a testbed for the algorithm. The algorithm identified the Olivine outcrops around two craters on Vesta's surface described in Ammannito et al., 2013. We furthermore mimic the data acquisition process as if the mission were dumping the data live. The algorithm provides insightful information on the novelty and classes int he data as they are collected. This will enhance MERTIS targeting and maximize its scientific return during BepiColombo mission at Mercury. E Ammannito et al. "Olivine in an unexpected location on Vesta/'s surface". In: Nature 504.7478 (2013), pp. 122-125.

Before the dawn recovering the lost history of our ancestors

CERN Document Server

Wade, Nicholas

2007-01-01

Nicholas Wade’s articles are a major reason why the science section has become the most popular, nationwide, in the New York Times. In his groundbreaking Before the Dawn, Wade reveals humanity’s origins as never before—a journey made possible only recently by genetic science, whose incredible findings have answered such questions as: What was the first human language like? How large were the first societies, and how warlike were they? When did our ancestors first leave Africa, and by what route did they leave? By eloquently solving these and numerous other mysteries, Wade offers nothing less than a uniquely complete retelling of a story that began 500 centuries ago.

Intruders: New Neighbors in "Dawn of the Planet of the Apes" and "The Hundred-Foot Journey"

Science.gov (United States)

Beck, Bernard

2015-01-01

Conflicts over territory are about the power to establish dominant cultures in territories and are often accompanied by cultural claims to legitimacy by each side. The cultural claims, or ideologies, are often expressed in terms of "homeland" dwellers versus "intruders." Two recent movies, "Dawn of the Planet of the…

Determination of epigenetic inheritance, genetic inheritance, and estimation of genome DNA methylation in a full-sib family of Cupressus sempervirens L.

Science.gov (United States)

Avramidou, Evangelia V; Doulis, Andreas G; Aravanopoulos, Filippos A

2015-05-15

Genetic inheritance and epigenetic inheritance are significant determinants of plant evolution, adaptation and plasticity. We studied inheritance of restriction site polymorphisms by the f-AFLP method and epigenetic DNA cytosine methylation inheritance by the f-MSAP technique. The study involved parents and 190 progeny of a Cupressus sempervirens L. full-sib family. Results from AFLP genetic data revealed that 71.8% of the fragments studied are under Mendelian genetic control, whereas faithful Mendelian inheritance for the MSAP fragments was low (4.29%). Further, MSAP fragment analysis showed that total methylation presented a mean of 28.2%, which was higher than the midparent value, while maternal inheritance was higher (5.65%) than paternal (3.01%). Interestingly de novo methylation in the progeny was high (19.65%) compared to parental methylation. Genetic and epigenetic distances for parents and offspring were not correlated (R(2)=0.0005). Furthermore, we studied correlation of total relative methylation and CG methylation with growth (height, diameter). We found CG/CNG methylation (N: A, C, T) to be positively correlated with height and diameter, while total relative methylation and CG methylation were positively correlated with height. Results are discussed in light of further research needed and of their potential application in breeding. Copyright © 2015 Elsevier B.V. All rights reserved.

A Study on the Type of School during the Dawn of Modern Education in Bhutan

Science.gov (United States)

Hirayama, Takehiro

2015-01-01

This study aims to clarify the state of school education in the Bhutan during the 1940-50s, a period of dawn of the modern education in Bhutan, by classifying schools and identifying their contrasting characteristics. The origins of modern education in Bhutan can be traced back approximately 100 years. Bhutan's modern period began in 1907 when…

77 FR 8943 - Culturally Significant Objects Imported for Exhibition Determinations: “The Dawn of Egyptian Art”

Science.gov (United States)

2012-02-15

... Determinations: ``The Dawn of Egyptian Art'' SUMMARY: Notice is hereby given of the following determinations... Egyptian Art,'' imported from abroad for temporary exhibition within the United States, are of cultural... of Art, New York, NY from on or about April 2, 2012, until on or about August 5, 2012, and at...

A natural resource condition assessment for Sequoia and Kings Canyon National Parks: Appendix 14: plants of conservation concern

Science.gov (United States)

Huber, Ann; Das, Adrian; Wenk, Rebecca; Haultain, Sylvia

2013-01-01

Sequoia and Kings Canyon National Parks are located in the California Floristic Province, which has been named one of world‘s hotspots of endemic biodiversity (Myers et al. 2000). The California Floristic Province is the largest and most important geographic floristic unit in California and extends from the Klamath Mountains of southwestern Oregon to the northwestern portion of Baja California (Hickman 1993). The Sierra Nevada, one of six regions that make up the California Floristic Province, covers nearly 20% of the land in California yet contains over 50% of its flora. Within the Sierra Nevada, the southern Sierra supports more Sierran endemic and rare plant taxa than the central and northern portions of the region (Shevock 1996). Sequoia and Kings Canyon National Parks (SEKI) encompass roughly 20% of the southern Sierra Nevada region. The parks overlap three floristic subregions (central Sierra Nevada High, southern Sierra Nevada High, and southern Sierra Nevada Foothills), and border the Great Basin Floristic Province. The parks support a rich and diverse vascular flora composed of over 1,560 taxa. Of these, 150 taxa are identified as having special status. The term special status is applied here to include taxa that are state or federally listed, rare in California, or at risk because they have a limited distribution. Only one species from these parks is listed under the state or federal Endangered Species Acts (Carex tompkinsii, Tompkins‘ sedge, is listed as a rare species under the California Endangered Species Act), and one species is under review for federal endangered listing (Pinus albicaulis, whitebark pine). However, an absence of threatened and endangered species recognized by Endangered Species Acts is not equivalent to an absence of species at risk. There are 83 plant taxa documented as occurring in SEKI that are considered imperiled or vulnerable in the state by the California Department of Fish and Game‘s California Natural Diversity

Dawn-dusk asymmetry in particles of solar wind origin within the magnetosphere

Directory of Open Access Journals (Sweden)

T. J. Stubbs

Full Text Available Solar wind/magnetosheath plasma in the magnetosphere can be identified using a component that has a higher charge state, lower density and, at least soon after their entry into the magnetosphere, lower energy than plasma from a terrestrial source. We survey here observations taken over 3 years of He²⁺ ions made by the Magnetospheric Ion Composition Sensor (MICS of the Charge and Mass Magnetospheric Ion Composition Experiment (CAMMICE instrument aboard POLAR. The occurrence probability of these solar wind ions is then plotted as a function of Magnetic Local Time (MLT and invariant latitude (7 for various energy ranges. For all energies observed by MICS (1.8–21.4 keV and all solar wind conditions, the occurrence probabilities peaked around the cusp region and along the dawn flank. The solar wind conditions were filtered to see if this dawnward asymmetry is controlled by the Svalgaard-Mansurov effect (and so depends on the B_Y component of the interplanetary magnetic field, IMF or by Fermi acceleration of He²⁺ at the bow shock (and so depends on the IMF ratio B_X /B_Y . It is shown that the asymmetry remained persistently on the dawn flank, suggesting it was not due to effects associated with direct entry into the magnetosphere. This asymmetry, with enhanced fluxes on the dawn flank, persisted for lower energy ions (below a "cross-over" energy of about 23 keV but reversed sense to give higher fluxes on the dusk flank at higher energies. This can be explained by the competing effects of gradient/curvature drifts and the convection electric field on ions that are convecting sunward on re-closed field lines. The lower-energy He²⁺ ions E × B drift dawnwards as they move earthward, whereas the higher energy ions curvature/ gradient drift towards dusk. The convection electric field in the tail is weaker for

Linking Forests and Fish: The Relationship Between Productivities of Salmonids and Forest Stands in Northern California

Science.gov (United States)

Wilzbach, P.; Frazey, S.

2005-05-01

Productivities of resident salmonid populations, upland, and riparian areas in 25 small watersheds of coastal northern California were estimated and compared to determine if: 1) upland site productivity predicted riparian site productivity; 2) either upland or riparian site productivity predicted salmonid productivity; and 3) other parameters explained more of the variance in salmonid productivity than upland or riparian site productivity. Salmonid productivity was indexed by total salmonid biomass, length of age 1 fish, and percent habitat saturation. Upland and riparian site productivities were estimated using site indices for redwood (Sequoia sempervirens) and red alder (Alnus rubra), respectively. Upland and riparian site indices were correlated, but neither factor contributed to the best approximating models of salmonid biomass or fish length at age one. Salmonid biomass was best described by a positive relationship with drainage area, and length at age was best described by a positive relationship with percent of riparian hardwoods. Percent habitat saturation was not well described by any of the models constructed. Lack of a relationship between upland conifer and salmonid productivity suggests that management of land for timber productivity and component streams for salmonid production in these sites will require separate, albeit integrated, strategies.

Structure and Composition of Old-Growth and Unmanaged Second-Growth Riparian Forests at Redwood National Park, USA

Directory of Open Access Journals (Sweden)

Christopher R. Keyes

2014-02-01

Full Text Available Restoration of second-growth riparian stands has become an important issue for managers of redwood (Sequoia sempervirens [D. Don] Endl. forest reserves. Identifying differences between old-growth and second-growth forest vegetation is a necessary step in evaluating restoration needs and targets. The objective of this study was to characterize and contrast vegetation structure and composition in old-growth and unmanaged second-growth riparian forests in adjacent, geomorphologically similar watersheds at Redwood National Park. In the old-growth, redwood was the dominant overstory species in terms of stem density, basal area, and importance values. Second-growth was dominated by red alder (Alnus rubra Bong., Douglas-fir (Pseudotsuga menziesii [Mirbel] Franco, and redwood. Understory species were similar in both forests, with several key differences: Oxalis oregana Nutt. and Trillium ovatum Pursh had greater importance values in the old-growth, and Vaccinium parvifolium Sm., Dryopteris spp. and sedges Carex spp. had greater importance values in the second-growth. Notable differences in structure and composition suggest that restoration practices such as thinning could expedite the acquisition of old-growth characteristics in second-growth riparian forests.

Plasma bubbles near the dawn terminator in the topside ionosphere

International Nuclear Information System (INIS)

Burke, W.J.

1979-01-01

The physical properties of plasma bubbles in the topside ionosphere near the dawn terminator are investigated. It is assumed that the bubbles result from either a Rayleigh-Taylor or an E X B instability on the bottom side of the F-layer. While the E-region is in darkness, the top and bottomsides of the ionospheres are electrically decoupled and the motion of the bubbles can be described by non-linear, two-dimensional theory. After sunrise, electric fields within the bubbles discharge through the conducting lower ionosphere. The upward drift of the bubbles is effectively halted. To achieve a dayside state of diffusive equilibrium the bubbles slowly begin to collapse from the bottom. (author)

Reionization and Cosmic Dawn: theory and simulations

Science.gov (United States)

Mesinger, Andrei

2018-05-01

We highlight recent progress in the sophistication and diversification of the simulations of cosmic dawn and reionization. The application of these modeling tools to recent observations has allowed us narrow down the timing of reionization. The midpoint of reionization is constrained to z = 7.6-0.7+0.8 (1 σ), with the strongest constraints coming from the optical depth to the CMB measured with the Planck satellite and the first detection of ongoing reionization from the spectra of the z = 7.1 QSOs ULASJ1120+0641. However, we still know virtually nothing about the astrophysical sources during the first billion years. The revolution in our understanding will be led by upcoming interferometric observations of the cosmic 21-cm signal. The properties of the sources and sinks of UV and X-ray photons are encoded in the 3D patterns of the signal. The development of Bayesian parameter recovery techniques, which tap into the wealth of the 21-cm signal, will soon usher in an era of precision astrophysical cosmology.

Factors associated to the career choice of family medicine among Japanese physicians: the dawn of a new era.

Science.gov (United States)

Ie, Kenya; Tahara, Masao; Murata, Akiko; Komiyama, Manabu; Onishi, Hirotaka

2014-01-01

Despite recent developments in post-graduate family medicine training in Japan, the numbers of junior doctors entering family medicine residencies are still limited. The objective of this qualitative study was to investigate the possible factors associated to the career choice of family medicine, especially in the context of the newly established family medicine programs in Japan. From December 2010 to January 2011, we distributed a semi-structured questionnaire about career choice to 58 physician members of the Japan Primary Care Association, and 41 of them responded. Four researchers used the Modified Grounded Theory Approach (Kinoshita, 2003) for three-stage conceptualization. We extracted a conceptual model of the choice of newly established family medicine as a career in Japan, consisting of six categories and 77 subordinate concepts from 330 variations. The subcategories of personal background affecting the family-medicine career choice were characteristics ("self-reliance," "pioneering spirit"), career direction ("community/rural-orientedness," "multifaceted orientation") and experience (e.g., "discomfort with fragmented care"). We divided the influencing factors that were identified for career choice into supporters (e.g., "role model"), conflict of career choice (e.g., "anxiety about diverse/broad practice"), and the dawn of a new era in family medicine in Japan (e.g., "lack of social recognition," "concern about livelihood," and "too few role models"). Although the dawn of a new era seemed a rather negative influencer, it was unique to our study that the dawn itself could attract those with a "pioneering spirit" and an "attitude of self-training." Unlike previous studies, the positive factors such as lifestyle and the short residency program were not shown to be part of family medicine's attractiveness. In contrast, "concern about livelihood" was specific among our respondents and was related to career choice in the dawn period. "Community

The Metaphor of the Dawn of the Space Age in the Contemporary Social Sciences and Humanities

Directory of Open Access Journals (Sweden)

Natalija Majsova

2015-05-01

Full Text Available The dawn of the space age in the early 1960s first provoked unabashed awe. Then, it inspired numerous attempts to explain (away the evental status of the first examples of manned spaceflight accounts that mainly interpreted Yuri Garagin’s flight (1961 and the Moon landing (1969 as logical consequences of technological progress, a certain constellation of political circumstances, and a pinch of ‘imagination’ to begin with. Curiously enough, conclusions of the vast majority of such accounts cannot but resort to ‘terrestrial’ metaphors in order to explain why these endeavours were worth undertaking in the first place. In the 21st century, reflections on outer space seem to have settled within three conceptually designed research fields within the social sciences and humanities: astrosociology, noocosmology and cultural studies of outer space. The text analyses conceptualisations and accounts of the dawn of the space age exhibited by the core texts and methodologies of these research fields to demonstrate how they actually hinge on variant epistemologies, and interpret the role of metaphor in world-formation in radically differing ways.

Vesta in the Light of Dawn: A Nuanced Confirmation of Expectations

Science.gov (United States)

Russell, C. T.

The ion-engine propelled Discovery-class mission Dawn was launched on its near decade-long odyssey to explore the two most massive asteroids in the main belt, 4 Vesta and 1 Ceres, in September 2007. Based on its mass and volume, its basaltic crust, and the chemistry of the associated HED meteorites, Vesta was expected to consist of a completely differentiated dry silicate body with an iron core in contrast to Ceres, whose much smaller density implied a much wetter body, perhaps with liquid water beneath the crust. Upon entering vestan orbit in July 2001, Dawn discovered that indeed the surface resembled the HED meteorites and the gravity data were consistent with a differentiated body with a 110-km radius core. The large southern basin seen from HST was studied and found to consist of two ancient impact basins with associated planetary rings of graben-like fossae. The water that had been hinted at in reflectance spectra observed by terrestrial telescopes was seen more broadly over the surface as was hydrogen detected with the GRaND gamma ray and neutron spectrometer. Moreover, some craters showed evidence for both running and standing water: gullies in the crater walls and pits in the crater floors. Furthermore, the expected exposure of olivine in the southern basin was not found. The presence of water, even if only transient, on the surface of Vesta, and the apparent lack of an olivine mantle were unexpected results. While these observations do not negate the earlier work based on the HED meteorites, they do add important new insight into the conditions under which Vesta formed and evolved.

A lightning multiple casualty incident in Sequoia and Kings Canyon National Parks.

Science.gov (United States)

Spano, Susanne J; Campagne, Danielle; Stroh, Geoff; Shalit, Marc

2015-03-01

Multiple casualty incidents (MCIs) are uncommon in remote wilderness settings. This is a case report of a lightning strike on a Boy Scout troop hiking through Sequoia and Kings Canyon National Parks (SEKI), in which the lightning storm hindered rescue efforts. The purpose of this study was to review the response to a lightning-caused MCI in a wilderness setting, address lightning injury as it relates to field management, and discuss evacuation options in inclement weather incidents occurring in remote locations. An analysis of SEKI search and rescue data and a review of current literature were performed. A lightning strike at 10,600 feet elevation in the Sierra Nevada Mountains affected a party of 5 adults and 7 Boy Scouts (age range 12 to 17 years old). Resources mobilized for the rescue included 5 helicopters, 2 ambulances, 2 hospitals, and 15 field and 14 logistical support personnel. The incident was managed from strike to scene clearance in 4 hours and 20 minutes. There were 2 fatalities, 1 on scene and 1 in the hospital. Storm conditions complicated on-scene communication and evacuation efforts. Exposure to ongoing lightning and a remote wilderness location affected both victims and rescuers in a lightning MCI. Helicopters, the main vehicles of wilderness rescue in SEKI, can be limited by weather, daylight, and terrain. Redundancies in communication systems are vital for episodes of radio failure. Reverse triage should be implemented in lightning injury MCIs. Education of both wilderness travelers and rescuers regarding these issues should be pursued. Copyright © 2015 Wilderness Medical Society. Published by Elsevier Inc. All rights reserved.

Climatic and physiological effects on leaf and tree-ring stable isotopes in California redwoods

Science.gov (United States)

Ambrose, A. R.; Baxter, W.; Wong, C.; Dawson, T. E.; Carroll, A.; Voelker, S.

2016-12-01

Variation in the stable isotope composition of organic matter can provide important information about environmental change and biological responses to it. We analyzed the stable carbon (d13C) and oxygen (d18O) isotope ratios of leaves and of the cellulose from individual tree-rings of California's two redwood species to examine how these trees have responded to environmental variation and change in both time and space. Analyses of leaf d13C for both coast redwood (Sequoia sempervirens) and giant sequoia (Sequoiadendron giganteum) from throughout their geographical ranges show a marked gradient with tree height for trees of all sizes and ages but no clear difference among species or populations. The gradient is best explained by tree response to changes in both microenvironment and physiology that are known to change with height. In contrast, leaf d18O for both species showed no clear relationship with height but very clear differences between species and populations with giant sequoia displaying a much stronger inferred leaf-level response to the higher evaporative conditions present in the Sierra Nevada mountains as compared to the coast. Both species showed population-level differences with the driest and warmest sites most distinct from all of the others. Intra-annual analyses of d13C and d18O in tree-rings over a 21-year period (1974-1994) were also used to explore how climate and tree response to climate was recorded for both species. These analyses revealed unique (local) climatic effects and response to the climate for each species and population of both redwood species. Most pronounced was a significant increase in intrinsic Water Use Efficiency (iWUE) derived from d13C data over the study period in both species, and a distinct d18O response in relation to drought (e.g. 1976/1977) and to warmer days and nights and above-average precipitation (e.g., 1982-1985). Patterns of co-variation in d13C and d18O in both species suggest that during dry and also warm

Emergency Department Visits Involving Misuse and Abuse of the Antipsychotic Quetiapine: Results from the Drug Abuse Warning Network (DAWN

Directory of Open Access Journals (Sweden)

Margaret E. Mattson

2015-01-01

Full Text Available Case reports in medical literature suggest that the atypical antipsychotic quetiapine, a medication not previously considered to have abuse potential, is now being subject to misuse and abuse (MUA; ie, taken when not prescribed for them or used in a way other than instructed by their health professional. Here we present systematic, nationally representative data from the 2005 to 2011 Drug Abuse Warning Network (DAWN for prevalence of emergency department (ED visits among the U.S. general population involving quetiapine and related to MUA, suicide attempts, and adverse reactions. Nationally, quetiapine-related ED visits increased 90% between 2005 and 2011, from 35,581 ED visits to 67,497. DAWN data indicate that when used without medical supervision for recreational/self-medication purposes, quetiapine poses health risks for its users, especially among polydrug users and women. These findings suggest that the medical and public health communities should increase vigilance concerning this drug and its potential for MUA.

An extended study of the low-latitude boundary layer on the dawn and dusk flanks of the magnetosphere

International Nuclear Information System (INIS)

Mitchell, D.G.; Kutchko, F.; Williams, D.J.; Eastman, T.E.; Frank, L.A.; Russell, C.T.

1987-01-01

The authors present a study of the low-latitude boundary layer (LLBL) using ISEE 1 energetic particle, plasma, and magnetic field data obtained during numerous traversals of the LLBL that occurred on 66 ISEE 1 passes through the magnetospheric flank LLBL region. They use energetic particle distributions to determine dawn and dusk LLBL behavior and topology for varying orientations of the magnetosheath and/or interplanetary magnetic field (M/IMF), for different local times, and for changing levels of geomagnetic activity (Kp). This study corroborates and extends the earlier work of Williams et al. (1985) who presented a detailed study of two (dusk and dawn) ISEE 1 passes through the LLBL region for the case of northward M/IMF. They find that the dawn and dusk LLBL are on closed geomagnetic field lines for northward M/IMF but are on a combination of closed and open field lines for a southward M/IMF. The energetic particle distributions show that cases of reverse-draped field lines in the LLBL are consistent with an open field line topology. In addition, they find that the LLBL is thicker (thinner) for northward (southward) M/IMF and becomes thicker with increasing distance from the subsolar point. LLBL electric fields nominally are in the few (3-5) millivolts per meter range and display an apparent maximum value of ∼10mV/m. These electric fields capture magnetospherically drifting particles as they approach the LLBL and propel them tailward. In this way, the plasma sheet is the dominant source of energetic (approx-gt 10 keV) particles in the LLBL while the magnetosheath appears to be the dominant source for lower-energy (approx-lt 10 keV) LLBL particles

Diabetes Attitudes, Wishes and Needs second study (DAWN2™)

DEFF Research Database (Denmark)

Nicolucci, Antonio; Kovacs Burns, K; Holt, Richard I G

2013-01-01

AIMS: The second Diabetes Attitudes, Wishes and Needs (DAWN2) study aimed to assess psychosocial outcomes in people with diabetes across countries for benchmarking. METHODS: Surveys included new and adapted questions from validated questionnaires that assess health-related quality of life, self......-management, attitudes/beliefs, social support and priorities for improving diabetes care. Questionnaires were conducted online, by telephone or in person. RESULTS: Participants were 8596 adults with diabetes across 17 countries. There were significant between-country differences for all benchmarking indicators; no one...... (17.2-67.6%). Overall quality of life was rated 'poor' or 'very poor' by 12.2% of participants (7.6-26.1%). Diabetes had a negative impact on all aspects investigated, ranging from 20.5% on relationship with family/friends to 62.2% on physical health. Approximately 40% of participants (18...

The spectral response of Buxus sempervirens to different types of environmental stress - A laboratory experiment

Science.gov (United States)

de Jong, Steven M.; Addink, Elisabeth A.; Hoogenboom, Priscilla; Nijland, Wiebe

2012-11-01

The European Mediterranean regions are expected to encounter drier summer conditions and warmer temperatures for the winter of +2 °C and of +5 °C for the summer in the next six decennia. As a result the natural vegetation will face harsher conditions due to lower water availability, longer summer droughts and higher temperatures resulting in plant stress conditions. To monitor vegetation conditions like stress and leaf area index dynamics in our study area in Mediterranean France we use earth observation techniques like imaging spectroscopy. To assist image analysis interpretation we carried out a laboratory experiment to investigate the spectral and visible response of Buxus sempervirens, a common Mediterranean species, to five different types of stress: drought, drought-and-heat, light deprivation, total saturation and chlorine poisoning. For 52 days plants were subjected to stress. We collected data on the visible and spectral signs, and calculated thirteen vegetation indices. The plant's response time to different stress types varied from 10 to 32 days. Spectroscopic techniques revealed plant stress up to 15 days earlier than visual inspection. Visible signs of stress of the plants included curling and shrinking of the leaves, de-colouring of the leaves, leaves becoming breakable, opening up of the plant's canopy and sagging of the branches. Spectral signs of stress occurred first in the water absorption bands at 1450 and 1940 nm, followed by reduced absorption in the visible wavelengths, and next by reduced reflectance in near infrared. Light deprivation did not result in any stress signs, while drought, drought and heat and chlorine poisoning resulted in significant stress. The spectral response did not show differences for different stress types. Analysis of the vegetation indices identified the Carter-2 (R695/R760), the Red-Green Index (R690/R550) and the Vogelman-2 (R734 - R747)/(R715 + R726) as the best performing ones to identify stress. The lab

Critical Loads of Atmospheric Nitrogen Deposition for Aquatic Ecosystems in Yosemite and Sequoia and Kings Canyon National Parks

Science.gov (United States)

Nanus, L.; Clow, D. W.; Sickman, J. O.

2016-12-01

High-elevation aquatic ecosystems in Yosemite (YOSE) and Sequoia and Kings Canyon (SEKI) National Parks are impacted by atmospheric nitrogen (N) deposition associated with local and regional air pollution. Documented effects include elevated surface water nitrate concentrations, increased algal productivity, and changes in diatom species assemblages. Annual wet inorganic N deposition maps, developed at 1-km resolution for YOSE and SEKI to quantify N deposition to sensitive high-elevation ecosystems, range from 1.0 to over 5.0 kg N ha-1 yr-1. Critical loads of N deposition for nutrient enrichment of aquatic ecosystems were quantified and mapped using a geostatistical approach, with N deposition, topography, vegetation, geology, and climate as potential explanatory variables. Multiple predictive models were created using various combinations of explanatory variables; this approach allowed us to better quantify uncertainty and more accurately identify the areas most sensitive to atmospherically deposited N. The lowest critical loads estimates and highest exceedances identified within YOSE and SEKI occurred in high-elevation basins with steep slopes, sparse vegetation, and areas of neoglacial till and talus. These results are consistent with previous analyses in the Rocky Mountains, and highlight the sensitivity of alpine ecosystems to atmospheric N deposition.

Regeneration Dynamics of Coast Redwood, a Sprouting Conifer Species: A Review with Implications for Management and Restoration

Directory of Open Access Journals (Sweden)

Kevin L. O’Hara

2017-04-01

Full Text Available Coast redwood (Sequoia sempervirens (Lamb. ex. D. Don Endl. is unique among conifer species because of its longevity, the great sizes of individual trees, and its propensity to reproduce through sprouts. Timber harvesting in the native redwood range along the coast of the western United States has necessitated restoration aimed to promote old forest structures to increase the total amount of old forest, the connectivity between old forests, and to enhance the resiliency of these ecosystems. After disturbance or harvest, healthy redwood stumps sprout vigorously, often producing dozens of sprouts within two years of disturbance. These sprouts form highly aggregated spatial patterns because they are clustered around stumps that may number less than 50 ha−1. Thinning of sprouts can accelerate individual tree growth, providing an effective restoration strategy to accelerate formation of large trees and old forest structures or increase stand growth for timber production. However, management, including restoration activities, is a contentious issue throughout the native range of redwood because of the history of overexploitation of this resource and perceptions that overexploitation is continuing. This paper reviews the science of early stand dynamics in coast redwood and their implications for restoration and other silvicultural strategies.

Impact of Time-Restricted Feeding and Dawn-to-Sunset Fasting on Circadian Rhythm, Obesity, Metabolic Syndrome, and Nonalcoholic Fatty Liver Disease

Directory of Open Access Journals (Sweden)

Ayse L. Mindikoglu

2017-01-01

Full Text Available Obesity now affects millions of people and places them at risk of developing metabolic syndrome, nonalcoholic fatty liver disease (NAFLD, and even hepatocellular carcinoma. This rapidly emerging epidemic has led to a search for cost-effective methods to prevent the metabolic syndrome and NAFLD as well as the progression of NAFLD to cirrhosis and hepatocellular carcinoma. In murine models, time-restricted feeding resets the hepatic circadian clock and enhances transcription of key metabolic regulators of glucose and lipid homeostasis. Studies of the effect of dawn-to-sunset Ramadan fasting, which is akin to time-restricted feeding model, have also identified significant improvement in body mass index, serum lipid profiles, and oxidative stress parameters. Based on the findings of studies conducted on human subjects, dawn-to-sunset fasting has the potential to be a cost-effective intervention for obesity, metabolic syndrome, and NAFLD.

Impact of Time-Restricted Feeding and Dawn-to-Sunset Fasting on Circadian Rhythm, Obesity, Metabolic Syndrome, and Nonalcoholic Fatty Liver Disease

Science.gov (United States)

Gagan, Sood K.

2017-01-01

Obesity now affects millions of people and places them at risk of developing metabolic syndrome, nonalcoholic fatty liver disease (NAFLD), and even hepatocellular carcinoma. This rapidly emerging epidemic has led to a search for cost-effective methods to prevent the metabolic syndrome and NAFLD as well as the progression of NAFLD to cirrhosis and hepatocellular carcinoma. In murine models, time-restricted feeding resets the hepatic circadian clock and enhances transcription of key metabolic regulators of glucose and lipid homeostasis. Studies of the effect of dawn-to-sunset Ramadan fasting, which is akin to time-restricted feeding model, have also identified significant improvement in body mass index, serum lipid profiles, and oxidative stress parameters. Based on the findings of studies conducted on human subjects, dawn-to-sunset fasting has the potential to be a cost-effective intervention for obesity, metabolic syndrome, and NAFLD. PMID:29348746

Magnetotail Fast Flow Occurrence Rate and Dawn-Dusk Asymmetry at XGSM ˜ -60 RE

Science.gov (United States)

Kiehas, S. A.; Runov, A.; Angelopolos, V.; Hietala, H.; Korovinksiy, D.

2018-03-01

As a direct result of magnetic reconnection, plasma sheet fast flows act as primary transporter of mass, flux, and energy in the Earth's magnetotail. During the last decades, these flows were mainly studied within XGSM>-60RE, as observations near or beyond lunar orbit were limited. By using 5 years (2011-2015) of ARTEMIS (Acceleration, Reconnection, Turbulence, and Electrodynamics of the Moons Interaction with the Sun) data, we statistically investigate earthward and tailward flows at around 60 RE downtail. A significant fraction of fast flows is directed earthward, comprising 43% (vx>400 km/s) to 56% (vx>100 km/s) of all observed flows. This suggests that near-Earth and midtail reconnection are equally probable of occurring on either side of the ARTEMIS downtail distance. For fast convective flows (v⊥x>400 km/s), this fraction of earthward flows is reduced to about 29%, which is in line with reconnection as source of these flows and a downtail decreasing Alfvén velocity. More than 60% of tailward convective flows occur in the dusk sector (as opposed to the dawn sector), while earthward convective flows are nearly symmetrically distributed between the two sectors for low AL (>-400 nT) and asymmetrically distributed toward the dusk sector for high AL (infer that near-Earth reconnection is preferentially located at dusk, whereas midtail reconnection (X >- 60RE) is likely symmetric across the tail during weak substorms and asymmetric toward the dusk sector for strong substorms, as the dawn-dusk asymmetric nature of reconnection onset in the near-Earth region progresses downtail.

Extreme sensitivity of gene expression in human SH-SY5Y neurocytes to ultra-low doses of Gelsemium sempervirens

Science.gov (United States)

2014-01-01

Background Gelsemium sempervirens L. (Gelsemium s.) is a traditional medicinal plant, employed as an anxiolytic at ultra-low doses and animal models recently confirmed this activity. However the mechanisms by which it might operate on the nervous system are largely unknown. This work investigates the gene expression of a human neurocyte cell line treated with increasing dilutions of Gelsemium s. extract. Methods Starting from the crude extract, six 100 × (centesimal, c) dilutions of Gelsemium s. (2c, 3c, 4c, 5c, 9c and 30c) were prepared according to the French homeopathic pharmacopoeia. Human SH-SY5Y neuroblastoma cells were exposed for 24 h to test dilutions, and their transcriptome compared by microarray to that of cells treated with control vehicle solutions. Results Exposure to the Gelsemium s. 2c dilution (the highest dose employed, corresponding to a gelsemine concentration of 6.5 × 10-9 M) significantly changed the expression of 56 genes, of which 49 were down-regulated and 7 were overexpressed. Several of the down-regulated genes belonged to G-protein coupled receptor signaling pathways, calcium homeostasis, inflammatory response and neuropeptide receptors. Fisher exact test, applied to the group of 49 genes down-regulated by Gelsemium s. 2c, showed that the direction of effects was significantly maintained across the treatment with high homeopathic dilutions, even though the size of the differences was distributed in a small range. Conclusions The study shows that Gelsemium s., a medicinal plant used in traditional remedies and homeopathy, modulates a series of genes involved in neuronal function. A small, but statistically significant, response was detected even to very low doses/high dilutions (up to 30c), indicating that the human neurocyte genome is extremely sensitive to this regulation. PMID:24642002

The Dawn of Human Matrilineal Diversity

Science.gov (United States)

Behar, Doron M.; Villems, Richard; Soodyall, Himla; Blue-Smith, Jason; Pereira, Luisa; Metspalu, Ene; Scozzari, Rosaria; Makkan, Heeran; Tzur, Shay; Comas, David; Bertranpetit, Jaume; Quintana-Murci, Lluis; Tyler-Smith, Chris; Wells, R. Spencer; Rosset, Saharon

2008-01-01

The quest to explain demographic history during the early part of human evolution has been limited because of the scarce paleoanthropological record from the Middle Stone Age. To shed light on the structure of the mitochondrial DNA (mtDNA) phylogeny at the dawn of Homo sapiens, we constructed a matrilineal tree composed of 624 complete mtDNA genomes from sub-Saharan Hg L lineages. We paid particular attention to the Khoi and San (Khoisan) people of South Africa because they are considered to be a unique relic of hunter-gatherer lifestyle and to carry paternal and maternal lineages belonging to the deepest clades known among modern humans. Both the tree phylogeny and coalescence calculations suggest that Khoisan matrilineal ancestry diverged from the rest of the human mtDNA pool 90,000–150,000 years before present (ybp) and that at least five additional, currently extant maternal lineages existed during this period in parallel. Furthermore, we estimate that a minimum of 40 other evolutionarily successful lineages flourished in sub-Saharan Africa during the period of modern human dispersal out of Africa approximately 60,000–70,000 ybp. Only much later, at the beginning of the Late Stone Age, about 40,000 ybp, did introgression of additional lineages occur into the Khoisan mtDNA pool. This process was further accelerated during the recent Bantu expansions. Our results suggest that the early settlement of humans in Africa was already matrilineally structured and involved small, separately evolving isolated populations. PMID:18439549

Structure of the auroral precipitation region in the dawn sector: relationship to convection reversal boundaries and field-aligned currents

Directory of Open Access Journals (Sweden)

Y. I. Feldstein

2001-05-01

precipitation (AO is mapped to the dawn periphery of the Central Plasma Sheet (CPS; the soft small scale structured precipitation (SSSL is mapped to the outer magnetosphere close to the magnetopause, i.e. the Low Latitude Boundary Layer (LLBL. In the near-noon sector, earthward fluxes of soft electrons, which cause the Diffuse Red Aurora (DRA, are observed. The ion energies decrease with increasing latitude. The plasma spectra of the DRA regime are analogous to the spectra of the Plasma Mantle (PM. In the dawn sector, the large-scale field-aligned currents flow into the ionosphere at the SSSL latitudes (Region 1 and flow out at the AO or DAZ latitudes (Region 2. In the dawn and dusk sectors, the large-scale Region 1 and Region 2 FAC generation occurs in different plasma domains of the distant magnetosphere. The dawn and dusk FAC connection to the traditional Region 1 and Region 2 has only formal character, as FAC generating in various magnetospheric plasma domains integrate in the same region (Region 1 or Region 2. In the SSSL, there is anti-sunward convection; in the DAZ and the AO, there is the sunward convection. At PM latitudes, the convection is controlled by the azimuthal IMF component (By . It is suggested to extend the notation of the plasma pattern boundaries, as proposed by Newell et al. (1996, for the nightside sector of the auroral oval to the dawn sector.Key words. Magnetospheric physics (current systems; magnetospheric configuration and dynamics; plasma convection

Structure of the auroral precipitation region in the dawn sector: relationship to convection reversal boundaries and field-aligned currents

Directory of Open Access Journals (Sweden)

Y. I. Feldstein

electrons and isotropic ion precipitation (AO is mapped to the dawn periphery of the Central Plasma Sheet (CPS; the soft small scale structured precipitation (SSSL is mapped to the outer magnetosphere close to the magnetopause, i.e. the Low Latitude Boundary Layer (LLBL. In the near-noon sector, earthward fluxes of soft electrons, which cause the Diffuse Red Aurora (DRA, are observed. The ion energies decrease with increasing latitude. The plasma spectra of the DRA regime are analogous to the spectra of the Plasma Mantle (PM. In the dawn sector, the large-scale field-aligned currents flow into the ionosphere at the SSSL latitudes (Region 1 and flow out at the AO or DAZ latitudes (Region 2. In the dawn and dusk sectors, the large-scale Region 1 and Region 2 FAC generation occurs in different plasma domains of the distant magnetosphere. The dawn and dusk FAC connection to the traditional Region 1 and Region 2 has only formal character, as FAC generating in various magnetospheric plasma domains integrate in the same region (Region 1 or Region 2. In the SSSL, there is anti-sunward convection; in the DAZ and the AO, there is the sunward convection. At PM latitudes, the convection is controlled by the azimuthal IMF component (B_y . It is suggested to extend the notation of the plasma pattern boundaries, as proposed by Newell et al. (1996, for the nightside sector of the auroral oval to the dawn sector.

Key words. Magnetospheric physics (current systems; magnetospheric configuration and dynamics; plasma convection

The Surface and Interior Evolution of Ceres Revealed by Analysis of Fractures and Secondary Crater Chains Using Dawn Data

Science.gov (United States)

Scully, J. E. C.; Buczkowski, D.; King, S. D.; Castillo, J. C.; Schmedemann, N.; Raymond, C. A.; O'Brien, D. P.; Marchi, S.; Russell, C. T.; Mitri, G.; Bland, M. T.

2016-12-01

Dawn is the first spacecraft to visit and orbit Ceres, a dwarf planet and the largest body in the asteroid belt (radius 470 km) (Russell et al., 2016). Previously, telescopic observations and thermal evolution modeling indicated Ceres was at least partially differentiated, with a density of 2,100 kg/m3 (e.g. Drummond et al., 2014; Castillo-Rogez & McCord, 2010). Moreover, models of crater retention predicted that pervasive viscous relaxation in a water-ice-rich outer layer could erase most surface features (Bland, 2013). However, a full understanding of Ceres' surface and interior evolution remained elusive until Dawn explored Ceres. Here we present a global geologic map of Ceres' ≥1 km wide linear features, which we interpret as: 1) the surface expression of subsurface fractures, and 2) secondary crater chains formed when material ejected during impact-crater formation impacts and scours the surface. The formation and preservation of these linear features indicate Ceres' outer layer is relatively strong, and not dominated by viscous relaxation as predicted (Buczkowski et al., 2016). The fractures (called the Samhain Catenae) give us insights into the interior. Based on a fracture spacing to fractured layer thickness ratio of 1 (Bai & Pollard, 2000), the spacing of the Samhain Catenae indicates that the outer, fractured layer is 88 km thick. Moreover, consistent with geodynamic modeling (King et al., 2016), we interpret the Samhain Catenae formed because of uplift and extension induced by an upwelling region. Unlike many cerean secondary crater chains, the Junina Catenae secondary crater chains are not radial to their source impact crater(s). On account of Ceres' fast rotation (period of 9 hours) and relatively small radius, modeling indicates that the Junina Catenae originated from the Urvara/Yalode impact craters, which are located in a different hemisphere. Our results show Ceres has different surface and interior characteristics than predicted, and underwent

ORIGIN: Metal Creation and Evolution from the Cosmic Dawn

CERN Document Server

Herder, Jan-Willem den; Ohashi, Takaya; Kouveliotou, Chryssa; Hartmann, Dieter H.; Kaastra, Jelle S.; Amati, L.; Andersen, M.I.; Arnaud, M.; Attéia, J.-L.; Bandler, S.; Barbera, M.; Barcons, X.; Barthelmy, S.; Basa, S.; Basso, S.; Boer, M.; Branchini, E.; Branduardi-Raymont, G.; Borgani, S.; Boyarsky, A.; Brunetti, G.; Budtz-Jorgensen, C.; Burrows, D.; Butler, N.; Campana, S.; Caroli, E.; Ceballos, M.; Christensen, F.; Churazov, E.; Comastri, A.; Colasanti, L.; Cole, R.; Content, R.; Corsi, A.; Costantini, E.; Conconi, P.; Cusumano, G.; de Plaa, J.; De Rosa, A.; Del Santo, M.; Di Cosimo, S.; De Pasquale, M.; Doriese, R.; Ettori, S.; Evans, P.; Ezoe, Y.; Ferrari, L.; Finger, H.; Figueroa-Feliciano, T.; Friedrich, P.; Fujimoto, R.; Furuzawa, A.; Fynbo, J.; Gatti, F.; Galeazzi, M.; Gehrels, N.; Gendre, B.; Ghirlanda, G.; Ghisellini, G.; Gilfanov, M.; Giommi, P.; Girardi, M.; Grindlay, J.; Cocchi, M.; Godet, O.; Guedel, M.; Haardt, F.; den Hartog, R.; Hepburn, I.; Hermsen, W.; Hjorth, J.; Hoekstra, H.; Holland, A.; Hornstrup, A.; van der Horst, A.; Hoshino, A.; in 't Zand, J.; Irwin, K.; Ishisaki, Y.; Jonker, P.; Kitayama, T.; Kawahara, H.; Kawai, N.; Kelley, R.; Kilbourne, C.; de Korte, P.; Kusenko, A.; Kuvvetli, I.; Labanti, M.; Macculi, C.; Maiolino, R.; Hesse, M. Mas; Matsushita, K.; Mazzotta, P.; McCammon, D.; Méndez, M.; Mignani, R.; Mineo, T.; Mitsuda, K.; Mushotzky, R.; Molendi, S.; Moscardini, L.; Natalucci, L.; Nicastro, F.; O'Brien, P.; Osborne, J.; Paerels, F.; Page, M.; Paltani, S.; Pedersen, K.; Perinati, E.; Ponman, T.; Pointecouteau, E.; Predehl, P.; Porter, S.; Rasmussen, A.; Rauw, G.; Röttgering, H.; Roncarelli, M.; Rosati, P.; Quadrini, E.; Ruchayskiy, O.; Salvaterra, R.; Sasaki, S.; Sato, K.; Savaglio, S.; Schaye, J.; Sciortino, S.; Shaposhnikov, M.; Sharples, R.; Shinozaki, K.; Spiga, D.; Sunyaev, R.; Suto, Y.; Takei, Y.; Tanvir, N.; Tashiro, M.; Tamura, T.; Tawara, Y.; Troja, E.; Tsujimoto, M.; Tsuru, T.; Ubertini, P.; Ullom, J.; Ursino, E.; Verbunt, F.; van de Voort, F.; Viel, M.; Wachter, S.; Watson, D.; Weisskopf, M.; Werner, N.; White, N.; Willingale, R.; Wijers, R.; Yamasaki, N.; Yoshikawa, K.; Zane, S.

2011-01-01

ORIGIN is a proposal for the M3 mission call of ESA aimed at the study of metal creation from the epoch of cosmic dawn. Using high-spectral resolution in the soft X-ray band, ORIGIN will be able to identify the physical conditions of all abundant elements between C and Ni to red-shifts of z=10, and beyond. The mission will answer questions such as: When were the first metals created? How does the cosmic metal content evolve? Where do most of the metals reside in the Universe? What is the role of metals in structure formation and evolution? To reach out to the early Universe ORIGIN will use Gamma-Ray Bursts (GRBs) to study their local environments in their host galaxies. This requires the capability to slew the satellite in less than a minute to the GRB location. By studying the chemical composition and properties of clusters of galaxies we can extend the range of exploration to lower redshifts (z ~ 0.2). For this task we need a high-resolution spectral imaging instrument with a large field of view. Using the ...

Technologies for Low Frequency Radio Observations of the Cosmic Dawn

Science.gov (United States)

Jones, Dayton L.

2014-01-01

The Jet Propulsion Laboratory (JPL) is developing concepts and technologies for low frequency radio astronomy space missions aimed at observing highly redshifted neutral Hydrogen from the Dark Ages. This is the period of cosmic history between the recombination epoch when the microwave background radiation was produced and the re-ionization of the intergalactic medium by the first generation of stars (Cosmic Dawn). This period, at redshifts greater than about 20, is a critical epoch for the formation and evolution of large-scale structure in the universe. The 21-cm spectral line of Hydrogen provides the most promising method for directly studying the Dark Ages, but the corresponding frequencies at such large redshifts are only tens of MHz and thus require space-based observations to avoid terrestrial RFI and ionospheric absorption and refraction. This paper reports on the status of several low frequency technology development activities at JPL, including deployable bi-conical dipoles for a planned lunar-orbiting mission, and both rover-deployed and inflation-deployed long dipole antennas for use on the lunar surface.

"The Voyage of the Dawn Treader": The World at the Dawn of 2006-2011. Understanding societal themes

Directory of Open Access Journals (Sweden)

Sanchen Henning

2014-01-01

Full Text Available This article offers a snapshot of the societal dynamics of individual countries around the world, integrated into a global view to provide the tourism and hospitality industry insight into potential customer needs and perceptions. The OPUS Reports on the Global Dynamics at the Dawn of 20...are published annually since 2006 in the Journal of Organisational and Social Dynamics in London. The researchers were interested in a metaphoric tour of the world's social dynamics over time as perceived from both the Systems psychodynamics and Positive psychology theoretical paradigms. The research methodology was qualitative using a case study approach where each of the six (2006- 2011 years' integrated hypotheses was studied as a separate case study. The six cases were integrated into new hypotheses reflecting how global social dynamics changed over the years. The findings were presented as hypotheses per individual country followed by an integrated global hypothesis. The three main emerging themes were framed as Identity, Hope and Love. Identity contains the sub-theme of Facelessness, described as the fragmentation of cultures, a loss of cultural identity and a search for shared social meaning. Hope embodies the theme Knight/s in shining armour which describes youth as saviours and Obama as saviour. The loss of Hope is illustrated by the sub-themes of the impotence of the older generation, pessimism, fear and the death of a way of life. Love consists of human connection described as affiliation, support and trust. The lack of Love consists of human alienation described as loneliness, aggression and violence. The findings of the study identify societal themes that can be operationalized in the tourism and hospitality industry through targeted offerings to provide in the unmet needs of society. In addition, training interventions to improve customer service and return on investment can be based on the findings of this research.

Mortality and community changes drive sudden oak death impacts on litterfall and soil nitrogen cycling.

Science.gov (United States)

Cobb, Richard C; Eviner, Valerie T; Rizzo, David M

2013-10-01

Few studies have quantified pathogen impacts to ecosystem processes, despite the fact that pathogens cause or contribute to regional-scale tree mortality. We measured litterfall mass, litterfall chemistry, and soil nitrogen (N) cycling associated with multiple hosts along a gradient of mortality caused by Phytophthora ramorum, the cause of sudden oak death. In redwood forests, the epidemiological and ecological characteristics of the major overstory species determine disease patterns and the magnitude and nature of ecosystem change. Bay laurel (Umbellularia californica) has high litterfall N (0.992%), greater soil extractable NO3 -N, and transmits infection without suffering mortality. Tanoak (Notholithocarpus densiflorus) has moderate litterfall N (0.723%) and transmits infection while suffering extensive mortality that leads to higher extractable soil NO3 -N. Redwood (Sequoia sempervirens) has relatively low litterfall N (0.519%), does not suffer mortality or transmit the pathogen, but dominates forest biomass. The strongest impact of pathogen-caused mortality was the potential shift in species composition, which will alter litterfall chemistry, patterns and dynamics of litterfall mass, and increase soil NO3 -N availability. Patterns of P. ramorum spread and consequent mortality are closely associated with bay laurel abundances, suggesting this species will drive both disease emergence and subsequent ecosystem function. © 2013 The Authors. New Phytologist © 2013 New Phytologist Trust.

Sudden Oak Death-Induced Tanoak Mortality in Coast Redwood Forests: Current and Predicted Impacts to Stand Structure

Directory of Open Access Journals (Sweden)

Kevin L. O’Hara

2010-08-01

Full Text Available Tanoak (Notholithocarpus densiflorus syn. Lithocarpus densiflorus is one of the most widespread and abundant associates of coast redwood (Sequoia sempervirens, but little is known about the structural relationships between these two species. Knowledge of such relationships is essential for a thorough understanding of the impacts of sudden oak death (caused by the exotic pathogen Phytophthora ramorum, which is currently decimating tanoak populations throughout the redwood range. In this study, we utilized a stratified plot design and a stand reconstruction technique to assess structural impacts, at present and in the future, of this emerging disease. We found that residual trees in diseased plots were more aggregated than trees in unaffected plots, and we predicted that the loss of tanoak will lead to the following short-term changes: greater average diameter, height, height-to-live-crown, and crown length, as well as an increase in average nearest neighbor differences for diameter, height, and crown length. In addition, plots lacking tanoak (living or dead—as compared to plots with tanoak—exhibited greater average diameter and increased nearest neighbor differences with regard to diameter, height, and crown length. We also conducted a preliminary exploration of how sudden oak death-induced structural changes compare with typical old-growth characteristics, and how this disease may affect the structure of old-growth forests.

mobile Digital Access to a Web-enhanced Network (mDAWN): Assessing the Feasibility of Mobile Health Tools for Self-Management of Type-2 Diabetes.

Science.gov (United States)

Ho, Kendall; Newton, Lana; Boothe, Allison; Novak-Lauscher, Helen

2015-01-01

The mobile Digital Access to a Web-enhanced Network (mDAWN) program was implemented as an online, mobile self-management system to support patients with type-2 diabetes and their informal caregivers. Patients used wireless physiological sensors, received text messages, and had access to a secure web platform with health resources and semi-facilitated discussion forum. Outcomes were evaluated using (1) pre and post self-reported health behavior measures, (2) physiological outcomes, (3) program cost, and (4) in-depth participant interviews. The group had significantly decreased health distress, HbA1c levels, and systolic blood pressure. Participants largely saw the mDAWN as providing good value for the costs involved and found the program to be empowering in gaining control over their diabetes. mHealth programs have the potential to improve clinical outcomes through cost effective patient-led care for chronic illness. Further evaluation needs to examine integration of similar mHealth programs into the patient-physician relationship.

Understanding Creation: Cosmology at the Dawn of the 21st Century

Science.gov (United States)

Lang, Andrew E.

1997-01-01

Cosmology attempts to answer questions concerning the origin of the universe, the way in which it evolves, and the way in which it will end. These are ancient questions that fascinate humanity and attendant metaphysical answers predate recorded history. The dawn of the 21st century has witnessed the first scientific answers. The goal of modern cosmology is to determine the basic properties of the universe. Numerous discoveries have been made in the last century which have had a profound influence on cosmology such as the expansion of the universe and the existence of the cosmic microwave background (CMB). CMB and other phenomena act as fossils for cosmologists who attempt to characterize the early universe through an interpretive methodology similar to that of archaeologists. Programs and tools such as NASA's Cosmic Background Explorer (COBE) have been designed to illuminate the morphologic history of the universe including the big bang theory and the current density of the universe. In this primer for cosmology, these and other discoveries and postulations are discussed.

Isozyme markers associated with O3 tolerance indicate shift in genetic structure of ponderosa and Jeffrey pine in Sequoia National Park, California

International Nuclear Information System (INIS)

Staszak, J.; Grulke, N.E.; Marrett, M.J.; Prus-Glowacki, W.

2007-01-01

Effects of canopy ozone (O 3 ) exposure and signatures of genetic structure using isozyme markers associated with O 3 tolerance were analyzed in ∼20-, ∼80-, and >200-yr-old ponderosa (Pinus ponderosa Dougl. ex Laws.) and Jeffrey pine (Pinus jeffreyi Grev. and Balf.) in Sequoia National Park, California. For both species, the number of alleles and genotypes per loci was higher in parental trees relative to saplings. In ponderosa pine, the heterozygosity value increased, and the fixation index indicated reduction of homozygosity with increasing tree age class. The opposite tendencies were observed for Jeffrey pine. Utilizing canopy attributes known to be responsive to O 3 exposure, ponderosa pine was more symptomatic than Jeffrey pine, and saplings were more symptomatic than old growth trees. We suggest that these trends are related to differing sensitivity of the two species to O 3 exposure, and to higher O 3 exposures and drought stress that younger trees may have experienced during germination and establishment. - Genetic variation in isozyme markers associated with ozone tolerance differed between parental trees and their progeny in two closely related species of yellow pine

On the Occurrence of Magnetic Reconnection Along the Dawn and Dusk Magnetopause

Science.gov (United States)

Petrinec, S. M.; Burch, J. L.; Fuselier, S. A.; Trattner, K. J.; Gomez, R. G.; Giles, B. L.; Pollock, C.; Russell, C. T.; Strangeway, R. J.

2017-12-01

Magnetic reconnection is recognized as the primary process by which bulk solar wind plasma is able to enter the magnetosphere. The amount of plasma and energy transport is affected by the reconnection rate along the reconnection line as well as the spatial extent of the reconnection line. These parameters are in turn influenced by parameters such as the orientation of the interplanetary magnetic field (IMF), the dipole tilt angle of the Earth, and the local change in plasma beta between the magnetosheath and magnetosphere. Local variations of magnetosheath parameters are influenced by the character of the standing bow shock upstream of the observing location; i.e., there is greater variation downstream of the quasi-parallel shock than downstream of the quasi-perpendicular shock. Observations from the MMS mission are used to examine the occurrence of quasi-steady magnetic reconnection along the dawn and dusk regions of the magnetopause, and to determine the influence of local magnetosheath variations on the characteristics of the extended reconnection line.

Estimating the spatial and temporal distribution of species richness within Sequoia and Kings Canyon National Parks.

Directory of Open Access Journals (Sweden)

Steve Wathen

Full Text Available Evidence for significant losses of species richness or biodiversity, even within protected natural areas, is mounting. Managers are increasingly being asked to monitor biodiversity, yet estimating biodiversity is often prohibitively expensive. As a cost-effective option, we estimated the spatial and temporal distribution of species richness for four taxonomic groups (birds, mammals, herpetofauna (reptiles and amphibians, and plants within Sequoia and Kings Canyon National Parks using only existing biological studies undertaken within the Parks and the Parks' long-term wildlife observation database. We used a rarefaction approach to model species richness for the four taxonomic groups and analyzed those groups by habitat type, elevation zone, and time period. We then mapped the spatial distributions of species richness values for the four taxonomic groups, as well as total species richness, for the Parks. We also estimated changes in species richness for birds, mammals, and herpetofauna since 1980. The modeled patterns of species richness either peaked at mid elevations (mammals, plants, and total species richness or declined consistently with increasing elevation (herpetofauna and birds. Plants reached maximum species richness values at much higher elevations than did vertebrate taxa, and non-flying mammals reached maximum species richness values at higher elevations than did birds. Alpine plant communities, including sagebrush, had higher species richness values than did subalpine plant communities located below them in elevation. These results are supported by other papers published in the scientific literature. Perhaps reflecting climate change: birds and herpetofauna displayed declines in species richness since 1980 at low and middle elevations and mammals displayed declines in species richness since 1980 at all elevations.

Evolution of asteroid (4) Vesta in the light of Dawn

Science.gov (United States)

Thangjam, Guneshwar; Mengel, Kurt; Nathues, Andreas; Schmidt, Kai H.; Hoffmann, Martin

2016-04-01

Asteroid (4) Vesta has been visited by the NASA Dawn spacecraft in 2011/12. The combination of compositional/elemental information from the three onboard instruments with mineralogical information from the howardite-eucrite-diogenite (HED) clan of stony achondrites has shed new light on the surface lithologic heterogeneity and the early evolution. Although petrologic/chemical models have tried to unravel the evolutionary processes, inconsistencies exist for some chemical major element/phase [e.g., 1, 2]. A revised evolutionary model is presented here [3]. The three oxygen isotope signature of HEDs and, thus, of proto-Vesta is best met by a mixture of 80% ordinary plus 20 % CV chondrites. Assuming a 27Al-triggered magma ocean within the first MA after accretion and taking into account the reliable major element data of the silicate fraction of the chondritic mixture results a crystallization sequence that differs from the earlier models [1, 2, 3]. The crystallized phase obtained by 'MELTS' software [4] starts with olivine and continues with minor olivine plus orthopyroxene until the liquid reaches a Kd value (partition coefficient) of 0.31 where the fractionated melt is in equilibrium with the residual liquid [5]. The abundance of minerals and rocks formed in this model are converted in volume proportions assuming a spherical shape of early Vesta (262 km radius) with a core (FeNi, FeNiS) radius of 110 km [6]. Two scenarios are considered to describe the early bulk silicate Vesta. First, the early-crystallized olivine accumulated at the base of the silicate shell is accounted for a dunitic lower mantle having a thickness of 46 km while the later crystallized phases form an orthopyroxenitic upper mantle and a crust of thickness 84 and 22 km, respectively. Second, an olivine-rich lower mantle that gradually changes to orthopyroxene-rich upper mantle is expected having an overall shell thickness of 137 km, with a 15 km thick crust. An important result is that the deep

The control of auroral zone dynamics and thermodynamics by the interplanetary magnetic field dawn-dusk (Y) component

International Nuclear Information System (INIS)

Sica, R.J.; Hernandez, G.; Emery, B.A.; Roble, R.G.; Smith, R.W.; Rees, M.H.

1989-01-01

Previous theoretical and experimental studies have shown that the dawn-dusk component of the interplanetary magnetic field (IMF B y ) expands the classical symmetric two-cell convection pattern toward dusk (B y negative) or toward dawn (B y positive) in the northern hemisphere, altering the ion drag forcing on the neutral atmosphere. Measurements of the neutral dynamics associated with these convection patterns have been presented primarily at magnetic latitudes greater than 70 degree in the polar cap. In this study, nights with coincident IMF measurements have been selected from the extensive four-year auroral zone thermospheric wind and temperature data set derived from Fabry-Perot spectrometer measurements of the Doppler shifts and widths of the O( 1 D) 15,867 cm -1 (630.0 nm) emission from College, Alaska. Averages from 112 nights of measurements from College were also computed using a selection criterion that depended on the previous 2 hours of IMF measurements (case 2). This procedure yielded averages that differed at times from case 1. The wind and temperature averages for both cases show large variations with B y in the auroral zone. The wind averages for B y negative and positive are compared with National Center for Atmospheric Research thermospheric general circulation model predictions that use a B y -dependent model of ionospheric convection. The results for B y negative and positive are compared with National Center for Atmospheric Research thermospheric general circulation model predictions that use a B y -dependent model of ionospheric convection. The results for B y negative compare favorably with the averages, but there are significant differences between model calculations and averages for the B y positive case

Constraints on Ceres' Internal Structure and Evolution From Its Shape and Gravity Measured by the Dawn Spacecraft

Science.gov (United States)

Ermakov, A. I.; Fu, R. R.; Castillo-Rogez, J. C.; Raymond, C. A.; Park, R. S.; Preusker, F.; Russell, C. T.; Smith, D. E.; Zuber, M. T.

2017-11-01

Ceres is the largest body in the asteroid belt with a radius of approximately 470 km. In part due to its large mass, Ceres more closely approaches hydrostatic equilibrium than major asteroids. Pre-Dawn mission shape observations of Ceres revealed a shape consistent with a hydrostatic ellipsoid of revolution. The Dawn spacecraft Framing Camera has been imaging Ceres since March 2015, which has led to high-resolution shape models of the dwarf planet, while the gravity field has been globally determined to a spherical harmonic degree 14 (equivalent to a spatial wavelength of 211 km) and locally to 18 (a wavelength of 164 km). We use these shape and gravity models to constrain Ceres' internal structure. We find a negative correlation and admittance between topography and gravity at degree 2 and order 2. Low admittances between spherical harmonic degrees 3 and 16 are well explained by Airy isostatic compensation mechanism. Different models of isostasy give crustal densities between 1,200 and 1,400 kg/m3 with our preferred model giving a crustal density of 1,287+70-87 kg/m3. The mantle density is constrained to be 2,434+5-8 kg/m3. We compute isostatic gravity anomaly and find evidence for mascon-like structures in the two biggest basins. The topographic power spectrum of Ceres and its latitude dependence suggest that viscous relaxation occurred at the long wavelengths (>246 km). Our density constraints combined with finite element modeling of viscous relaxation suggests that the rheology and density of the shallow surface are most consistent with a rock, ice, salt and clathrate mixture.

Isozyme markers associated with O{sub 3} tolerance indicate shift in genetic structure of ponderosa and Jeffrey pine in Sequoia National Park, California

Energy Technology Data Exchange (ETDEWEB)

Staszak, J. [A Mickiewicz University, Genetics Department, ul. Umultowska 89, 61-614 Poznan (Poland); Grulke, N.E. [USDA Forest Service, 4955 Canyon Crest Drive, Riverside, CA 92507 (United States)], E-mail: ngrulke@fs.fed.us; Marrett, M.J. [5184 Tower Road, Riverside, CA 92506 (United States); Prus-Glowacki, W. [A Mickiewicz University, Genetics Department, ul. Umultowska 89, 61-614 Poznan (Poland)

2007-10-15

Effects of canopy ozone (O{sub 3}) exposure and signatures of genetic structure using isozyme markers associated with O{sub 3} tolerance were analyzed in {approx}20-, {approx}80-, and >200-yr-old ponderosa (Pinus ponderosa Dougl. ex Laws.) and Jeffrey pine (Pinus jeffreyi Grev. and Balf.) in Sequoia National Park, California. For both species, the number of alleles and genotypes per loci was higher in parental trees relative to saplings. In ponderosa pine, the heterozygosity value increased, and the fixation index indicated reduction of homozygosity with increasing tree age class. The opposite tendencies were observed for Jeffrey pine. Utilizing canopy attributes known to be responsive to O{sub 3} exposure, ponderosa pine was more symptomatic than Jeffrey pine, and saplings were more symptomatic than old growth trees. We suggest that these trends are related to differing sensitivity of the two species to O{sub 3} exposure, and to higher O{sub 3} exposures and drought stress that younger trees may have experienced during germination and establishment. - Genetic variation in isozyme markers associated with ozone tolerance differed between parental trees and their progeny in two closely related species of yellow pine.

Characterization of Cypress Wood for Kraft Pulp Production

Directory of Open Access Journals (Sweden)

António J. A. Santos

2014-06-01

Full Text Available Wood samples of Cupressus arizonica, C. lusitanica, and C. sempervirens were evaluated for chemical, anatomical, and pulp characteristics as raw material for pulp production. Two 17-year-old trees per species were harvested, and wood samples were taken at a height of 2 m. Wood chips from Pinus pinaster (Portugal and P. sylvestris (Finland were used as references. C. arizonica differed from C. lusitanica and C. sempervirens with significantly lower (p < 0.05 tracheid diameter and wall thickness in the earlywood. The total extractives contents were 3.9%, 3.3%, and 2.5% for C. lusitanica, C. sempervirens, and C. arizonica, respectively, lower than the 5.1% for P. pinaster and 4.5% for P. sylvestris. Klason lignin content ranged from 33.0 to 35.6%, higher than the 28.0 to 28.7% for the pinewoods. The kraft pulp yields for C. arizonica, C. lusitanica, and C. sempervirens were 37.7%, 36.7%, and 38.7%, respectively, with kappa numbers of 32.0, 31.6, and 28.7, respectively; the yield values were 40.8% and 42.8%, with kappa numbers of 23.4 and 21.0, for P. pinaster and P. sylvestris, respectively. The cypress species are clearly different from pine in relation to wood pulping behavior. Among the cypress, C. sempervirens provided the best pulping results.

Internal lecture: The dawn of the Standard Model's revolution | 6 June | Main Auditorium

CERN Multimedia

2014-01-01

"The dawn of the Standard Model's revolution", by Luigi di Lella and Alvaro de Rujula.   Alvaro de Rujula. 15:30 - 16:20: Lecture by Alvaro de Rujula (followed by 20 minutes of questions) Abstract In the few years around November 1974, particle physics changed very significantly and at a frantic pace. Practitioners began to get accustomed to the successful predictions of the Standard Model, which did not have many believers at that time. I shall recall the main experimental and theoretical advances, concerning in particular quarks as partons, the asymptotic freedom of QCD, charmonia and the first openly charmed particles. Career Alvaro de Rújula was at Harvard University during the Standard Model revolution. Before and after, amongst many other places, he worked at CERN.   16:40 - 17:00: Coffee break   Luigi di Lella. 17:00 - 17:50: Lecture by Luigi di Lella: Experiments at CERN in the decade 1964-1974 (followed by 20 minut...

Plant Uptake of Atmospheric Carbonyl Sulfide in Coast Redwood Forests

Science.gov (United States)

Campbell, J. E.; Whelan, M. E.; Berry, J. A.; Hilton, T. W.; Zumkehr, A.; Stinecipher, J.; Lu, Y.; Kornfeld, A.; Seibt, U.; Dawson, T. E.; Montzka, S. A.; Baker, I. T.; Kulkarni, S.; Wang, Y.; Herndon, S. C.; Zahniser, M. S.; Commane, R.; Loik, M. E.

2017-12-01

The future resilience of coast redwoods (Sequoia sempervirens) is now of critical concern due to the detection of a 33% decline in California coastal fog over the 20th century. However, ecosystem-scale measurements of photosynthesis and stomatal conductance are challenging in coast redwood forests, making it difficult to anticipate the impacts of future changes in fog. To address this methodological problem, we explore coastal variations in atmospheric carbonyl sulfide (COS or OCS), which could potentially be used as a tracer of these ecosystem processes. We conducted atmospheric flask campaigns in coast redwood sites, sampling at surface heights and in the canopy ( 70 m), at the University of California Landels-Hill Big Creek Reserve and Big Basin State Park. We simulated COS atmosphere-biosphere exchange with a high-resolution 3-D model to interpret these data. Flask measurements indicated a persistent daytime drawdown between the coast and the downwind forest (45 ± 6 ppt COS) that is consistent with the expected relationship between COS plant uptake, stomatal conductance, and gross primary production. Other sources and sinks of COS that could introduce noise to the COS tracer technique (soils, anthropogenic activity, nocturnal plant uptake, and surface hydrolysis on leaves) are likely to be small relative to daytime COS plant uptake. These results suggest that COS measurements may be useful for making ecosystem-scale estimates of carbon, water, and energy exchange in coast redwood forests.

Imaging the redshifted 21 cm pattern around the first sources during the cosmic dawn using the SKA

Science.gov (United States)

Ghara, Raghunath; Choudhury, T. Roy; Datta, Kanan K.; Choudhuri, Samir

2017-01-01

Understanding properties of the first sources in the Universe using the redshifted H I 21 cm signal is one of the major aims of present and upcoming low-frequency experiments. We investigate the possibility of imaging the redshifted 21 cm pattern around the first sources during the cosmic dawn using the SKA1-low. We model the H I 21 cm image maps, appropriate for the SKA1-low, around the first sources consisting of stars and X-ray sources within galaxies. In addition to the system noise, we also account for the astrophysical foregrounds by adding them to the signal maps. We find that after subtracting the foregrounds using a polynomial fit and suppressing the noise by smoothing the maps over 10-30 arcmin angular scale, the isolated sources at z ˜ 15 are detectable with the ˜4σ-9σ confidence level in 2000 h of observation with the SKA1-low. Although the 21 cm profiles around the sources get altered because of the Gaussian smoothing, the images can still be used to extract some of the source properties. We account for overlaps in the patterns of the individual sources by generating realistic H I 21 cm maps of the cosmic dawn that are based on N-body simulations and a one-dimensional radiative transfer code. We find that these sources should be detectable in the SKA1-low images at z = 15 with a signal-to-noise ratio (SNR) of ˜14(4) in 2000 (200) h of observations. One possible observational strategy thus could be to observe multiple fields for shorter observation times, identify fields with SNR ≳ 3 and observe these fields for much longer duration. Such observations are expected to be useful in constraining the parameters related to the first sources.

A preliminary global geologic map of Vesta based on Dawn Survey orbit data

Science.gov (United States)

Yingst, R.; Williams, D. A.; Garry, W. B.; Mest, S. C.; Petro, N. E.; Buczkowski, D.; Schenk, P.; Jaumann, R.; Pieters, C. M.; Roatsch, T.; Preusker, F.; Nathues, A.; LeCorre, L.; Reddy, V.; Russell, C. T.; Raymond, C. A.; DeSanctis, C.; Ammannito, E.; Filacchione, G.

2011-12-01

NASA's Dawn spacecraft arrived at the asteroid 4Vesta on July 15, 2011, and is now collecting imaging, spectroscopic, and elemental abundance data during its one-year orbital mission. As part of the geological analysis of the surface, we have utilized images and data from the Survey orbital sequence to produce a global map of Vesta's surface. Unit boundaries and feature characteristics were determined primarily from morphologic analysis of image data; projected Framing Camera (FC) images were used as the base map. Spectral information from FC and VIR are used to refine unit contacts and to separate compositional distinctions from differences arising from illumination or other factors. Those units that could be discerned both in morphology and in the color data were interpreted as geologically distinct units. Vesta's surface is highly-cratered; differences in color and albedo are possible indicators of varying thicknesses and areal extents of crater ejecta. The most prominent candidate impact feature dominates the south pole. This feature consists of a depression roughly circular in shape, with a central hill that is characterized by smoother texture and lower albedo distinctive from the lower-lying surrounding terrain. A complex network of deep troughs and ridges cuts through the floor of the feature. Many of these troughs trend north-south, while others appear circumferential to the hill and are truncated by or terminate at orthogonal ridges/grooves. Detailed mapping of these features will provide information on their orientations, possible origin(s), and their relationship, if any, to the central hill. The equator of Vesta is also girdled by a wide set of flat-floored troughs. Their orientation implies that their formation is related to the south polar structure. Several regions on Vesta have a concentration of craters displaying low-albedo interiors or exteriors. These craters may have an exogenic origin, or may be the result of excavation of a thin sub

Red Dawn – the final episode of the Cold war

Directory of Open Access Journals (Sweden)

Ivan Kovačević

2016-02-01

Full Text Available In the period of renewal of the Cold war, after 1980, movies which abandon the idea of the dentate appear, and they represent the response to Soviet expansion taking place under the auspices of diminished military confrontation. Of course, the Hollywood reaction to the real expansion of communism was not at adequate response, but it is a part of the wider restructuring of American politics regarding the Soviet Union, which was evidenced by strengthening defenses through the Strategic Defense Initiative (SDI, forcible intervention in Grenada, helping anti-communist movements around the world etc. In opposition to part of the US political scene which shut down attempts to stop the spread of communism across the world, action through popular culture, especially film, created a new climate in which multifaceted pressures on the socialist block were prepared. The movie Red Dawn can be considered part of the reaction of US politics on the particularistic view of the dentate as a shield for military and political spread of the USSR in Africa and other parts of the world. This pressure played on the inherent weaknesses of Soviet society in the 1980’s, a society which, after a brief period of failed transformation fell apart at the start of the final decade of the 20th century.

Dark-ages reionization and galaxy formation simulation - XII. Bubbles at dawn

Science.gov (United States)

Geil, Paul M.; Mutch, Simon J.; Poole, Gregory B.; Duffy, Alan R.; Mesinger, Andrei; Wyithe, J. Stuart B.

2017-12-01

The direct detection of regions of ionized hydrogen (H II) has been suggested as a promising probe of cosmic reionization. Observing the redshifted 21-cm signal of hydrogen from the epoch of reionization (EoR) is a key scientific driver behind new-generation, low-frequency radio interferometers. We investigate the feasibility of combining low-frequency observations with the Square Kilometre Array and near infra-red survey data of the Wide-Field Infrared Survey Telescope to detect cosmic reionization by imaging H II bubbles surrounding massive galaxies during the cosmic dawn. While individual bubbles will be too small to be detected, we find that by stacking redshifted 21-cm spectra centred on known galaxies, it will be possible to directly detect the EoR at z ∼ 9-12, and to place qualitative constraints on the evolution of the spin temperature of the intergalactic medium (IGM) at z ≳ 9. In particular, given a detection of ionized bubbles using this technique, it is possible to determine if the IGM surrounding them is typically in absorption or emission. Determining the globally averaged neutral fraction of the IGM using this method will prove more difficult due to degeneracy with the average size of H II regions.

Geologic Mapping Results for Ceres from NASA's Dawn Mission

Science.gov (United States)

Williams, D. A.; Mest, S. C.; Buczkowski, D.; Scully, J. E. C.; Raymond, C. A.; Russell, C. T.

2017-12-01

NASA's Dawn Mission included a geologic mapping campaign during its nominal mission at dwarf planet Ceres, including production of a global geologic map and a series of 15 quadrangle maps to determine the variety of process-related geologic materials and the geologic history of Ceres. Our mapping demonstrates that all major planetary geologic processes (impact cratering, volcanism, tectonism, and gradation (weathering-erosion-deposition)) have occurred on Ceres. Ceres crust, composed of altered and NH3-bearing silicates, carbonates, salts and 30-40% water ice, preserves impact craters and all sizes and degradation states, and may represent the remains of the bottom of an ancient ocean. Volcanism is manifested by cryovolcanic domes, such as Ahuna Mons and Cerealia Facula, and by explosive cryovolcanic plume deposits such as the Vinalia Faculae. Tectonism is represented by several catenae extending from Ceres impact basins Urvara and Yalode, terracing in many larger craters, and many localized fractures around smaller craters. Gradation is manifested in a variety of flow-like features caused by mass wasting (landslides), ground ice flows, as well as impact ejecta lobes and melts. We have constructed a chronostratigraphy and geologic timescale for Ceres that is centered around major impact events. Ceres geologic periods include Pre-Kerwanan, Kerwanan, Yalodean/Urvaran, and Azaccan (the time of rayed craters, similar to the lunar Copernican). The presence of geologically young cryovolcanic deposits on Ceres surface suggests that there could be warm melt pockets within Ceres shallow crust and the dwarf planet remain geologically active.

Evidence of sub-optimal sleep in adolescent Middle Eastern academy soccer players which is exacerbated by sleep intermission proximal to dawn.

Science.gov (United States)

Fowler, Peter M; Paul, Darren J; Tomazoli, Gustavo; Farooq, Abdulaziz; Akenhead, Richard; Taylor, Lee

2017-10-01

The purpose was to assess sleep patterns, quantity and quality in adolescent (16.2 ± 1.2 yr) Middle Eastern academy soccer players (n = 20) and the influence of an intermission upon these characteristics. On a 17-day training camp (located one time zone west of home) including three discrete matches, sleep was assessed pre- (PRE) and post-match (POST) via wrist actigraphy. Retrospective actigraphy analysis identified sleep characteristics, including if players experienced a sleep intermission (YES) or not (NO) proximal to dawn, and bedtime (hh:mm), get-up time (hh:mm), time in bed (h), sleep duration (h) and sleep efficiency (%). Within YES two bouts were identified (BOUT1 and BOUT2). No differences were seen between PRE and POST, nor between BOUT1 and BOUT2 (p > .05). Overall players did not meet National Sleep Foundation (NSF) guidelines (7:04 ± 1:16 h vs. recommended 8-10 h for 14-17 yr). Sleep duration was significantly reduced (∼ -13% or -1:06) in YES compared to NO (6:33 ± 1:05 vs. 7:29 ± 1:17, p sleep durations relative to NSF guidelines, with decrements increased by an intermission proximal to dawn. High inter- and intra-individual variance in the players sleep characteristics indicates the need for individualized sleep education strategies and interventions to promote appropriate sleep.

Bayesian constraints on the global 21-cm signal from the Cosmic Dawn

Science.gov (United States)

Bernardi, G.; Zwart, J. T. L.; Price, D.; Greenhill, L. J.; Mesinger, A.; Dowell, J.; Eftekhari, T.; Ellingson, S. W.; Kocz, J.; Schinzel, F.

2016-09-01

The birth of the first luminous sources and the ensuing epoch of reionization are best studied via the redshifted 21-cm emission line, the signature of the first two imprinting the last. In this work, we present a fully Bayesian method, HIBAYES, for extracting the faint, global (sky-averaged) 21-cm signal from the much brighter foreground emission. We show that a simplified (but plausible) Gaussian model of the 21-cm emission from the Cosmic Dawn epoch (15 ≲ z ≲ 30), parametrized by an amplitude A_{H I}, a frequency peak ν _{H I} and a width σ _{H I}, can be extracted even in the presence of a structured foreground frequency spectrum (parametrized as a seventh-order polynomial), provided sufficient signal-to-noise (400 h of observation with a single dipole). We apply our method to an early, 19-min-long observation from the Large aperture Experiment to detect the Dark Ages, constraining the 21-cm signal amplitude and width to be -890 6.5 MHz (corresponding to Δz > 1.9 at redshift z ≃ 20) respectively at the 95-per cent confidence level in the range 13.2 ν > 50 MHz).

Unique bioactive polyphenolic profile of guava (Psidium guajava) budding leaf tea is related to plant biochemistry of budding leaves in early dawn.

Science.gov (United States)

Chang, Chi-Huang; Hsieh, Chiu-Lan; Wang, Hui-Er; Peng, Chiung-Chi; Chyau, Charng-Cherng; Peng, Robert Y

2013-03-15

Guava leaf tea (GLT), exhibiting a diversity of medicinal bioactivities, has become a popularly consumed daily beverage. To improve the product quality, a new process was recommended to the Ser-Tou Farmers' Association (SFA), who began field production in 2005. The new process comprised simplified steps: one bud-two leaves were plucked at 3:00-6:00 am, in the early dawn period, followed by withering at ambient temperature (25-28 °C), rolling at 50 °C for 50-70 min, with or without fermentation, then drying at 45-50 °C for 70-90 min, and finally sorted. The product manufactured by this new process (named herein GLTSF) exhibited higher contents (in mg g(-1), based on dry ethyl acetate fraction/methanolic extract) of polyphenolics (417.9 ± 12.3) and flavonoids (452.5 ± 32.3) containing a compositional profile much simpler than previously found: total quercetins (190.3 ± 9.1), total myricetin (3.3 ± 0.9), total catechins (36.4 ± 5.3), gallic acid (8.8 ± 0.6), ellagic acid (39.1 ± 6.4) and tannins (2.5 ± 9.1). We have successfully developed a new process for manufacturing GLTSF with a unique polyphenolic profile. Such characteristic compositional distribution can be ascribed to the right harvesting hour in the early dawn and appropriate treatment process at low temperature, avoiding direct sunlight. © 2012 Society of Chemical Industry.

Dawn of the electronic age electrical technologies in the shaping of the modern world 1914 to 1945

CERN Document Server

Nebeker, Frederik

2009-01-01

Much of the infrastructure of today's industrialized world arose in the period from the outbreak of World War I to the conclusion of World War II. It was during these years that the capabilities of traditional electrical engineering became ubiquitous. Even more importantly, it was during this time that a new type of electrical engineering--electronics--emerged. Because of its applications in communications, entertainment, industry, science and medicine, and the military, the electronics industry became a major part of the economy. Dawn of the Electronic Age explores how this engineering knowledge and its main applications developed in various scientific, economic, and social contexts, and explains how each was profoundly affected by electrical technologies. It takes an international perspective and a narrative approach, unfolding the story chronologically. --from publisher description.

At the dawn of the Anthropocene, a "crude look at the whole"

Science.gov (United States)

Revkin, Andrew

2016-04-01

This lecture provides an informed lay reflection on evidence that, for the first time in planetary history, a species is both a planet-scale force and slowly becoming aware of that potency. The presenter, a veteran science journalist who is also a member of the Anthropocene Working Group, will argue for the value of a rough overview by alluding to Nobelist Murray Gell-mann's stragey for finding meaning in complex systems by taking a "crude look at the whole." The debate around the dawn of the Anthropocene, whether it is accepted as a geological epoch or remains an informal construct, is really a debate about the burdens that come with increased knowledge. Human beings are essentially in a three-pronged race -- between their environmental potency; their awareness of the expressed and potential ramifications of impacts on Earth's operating systems; and growing awareness of the deeply embedded perceptual and behavioral traits that shape how our species does, or doesn't, address certain kinds of risks. The outcome of this race remains an open question, this lecture will argue, and whether the outcome can be judged good or bad is not just a function of more science. The talk will focus on the role of communication innovation in tipping the odds in a positive direction.

A Howardite-Eucrite-Diogenite (HED) Meteorite Compendium: Summarizing Samples of ASteroid 4 Vesta in Preparation for the Dawn Mission

Science.gov (United States)

Garber, J. M.; Righter, K.

2011-01-01

The Howardite-Eucrite-Diogenite (HED) suite of achondritic meteorites, thought to originate from asteroid 4 Vesta, has recently been summarized into a meteorite compendium. This compendium will serve as a guide for researchers interested in further analysis of HEDs, and we expect that interest in these samples will greatly increase with the planned arrival of the Dawn Mission at Vesta in August 2011. The focus of this abstract/poster is to (1) introduce and describe HED samples from both historical falls and Antarctic finds, and (2) provide information on unique HED samples available for study from the Antarctic Meteorite Collection at JSC, including the vesicular eucrite PCA91007, the olivine diogenite EETA79002, and the paired ALH polymict eucrites.

Performance of High-Efficiency Advanced Triple-Junction Solar Panels for the LILT Mission Dawn

Science.gov (United States)

Fatemi, Navid S.; Sharma, Surya; Buitrago, Oscar; Sharps, Paul R.; Blok, Ron; Kroon, Martin; Jalink, Cees; Harris, Robin; Stella, Paul; Distefano, Sal

2005-01-01

NASA's Discovery Mission Dawn is designed to (LILT) conditions. operate within the solar system's Asteroid belt, where the large distance from the sun creates a low-intensity, low-temperature (LILT) condition. To meet the mission power requirements under LlLT conditions, very high-efficiency multi-junction solar cells were selected to power the spacecraft to be built by Orbital Sciences Corporation (OSC) under contract with JPL. Emcore's InGaP/InGaAs/Ge advanced triple-junction (ATJ) solar cells, exhibiting an average air mass zero (AMO) efficiency of greater than 27.6% (one-sun, 28 C), were used to populate the solar panels [1]. The two solar array wings, to be built by Dutch Space, with 5 large- area panels each (total area of 36.4 sq. meters) are projected to produce between 10.3 kWe and 1.3 kWe of end-of life (EOL) power in the 1.0 to 3.0 AU range, respectively. The details of the solar panel design, testing and power analysis are presented.

Vesta and Ceres by the light of Dawn

Science.gov (United States)

Russell, Christopher T.

2015-11-01

Ceres and Vesta are the most massive bodies in the main asteroid belt. They both appear to be intact protoplanets whose growth may have been drastically altered by the concomitant formation of Jupiter.. These two bodies have witnessed 4.6 Ga of solar system history, much, but not all, of which has been recorded in their surfaces. Dawn’s objective is to interview these two witnesses to learn as much as possible about the early epoch. These bodies are protoplanets, our best archetypes of the early building blocks of the terrestrial planets. In particular, siderophile elements in the Earth’s core were probably first segregated in Vesta-like bodies, and its water was likely first condensed in Ceres-like bodies.Many of the basaltic achondrites originated from a common parent body. Dawn verified that Vesta was consistent with that parent body. hence strengthening geochemical inferences from these samples on the formation and evolution of the solar system and supporting hypotheses for their delivery from Vesta to Earth. Ceres has not revealed itself with a meteoritic record. While the surface is scarred with craters, it is probable that the ejecta from the crater-forming event created little competent material from the icy crust and any such ejected projectiles that reached Earth might have disintegrated upon entry into the Earth’s atmosphere.Ceres’ surface differs greatly from Vesta’s. Plastic or fluidized mass wasting is apparent, as are many irregularly shaped craters, including many polygonal crater forms. There are many central-pit craters possibly caused by volatilization of the crust in the center of the impact. There are also many central-peak craters, which were made by rebound or pingo-like formation processes. Bright deposits dot the landscape, which are possibly salt-rich, suggesting fluvial activity beneath the crust. Observations of the brightest spots on Ceres could suggest sublimation from the surface of the bright area, which may be water vapor

Preferences of Coptotermes formosanus Shiraki and Coptotermes gestroi (Wasmann (Blattodea: Rhinotermitidae among Three Commercial Wood Species

Directory of Open Access Journals (Sweden)

Nirmala K. Hapukotuwa

2011-11-01

Full Text Available The Formosan subterranean termite, Coptotermes formosanus Shiraki, and the Asian subterranean termite, Coptotermes gestroi (Wasmann, are both pests of wood in service in Hawaii and Florida. We conducted a laboratory study using method modified from those described in standard E1-09 of the American Wood Protection Association (AWPA 2009 to assess the termite resistance of three commercially available wood species used in regions of the USA where both termite species occur: Douglas fir, Pseudotsuga menziessii, southern yellow pine, Pinus spp. and redwood, Sequoia sempervirens. A multiple-choice (three-choice assay was used for four weeks (28 days in order to simulate field conditions of food choice and assess termite feeding preferences under 28 °C and 72–80% RH. 400 termites (360 workers: 40 soldiers were released into each test jar. Five replicates and two controls of each wood species were used with each termite species. Termite mortality was recorded at the end of the test; and wood wafers were oven-dried and weighed before and after termite exposure to determine the mass loss due to termite feeding, and rated visually on a 0 (failure to 10 (sound scale. There were significant differences in mean mass loss values among the three wood species and between two termite species. The mean mass loss value for redwood was significantly lower than Douglas fir and southern yellow pine with both termite species. However, C. formosanus showed increased feeding on Douglas fir and southern yellow pine compared to C. gestroi.

Forest restoration at Redwood National Park: exploring prescribed fire alternatives to second-growth management: a case study

Science.gov (United States)

Engber, Eamon; Teraoka, Jason; van Mantgem, Phillip J.

2017-01-01

Almost half of Redwood National Park is comprised of second-growth forests characterized by high stand density, deficient redwood composition, and low understory biodiversity. Typical structure of young redwood stands impedes the recovery of old-growth conditions, such as dominance of redwood (Sequoia sempervirens (D. Don) Endl.), distinct canopy layers and diverse understory vegetation. Young forests are commonly comprised of dense, even-aged Douglas-fir (Pseudotsuga menziesii (Mirb.) Franco) and redwood stump sprouts, with simple canopy structure and little understory development. Moreover, many of these young stands are believed to be vulnerable to disturbance in the form of drought, disease and fire. Silvicultural practices are increasingly being employed by conservation agencies to restore degraded forests throughout the coast redwood range; however, prescribed fire treatments are less common and potentially under-utilized as a restoration tool. We present an early synthesis from three separate management-scale prescribed fire projects at Redwood National Park spanning 1to 7 years post-treatment. Low intensity prescribed fire had minimal effect on overstory structure, with some mortality observed in trees smaller than 30 cm diameter. Moderate to high intensity fire may be required to reduce densities of larger Douglas-fir, the primary competitor of redwood in the Park’s second growth forests. Fine woody surface fuels fully recovered by 7 years post-burn, while recruitment of larger surface fuels was quite variable. Managers of coastal redwood ecosystems will benefit by having a variety of tools at their disposal for forest restoration and management.

The right tree for the job? perceptions of species suitability for the provision of ecosystem services.

Science.gov (United States)

Smaill, Simeon J; Bayne, Karen M; Coker, Graham W R; Paul, Thomas S H; Clinton, Peter W

2014-04-01

Stakeholders in plantation forestry are increasingly aware of the importance of the ecosystem services and non-market values associated with forests. In New Zealand, there is significant interest in establishing species other than Pinus radiata D. Don (the dominant plantation species) in the belief that alternative species are better suited to deliver these services. Significant risk is associated with this position as there is little objective data to support these views. To identify which species were likely to be planted to deliver ecosystem services, a survey was distributed to examine stakeholder perceptions. Stakeholders were asked which of 15 tree attributes contributed to the provision of five ecosystem services (amenity value, bioenergy production, carbon capture, the diversity of native habitat, and erosion control/water quality) and to identify which of 22 candidate tree species possessed those attributes. These data were combined to identify the species perceived most suitable for the delivery of each ecosystem service. Sequoia sempervirens (D.Don) Endl. closely matched the stakeholder derived ideotypes associated with all five ecosystem services. Comparisons to data from growth, physiological and ecological studies demonstrated that many of the opinions held by stakeholders were inaccurate, leading to erroneous assumptions regarding the suitability of most candidate species. Stakeholder perceptions substantially influence tree species selection, and plantations established on the basis of inaccurate opinions are unlikely to deliver the desired outcomes. Attitudinal surveys associated with engagement campaigns are essential to improve stakeholder knowledge, advancing the development of fit-for-purpose forest management that provides the required ecosystem services.

Source modelling at the dawn of gravitational-wave astronomy

Science.gov (United States)

Gerosa, Davide

2016-09-01

The age of gravitational-wave astronomy has begun. Gravitational waves are propagating spacetime perturbations ("ripples in the fabric of space-time") predicted by Einstein's theory of General Relativity. These signals propagate at the speed of light and are generated by powerful astrophysical events, such as the merger of two black holes and supernova explosions. The first detection of gravitational waves was performed in 2015 with the LIGO interferometers. This constitutes a tremendous breakthrough in fundamental physics and astronomy: it is not only the first direct detection of such elusive signals, but also the first irrefutable observation of a black-hole binary system. The future of gravitational-wave astronomy is bright and loud: the LIGO experiments will soon be joined by a network of ground-based interferometers; the space mission eLISA has now been fully approved by the European Space Agency with a proof-of-concept mission called LISA Pathfinder launched in 2015. Gravitational-wave observations will provide unprecedented tests of gravity as well as a qualitatively new window on the Universe. Careful theoretical modelling of the astrophysical sources of gravitational-waves is crucial to maximize the scientific outcome of the detectors. In this Thesis, we present several advances on gravitational-wave source modelling, studying in particular: (i) the precessional dynamics of spinning black-hole binaries; (ii) the astrophysical consequences of black-hole recoils; and (iii) the formation of compact objects in the framework of scalar-tensor theories of gravity. All these phenomena are deeply characterized by a continuous interplay between General Relativity and astrophysics: despite being a truly relativistic messenger, gravitational waves encode details of the astrophysical formation and evolution processes of their sources. We work out signatures and predictions to extract such information from current and future observations. At the dawn of a revolutionary

Iron oxide minerals in dust of the Red Dawn event in eastern Australia, September 2009

Science.gov (United States)

Reynolds, Richard L.; Cattle, Stephen R.; Moskowitz, Bruce M.; Goldstein, Harland L.; Yauk, Kimberly; Flagg, Cody B.; Berquó, Thelma S.; Kokaly, Raymond F.; Morman, Suzette A.; Breit, George N.

2014-01-01

Iron oxide minerals typically compose only a few weight percent of bulk atmospheric dust but are important for potential roles in forcing climate, affecting cloud properties, influencing rates of snow and ice melt, and fertilizing marine phytoplankton. Dust samples collected from locations across eastern Australia (Lake Cowal, Orange, Hornsby, and Sydney) following the spectacular “Red Dawn” dust storm on 23 September 2009 enabled study of the dust iron oxide assemblage using a combination of magnetic measurements, Mössbauer spectroscopy, reflectance spectroscopy, and scanning electron microscopy. Red Dawn was the worst dust storm to have hit the city of Sydney in more than 60 years, and it also deposited dust into the Tasman Sea and onto snow cover in New Zealand. Magnetization measurements from 20 to 400 K reveal that hematite, goethite, and trace amounts of magnetite are present in all samples. Magnetite concentrations (as much as 0.29 wt%) were much higher in eastern, urban sites than in western, agricultural sites in central New South Wales (0.01 wt%), strongly suggesting addition of magnetite from local urban sources. Variable temperature Mössbauer spectroscopy (300 and 4.2 K) indicates that goethite and hematite compose approximately 25–45% of the Fe-bearing phases in samples from the inland sites of Orange and Lake Cowal. Hematite was observed at both temperatures but goethite only at 4.2 K, thereby revealing the presence of nanogoethite (less than about 20 nm). Similarly, hematite particulate matter is very small (some of it d < 100 nm) on the basis of magnetic results and Mössbauer spectra. The degree to which ferric oxide in these samples might absorb solar radiation is estimated by comparing reflectance values with a magnetic parameter (hard isothermal remanent magnetization, HIRM) for ferric oxide abundance. Average visible reflectance and HIRM are correlated as a group (r2 = 0.24), indicating that Red Dawn ferric oxides have

Photometric behavior of spectral parameters in Vesta dark and bright regions as inferred by the Dawn VIR spectrometer

Science.gov (United States)

Longobardo, Andrea; Palomba, Ernesto; Capaccioni, Fabrizio; De Sanctis, Maria Cristina; Tosi, Federico; Ammannito, Eleonora; Schröder, Stefan E.; Zambon, Francesca; Raymond, Carol A.; Russell, Christopher T.

2014-09-01

NASA’s Dawn spacecraft orbited Vesta for approximately one year, collecting thousands of hyperspectral images of its surface. The mission revealed that Vesta’s surface shows the largest variations in surface albedo on asteroids visited thus far, due to the presence of dark and bright materials at the local scale (i.e. 0.1-10 km). The aim of this work is to characterize the photometric properties of bright and dark regions, and thus derive and apply an empirical photometric correction to all the hyperspectral observations of Vesta. The very large dataset (i.e. more than 20 million spectra) provided by the VIR imaging spectrometer onboard Dawn enabled accurate statistical analysis of the spectral dataset, aimed at retrieving empirical relations between several spectral parameters (i.e. visible and infrared reflectance, band depths, band centers, Band Area Ratio) and the illumination/viewing angles. The derived relations made it possible to derive photometrically corrected maps of these spectral parameters and to infer information on the regolith shadowing effect in the Vestan dark and bright regions. As an additional analysis, we also evaluated the correlation between surface temperature and band center position. A general conclusion of this analysis is that, from a photometric point of view, the distinction between bright and dark material units lies mainly in the larger contribution due to multiple scattering in the bright units. We observed reflectance and band depth variations over Vesta’s entire surface, but these variations were much larger in the dark regions than in the bright ones. Band centers have been found to shift to longer wavelengths at increasing temperatures, with a trend that is the same observed for HED meteorites (Reddy et al. [2012]. Icarus 217, 153-158). Finally, the Band Area Ratio (i.e. the ratio between areas of the main pyroxene absorption bands located at 1.9 μm and at 0.9 μm, respectively) did not show any dependence on

A comparison of effects from prescribed fires and wildfires managed for resource objectives in Sequoia and Kings Canyon National Parks

Science.gov (United States)

Nesmith, C.B.; Caprio, Anthony C.; Pfaff, Anne H.; McGinnis, Thomas W.; Keeley, Jon E.

2011-01-01

Current goals for prescription burning are focused on measures of fuel consumption and changes in forest density. These benchmarks, however, do not address the extent to which prescription burning meets perceived ecosystem needs of heterogeneity in burning, both for overstory trees and understory herbs and shrubs. There are still questions about how closely prescribed fires mimic these patterns compared to natural wildfires. This study compared burn patterns of prescribed fires and managed unplanned wildfires to understand how the differing burning regimes affect ecosystem properties. Measures of forest structure and fire severity were sampled in three recent prescribed fires and three wildfires managed for resource objectives in Sequoia and Kings Canyon National Parks. Fine scale patterns of fire severity and heterogeneity were compared between fire types using ground-based measures of fire effects on fuels and overstory and understory vegetation. Prescribed fires and wildfires managed for resource objectives displayed similar patterns of overstory and understory fire severity, heterogeneity, and seedling and sapling survival. Variation among plots within the same fire was always greater than between fire types. Prescribed fires can provide burned landscapes that approximate natural fires in many ways. It is recognized that constraints placed on when wildfires managed for resource objectives are allowed to burn freely may bias the range of conditions that might have been experienced under more natural conditions. Therefore they may not exactly mimic natural wildfires. Overall, the similarity in fire effects that we observed between prescribed fires and managed wildfires indicate that despite the restrictions that are often placed on prescribed fires, they appear to be creating post-fire conditions that approximate natural fires when assessed on a fine spatial scale.

Effects of stock use and backpackers on water quality in wilderness in Sequoia and Kings Canyon National Parks, USA

Science.gov (United States)

Clow, David W.; Forrester, Harrison; Miller, Benjamin; Roop, Heidi; Sickman, James O.; Ryu, Hodon; Santo Domingo, Jorge

2013-01-01

During 2010-2011, a study was conducted in Sequoia and Kings Canyon National Parks (SEKI) to evaluate the influence of pack animals (stock) and backpackers on water quality in wilderness lakes and streams. The study had three main components: (1) a synoptic survey of water quality in wilderness areas of the parks, (2) paired water-quality sampling above and below several areas with differing types and amounts of visitor use, and (3) intensive monitoring at six sites to document temporal variations in water quality. Data from the synoptic water-quality survey indicated that wilderness lakes and streams are dilute and have low nutrient and Escherichia coli (E. coli) concentrations. The synoptic survey sites were categorized as minimal use, backpacker use, or mixed use (stock and backpackers), depending on the most prevalent type of use upstream from the sampling locations. Sites with mixed use tended to have higher concentrations of most constituents (including E.coli) than those categorized as minimal-use (p≤0.05); concentrations at backpacker-use sites were intermediate. Data from paired-site sampling indicated that E.coli, total coliform, and particulate phosphorus concentrations were greater in streams downstream from mixed-use areas than upstream from those areas (p≤0.05). Paired-site data also indicated few statistically significant differences in nutrient, E. coli, or total coliform concentrations in streams upstream and downstream from backpacker-use areas. The intensive-monitoring data indicated that nutrient and E. coli concentrations normally were low, except during storms, when notable increases in concentrations of E.coli, nutrients, dissolved organic carbon, and turbidity occurred. In summary, results from this study indicate that water quality in SEKI wilderness generally is good, except during storms; and visitor use appears to have a small, but statistically significant influence on stream water quality.

Dusk but not dawn burrow emergence rhythms of Nephrops norvegicus (Crustacea: Decapoda

Directory of Open Access Journals (Sweden)

Valerio Sbragaglia

2013-10-01

Full Text Available The Norway lobster, Nephrops norvegicus, can be captured by haul nets only during the emergence from its burrow. In the last few decades, an extensive field research revealed distinct diel (24-h–based catchability patterns at different depths. Laboratory experiments suggested that burrow emergence (used as a proxy of catchability is endogenously controlled via a circadian system. Results were usually presented in terms of mean effects without a quantification of inter-individual variability and arrhythmia. Here, we studied the burrow emergence of 52 adult Nephrops by an infrared actograph endowed with an artificial burrow. Animals were exposed to 12-12 h light-darkness cycle, simulating photic condition of the lower shelf. Forty-five animals showed rhythmic emergence (87%, while seven were arrhythmic (13%. Rhythmic animals were clustered according to their timing of emergence: 54% at dusk and 4% at dawn. Moreover, other animals showed fully diurnal or nocturnal emergence (10% and 19%, respectively. The comparison of our results with those derived from temporally scheduled trawling indicates that bimodal catch patterns observed in shelf populations are poorly observed during individual experiments in the laboratory, where the same light conditions are simulated. Nephrops burrow emergence seems to be the result of a mixed endogenous-exogenous control, while arrhythmia could also be present in the wild.

Technologies for low radio frequency observations of the Cosmic Dawn

Science.gov (United States)

Jones, D. L.

2014-03-01

The Jet Propulsion Laboratory (JPL) is developing concepts and technologies for low frequency radio astronomy space missions aimed at observing highly redshifted neutral Hydrogen from the Dark Ages. This is the period of cosmic history between the recombination epoch when the microwave background radiation was produced and the re-ionization of the intergalactic medium by the first generation of stars (Cosmic Dawn). This period, at redshifts z > ~20, is a critical epoch for the formation and evolution of large-scale structure in the universe. The 21-cm spectral line of Hydrogen provides the most promising method for directly studying the Dark Ages, but the corresponding frequencies at such large redshifts are only tens of MHz and thus require space-based observations to avoid terrestrial RFI and ionospheric absorption and refraction. This paper reports on the status of several low frequency technology development activities at JPL, including deployable bi-conical dipoles for a planned lunar-orbiting mission, and both rover-deployed and inflation-deployed long dipole antennas for use on the lunar surface. In addition, recent results from laboratory testing of low frequency receiver designs are presented. Finally, several concepts for space-based imaging interferometers utilizing deployable low frequency antennas are described. Some of these concepts involve large numbers of antennas and consequently a large digital cross-correlator will be needed. JPL has studied correlator architectures that greatly reduce the DC power required for this step, which can dominate the power consumption of real-time signal processing. Strengths and weaknesses of each mission concept are discussed in the context of the additional technology development required.

The influence of prefire tree growth and crown condition on postfire mortality of sugar pine following prescribed fire in Sequoia National Park

Science.gov (United States)

Nesmith, Jonathan C. B.; Das, Adrian J.; O'Hara, Kevin L.; van Mantgem, Phillip J.

2015-01-01

Tree mortality is a vital component of forest management in the context of prescribed fires; however, few studies have examined the effect of prefire tree health on postfire mortality. This is especially relevant for sugar pine (Pinus lambertiana Douglas), a species experiencing population declines due to a suite of anthropogenic factors. Using data from an old-growth mixed-conifer forest in Sequoia National Park, we evaluated the effects of fire, tree size, prefire radial growth, and crown condition on postfire mortality. Models based only on tree size and measures of fire damage were compared with models that included tree size, fire damage, and prefire tree health (e.g., measures of prefire tree radial growth or crown condition). Immediately following the fire, the inclusion of different metrics of prefire tree health produced variable improvements over the models that included only tree size and measures of fire damage, as models that included measures of crown condition performed better than fire-only models, but models that included measures of prefire radial growth did not perform better. However, 5 years following the fire, sugar pine mortality was best predicted by models that included measures of both fire damage and prefire tree health, specifically, diameter at breast height (DBH, 1.37 m), crown scorch, 30-year mean growth, and the number of sharp declines in growth over a 30-year period. This suggests that factors that influence prefire tree health (e.g., drought, competition, pathogens, etc.) may partially determine postfire mortality, especially when accounting for delayed mortality following fire.

Evaluating potential overlap between pack stock and Sierra Nevada bighorn sheep (Ovis canadensis sierrae) in Sequoia and Kings Canyon National Parks, California

Science.gov (United States)

Klinger, Robert C.; Few, Alexandra P.; Knox, Kathleen A.; Hatfield, Brian E.; Clark, Jonathan; German, David W.; Stephenson, Thomas R.

2015-01-01

Pack stock (horses, mules, burros, llamas, and goats) are frequently assumed to have negative effects on public lands, but there is a general lack of data to be able to quantify the degree to which this is actually the case. Sequoia and Kings Canyon National Parks have received complaints that pack stock may affect Sierra Nevada bighorn sheep (Ovis canadensis sierrae; SNBS), a federally endangered subspecies that occurs in largely disjunct herds in the Sierra Nevada Range of California. The potential effects are thought to be displacement of SNBS from meadows on their summer range (altered habitat use) or, more indirectly, through changes in SNBS habitat or forage quality. Our goals were to conduct an association analysis to quantify the degree of potential spatial overlap in meadow use between SNBS and pack stock and to compare differences in vegetation community composition, structure, and diversity among meadows with different levels of use by bighorn sheep and pack stock. For the association analysis, we used two approaches: (1) we quantified the proportion of meadows that were within the herd home ranges of bighorn sheep and were potentially open to pack stock, and, (2) we used Monte Carlo simulations and use-availability analyses to compare the proportion of meadows used by bighorn sheep relative to the proportional occurrence or area of meadows available to bighorn sheep that were used by pack stock. To evaluate potential effects of pack stock on meadow plant communities and SNBS forage, we sampled vegetation in 2011 and 2012 at 100 plots to generate data that allowed us to compare:

Utilizing Remote Sensing Information to Improve Post-fire Rainfall-runoff Predictions after the 2010 Bull Fire in the Sequoia National Forest, CA

Science.gov (United States)

Kinoshita, A. M.; Hale, B.; Hogue, T. S.

2012-12-01

Post-fire management decisions are guided by rainfall-runoff predictions, which ultimately influence downstream treatment and mitigation costs. The current study investigates evolving rainfall-runoff partitioning at the watershed scale over a two-year period after the 2010 Bull Fire which occurred in the southern Sequoia National Forest in California. Stage height was measured at five-minute intervals using pressure transducers, tipping buckets were installed for rainfall duration and intensity, and channel cross-sections were measured approximately every two months to detail sediment deposition or scour. We also utilize remotely sensed vegetation data to evaluate vegetation recovery in the studied watersheds and the corresponding relationship to storm runoff. Normalized Difference Vegetation Index (NDVI), a measure of vegetation greenness, is evaluated for its potential use as a key recovery indicator. Preliminary results focus on alterations in annual and seasonal precipitation and discharge relationships using in-situ data and Landsat NDVI values for the period of study. NDVI values are consistent with a comprehensive burn, with an acute decrease observed in the initial post-fire period. However, vegetation recovery is highly variable in the studied systems and influenced by shorter-term biomass pulses (grasses) while longer-term recovery of other species (chaparral and pine) is ongoing. Runoff ratios are elevated during early storms and show some recovery in the later part of the study period. The ability to accurately and confidently predict post-fire runoff and longer-term recovery is critical for monitoring values-at-risk, reducing mitigation costs, and improving warnings to downstream public communities.

Cluster observations of surface waves on the dawn flank magnetopause

Directory of Open Access Journals (Sweden)

C. J. Owen

2004-03-01

Full Text Available On 14 June 2001 the four Cluster spacecraft recorded multiple encounters of the dawn-side flank magnetopause. The characteristics of the observed electron populations varied between a cold, dense magnetosheath population and warmer, more rarified boundary layer population on a quasi-periodic basis. The demarcation between these two populations can be readily identified by gradients in the scalar temperature of the electrons. An analysis of the differences in the observed timings of the boundary at each spacecraft indicates that these magnetopause crossings are consistent with a surface wave moving across the flank magnetopause. When compared to the orientation of the magnetopause expected from models, we find that the leading edges of these waves are approximately 45° steeper than the trailing edges, consistent with the Kelvin-Helmholtz (KH driving mechanism. A stability analysis of this interval suggests that the magnetopause is marginally stable to this mechanism during this event. Periods in which the analysis predicts that the magnetopause is unstable correspond to observations of greater wave steepening. Analysis of the pulses suggests that the waves have an average wavelength of approximately 3.4 R_E and move at an average speed of ~65km s^-1 in an anti-sunward and northward direction, despite the spacecraft location somewhat south of the GSE Z=0 plane. This wave propagation direction lies close to perpendicular to the average magnetic field direction in the external magnetosheath, suggesting that these waves may preferentially propagate in the direction that requires no bending of these external field lines

Key words. Magnetospheric physics (magnetospheric configuration and dynamics; MHD waves and unstabilities; solar wind-magnetosphere interactions

The prehistory of potyviruses: their initial radiation was during the dawn of agriculture.

Science.gov (United States)

Gibbs, Adrian J; Ohshima, Kazusato; Phillips, Matthew J; Gibbs, Mark J

2008-06-25

Potyviruses are found world wide, are spread by probing aphids and cause considerable crop damage. Potyvirus is one of the two largest plant virus genera and contains about 15% of all named plant virus species. When and why did the potyviruses become so numerous? Here we answer the first question and discuss the other. We have inferred the phylogenies of the partial coat protein gene sequences of about 50 potyviruses, and studied in detail the phylogenies of some using various methods and evolutionary models. Their phylogenies have been calibrated using historical isolation and outbreak events: the plum pox virus epidemic which swept through Europe in the 20th century, incursions of potyviruses into Australia after agriculture was established by European colonists, the likely transport of cowpea aphid-borne mosaic virus in cowpea seed from Africa to the Americas with the 16th century slave trade and the similar transport of papaya ringspot virus from India to the Americas. Our studies indicate that the partial coat protein genes of potyviruses have an evolutionary rate of about 1.15x10(-4) nucleotide substitutions/site/year, and the initial radiation of the potyviruses occurred only about 6,600 years ago, and hence coincided with the dawn of agriculture. We discuss the ways in which agriculture may have triggered the prehistoric emergence of potyviruses and fostered their speciation.

Dynamics and local boundary properties of the dawn-side magnetopause under conditions observed by Equator-S

Directory of Open Access Journals (Sweden)

M. W. Dunlop

Full Text Available Magnetic field measurements, taken by the magnetometer experiment (MAM on board the German Equator-S spacecraft, have been used to identify and categorise 131 crossings of the dawn-side magnetopause at low latitude, providing unusual, long duration coverage of the adjacent magnetospheric regions and near magnetosheath. The crossings occurred on 31 orbits, providing unbiased coverage over the full range of local magnetic shear from 06:00 to 10:40 LT. Apogee extent places the spacecraft in conditions associated with intermediate, rather than low, solar wind dynamic pressure, as it processes into the flank region. The apogee of the spacecraft remains close to the magnetopause for mean solar wind pressure. The occurrence of the magnetopause encounters are summarised and are found to compare well with predicted boundary location, where solar wind conditions are known. Most scale with solar wind pressure. Magnetopause shape is also documented and we find that the magnetopause orientation is consistently sunward of a model boundary and is not accounted for by IMF or local magnetic shear conditions. A number of well-established crossings, particularly those at high magnetic shear, or exhibiting unusually high-pressure states, were observed and have been analysed for their boundary characteristics and some details of their boundary and near magnetosheath properties are discussed. Of particular note are the occurrence of mirror-like signatures in the adjacent magnetosheath during a significant fraction of the encounters and a high number of multiple crossings over a long time period. The latter is facilitated by the spacecraft orbit which is designed to remain in the near magnetosheath for average solar wind pressure. For most encounters, a well-ordered, tangential (draped magnetosheath field is observed and there is little evidence of large deviations in local boundary orientations. Two passes corresponding to close conjunctions of the Geotail spacecraft

Seasonal and diel environmental conditions predict western pond turtle (Emys marmorata) behavior at a perennial and an ephemeral stream in Sequoia National Park, California

Science.gov (United States)

Ruso, Gabrielle; Meyer, Erik; Das, Adrian J.

2017-01-01

Managers making decisions may benefit from a well-informed understanding of a species' population size and trends. Given the cryptic nature and habitat characteristics of the western pond turtle (Emys marmorata), however, imperfect detection may be high and population estimates are frequently varied and unreliable. As a case study to investigate this issue, we used temperature dataloggers to examine turtle behavior at 2 long-term monitoring sites with different hydrological characteristics in Sequoia National Park, California, to determine if common stream-survey techniques are consistent with site-specific turtle behavior. Sycamore Creek is an intermittent stream that dries up every summer while the North Fork Kaweah River flows year-round. We found that while turtles spent most of the recorded time in the water (55% in Sycamore Creek and 82% in the North Fork Kaweah River), the timing of traditional surveys only coincided with the turtles' aquatic activity in the North Fork Kaweah River. At Sycamore Creek, turtles were most likely to be in the water at night. In contrast, failure to detect turtles in North Fork Kaweah River is likely owing to the larger size and complexity of the underwater habitat. In both streams, turtles were also more likely to be in the water in the weeks leading up to important changes in hydroperiods. Our findings illustrate the effects that differences in water permanence can have on turtle behavior within the same watershed and how phenotypic plasticity may then affect detection during surveys. Our study highlights the importance of tailoring survey practices to the site-specific behavioral traits of the target species.

Dawn-dusk asymmetry induced by the Parker spiral angle in the plasma dynamics around comet 67P/Churyumov-Gerasimenko

Science.gov (United States)

Behar, E.; Tabone, B.; Nilsson, H.

2018-05-01

When interacting, the solar wind and the ionised atmosphere of a comet exchange energy and momentum. Our aim is to understand the influence of the average Parker spiral configuration of the solar wind magnetic field on this interaction. We compare the theoretical expectations of an analytical generalised gyromotion with Rosetta observations at comet 67P/Churyumov-Gerasimenko. A statistical approach allows one to overcome the lack of upstream solar wind measurement. We find that additionally to their acceleration along (for cometary pick-up ions) or against (for solar wind ions) the upstream electric field orientation and sense, the cometary pick-up ions are drifting towards the dawn side of the coma, while the solar wind ions are drifting towards the dusk side of the coma, independent of the heliocentric distance. The dynamics of the interaction is not taking place in a plane, as often assumed in previous works.

Dawn-dusk asymmetries and sub-Alfvénic flow in the high and low latitude magnetosheath

Directory of Open Access Journals (Sweden)

M. Longmore

2005-11-01

Full Text Available We present the results of a statistical survey of the magnetosheath using four years of Cluster orbital coverage. Moments of the plasma distribution obtained from the electron and ion instruments together with magnetic field data are used to characterise the flow and density in the magnetosheath. We note two important differences between our survey and the gasdynamic model predictions: a deceleration of the flow at higher latitudes close to the magnetopause, resulting in sub-Alfvénic flow near the cusp, and a dawn-dusk asymmetry with higher velocity magnitudes and lower densities measured on the dusk side of the magnetosheath in the Northern Hemisphere. The latter observation is in agreement with studies carried out by Paularena et al. (2001, Němeček et al. (2000, and Šafránková et al. (2004. In equations of hydrodynamics for a single-component additon to this we observe a reverse of this asymmetry for the Southern Hemisphere. High-latitude sub-Alfvénic flow is thought to be a necessary condition for steady state reconnection pole-ward of the cusp.

One Year of Observations of Dawn at Ceres: Composition as seen by VIR

Science.gov (United States)

De Sanctis, M. Cristina; Ammannito, Eleonora; Ciarniello, Mauro; Raponi, Andrea; Carrozzo, F. Giacomo; Frigeri, Alessandro; Longobardo, Andrea; Palomba, Ernesto; Tosi, Federico; Zambon, Francesca; Fonte, Sergio; Formisano, Michelangelo; Giardino, Marco; Magni, Gianfranco; Capaccioni, Fabrizio; Capria, M. Teresa; Marchi, Simone; Pieters, Carle M.; Ehlmann, Bethany; McCord, Tom

2016-04-01

NASA's Dawn spacecraft [1] arrived at Ceres on March 5, 2015, and has been studying the dwarf planet. The Dawn mission is observing Ceres' surface with its suite of instruments [1] including a Visible and InfraRed Mapping Spectrometer (VIR-MS) [2]. VIR-MS is an imaging spectrometer coupling high spectral and spatial resolution in the VIS (0.25-1-micron) and IR (0.95-5-micron) spectral ranges. Ceres' surface is very dark, but small localized areas exhibit unexpectedly bright materials. Since the first approach data, near infrared spectra revealed a dark surface, with a strong and complex absorption band in the spectral region around 3 microns [3]. Near-infrared spectroscopic analyses confirmed previous observation of bands at 3.1, 3.3-3.5, 3.9 micron but have clearly identified a band at 2.72 micron. This characteristic narrow feature is distinctive for OH-bearing minerals, while H2O-bearing phases, show a much broader absorption band that is a poor match for the Ceres spectrum. Water ice does not fit the observed spectrum. The 3.05-3.1 μm band is also visible in Ceres' ground-based spectra, and has been previously attributed to different phases including water ice, hydrated or NH4-bearing clays and brucite [4,5,6]. We find here that the best fit is obtained with ammoniated phyllosilicate added to a dark material (likely magnetite), antigorite and carbonate [7]. These different components, including ammoniated phases, occur everywhere across the surface although with different relative abundances [8]. Particularly interesting are the bright materials present in some craters like Occator, Haulani and Oxo that show different proportions of the components of the mixture [8]. However, the distribution of the band depths are not always linked to morphological structures. The retrieved mineralogy and composition indicates pervasive aqueous alteration of the surface, processes that are expected to be favored on large bodies like Ceres [9]. Furthermore, Ceres' low density

An exploration of barriers to insulin initiation for physicians in Japan: findings from the Diabetes Attitudes, Wishes And Needs (DAWN JAPAN study.

Directory of Open Access Journals (Sweden)

Hitoshi Ishii

Full Text Available OBJECTIVE: Insulin is recommended as an appropriate treatment in type 2 diabetes patients with suboptimal glycemic control; however, its initiation is often delayed. We therefore conducted the DAWN (Diabetes Attitudes, Wishes and Needs JAPAN study in an attempt to identify specific patient- and physician-related factors which contribute to delay of insulin initiation among Japanese patients with diabetes. In this report, we explored barriers for physicians which prevent timely insulin initiation. METHODS: The DAWN JAPAN study is a multicenter, questionnaire-based survey, conducted between 2004 and 2005. Participating physicians were categorized as follows based on their expertise: Japan Diabetes Society (JDS certified specialists (n = 77, JDS-affiliated physicians (n = 30, and non-JDS-affiliated physicians (n = 27. To assess physician barriers to insulin initiation, we have used a newly developed 27- item questionnaire. RESULTS: The mean age of patients (n = 11,656 treated by participating physicians was 64.1 years. The mean duration of diabetes was 121.6 months, and their mean HbA1c was 7.5%. Insulin was used in 27.4% of total patients. With regard to physician barriers to insulin initiation, the biggest differences in concerns expressed by JDS-certified specialists and non-JDS-affiliated physicians were observed in the following items with statistical significance: "I do not have staff (nurse, pharmacists who can assist with explanations" (1.3% vs 55.5%, respectively, "I have concerns about the use of insulin therapy in elderly patients" (38.1% vs 81.5%, and "It is difficult to provide guidance and education on insulin injection to patients" (16.9% vs 55.5%. The mean HbA1c at which physicians responded they would recommend insulin to their patients was 8.7%; however, they would reduce this level to 8.2% if they themselves required insulin. CONCLUSIONS: Our results demonstrated that physicians have concerns about insulin use, and suggested that

Assessing the response of Emerald Lake, an alpine watershed in Sequoia National Park, California, to acidification during snowmelt by using a simple hydrochemical model

International Nuclear Information System (INIS)

Hooper, R.P.; West, C.T.; Peters, N.E.

1990-01-01

A sparsely parameterized hydrochemical model has been developed by using data from Emerald Lake watershed, which is a 120-ha alpine catchment in Sequoia National Park, California. Greater than 90% of the precipitation to this watershed is snow; hence, snowmelt is the dominant hydrologic event. A model which uses a single alkalinity-generating mechanism, primary mineral weathering, was able to capture the pattern of solute concentrations in surface waters during snowmelt. An empirical representation of the weathering reaction, which is based on rock weathering stoichiometry and which uses discharge as a measure of residence time, was included in the model. Results of the model indicate that current deposition levels would have to be increased between three-fold and eight-fold to exhaust the alkalinity of the lake during snowmelt if their is a mild acidic pulse in the stream at the beginning of snowmelt as was observed during the study period. The acidic pulse in the inflow stream at the onset of snowmelt was less pronounced than acidic pulses observed in the meltwater draining the snowpack at a point using snow lysimeters or in the laboratory. Sulfate concentrations in the stream water were the most constant; chloride and nitrate concentrations increased slightly at the beginning of snowmelt. Additional field work is required to resolve whether an acidic meltwater pulse occurs over a large area as well as at a point or whether, due to physical and chemical processes within the snowpack, the acidic meltwater pulse is attenuated at the catchment scale. The modest data requirements of the model permit its applications to other alpine watersheds that are much less intensively studied than Emerald Lake watershed

ORIGIN: Metal Creation and Evolution from the Cosmic Dawn

Science.gov (United States)

Kouveliotou, C.; vanderHorst, A.; Weisskopf, M.; White, N.; denHerder, J. W.; Costantini, E.; denHartog, R.; Hermsen, W.; in'tZhand, J.; Kaastra, J.;

Dusk to dawn activity patterns of anopheline mosquitoes in West Timor and Java, Indonesia.

Science.gov (United States)

Ndoen, Ermi; Wild, Clyde; Dale, Pat; Sipe, Neil; Dale, Mike

2011-05-01

Malaria is a serious health issue in Indonesia. We investigated the dusk to dawn anopheline mosquito activity patterns, host-seeking and resting locations in coastal plain, hilly and highland areas in West Timor and Java. Adult mosquitoes were captured landing on humans or resting in houses or animal barns. Data analyzed were: mosquito night-time activities; period of peak activity; night-time activity in specific periods of time and for mosquito resting locations. Eleven species were recorded; data were sparse for some species therefore detailed analyses were performed for four species only. In Java Anopheles vagus was common, with a bimodal pattern of high activity. In West Timor, its activity peaked around midnight. Other species with peak activity around the middle of the night were An. barbirostris and An. subpictus. Most species showed no biting and resting preference for indoors or outdoors, although An. barbirostris preferred indoors in West Timor, but outdoors in Java. An. aconitus and An. annularis preferred resting in human dwellings; An. subpictus and An. vagus preferred resting in animal barns. An. barbirostris preferred resting in human dwellings in West Timor and in animal barns in Java. The information is useful for planning the mosquito control aspect of malaria management. For example, where mosquito species have peak activity at night indoors, bednets and indoor residual spraying should reduce malaria risk, but where mosquitoes are most active outdoors, other options may be more effective.

Compressional wave events in the dawn plasma sheet observed by Interball-1

Directory of Open Access Journals (Sweden)

O. Verkhoglyadova

1999-09-01

Full Text Available Compressional waves with periods greater than 2 min (about 10-30 min at low geomagnetic latitudes, namely compressional Pc5 waves, are studied. The data set obtained with magnetometer MIF-M and plasma analyzer instrument CORALL on board the Interball-1 are analyzed. Measurements performed in October 1995 and October 1996 in the dawn plasma sheet at -30 RE ≤ XGSM and |ZGSM| ≤ 10 RE are considered. Anti-phase variations of magnetic field and ion plasma pressures are analyzed by searching for morphological similarities in the two time series. It is found that longitudinal and transverse magnetic field variations with respect to the background magnetic field are of the same order of magnitude. Plasma velocities are processed for each time period of the local dissimilarity in the pressure time series. Velocity disturbances occur mainly transversely to the local field line. The data reveal the rotation of the velocity vector. Because of the field line curvature, there is no fixed position of the rotational plane in the space. These vortices are localized in the regions of anti-phase variations of the magnetic field and plasma pressures, and the vortical flows are associated with the compressional Pc5 wave process. A theoretical model is proposed to explain the main features of the nonlinear wave processes. Our main goal is to study coupling of drift Alfven wave and magnetosonic wave in a warm inhomogeneous plasma. A vortex is the partial solution of the set of the equations when the compression is neglected. A compression effect gives rise to a nonlinear soliton-like solution.Key words. Magnetosphere physics (magnetotail · Space plasma physics (kinetic and MHD theory; non-linear phenomena

Water-use responses of 'living fossil' conifers to CO2 enrichment in a simulated Cretaceous polar environment.

Science.gov (United States)

Llorens, Laura; Osborne, Colin P; Beerling, David J

2009-07-01

During the Mesozoic, the polar regions supported coniferous forests that experienced warm climates, a CO(2)-rich atmosphere and extreme seasonal variations in daylight. How the interaction between the last two factors might have influenced water use of these conifers was investigated. An experimental approach was used to test the following hypotheses: (1) the expected beneficial effects of elevated [CO(2)] on water-use efficiency (WUE) are reduced or lost during the 24-h light of the high-latitude summer; and (2) elevated [CO(2)] reduces plant water use over the growing season. Measurements of leaf and whole-plant gas exchange, and leaf-stable carbon isotope composition were made on one evergreen (Sequoia sempervirens) and two deciduous (Metasequoia glyptostroboides and Taxodium distichum) 'living fossil' coniferous species after 3 years' growth in controlled-environment simulated Cretaceous Arctic (69 degrees N) conditions at either ambient (400 micromol mol(-1)) or elevated (800 micromol mol(-1)) [CO(2)]. Stimulation of whole-plant WUE (WUE(P)) by CO(2) enrichment was maintained over the growing season for the three studied species but this pattern was not reflected in patterns of WUE inferred from leaf-scale gas exchange measurements (iWUE(L)) and delta(13)C of foliage (tWUE(L)). This response was driven largely by increased rates of carbon uptake, because there was no overall CO(2) effect on daily whole-plant transpiration or whole-plant water loss integrated over the study period. Seasonal patterns of tWUE(L) differed from those measured for iWUE(L). The results suggest caution against over simplistic interpretations of WUE(P) based on leaf isotopic composition. The data suggest that the efficiency of whole-tree water use may be improved by CO(2) enrichment in a simulated high-latitude environment, but that transpiration is relatively insensitive to atmospheric CO(2) in the living fossil species investigated.

Executive summary - Assessing the response of Emerald Lake, an alpine watershed in Sequoia National Park, California, to acidification during snowmelt using a simple hydrochemical model

International Nuclear Information System (INIS)

Hooper, R.P.; West, C.T.; Peters, N.E.

1990-01-01

A simple process-oriented model, called the Alpine Lake Forecaster (ALF), was constructed using data collected from the Integrated Watershed Study of Emerald Lake, Sequoia National Park, California. ALF is able to capture the basic solute patterns during snowmelt in this alpine catchment where groundwater is a minor contributor to streamflow. It includes an empirical representation of primary mineral weathering as the only alkalinity generating mechanism. During a heavy snow year, such as the one used for calibrating the model, the model accurately simulated the surface water chemical change in response to the initial ionic pulse from the snowpack and to the dilution that occurs at peak snowmelt. Because the model does not consider cation exchange, it over-predicts the acidification during the initial period of snowmelt, and therefore is a conservative predictor. However, the minimum alkalinity observed in the main inflows to Emerald Lake and in the lake outflow is accurately simulated by the model. The representation of the lake as simply a missing volume with no additional chemical reactions is supported by the observation. The model predicts a change of 2 to 5 microequiv/L in the minimum alkalinity of the lake outflow during snowmelt if the deposition would have to increase between two and 18 times the current load-alkalinity of the lake; the precise increase depends on hydrologic conditions and on the pattern of solute release from the snowpack. An acidic rainstorm that exhausted the alkalinity of the lake was observed during summer 1984 after the lake had stratified, and is the likely cause of the acidification of Emerald Lake

The effects of raking on sugar pine mortality following prescribed fire in Sequoia and Kings Canyon National Parks, California, USA

Science.gov (United States)

Nesmith, Jonathan C. B.; O'Hara, Kevin L.; van Mantgem, Phillip J.; de Valpine, Perry

2010-01-01

Prescribed fire is an important tool for fuel reduction, the control of competing vegetation, and forest restoration. The accumulated fuels associated with historical fire exclusion can cause undesirably high tree mortality rates following prescribed fires and wildfires. This is especially true for sugar pine (Pinus lambertiana Douglas), which is already negatively affected by the introduced pathogen white pine blister rust (Cronartium ribicola J.C. Fisch. ex Rabenh). We tested the efficacy of raking away fuels around the base of sugar pine to reduce mortality following prescribed fire in Sequoia and Kings Canyon national parks, California, USA. This study was conducted in three prescribed fires and included 457 trees, half of which had the fuels around their bases raked away to mineral soil to 0.5 m away from the stem. Fire effects were assessed and tree mortality was recorded for three years after prescribed fires. Overall, raking had no detectable effect on mortality: raked trees averaged 30% mortality compared to 36% for unraked trees. There was a significant effect, however, between the interaction of raking and average pre-treatment forest floor fuel depth: the predicted probability of survival of a 50 cm dbh tree was 0.94 vs. 0.96 when average pre-treatment fuel depth was 0 cm for a raked and unraked tree, respectively. When average pre-treatment forest floor fuel depth was 30 cm, the predicted probability of survival for a raked 50 cm dbh tree was 0.60 compared to only 0.07 for an unraked tree. Raking did not affect mortality when fire intensity, measured as percent crown volume scorched, was very low (0% scorch) or very high (>80% scorch), but the raking treatment significantly increased the proportion of trees that survived by 9.6% for trees that burned under moderate fire intensity (1% to 80% scorch). Raking significantly reduced the likelihood of bole charring and bark beetle activity three years post fire. Fuel depth and anticipated fire intensity need

Detection of serpentine in exogenic carbonaceous chondrite material on Vesta from Dawn FC data

Science.gov (United States)

Nathues, Andreas; Hoffmann, Martin; Cloutis, Edward A.; Schäfer, Michael; Reddy, Vishnu; Christensen, Ulrich; Sierks, Holger; Thangjam, Guneshwar Singh; Le Corre, Lucille; Mengel, Kurt; Vincent, Jean-Baptist; Russell, Christopher T.; Prettyman, Tom; Schmedemann, Nico; Kneissl, Thomas; Raymond, Carol; Gutierrez-Marques, Pablo; Hall, Ian; Büttner, Irene

2014-09-01

The Dawn mission’s Framing Camera (FC) observed Asteroid (4) Vesta in 2011 and 2012 using seven color filters and one clear filter from different orbits. In the present paper we analyze recalibrated HAMO color cubes (spatial resolution ∼60 m/pixel) with a focus on dark material (DM). We present a definition of highly concentrated DM based on spectral parameters, subsequently map the DM across the Vestan surface, geologically classify DM, study its spectral properties on global and local scales, and finally, compare the FC in-flight color data with laboratory spectra. We have discovered an absorption band centered at 0.72 μm in localities of DM that show the lowest albedo values by using FC data as well as spectral information from Dawn’s imaging spectrometer VIR. Such localities are contained within impact-exposed outcrops on inner crater walls and ejecta material. Comparisons between spectral FC in-flight data, and laboratory spectra of meteorites and mineral mixtures in the wavelength range 0.4-1.0 μm, revealed that the absorption band can be attributed to the mineral serpentine, which is typically present in CM chondrites. Dark material in its purest form is rare on Vesta’s surface and is distributed globally in a non-uniform manner. Our findings confirm the hypothesis of an exogenic origin of the DM by the infall of carbonaceous chondritic material, likely of CM type. It further confirms the hypothesis that most of the DM was deposited by the Veneneia impact.

Incidence of Mental Health Diagnoses in Veterans of Operations Iraqi Freedom, Enduring Freedom, and New Dawn, 2001-2014.

Science.gov (United States)

Ramsey, Christine; Dziura, James; Justice, Amy C; Altalib, Hamada Hamid; Bathulapalli, Harini; Burg, Matthew; Decker, Suzanne; Driscoll, Mary; Goulet, Joseph; Haskell, Sally; Kulas, Joseph; Wang, Karen H; Mattocks, Kristen; Brandt, Cynthia

2017-02-01

To evaluate gender, age, and race/ethnicity as predictors of incident mental health diagnoses among Operations Iraqi Freedom, Enduring Freedom, and New Dawn veterans. We used US Veterans Health Administration (VHA) electronic health records from 2001 to 2014 to examine incidence rates and sociodemographic risk factors for mental health diagnoses among 888 142 veterans. Posttraumatic stress disorder (PTSD) was the most frequently diagnosed mental health condition across gender and age groups. Incidence rates for all mental health diagnoses were highest at ages 18 to 29 years and declined thereafter, with the exceptions of major depressive disorder (MDD) in both genders, and PTSD among women. Risk of incident bipolar disorder and MDD diagnoses were greater among women; risk of incident schizophrenia, and alcohol- and drug-use disorders diagnoses were greater in men. Compared with Whites, risk incident PTSD, MDD, and alcohol-use disorder diagnoses were lower at ages 18 to 29 years and higher at ages 45 to 64 years for both Hispanics and African Americans. Differentiating high-risk demographic and gender groups can lead to improved diagnosis and treatment of mental health diagnoses among veterans and other high-risk groups.

Colors and Photometry of Bright Materials on Vesta as Seen by the Dawn Framing Camera

Science.gov (United States)

Schroeder, S. E.; Li, J.-Y.; Mittlefehldt, D. W.; Pieters, C. M.; De Sanctis, M. C.; Hiesinger, H.; Blewett, D. T.; Russell, C. T.; Raymond, C. A.; Keller, H. U.;

Chemical Composition and Antimicrobial Activities of Essential Oils of Some Coniferous Plants Cultivated in Egypt.

Science.gov (United States)

Ibrahim, Taghreed A; El-Hela, Atef A; El-Hefnawy, Hala M; Al-Taweel, Areej M; Perveen, Shagufta

2017-01-01

Family Cupressaceae is the largest coniferous plant family. Essential oils of many species belonging to family Cupressaceae are known to have several biological activities specially antimicrobial activity. The essential oils from aerial parts of Calocedrus decurrens Torr., Cupressus sempervirens stricta L. and Tetraclinis articulata (Vahl) Mast. were prepared by hydrodistillation. The chemical composition of the essential oils has been elucidated by gas chromatography-mass spectroscopy analysis. The prepared essential oils were examined against selected species of Gram-positive, Gram-negative bacteria and Candida species. Broth dilution methods were used to detect minimum inhibitory concentration (MIC), minimum bactericidal concentration (MBC) and minimum fungicidal concentration (MFC). Sixteen compounds were identified in the essential oils of both Calocedrus decurrens and Cupressus sempervirens L. and fifteen compounds were identified in the essential oil of Tetraclinis articulata . δ-3-Carene (43.10%), (+)-Cedrol (74.03%) and Camphor (21.23%) were the major constituents in the essential oils of Calocedrus decurrens , Cupressus sempervirens L. and Tetraclinis articulata , respectively. The essential oils showed strong antimicrobial activities against the selected microorganisms in concentration range 0.02 3- 3.03 µL/mL. This study could contribute to the chemotaxonomic characterization of family Cupressaceae. In addition, it proved that the essential oils under investigation possess potential antimicrobial properties.

Observations of unusual pre-dawn response of the equatorial F-region during geomagnetic disturbances

Science.gov (United States)

Lima, W.; Becker-Guedes, F.; Fagundes, P.; Sahai, Y.; Abalde, J.; Pillat, V.

It is known that the disturbed solar wind-magnetosphere interactions have important effects on equatorial and low-latitude ionospheric electrodynamics. The response of equatorial ionosphere during storm-time is an important aspect of space weather studies. It has been observed that during geomagnetic disturbances both suppression as well as generation of equatorial spread-F (ESF) or plasma irregularities takes place. However, the mechanism(s) associated with the generation of ESF still needs further investigations. This work reports some unusual events of pre-dawn occurrence of ionospheric F-region satellite traces followed by spread-F and cusp-like spread-F from ionospheric sounding observations carried out by a Canadian Advanced Digital Ionosonde (CADI) localized at Palmas (10.2°, 48.2°W, dip latitude 5.7°S), Brazil during 2002, every 5 minutes. For the present work we have scaled and analyzed the ionospheric sounding data for three events (April 20, September 04 and 08, 2002), which are associated with geomagnetic disturbances. In the events studied, the ionograms show the occurrence of satellite trace followed by cusp-like spread. The cusp like features move up in frequency and height and finally attain the F-layer peak value (foF2) and then disappear. They had duration of about 30 min and always occurred in the early morning hours. Our studies involved seven geomagnetic disturbances as well as quiet days during the year 2002, but only on these three occasions we observed these features. We present and discuss these observations in this paper and suggest possible mechanisms for the occurrence of these unusual features.

Dawn approaches Ceres: Analysis of first FC color data

Science.gov (United States)

Hoffmann, Martin; Nathues, Andreas; Schäfer, Michael; Russell, Christopher T.; Schäfer, Tanja; Memgel, Kurt; Reddy, Vishnu; Thangjam, Guneshwar S.; Sierks, Holger; Christensen, Ulrich; Hiesinger, Harald; Le Corre, Lucille; Gutiérrez-Marqués, Pablo; Büttner, Irene; Hall, Ian; Ripken, Joachim; Sykes, Mark V.; Li, Jian-Yang

2015-04-01

Since December 1, 2014 the Dawn spacecraft obtains images of Ceres by its onboard Framing Camera in seven color bands and one clear (panchromatic) filter. The size of Ceres (in pixels) has increased during this time from a diameter of 9 pixels to about a quarter of the full frame. The higher resolution of more recent data reveals first details of the topography and distribution of reflectances. Also, we are going to show evidence on extent and elevation of impact structures and other geologic features. These are first indications on their context and unique properties of the surface and evolution of Ceres. The relationship of these features to previous resolved HST observations (Li et al., 2006) and the recent discussion on water emission activity (Küppers et al., 2014), as well as their distribution in longitude and latitude, will be discussed. The (anticipated) most recent data will be able to resolve water related features comparable with those on icy satellites. Potential consequences for the upcoming high resolution data and their planning are to be shown. The first data, obtained on Dec 1st, have been used to start studying the phase curve and to derive an integrated spectrum of Ceres (17 co-registered pixels around the center of the disk). The data were integrated to a single spectrum between 0.44 µm and 0.96 µm. The spectrum is essentially flat over all bands within the accuracy of the data (± 0.01 in reflectance). It is consistent with previous Earth based spectra (Vilas and McFadden, 1992, Burbine et al., 2002, Li et al., 2006). Potential sites showing spectral absorption features in the visual wavelength range will be discussed. The distribution of reflectances at positions relative to the sub-solar longitude also confirms the expected extrapolation of the phase curve from ground based observations. A comparison of the observed phase effect and detected surface features will be presented. Thus differences of the surface roughness on different size

Persistent pain and comorbidity among Operation Enduring Freedom/Operation Iraqi Freedom/operation New Dawn veterans.

Science.gov (United States)

Higgins, Diana M; Kerns, Robert D; Brandt, Cynthia A; Haskell, Sally G; Bathulapalli, Harini; Gilliam, Wesley; Goulet, Joseph L

2014-05-01

Chronic pain is a significant concern for the Veterans Health Administration (VHA), with chronic pain conditions among those most frequently reported by Operation Enduring Freedom (OEF)/Operation Iraqi Freedom (OIF)/Operation New Dawn (OND) veterans. The current study examined VHA electronic medical record data to examine variation in demographics and high prevalence and high impact medical and mental health conditions in order to characterize the differences between patients with persistent pain and no pain. A conservative operational definition of chronic or "persistent pain" based on multiple indicators of pain (i.e., pain intensity ratings, prescription opioids, pain clinic visits, International Classification of Diseases, Ninth Revision codes) was employed. Analyses included the entire roster of longitudinal clinical data on OEF/OIF/OND veterans who used VHA care to compare those with persistent pain with those with no clinical evidence of pain. Results of logistic regression models suggest that sex, race, education, military variables, body mass index (BMI), traumatic brain injury (TBI), and mental health conditions, but not age, reliably discriminate the two groups. Those with persistent pain were more likely to be Black, female, on active duty, enlisted, Army service members, have a high school education or less, and have diagnoses of mood disorders, post-traumatic stress disorder, substance use disorders, anxiety disorders, TBI, and have a BMI consistent with overweight and obesity. The operational definition of chronic pain used in this study may have research implications for examining predictors of incident and chronic pain. These data have important clinical implications in that addressing comorbid conditions of persistent pain may improve adaptive coping and functioning in these patients. Wiley Periodicals, Inc.

Modeling the Radio Foreground for Detection of CMB Spectral Distortions from the Cosmic Dawn and the Epoch of Reionization

Energy Technology Data Exchange (ETDEWEB)

Sathyanarayana Rao, Mayuri; Subrahmanyan, Ravi; Shankar, N Udaya [Raman Research Institute, C V Raman Avenue, Sadashivanagar, Bangalore 560080 (India); Chluba, Jens, E-mail: mayuris@rri.res.in [Jodrell Bank Centre for Astrophysics, University of Manchester, Oxford Road, M13 9PL (United Kingdom)

2017-05-01

Cosmic baryon evolution during the Cosmic Dawn and Reionization results in redshifted 21-cm spectral distortions in the cosmic microwave background (CMB). These encode information about the nature and timing of first sources over redshifts 30–6 and appear at meter wavelengths as a tiny CMB distortion along with the Galactic and extragalactic radio sky, which is orders of magnitude brighter. Therefore, detection requires precise methods to model foregrounds. We present a method of foreground fitting using maximally smooth (MS) functions. We demonstrate the usefulness of MS functions over traditionally used polynomials to separate foregrounds from the Epoch of Reionization (EoR) signal. We also examine the level of spectral complexity in plausible foregrounds using GMOSS, a physically motivated model of the radio sky, and find that they are indeed smooth and can be modeled by MS functions to levels sufficient to discern the vanilla model of the EoR signal. We show that MS functions are loss resistant and robustly preserve EoR signal strength and turning points in the residuals. Finally, we demonstrate that in using a well-calibrated spectral radiometer and modeling foregrounds with MS functions, the global EoR signal can be detected with a Bayesian approach with 90% confidence in 10 minutes’ integration.

A natural resource condition assessment for Sequoia and Kings Canyon National Parks: Appendix 22: climatic change

Science.gov (United States)

Das, Adrian J.; Stephenson, Nathan L.

2013-01-01

Climate is a master controller of the structure, composition, and function of biotic communities, affecting them both directly, through physiological effects, and indirectly, by mediating biotic interactions and by influencing disturbance regimes. Sequoia and Kings Canyon National Park’s (SEKI’s) dramatic elevational changes in biotic communities -- from warm mediterranean to cold alpine -- are but one manifestation of climate’s overarching importance in shaping SEKI’s landscape. Yet humans are now altering the global climate, with measurable effects on ecosystems (IPCC 2007). Over the last few decades across the western United States, human-induced climatic changes have likely contributed to observed declines in fraction of precipitation falling as snow and snowpack water content (Mote et al. 2005, Knowles et al. 2006), advance in spring snowmelt (Stewart et al. 2005, Barnett et al. 2008), and consequent increase in area burned in wildfires (Westerling et al. 2006). In the Sierra Nevada, warming temperatures have likely contributed to observed glacial recession (Basagic 2008), uphill migration of small mammals (Moritz et al. 2008), and increasing tree mortality rates (van Mantgem and Stephenson 2007, van Mantgem et al. 2009). More substantial changes can be expected for the future (e.g., IPCC 2007). Given the central importance of climate and climatic changes, we sought to describe long-term trends in temperature and precipitation at SEKI. Time and budget constraints limited us to analyses of mean annual temperature and mean annual precipitation, using readily-available data. If funds become available in the future, further analyses will be needed to analyze trends by season, trends in daily minimum and maximum temperatures, and so on. We chose to analyze data from individual weather stations rather than use interpolated climatic data from sources such as PRISM (http://www.prism.oregonstate.edu/). In topographically complex mountainous regions with few

Dawn and Dusk Set States of the Circadian Oscillator in Sprouting Barley (Hordeum vulgare Seedlings.

Directory of Open Access Journals (Sweden)

Weiwei Deng

Full Text Available The plant circadian clock is an internal timekeeper that coordinates biological processes with daily changes in the external environment. The transcript levels of clock genes, which oscillate to control circadian outputs, were examined during early seedling development in barley (Hordeum vulgare, a model for temperate cereal crops. Oscillations of clock gene transcript levels do not occur in barley seedlings grown in darkness or constant light but were observed with day-night cycles. A dark-to-light transition influenced transcript levels of some clock genes but triggered only weak oscillations of gene expression, whereas a light-to-dark transition triggered robust oscillations. Single light pulses of 6, 12 or 18 hours induced robust oscillations. The light-to-dark transition was the primary determinant of the timing of subsequent peaks of clock gene expression. After the light-to-dark transition the timing of peak transcript levels of clock gene also varied depending on the length of the preceding light pulse. Thus, a single photoperiod can trigger initiation of photoperiod-dependent circadian rhythms in barley seedlings. Photoperiod-specific rhythms of clock gene expression were observed in two week old barley plants. Changing the timing of dusk altered clock gene expression patterns within a single day, showing that alteration of circadian oscillator behaviour is amongst the most rapid molecular responses to changing photoperiod in barley. A barley EARLY FLOWERING3 mutant, which exhibits rapid photoperiod-insensitive flowering behaviour, does not establish clock rhythms in response to a single photoperiod. The data presented show that dawn and dusk cues are important signals for setting the state of the circadian oscillator during early development of barley and that the circadian oscillator of barley exhibits photoperiod-dependent oscillation states.

A new dawn for the naming of fungi: impacts of decisions made in Melbourne in July 2011 on the future publication and regulation of fungal names

Directory of Open Access Journals (Sweden)

David Hawksworth

2011-09-01

Full Text Available A personal synopsis of the decisions made at the Nomenclature Section meeting of the International Botanical Congress in Melbourne in July 2011 is provided, with an emphasis on those which will affect the working practices of, or will otherwise be of interest to, mycologists. The topics covered include the re-naming of the Code, the acceptance of English as an alternative to Latin for validating diagnoses, conditions for permitting electronic publication of names, mandatory deposit of key nomenclatural information in a recognized repository for the valid publication of fungal names, the discontinuance of dual nomenclature for pleomorphic fungi, and clarification over the typification of sanctioned names, and acceptability of names originally published under the zoological code. Collectively, these changes are the most fundamental to have been enacted at single Congress since the 1950s, and herald the dawn of a new era in the practice of fungal nomenclature.

Surface mapping via unsupervised classification of remote sensing: application to MESSENGER/MASCS and DAWN/VIRS data.

Science.gov (United States)

D'Amore, M.; Le Scaon, R.; Helbert, J.; Maturilli, A.

2017-12-01

Machine-learning achieved unprecedented results in high-dimensional data processing tasks with wide applications in various fields. Due to the growing number of complex nonlinear systems that have to be investigated in science and the bare raw size of data nowadays available, ML offers the unique ability to extract knowledge, regardless the specific application field. Examples are image segmentation, supervised/unsupervised/ semi-supervised classification, feature extraction, data dimensionality analysis/reduction.The MASCS instrument has mapped Mercury surface in the 400-1145 nm wavelength range during orbital observations by the MESSENGER spacecraft. We have conducted k-means unsupervised hierarchical clustering to identify and characterize spectral units from MASCS observations. The results display a dichotomy: a polar and equatorial units, possibly linked to compositional differences or weathering due to irradiation. To explore possible relations between composition and spectral behavior, we have compared the spectral provinces with elemental abundance maps derived from MESSENGER's X-Ray Spectrometer (XRS).For the Vesta application on DAWN Visible and infrared spectrometer (VIR) data, we explored several Machine Learning techniques: image segmentation method, stream algorithm and hierarchical clustering.The algorithm successfully separates the Olivine outcrops around two craters on Vesta's surface [1]. New maps summarizing the spectral and chemical signature of the surface could be automatically produced.We conclude that instead of hand digging in data, scientist could choose a subset of algorithms with well known feature (i.e. efficacy on the particular problem, speed, accuracy) and focus their effort in understanding what important characteristic of the groups found in the data mean. [1] E Ammannito et al. "Olivine in an unexpected location on Vesta's surface". In: Nature 504.7478 (2013), pp. 122-125.

A Vortical Dawn Flank Boundary Layer for Near-Radial IMF: Wind Observations on 24 October 2001

Science.gov (United States)

Farrugia, C. J.; Gratton, F. T.; Gnavi, G.; Torbert, R. B.; Wilson, Lynn B., III

2014-01-01

We present an example of a boundary layer tailward of the dawn terminator which is entirely populated by rolled-up flow vortices. Observations were made by Wind on 24 October 2001 as the spacecraft moved across the region at the X plane approximately equal to -13 Earth radii. Interplanetary conditions were steady with a near-radial interplanetary magnetic field (IMF). Approximately 15 vortices were observed over the 1.5 hours duration of Wind's crossing, each lasting approximately 5 min. The rolling up is inferred from the presence of a hot tenuous plasma being accelerated to speeds higher than in the adjoining magnetosheath, a circumstance which has been shown to be a reliable signature of this in single-spacecraft observations. A blob of cold dense plasma was entrained in each vortex, at whose leading edge abrupt polarity changes of field and velocity components at current sheets were regularly observed. In the frame of the average boundary layer velocity, the dense blobs were moving predominantly sunward and their scale size along the X plane was approximately 7.4 Earth radii. Inquiring into the generation mechanism of the vortices, we analyze the stability of the boundary layer to sheared flows using compressible magnetohydrodynamic Kelvin-Helmholtz theory with continuous profiles for the physical quantities. We input parameters from (i) the exact theory of magnetosheath flow under aligned solar wind field and flow vectors near the terminator and (ii) the Wind data. It is shown that the configuration is indeed Kelvin-Helmholtz (KH) unstable. This is the first reported example of KH-unstable waves at the magnetopause under a radial IMF.

US ethnic group differences in self-management in the 2nd diabetes attitudes, wishes and needs (DAWN2) study.

Science.gov (United States)

Peyrot, Mark; Egede, Leonard E; Funnell, Martha M; Hsu, William C; Ruggiero, Laurie; Siminerio, Linda M; Stuckey, Heather L

2018-03-08

Understanding the relationship between ethnicity and self-management is important due to disparities in healthcare access, utilization, and outcomes among adults with type 2 diabetes from different ethnic groups in the US. Self-reports of self-management and interest in improving self-management from US people with diabetes (PWD) in the 2nd Diabetes Attitudes, Wishes and Needs (DAWN2) study, a multinational, multi-stakeholder survey, were analyzed, including 447 non-Hispanic White, 241 African American, 194 Hispanic American, and 173 Chinese American PWD (>18 years). Overall, self-management behavior was highest for medication taking and lowest for physical activity. Non-Hispanic Whites had lowest physical activity and highest adherence to insulin therapy. Chinese Americans had lowest foot care and highest healthy eating. Overall, interest was highest for improving healthy eating and physical activity. Chinese Americans and Hispanic Americans were more interested than non-Hispanic Whites in improving most self-management behaviors. Chinese Americans were more interested than African Americans in improving most self-management behaviors. Healthcare providers telling PWD that their A1c needs improvement was associated with lower self-rated glucose control, which was associated with higher PWD interest in improving self-management behaviors. Diabetes care providers should use patient-centered approaches and consider ethnicity in tailoring self-management support. Copyright © 2017 The Authors. Published by Elsevier Inc. All rights reserved.

Estimation the remaining service-lifetime of wooden structure of geothermal cooling tower

Directory of Open Access Journals (Sweden)

Effendi Tri Bahtiar

2017-06-01

Full Text Available Similar with other construction materials, wood strength is decreasing when applied by long term loading. Wooden cooling tower structure at Star Energy Geothermal (Wayang Windu Ltd was built in 1998 and it should be evaluated to avoid sudden structural failure. Evaluation conducted through several steps: wood species identification, the physical and mechanical properties testing, and estimation for remaining service-lifetime by generating mathematical models derived from creep test and reduction of cross sectional area of the wood. Identification result that the wood are redwood (Sequoia sempervirens and Douglas fir (Pseudotsuga menziesii. The wood density value has degraded from the surface until 0.25 cm depth. Strength characteristics of the wood have considerably decreased, but the allowable stress for bending, tension parallel to grain, and shear were still higher than NDS2005 requirements. The allowable stress for compression parallel to grain was slightly lower than NDS, while compression perpendicular to grain was much lower. Average modulus of elasticity reduces become lower than the value stated by the code, but the minimum value of modulus of elasticity (Emin of redwood was still higher than the code value, while Emin of Douglas fir is slightly lower. Then, in accordance with those findings, the construction would not failure yet but the deformation and vibration will occur in higher rate than design planning. This research develops mathematical models for estimating the remaining service-lifetime of the wooden cooling tower structure in geothermal power plant based on the wood performance in resisting long term loading and its deterioration rate. The deterioration rate of wood member of cooling tower structure at Star Energy Geothermal (Wayang Windu Ltd is 0.0147 cm depth per year, so equation for the residual service life estimation is σlaterσtoday=bh2(b−0.0147T(h−0.0147T2, and σlater must be lower than allowable stress.

Millennium-scale crossdating and inter-annual climate sensitivities of standing California redwoods.

Science.gov (United States)

Carroll, Allyson L; Sillett, Stephen C; Kramer, Russell D

2014-01-01

Extremely decay-resistant wood and fire-resistant bark allow California's redwoods to accumulate millennia of annual growth rings that can be useful in biological research. Whereas tree rings of Sequoiadendron giganteum (SEGI) helped formalize the study of dendrochronology and the principle of crossdating, those of Sequoia sempervirens (SESE) have proven much more difficult to decipher, greatly limiting dendroclimatic and other investigations of this species. We overcame these problems by climbing standing trees and coring trunks at multiple heights in 14 old-growth forest locations across California. Overall, we sampled 1,466 series with 483,712 annual rings from 120 trees and were able to crossdate 83% of SESE compared to 99% of SEGI rings. Standard and residual tree-ring chronologies spanning up to 1,685 years for SESE and 1,538 years for SEGI were created for each location to evaluate crossdating and to examine correlations between annual growth and climate. We used monthly values of temperature, precipitation, and drought severity as well as summer cloudiness to quantify potential drivers of inter-annual growth variation over century-long time series at each location. SESE chronologies exhibited a latitudinal gradient of climate sensitivities, contrasting cooler northern rainforests and warmer, drier southern forests. Radial growth increased with decreasing summer cloudiness in northern rainforests and a central SESE location. The strongest dendroclimatic relationship occurred in our southernmost SESE location, where radial growth correlated negatively with dry summer conditions and exhibited responses to historic fires. SEGI chronologies showed negative correlations with June temperature and positive correlations with previous October precipitation. More work is needed to understand quantitative relationships between SEGI radial growth and moisture availability, particularly snowmelt. Tree-ring chronologies developed here for both redwood species have

Water-use responses of ‘living fossil’ conifers to CO2 enrichment in a simulated Cretaceous polar environment

Science.gov (United States)

Llorens, Laura; Osborne, Colin P.; Beerling, David J.

2009-01-01

Background and Aims During the Mesozoic, the polar regions supported coniferous forests that experienced warm climates, a CO2-rich atmosphere and extreme seasonal variations in daylight. How the interaction between the last two factors might have influenced water use of these conifers was investigated. An experimental approach was used to test the following hypotheses: (1) the expected beneficial effects of elevated [CO2] on water-use efficiency (WUE) are reduced or lost during the 24-h light of the high-latitude summer; and (2) elevated [CO2] reduces plant water use over the growing season. Methods Measurements of leaf and whole-plant gas exchange, and leaf-stable carbon isotope composition were made on one evergreen (Sequoia sempervirens) and two deciduous (Metasequoia glyptostroboides and Taxodium distichum) ‘living fossil’ coniferous species after 3 years' growth in controlled-environment simulated Cretaceous Arctic (69°N) conditions at either ambient (400 µmol mol−1) or elevated (800 µmol mol−1) [CO2]. Key Results Stimulation of whole-plant WUE (WUEP) by CO2 enrichment was maintained over the growing season for the three studied species but this pattern was not reflected in patterns of WUE inferred from leaf-scale gas exchange measurements (iWUEL) and δ13C of foliage (tWUEL). This response was driven largely by increased rates of carbon uptake, because there was no overall CO2 effect on daily whole-plant transpiration or whole-plant water loss integrated over the study period. Seasonal patterns of tWUEL differed from those measured for iWUEL. The results suggest caution against over simplistic interpretations of WUEP based on leaf isotopic composition. Conclusions The data suggest that the efficiency of whole-tree water use may be improved by CO2 enrichment in a simulated high-latitude environment, but that transpiration is relatively insensitive to atmospheric CO2 in the living fossil species investigated. PMID:19447810

Millennium-scale crossdating and inter-annual climate sensitivities of standing California redwoods.

Directory of Open Access Journals (Sweden)

Allyson L Carroll

Full Text Available Extremely decay-resistant wood and fire-resistant bark allow California's redwoods to accumulate millennia of annual growth rings that can be useful in biological research. Whereas tree rings of Sequoiadendron giganteum (SEGI helped formalize the study of dendrochronology and the principle of crossdating, those of Sequoia sempervirens (SESE have proven much more difficult to decipher, greatly limiting dendroclimatic and other investigations of this species. We overcame these problems by climbing standing trees and coring trunks at multiple heights in 14 old-growth forest locations across California. Overall, we sampled 1,466 series with 483,712 annual rings from 120 trees and were able to crossdate 83% of SESE compared to 99% of SEGI rings. Standard and residual tree-ring chronologies spanning up to 1,685 years for SESE and 1,538 years for SEGI were created for each location to evaluate crossdating and to examine correlations between annual growth and climate. We used monthly values of temperature, precipitation, and drought severity as well as summer cloudiness to quantify potential drivers of inter-annual growth variation over century-long time series at each location. SESE chronologies exhibited a latitudinal gradient of climate sensitivities, contrasting cooler northern rainforests and warmer, drier southern forests. Radial growth increased with decreasing summer cloudiness in northern rainforests and a central SESE location. The strongest dendroclimatic relationship occurred in our southernmost SESE location, where radial growth correlated negatively with dry summer conditions and exhibited responses to historic fires. SEGI chronologies showed negative correlations with June temperature and positive correlations with previous October precipitation. More work is needed to understand quantitative relationships between SEGI radial growth and moisture availability, particularly snowmelt. Tree-ring chronologies developed here for both redwood

Redwoods, restoration, and implications for carbon budgets

Science.gov (United States)

Madej, Mary Ann

2010-01-01

The coast redwoods (Sequoia sempervirens) of California have several unique characteristics that influence interactions between vegetation and geomorphic processes. Case studies, using a combination of in-channel wood surveys and an air photo inventory of landslides, illustrate current conditions in a redwood-dominated watershed undergoing restoration work, and the influence of wood loading and landslides on the carbon budget. Redwood trees have extremely large biomass (trunk wood volumes of 700 to 1000 m3) and are very decay-resistant; consequently, they have a large and persistent influence on in-channel wood loading. Large wood surveys indicate high wood loading in streams in uncut forests (0.3-0.5 m3/m2 of channel), but also show that high wood loading can persist in logged basin with unlogged riparian buffers because of the slow decay of fallen redwoods. Through a watershed restoration program, Redwood National Park increases in-channel wood loading in low-order streams, but the effectiveness of this technique has not yet been tested by a large flood. Another unique characteristic of redwood is its ability to resprout from basal burls after cutting, so that root strength may not decline as sharply following logging as in other types of forests. An air photo inventory of landslides following a large storm in 1997 indicated: 1) that in the Redwood Creek watershed the volume of material displaced by landslides in harvested areas was not related to the time elapsed since logging, suggesting that the loss of root strength was not a decisive factor in landslide initiation, 2) landslide production on decommissioned logging roads was half that of untreated roads, and 3) landslides removed an estimated 28 Mg of organic carbon/km2 from hillslopes. The carbon budget of a redwood-dominated catchment is dominated by the vegetative component, but is also influenced by the extent of mass movement, erosion control work, and in-channel storage of wood.

Constraining Cosmic Dawn and Cosmological Reionization via the global redshifted 21-cm signal

Science.gov (United States)

Singh, Saurabh

2018-01-01

The formation of first stars and consequent thermal evolution in baryons during Cosmic Dawn and the Epoch of Reionization (EoR) is poorly constrained. The 21-cm line transition of neutral hydrogen is one of the richest probes of the astrophysics during this era. The signal has the potential to reveal the nature and timing of the emergence of first stars, first light, and the consequent evolution in thermal and ionization state of the baryons.The detection of the global redshifted 21-cm signal, which represents the mean thermal history of the gas, is challenging since it is extremely faint and seen through orders of magnitude stronger contributions from Galactic and extragalactic foregrounds. Man-made terrestrial Radio Frequency Interference (RFI) and the exacting tolerances required on instrument systematics make the detection even more daunting.The design considerations for a precision spectral radiometer are first listed, and a comparison is made of different radiometer configurations, including short and zero baseline interferometers along with methods to enhance the response. We discuss the relative merits of different methods.We then describe SARAS 2, a spectral radiometer custom-designed for precision measurement of the global 21-cm signal. SARAS 2 has been designed to have a system transfer function and internal systematics – both multiplicative and additive – to be spectrally smooth so as to allow a separation of foregrounds and systematics from plausible and predicted global cosmological 21-cm signals. The algorithms for calibration and RFI mitigation are carefully developed so that they do not introduce spectral features that may confuse the detection of the 21-cm signal.We present the outcomes for cosmology from analysis of 60 hr observing with the radiometer deployed at the Timbaktu Collective in Southern India. The detailed analysis of the data reveals an RMS noise level of 11 mK, without being limited by systematic structures. The likelihood

Acid mist and ozone effects on the leaf chemistry of two western conifer species

Science.gov (United States)

Westman, Walter E.; Temple, Patrick J.

1989-01-01

The effects of ozone and acid-mist exposures on the leaf chemistry of Jeffrey pine and giant sequoia seedlings grown in filtered-air greenhouses were investigated. Acid-mist treatments (pH 4.1, 3.4, 2.7, or 2.0) were administered for 3 h, and ozone exposures (0, 0.10, and 0.20 microliter/liter), which followed acid-mist treatments, for 4 h, each for three days a week for six to nine weeks. It was found that seedlings were more susceptible to acid-mist and acid mist/ozone combinations, than to ozone alone. Acid mist treatment resulted in higher levels of nitrogen and sulfur (both present in acid mist) as well as Na. Leaves of giant sequoia exhibited increased K and decreased Mn, while Jeffrey pine showed increases in Fe and Mn. In sequoia leaves, concentrations of Ca, Mg, and Ba decreased. Acid treatment also reduced chlorophyll b concentrations in both conifer species. Extensive changes induced by acid mist are consistent with earlier observations of changes in spectral reflectance of conifer seedlings observed after three weeks of fumigation.

Development of polymorphic genic-SSR markers by cDNA library sequencing in boxwood, Buxus spp. (Buxaceae)

Science.gov (United States)

Genic microsatellites or simple sequence repeat (genic-SSR) markers were developed in boxwood (Buxus taxa) for genetic diversity analysis, identification of taxa, and to facilitate breeding. cDNA libraries were developed from mRNA extracted from leaves of Buxus sempervirens ‘Vardar Valley’ and seque...

The Geology of the Marcia Quadrangle of Asteroid 4Vesta: An Integrated Mapping Study Using Dawn Spacecraft Data

Science.gov (United States)

Williams, David A.; Denevi, B. W.; Mittlefehldt, D. W.; Mest, S. C.; Schenk, P. M.; Jaumann, R.; DeSanctis, M. C.; Buczkowski, D. L.; Ammannito, E.; Prettyman, T. H.;

Thermal measurements of dark and bright surface features on Vesta as derived from Dawn/VIR

Science.gov (United States)

Tosi, Federico; Capria, Maria Teresa; De Sanctis, M.C.; Combe, J.-Ph.; Zambon, F.; Nathues, A.; Schröder, S.E.; Li, J.-Y.; Palomba, E.; Longobardo, A.; Blewett, D.T.; Denevi, B.W.; Palmer, E.; Capaccioni, F.; Ammannito, E.; Titus, Timothy N.; Mittlefehldt, D.W.; Sunshine, J.M.; Russell, C.T.; Raymond, C.A.; Dawn/VIR Team,

2014-01-01

Remote sensing data acquired during Dawn’s orbital mission at Vesta showed several local concentrations of high-albedo (bright) and low-albedo (dark) material units, in addition to spectrally distinct meteorite impact ejecta. The thermal behavior of such areas seen at local scale (1-10 km) is related to physical properties that can provide information about the origin of those materials. We use Dawn’s Visible and InfraRed (VIR) mapping spectrometer hyperspectral data to retrieve surface temperatures and emissivities, with high accuracy as long as temperatures are greater than 220 K. Some of the dark and bright features were observed multiple times by VIR in the various mission phases at variable spatial resolution, illumination and observation angles, local solar time, and heliocentric distance. This work presents the first temperature maps and spectral emissivities of several kilometer-scale dark and bright material units on Vesta. Results retrieved from the infrared data acquired by VIR show that bright regions generally correspond to regions with lower temperature, while dark regions correspond to areas with higher temperature. During maximum daily insolation and in the range of heliocentric distances explored by Dawn, i.e. 2.23-2.54 AU, the warmest dark unit found on Vesta rises to a temperature of 273 K, while bright units observed under comparable conditions do not exceed 266 K. Similarly, dark units appear to have higher emissivity on average compared to bright units. Dark-material units show a weak anticorrelation between temperature and albedo, whereas the relation is stronger for bright material units observed under the same conditions. Individual features may show either evanescent or distinct margins in the thermal images, as a consequence of the cohesion of the surface material. Finally, for the two categories of dark and bright materials, we were able to highlight the influence of heliocentric distance on surface temperatures, and estimate an

[Analysis of the effectiveness of the spa and health resort-based treatment of the patients presenting with broncho-pulmonary pathology at the southern coast of the Crimea depending on the period of flowering of Mediterranean Cypress (Cupressus sempervirens)].

Science.gov (United States)

Savchenko, V M; Belyaeva, S N; Govorun, M I; Pirogova, M E

The objective of the present study was to evaluate the influence of pollen of Mediterranean Cypress (Cupressus sempervirens) on the effectiveness of the spa and health resort-based treatment (SHRT) of the patients with broncho-pulmonary pathology at the southern coast of the Crimea (SCC). This article presents the results of the analysis of the data on 122 patients presenting with broncho-pulmonary pathology who received SHRT under the conditions of the Southern Coast of the Crimea. Fifty one (41.8%) of these patients suffered from chronic obstructive pulmonary disease and 71 (58.2%) ones had bronchial asthma. The whole group was comprised of 44 men (36.1%) and 78 women (63.9%). The average (median) age of the patients was 55.8 years. All the participants of the study underwent the comprehensive examination including the general medical and physical examination, complete blood count, the study of sputum cytology and immunological properties of blood including the standard characteristics, IgE and lysozyme levels), evaluation of the respiratory and locomotor (physical) functions with the use of the 6-minute walking test. The aeropollenological study of the aerial environment of the southern coast of the Crimea in the region of Yalta showed that the «bloom» of the Mediterranean Cypress occurs during the period from February till April inclusive. The highest concentrations of cypress pollen are observed in March and early April. The overall effectiveness of SHRT for the patients with broncho-pulmonary pathology arriving for the treatment at the southern coast of the Crimea from other Crimean localities does not depend on the period of «flowering» (the presence of pollen in the air) of the Mediterranean Cypress. In these patients, the termination of the spa and health resort-based treatment during the «flowering» of the Mediterranean Cypress resulted in nothing more than a strained adaptive response manifested as the altered blood leukocyte count. Such reaction

An analysis of United States K-12 stem education versus STEM workforce at the dawn of the digital revolution

Science.gov (United States)

Cataldo, Franca

The world is at the dawn of a third industrial revolution, the digital revolution, that brings great changes the world over. Today, computing devices, the Internet, and the World Wide Web are vital technology tools that affect every aspect of everyday life and success. While computing technologies offer enormous benefits, there are equally enormous safety and security risks that have been growing exponentially since they became widely available to the public in 1994. Cybercriminals are increasingly implementing sophisticated and serious hack attacks and breaches upon our nation's government, financial institutions, organizations, communities, and private citizens. There is a great need for computer scientists to carry America's innovation and economic growth forward and for cybersecurity professionals to keep our nation safe from criminal hacking. In this digital age, computer science and cybersecurity are essential foundational ingredients of technological innovation, economic growth, and cybersecurity that span all industries. Yet, America's K-12 education institutions are not teaching the computer science and cybersecurity skills required to produce a technologically-savvy 21st century workforce. Education is the key to preparing students to enter the workforce and, therefore, American K-12 STEM education must be reformed to accommodate the teachings required in the digital age. Keywords: Cybersecurity Education, Cybersecurity Education Initiatives, Computer Science Education, Computer Science Education Initiatives, 21 st Century K-12 STEM Education Reform, 21st Century Digital Literacies, High-Tech Innovative Problem-Solving Skills, 21st Century Digital Workforce, Standardized Testing, Foreign Language and Culture Studies, Utica College, Professor Chris Riddell.

Towards Homo Digitalis: Important Research Issues for Psychology and the Neurosciences at the Dawn of the Internet of Things and the Digital Society

Directory of Open Access Journals (Sweden)

Christian Montag

2018-02-01

Full Text Available The present article gives an overview on central challenges humans face at the dawn of complex digital societies and the Internet of Things (IoT, i.e., a world completely connected to the Internet. Among the many challenges to be handled in digital societies is a growing fragmented life style leading to loss of productivity as well as moments for self-reflection. In all this, it is of tremendous importance to understand the impact of digital worlds on our brains and psyches and to reveal possible unintended side-effects of technology use. Does human nature change due to constant interactions with virtual realities? In this context, we also face the challenge to design digital worlds according to our mammalian-emotional heritage deeply anchored in subcortical areas of the human brain. Here, we refer to emotional needs as carved out by Panksepp’s Affective Neuroscience Theory and how they can or cannot be fulfilled in digital worlds. Aside from a review of several key studies dealing with the raised challenges, some first solutions to successfully meet the mentioned problems are provided to achieve sustainable and healthy digital worlds, with whom humans can interact carefree on a daily basis.

Resolved spectrophotometric properties of the Ceres surface from Dawn Framing Camera images

Science.gov (United States)

Schröder, S. E.; Mottola, S.; Carsenty, U.; Ciarniello, M.; Jaumann, R.; Li, J.-Y.; Longobardo, A.; Palmer, E.; Pieters, C.; Preusker, F.; Raymond, C. A.; Russell, C. T.

2017-05-01

We present a global spectrophotometric characterization of the Ceres surface using Dawn Framing Camera (FC) images. We identify the photometric model that yields the best results for photometrically correcting images. Corrected FC images acquired on approach to Ceres were assembled into global maps of albedo and color. Generally, albedo and color variations on Ceres are muted. The albedo map is dominated by a large, circular feature in Vendimia Planitia, known from HST images (Li et al., 2006), and dotted by smaller bright features mostly associated with fresh-looking craters. The dominant color variation over the surface is represented by the presence of "blue" material in and around such craters, which has a negative spectral slope over the visible wavelength range when compared to average terrain. We also mapped variations of the phase curve by employing an exponential photometric model, a technique previously applied to asteroid Vesta (Schröder et al., 2013b). The surface of Ceres scatters light differently from Vesta in the sense that the ejecta of several fresh-looking craters may be physically smooth rather than rough. High albedo, blue color, and physical smoothness all appear to be indicators of youth. The blue color may result from the desiccation of ejected material that is similar to the phyllosilicates/water ice mixtures in the experiments of Poch et al. (2016). The physical smoothness of some blue terrains would be consistent with an initially liquid condition, perhaps as a consequence of impact melting of subsurface water ice. We find red terrain (positive spectral slope) near Ernutet crater, where De Sanctis et al. (2017) detected organic material. The spectrophotometric properties of the large Vendimia Planitia feature suggest it is a palimpsest, consistent with the Marchi et al. (2016) impact basin hypothesis. The central bright area in Occator crater, Cerealia Facula, is the brightest on Ceres with an average visual normal albedo of about 0.6 at

Spectral measurements of howardites in support of the interpretation of the Dawn VIR spectra at Vesta

Science.gov (United States)

De Angelis, S.; Ammannito, E.; Di Iorio, T.; De Sanctis, M.; Mittlefehldt, D.

2014-07-01

The howardites, eucrites, and diogenites constitute a suite of meteorite lithologies (HED) known to be related to asteroid Vesta [1]. Howardites are physical mixtures of eucrites and diogenites. Howardites are divided in two subtypes: regolithic howardites are actually linked to the true regolith, while fragmental howardites are simple polymict breccias [2]. Mapping of Vesta's surface, as obtained with data from Visible and Infrared mapping Spectrometer (VIR) on Dawn [3,4], showed that it is mainly howarditic, with few regions of diogenite-rich and eucrite-rich terrains [5, 6]. In order to map quantitatively the distribution of lithologic types on Vesta, we are carrying on a study of a set of well-characterized howardites [7]. Spectra were measured on sample powders sieved to 75 μ m in the laboratories of the Istituto di Astrofisica e Planetologia Spaziali (IAPS-INAF) in Rome (Italy) and Brown University, in Providence (USA). Here we report about the measurements done at IAPS-INAF. The spectra of 33 samples have been acquired with the S.LAB setup, consisting in the FieldSpec Pro spectrometer (range 0.35-2.5 μ m, spatial resolution 0.5 cm^2) coupled with a goniometer (incidence i=30°, emission e=0°) [8]. Some representative spectra of the measured howardites are shown in the figure. The spectra are characterized by the two broad Fe^{2+} absorption bands near 1 and 2 μ m (BI and BII) indicative of pyroxenes. Band parameters relative to BI and BII have been calculated using the algorithm developed to process VIR spectra [4]. This enables us to compare laboratory data directly with the VIR results. Other weaker absorptions also characterize some spectra: the 0.5 μ m feature (Mn^{2+} or Cr^{3+}) and the 1.2 μ m feature possibly due to Fe^{2+} in plagioclases. The PRA04401 sample is characterized by a pyroxene-carbonaceous matter mixture [7].

[Entering the Dawn of a New Life: A Discussion of Life for Survivors of the Formosa Fun Coast Water Park Explosion].

Science.gov (United States)

Wen, Hui-Min

2016-02-01

A dust explosion at the Formosa Fun Coast water park in Taiwan caused nearly 500 burn injury cases. One hundred of these cases involved burns over more than 20% of the total body surface area. This tragedy inundated hospitals across northern Taiwan with an unprecedented number of burn patients. Significant manpower and medical resources were targeted on related resuscitation and treatment efforts, with support and assistance provided by agencies and organizations nationwide. Most of the burn patients were young people in their teens and twenties, whose severe burns posed the greatest threat and challenge to their lives so far. Furthermore, their experience presented major psychosocial and physical health challenges. Patients received an array of clinical treatments such as debridement, skin grafting, dressing, and rehabilitation. Debilitating pain, skin damage, changes to body image, physical disabilities, helplessness, sadness, and anxiety have not only deeply affected the patients physically and psychologically but also created significant life stresses for their family members / companions, which requires counseling in order to facilitate emotional healing. Although burn patients gradually recover as they pass through the acute, recovery, and rehabilitation phases, they will face the challenges of lifelong rehabilitation after discharge. I hope that these young victims will take courage and be brave and strong in dealing with the difficulties and challenges of daily life and will embrace the future with hope as they enter the dawn of their new life.

Effect of solar UV/EUV heating on the intensity and spatial distribution of Jupiter's synchrotron radiation

Science.gov (United States)

Kita, H.; Misawa, H.; Tsuchiya, F.; Tao, C.; Morioka, A.

2013-10-01

We analyzed the Very Large Array archived data observed in 2000 to determine whether solar ultraviolet (UV)/extreme ultraviolet (EUV) heating of the Jovian thermosphere causes variations in the total flux density and dawn-dusk asymmetry (the characteristic differences between the peak emissions at dawn and dusk) of Jupiter's synchrotron radiation (JSR). The total flux density varied by 10% over 6 days of observations and accorded with theoretical expectations. The average dawn-dusk peak emission ratio indicated that the dawn side emissions were brighter than those on the dusk side and this was expected to have been caused by diurnal wind induced by the solar UV/EUV. The daily variations in the dawn-dusk ratio did not correspond to the solar UV/EUV, and this finding did not support the theoretical expectation that the dawn-dusk ratio and diurnal wind velocity varies in correspondence with the solar UV/EUV. We tried to determine whether the average dawn-dusk ratio could be explained by a reasonable diurnal wind velocity. We constructed an equatorial brightness distribution model of JSR using the revised Divine-Garrett particle distribution model and used it to derive a relation between the dawn-dusk ratio and diurnal wind velocity. The estimated diurnal wind velocity reasonably corresponded to a numerical simulation of the Jovian thermosphere. We also found that realistic changes in the diurnal wind velocity could not cause the daily variations in the dawn-dusk ratio. Hence, we propose that the solar UV/EUV related variations were below the detection limit and some other processes dominated the daily variations in the dawn-dusk ratio.

Phytochemical composition and in vitro functional properties of three wild rose hips and their traditional preserves.

Science.gov (United States)

Nađpal, Jelena D; Lesjak, Marija M; Mrkonjić, Zorica O; Majkić, Tatjana M; Četojević-Simin, Dragana D; Mimica-Dukić, Neda M; Beara, Ivana N

2018-02-15

The aim of the present study was investigation of the phenolic profile, ascorbic acid content, antioxidant, anti-acetylcholinesterase, anti-inflammatory and cytotoxic activity of rose hips and the preserves (purée and jam) of three insufficiently examined Rosa species: Rosa dumalis Bechst., R. dumetorum Thuill. and R. sempervirens L. The liquid chromatography-tandem mass spectrometry analysis resulted in quantification of 14 of the 45 phenolic compounds examined, with ellagic acid as the most dominant. Notable antioxidant activity of all three species was confirmed through several assays. Moderate inhibition of acetylcholinesterase by extracts of all investigated Rosa species was observed. Several extracts of examined Rosa species demonstrated inhibition potency towards production of some monitored eicosanoids in cyclooxygenase-1 and 12-lipoxygenase pathways. Two R. sempervirens extracts exerted cytotoxic activity against HeLa and HT-29 cell lines, but were inactive towards MRC-5 and MCF7. The results support the potential of these rose hips as food with health-promoting properties. Copyright © 2017 Elsevier Ltd. All rights reserved.

Biosynthesized silver nanoparticles to control fungal infections in indoor environments

Science.gov (United States)

Deyá, Cecilia; Bellotti, Natalia

2017-06-01

Fungi grow especially in dark and moist areas, deteriorating the indoor environment and causing infections that particularly affect immunosuppressed individuals. Antimicrobial coatings have as principal objective to prevent biofilm formation and infections by incorporation of bioactive additives. In this sense, metallic nanoparticles, such as silver, have proven to be active against different microorganisms specially bacteria. Biosynthesized method is a promising environmentally friendly option to obtain nanoparticles. The aim of this research was assess the employment of plants extracts of Aloysia triphylla (cedrón), Laurelia sempervirens (laurel) and Ruta chalepensis (ruda) to obtain silver nanoparticles to be used as an antimicrobial additive to a waterborne coating formulation. The products obtained were assessed against fungal isolates from biodeteriorated indoor coatings. The fungi were identified by conventional and molecular techniques as Chaetomium globosum and Alternaria alternate. The results revealed that the coating with silver nanoparticles obtained with L. sempervirens extract at 60 °C with a size of 9.8 nm was the most efficient against fungal biofilm development.

Preparation and characterisation of biodegradable pollen-chitosan microcapsules and its application in heavy metal removal.

Science.gov (United States)

Sargın, İdris; Kaya, Murat; Arslan, Gulsin; Baran, Talat; Ceter, Talip

2015-02-01

Biosorbents have been widely used in heavy metal removal. New resources should be exploited to develop more efficient biosorbents. This study reports the preparation of three novel chitosan microcapsules from pollens of three common, wind-pollinated plants (Acer negundo, Cupressus sempervirens and Populus nigra). The microcapsules were characterized (Fourier transform infrared spectroscopy, thermogravimetric analysis, scanning electron microscopy and elemental analysis) and used in removal of heavy metal ions: Cd(II), Cr(III), Cu(II), Ni(II) and Zn(II). Their sorption capacities were compared to those of cross-linked chitosan beads without pollen grains. C. sempervirens-chitosan microcapsules exhibited better performance (Cd(II): 65.98; Cu(II): 67.10 and Zn(II): 49.55 mg g(-1)) than the other microcapsules and the cross-linked beads. A. negundo-chitosan microcapsules were more efficient in Cr(III) (70.40 mg g(-1)) removal. P. nigra-chitosan microcapsules were found to be less efficient. Chitosan-pollen microcapsules (except P. nigra-chitosan microcapsules) can be used in heavy metal removal. Copyright © 2014 Elsevier Ltd. All rights reserved.

The INTERBALL-Tail ELECTRON experiment: initial results on the low-latitude boundary layer of the dawn magnetosphere

Directory of Open Access Journals (Sweden)

J.-A. Sauvaud

Full Text Available The Toulouse electron spectrometer flown on the Russian project INTERBALL-Tail performs electron measurements from 10 to 26 000 eV over a 4 solid angle in a satellite rotation period. The INTERBALL-Tail probe was launched on 3 August 1995 together with a subsatellite into a 65° inclination orbit with an apogee of about 30 R_E. The INTERBALL mission also includes a polar spacecraft launched in August 1996 for correlated studies of the outer magnetosphere and of the auroral regions. We present new observations concerning the low-latitude boundary layers (LLBL of the magnetosphere obtained near the dawn magnetic meridian. LLBL are encountered at the interface between two plasma regimes, the magnetosheath and the dayside extension of the plasma sheet. Unexpectedly, the radial extent of the region where LLBL electrons can be sporadically detected as plasma clouds can reach up to 5 R_E inside the magnetopause. The LLBL core electrons have an average energy of the order of 100 eV and are systematically field-aligned and counterstreaming. As a trend, the temperature of the LLBL electrons increases with decreasing distance to Earth. Along the satellite orbit, the apparent time of occurrence of LLBL electrons can vary from about 5 to 20 min from one pass to another. An initial first comparison between electron- and magnetic-field measurements indicates that the LLBL clouds coincide with a strong increase in the magnetic field (by up to a factor of 2. The resulting strong magnetic field gradient can explain why the plasma-sheet electron flux in the keV range is strongly depressed in LLBL occurrence regions (up to a factor of sim10. We also show that LLBL electron encounters are related to field-aligned current structures and that wide LLBL correspond to northward interplanetary magnetic field. Evidence for LLBL/plasma-sheet electron leakage into the magnetosheath during southward IMF is also presented.

The ASC Sequoia Programming Model

Energy Technology Data Exchange (ETDEWEB)

Seager, M

2008-08-06

In the late 1980's and early 1990's, Lawrence Livermore National Laboratory was deeply engrossed in determining the next generation programming model for the Integrated Design Codes (IDC) beyond vectorization for the Cray 1s series of computers. The vector model, developed in mid 1970's first for the CDC 7600 and later extended from stack based vector operation to memory to memory operations for the Cray 1s, lasted approximately 20 years (See Slide 5). The Cray vector era was deemed an extremely long lived era as it allowed vector codes to be developed over time (the Cray 1s were faster in scalar mode than the CDC 7600) with vector unit utilization increasing incrementally over time. The other attributes of the Cray vector era at LLNL were that we developed, supported and maintained the Operating System (LTSS and later NLTSS), communications protocols (LINCS), Compilers (Civic Fortran77 and Model), operating system tools (e.g., batch system, job control scripting, loaders, debuggers, editors, graphics utilities, you name it) and math and highly machine optimized libraries (e.g., SLATEC, and STACKLIB). Although LTSS was adopted by Cray for early system generations, they later developed COS and UNICOS operating systems and environment on their own. In the late 1970s and early 1980s two trends appeared that made the Cray vector programming model (described above including both the hardware and system software aspects) seem potentially dated and slated for major revision. These trends were the appearance of low cost CMOS microprocessors and their attendant, departmental and mini-computers and later workstations and personal computers. With the wide spread adoption of Unix in the early 1980s, it appeared that LLNL (and the other DOE Labs) would be left out of the mainstream of computing without a rapid transition to these 'Killer Micros' and modern OS and tools environments. The other interesting advance in the period is that systems were being developed with multiple 'cores' in them and called Symmetric Multi-Processor or Shared Memory Processor (SMP) systems. The parallel revolution had begun. The Laboratory started a small 'parallel processing project' in 1983 to study the new technology and its application to scientific computing with four people: Tim Axelrod, Pete Eltgroth, Paul Dubois and Mark Seager. Two years later, Eugene Brooks joined the team. This team focused on Unix and 'killer micro' SMPs. Indeed, Eugene Brooks was credited with coming up with the 'Killer Micro' term. After several generations of SMP platforms (e.g., Sequent Balance 8000 with 8 33MHz MC32032s, Allian FX8 with 8 MC68020 and FPGA based Vector Units and finally the BB&N Butterfly with 128 cores), it became apparent to us that the killer micro revolution would indeed take over Crays and that we definitely needed a new programming and systems model. The model developed by Mark Seager and Dale Nielsen focused on both the system aspects (Slide 3) and the code development aspects (Slide 4). Although now succinctly captured in two attached slides, at the time there was tremendous ferment in the research community as to what parallel programming model would emerge, dominate and survive. In addition, we wanted a model that would provide portability between platforms of a single generation but also longevity over multiple--and hopefully--many generations. Only after we developed the 'Livermore Model' and worked it out in considerable detail did it become obvious that what we came up with was the right approach. In a nutshell, the applications programming model of the Livermore Model posited that SMP parallelism would ultimately not scale indefinitely and one would have to bite the bullet and implement MPI parallelism within the Integrated Design Code (IDC). We also had a major emphasis on doing everything in a completely standards based, portable methodology with POSIX/Unix as the target environment. We decided against specialized libraries like STACKLIB for performance, but kept as many general purpose, portable math libraries as were needed by the codes. Third, we assumed that the SMPs in clusters would evolve in time to become more powerful, feature rich and, in particular, offer more cores. Thus, we focused on OpenMP, and POSIX PThreads for programming SMP parallelism. These code porting efforts were lead by Dale Nielsen, A-Division code group leader, and Randy Christensen, B-Division code group leader. Most of the porting effort revolved removing 'Crayisms' in the codes: artifacts of LTSS/NLTSS, Civic compiler extensions beyond Fortran77, IO libraries and dealing with new code control languages (we switched to Perl and later to Python). Adding MPI to the codes was initially problematic and error prone because the programmers used MPI directly and sprinkled the calls throughout the code.

78 FR 11899 - Notice of Realty Action: Direct Sale of Public Land in San Mateo County, CA

Science.gov (United States)

2013-02-20

... California Nonprofit Corporation, for the appraised fair market value. The total appraised value of both... Sempervirens Fund for the appraised fair market value of $420,000. Parcel No. 2 T. 8 S., R. 4 W., Sec. 9, NE\\1... appraised fair market value of $450,000. The areas described aggregate 80 acres, more or less, in Santa...

AcEST: BP917160 [AcEST

Lifescience Database Archive (English)

Full Text Available sequoia glyptostroboides PE=2 SV=1 Length = 319 Score = ...jct: 64 GRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGSILFEETLY 121 >tr|Q8LK59|Q8LK59_METGY Fructose-bisphosphate aldolase OS=Meta

SVD/MCMC Data Analysis Pipeline for Global Redshifted 21-cm Spectrum Observations of the Cosmic Dawn and Dark Ages

Science.gov (United States)

Burns, Jack O.; Tauscher, Keith; Rapetti, David; Mirocha, Jordan; Switzer, Eric

2018-01-01

We have designed a complete data analysis pipeline for constraining Cosmic Dawn physics using sky-averaged spectra in the VHF range (40-200 MHz) obtained either from the ground (e.g., the Experiment to Detect Global Epoch of Reionization Signal, EDGES; and the Cosmic Twilight Polarimeter, CTP) or from orbit above the lunar farside (e.g., the Dark Ages Radio Explorer, DARE). In the case of DARE, we avoid Earth-based RFI, ionospheric effects, and radio solar emissions (when observing at night). To extract the 21-cm spectrum, we parametrize the cosmological signal and systematics with two separate sets of modes defined through Singular Value Decomposition (SVD) of training set curves. The training set for the 21-cm spin-flip brightness temperatures is composed of theoretical models of the first stars, galaxies and black holes created by varying physical parameters within the ares code. The systematics training set is created using sky and beam data to model the beam-weighted foregrounds (which are about four orders of magnitude larger than the signal) as well as expected lab data to model receiver systematics. To constrain physical parameters determining the 21-cm spectrum, we apply to the extracted signal a series of consecutive fitting techniques including two usages of a Markov Chain Monte Carlo (MCMC) algorithm. Importantly, our pipeline efficiently utilizes the significant differences between the foreground and the 21-cm signal in spatial and spectral variations. In addition, it incorporates for the first time polarization data, dramatically improving the constraining power. We are currently validating this end-to-end pipeline using detailed simulations of the signal, foregrounds and instruments. This work was directly supported by the NASA Solar System Exploration Research Virtual Institute cooperative agreement number 80ARC017M0006 and funding from the NASA Ames Research Center cooperative agreement NNX16AF59G.

Taliraps on koristatud ja müüdudki / Lii Sammler

Index Scriptorium Estoniae

Sammler, Lii, 1963-

2014-01-01

Esimest korda talirapsiga viljelusvõistlusel osalenud Väätsa Agro ja Karinu PM OÜ panustasid sordile DK 'Sequoia' ja esialgsetel andmetel korjati kuiva seemet 4-5 tonni ümber hektarilt. Vestlusest agronoomidega

Seasonal Variation in Soil Greenhouse Gas Emissions at Three Age-Stages of Dawn Redwood (Metasequoia glyptostroboides Stands in an Alluvial Island, Eastern China

Directory of Open Access Journals (Sweden)

Shan Yin

2016-11-01

Full Text Available Greenhouse gas (GHG emissions are an important part of the carbon (C and nitrogen (N cycle in forest soil. However, soil greenhouse gas emissions in dawn redwood (Metasequoia glyptostroboides stands of different ages are poorly understood. To elucidate the effect of plantation age and environmental factors on soil GHG emissions, we used static chamber/gas chromatography (GC system to measure soil GHG emissions in an alluvial island in eastern China for two consecutive years. The soil was a source of CO2 and N2O and a sink of CH4 with annual emissions of 5.5–7.1 Mg C ha−1 year−1, 0.15–0.36 kg N ha−1 year−1, and 1.7–4.5 kg C ha−1 year−1, respectively. A clear exponential correlation was found between soil temperature and CO2 emission, but a negative linear correlation was found between soil water content and CO2 emission. Soil temperature had a significantly positive effect on CH4 uptake and N2O emission, whereas no significant correlation was found between CH4 uptake and soil water content, and N2O emission and soil water content. These results implied that older forest stands might cause more GHG emissions from the soil into the atmosphere because of higher litter/root biomass and soil carbon/nitrogen content compared with younger stands.

76 FR 13944 - Approval and Promulgation of Air Quality Implementation Plans; State of California; Regional Haze...

Science.gov (United States)

2011-03-15

... Wilderness; 14. Emigrant Wilderness; 15. Hoover Wilderness; 16. Yosemite National Park; 17. Ansel Adams... monitor) Ansel Adams WA, Kaiser WA, John 15.5 14.9 13.6 7.1 2200 Muir WA (KAIS monitor)......... Sequoia...

SARAS 2: a spectral radiometer for probing cosmic dawn and the epoch of reionization through detection of the global 21-cm signal

Science.gov (United States)

Singh, Saurabh; Subrahmanyan, Ravi; Shankar, N. Udaya; Rao, Mayuri Sathyanarayana; Girish, B. S.; Raghunathan, A.; Somashekar, R.; Srivani, K. S.

2018-04-01

The global 21-cm signal from Cosmic Dawn (CD) and the Epoch of Reionization (EoR), at redshifts z ˜ 6-30, probes the nature of first sources of radiation as well as physics of the Inter-Galactic Medium (IGM). Given that the signal is predicted to be extremely weak, of wide fractional bandwidth, and lies in a frequency range that is dominated by Galactic and Extragalactic foregrounds as well as Radio Frequency Interference, detection of the signal is a daunting task. Critical to the experiment is the manner in which the sky signal is represented through the instrument. It is of utmost importance to design a system whose spectral bandpass and additive spurious signals can be well calibrated and any calibration residual does not mimic the signal. Shaped Antenna measurement of the background RAdio Spectrum (SARAS) is an ongoing experiment that aims to detect the global 21-cm signal. Here we present the design philosophy of the SARAS 2 system and discuss its performance and limitations based on laboratory and field measurements. Laboratory tests with the antenna replaced with a variety of terminations, including a network model for the antenna impedance, show that the gain calibration and modeling of internal additive signals leave no residuals with Fourier amplitudes exceeding 2 mK, or residual Gaussians of 25 MHz width with amplitudes exceeding 2 mK. Thus, even accounting for reflection and radiation efficiency losses in the antenna, the SARAS 2 system is capable of detection of complex 21-cm profiles at the level predicted by currently favoured models for thermal baryon evolution.

Stephen S. Wise and the Urban Frontier: American Jewish Life in New York and the Pacific Northwest at the Dawn of the 20th Century

Directory of Open Access Journals (Sweden)

Mark A. Raider

2011-10-01

Full Text Available The case of Stephen S. Wise provides a lens through which to examine American Jewry’s transformation at the dawn of the 20th century. Not only were New York City and Portland, Oregon – places Wise called home – two geographic poles of America’s urban frontier, they also highlight a spectrum of possibilities available to the New World’s fledgling Jewish community. Viewed in tandem, they illustrate American society’s raw, open, and pliable terrain as it emerged from a rural pre-industrial past. Moreover, by placing Wise in the context of the metropolitan growth that reshaped the Atlantic and Pacific frontiers in the late 19th century, we gain a better understanding of the relationship between the country’s dynamic environmental conditions and the phenomenon of Jewish immigrant absorption, acculturation, and Americanization.In withdrawing to the wilderness, Wise exposed himself to new possibilities for thinking about the place of Jews in American society and the future of American Judaism. He also honed the role of which he was to become a superlative exemplar – a 20th-century American rabbi at home in the worlds of religion and politics. Furthermore, his synthesis of liberal Judaism, American pluralism, Zionism, and Progressive-era notions of social justice anticipated the rise of a new American Jewish sensibility that would become normative in the 20th century.

Magnetic record associated with tree ring density: Possible climate proxy

Czech Academy of Sciences Publication Activity Database

Kletetschka, Günther; Pruner, Petr; Venhodová, Daniela; Kadlec, Jaroslav

2007-01-01

Roč. 8, - (2007), s. 1-11 ISSN 1467-4866 Institutional research plan: CEZ:AV0Z3013912 Keywords : palaeo-climatic indicator * sequoia tree * magnetic properties Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.842, year: 2007

Information needs for natural fire management planning

Science.gov (United States)

Parsons, David; Bancroft, Larry; Nichols, Thomas; Stohlgren, Thomas

1985-01-01

The development and implementation of an effective natural fire management program require a clear definition of goals and objectives, an ever-expanding information base, and effective program evaluation. Examples are given from Sequoia and Kings Canyon National Parks.

Ethnic differences in family member diabetes involvement and psychological outcomes: results from the second Diabetes Attitudes, Wishes and Needs (DAWN2) study in the USA.

Science.gov (United States)

Peyrot, Mark; Egede, Leonard E; Funnell, Martha M; Hsu, William C; Ruggiero, Laurie; Siminerio, Linda M; Stuckey, Heather L

2015-01-01

To assess differences among USA ethnic groups in psychological status of adult family members (FMs) and their involvement with the diabetes of another adult. Data are from the FM survey of the USA DAWN2 study, including 105 White non-Hispanics, 47 African Americans, 46 Hispanic Americans and 40 Chinese Americans. All FMs lived with and cared for an adult with diabetes. Analysis of covariance controlled for respondent and patient characteristics to assess ethnic group differences (P ethnic minority groups. African Americans reported the highest well-being and lowest negative life impact, Chinese Americans reported the most diabetes burden, Hispanic Americans reported the highest distress. There were no ethnic group differences in QoL. Ethnic minority FMs reported having more involvement with diabetes, greater support success, and more access to a diabetes support network than White non-Hispanics. Higher FM diabetes involvement was associated with negative psychological outcomes, while diabetes education, support success and diabetes support network size were associated with better psychological outcomes. Potential limitations are the sample sizes and representativeness. Minority ethnic FMs experienced both advantages and disadvantages in psychological outcomes relative to each other and to White non-Hispanics. Ethnic minority FMs had more involvement in diabetes care, support success and support from others, with the first associated with worse and the latter two with better psychological outcomes. Additional studies are needed with larger samples and broader representation of ethnic groups to better understand these associations and identify areas for intervention.

Analysis of forest structure using thematic mapper simulator data

Science.gov (United States)

Peterson, D. L.; Westman, W. E.; Brass, J. A.; Stephenson, N. J.; Ambrosia, V. G.; Spanner, M. A.

1986-01-01

The potential of Thematic Mapper Simulator (TMS) data for sensing forest structure information has been explored by principal components and feature selection techniques. In a survey of forest structural properties conducted for 123 field sites of the Sequoia National Park, the canopy closure could be well estimated (r = 0.62 to 0.69) by a variety of channel bands and band ratios, without reference to the forest type. Estimation of the basal area was less successful (r = 0.51 or less) on the average, but could be improved for certain forest types when data were stratified by floristic composition. To achieve such a stratification, individual sites were ordinated by a detrended correspondence analysis based on the canopy of dominant species. The analysis of forest structure in the Sequoia data suggests that total basal area can be best predicted in stands of lower density, and in younger even-aged managed stands.

AcEST: DK962439 [AcEST

Lifescience Database Archive (English)

Full Text Available sequoia glyptostroboides PE=2 SV=1 Length = 319 Score = 261 bits (667), Expect = 3e...GLASRSAAYYQQGARFAK 183 Query: 637 WRTVV 651 WRTVV Sbjct: 184 WRTVV 188 >tr|Q8LK59|Q8LK59_METGY Fructose-bisphosphate aldolase OS=Meta

Dawn of Science

Indian Academy of Sciences (India)

Bible took the elaborate precaution of counting the total number of letters at the end of copying!) Gutenberg's genius was in realising that by producing a series of small and durable metallic seals, each representing a single letter, printing could be made much more efficient. The letters can be assembled to form a page and ...

Dawn of Science

Indian Academy of Sciences (India)

Copernicus realised that his model could explain several things, which Ptolemy ... dedicated to Pope Paul III in order to pre-empt opposition from the Church. ... It was then rather strange to think that the Sun was going round the. Earth instead ...

Dawn of Science

Indian Academy of Sciences (India)

2016-08-26

Aug 26, 2016 ... Home; Journals; Resonance – Journal of Science Education; Volume 17; Issue 2 ... email addresses used by the office of Indian Academy of Sciences, including those of the staff, the journals, various programmes, and Current Science, has changed from 'ias.ernet.in' (or 'academy.ias.ernet.in') to 'ias.ac.in'.

Mesocosm-Scale Experimental Quantification of Plant-Fungi Associations on Carbon Fluxes and Mineral Weathering

Science.gov (United States)

Andrews, M. Y.; Palmer, B.; Leake, J. R.; Banwart, S. A.; Beerling, D. J.

2009-12-01

The rise of land plants in the Paleozoic is classically implicated as driving lower atmospheric CO2 levels through enhanced weathering of Ca and Mg bearing silicate minerals. However, this view overlooks the fact that plants coevolved with associated mycorrhizal fungi over this time, with many of the weathering processes usually ascribed to plants actually being driven by the combined activities of roots and mycorrhizal fungi. Here we present initial results from a novel mesocosm-scale laboratory experiment designed to allow investigation of plant-driven carbon flux and mineral weathering at different soil depths under ambient (400 ppm) and elevated (1500 ppm) atmospheric CO2. Four species of plants were chosen to address evolutionary trends in symbiotic mycorrhizal association and rooting depth on biologically driven silicate weathering under the different CO2 regimes. Gymnosperms were used to investigate potential differences in weathering capabilities of two fungal symbioses: Sequoia sempervirens and Metasequoia glyptostroboides (arbuscular mycorrhizal, AM) and Pinus sylvestris (ectomycorrhizal, EM), and the shallow rooted ancient fern, Osmunda regalis, used to provide a contrast to the three more deeply rooted trees. Plants were grown in a cylindrical mesocosm with four horizontal inserts at each depth. These inserts are a mesh-covered dual-core unit whereby an inner core containing silicate minerals can be rotated within an outer core. The mesh excludes roots from the cylinders allowing fungal-rock pairings to be examined at each depth. Each core contains either basalt or granite, each with severed (rotated cores) or intact (static cores) mycorrhizae. This system provides a unique opportunity to examine the ability of a plant to weather minerals with and without its symbiotic fungi. Preliminary results indicate marked differences in nutritional and water requirements, and response to elevated CO2 between the species. The bulk solution chemistries (p

Chemical and biological characterization of phytotoxins produced by Diplodia species, fungi involved in forest plants diseases

OpenAIRE

Masi, Marco

2013-01-01

In recent years, numerous studies have been initiated in order to understand what are the microorganisms involved in forest plants diseases and the role played by phytotoxins produced in the pathogenesis processes. The aim of the present thesis was to study the fungi and the phytotoxins associated with canker disease of the Italian cypress (Cupressus sempervirens L.) and the branch dieback of juniper (Juniperus phoenicea L.) which are plant diseases with noteworthy social and economical impli...

Updates in the IR responsivity of VIR, the spectrometer of the Dawn mission.

Science.gov (United States)

Ammannito, Eleonora; Mc Cord, Thomas B.; De Sanctis, Maria Cristina.; Combe, Jean-Philippe

VIR-MS (Visual and Infrared Mapping Spectrometer) is the imaging spectrometer of the Dawn mission (1,2). Here, first we describe the computation of a new instrument responsivity based on the internal calibration data acquired during the operations at Vesta, and then we describe its effect on the dataset and on the results published so far. VIR-MS was built in Italy by a scientific-industrial (IAPS/INAF in Rome (Italy) and Selex ES in Campi Bisenzio (Fi, Italy)) consortium financially supported by the Italian Space Agency. VIR-MS is an high spatial resolution spectrometer (FOV of 64mrad, IFOV of 250 µrad) in the 0.25-5 µm range with an IFOV of 250 µrad and a spectral sampling of about 2 nm in the visible range and 10 nm in the IR range. The results of the on-ground calibration held in the Selex calibration facility in September 2005 were already presented and discussed in a paper (2). This version has been used to calibrate the data available on the Planetary Data System (PDS) Small Bodies Node, dataset used in all the papers published so far. However, after the operations at the asteroid Vesta, we have identified some artifacts in the instrument responsivity in the 2.5-3.5 µm region, which is where several absorption bands of OH and H2O occur. Those artifacts were systematic, and therefore they did not prevent the detection of relative spectral variations associated to OH and H2O. Actually, the only paper published in which are discussed spectra in this range (3) used a different calibration method described in the paper itself. This method used a simple correction of the response function based on an empirical calibration correction that is appropriate to recover the signal in that specific range. However, the absolute absorption band depth of OH and H2O could not be calculated. To compute a new instrument responsivity we used the internal lamp of the spectrometer. This lamp, made of a tungsten filament, is characterized by a blackbody-like emission at about

High Sierra Ecosystems: The Role of Fish Stocking in Amphibian Declines

Science.gov (United States)

Kathleen Matthews

2003-01-01

With a rich diversity of aquatic habitats, including deep lakes, shallow ponds, and rushing streams, Dusy Basinin Sequoia-Kings Canyon National Parks typifies the high Sierra ecosystem where mountain yellow-legged frogs usually thrive. Yet throughout the Sierra, aquatic ecologist Kathleen Matthews found entire water basins empty of these amphibians. Comprehensive...

The impact of normative message types on off-trail hiking

Science.gov (United States)

P.L. Winter

2006-01-01

Depreciative activities and high annual visitation levels threaten the health and sustainability of the giant Sequoia. Signage is one route to managing visitor behavior. Research suggests a two-by-two conceptualization of normative messages in signs. Messages may present the "ought" (injunctive) or the "is" (descriptive) of behavior and may be...

An examination of the roles of trauma exposure and posttraumatic stress disorder on emotion regulation strategies of Operation Iraqi Freedom, Operation Enduring Freedom, and Operation New Dawn veterans.

Science.gov (United States)

Sippel, Lauren M; Roy, Alicia M; Southwick, Steven M; Fichtenholtz, Harlan M

2016-09-01

Theories of posttraumatic stress disorder (PTSD) implicate emotional processes, including difficulties utilizing adaptive emotion regulation strategies, as critical to the etiology and maintenance of PTSD. Operation Iraqi Freedom, Operation Enduring Freedom, and Operation New Dawn (OIF/OEF/OND) veterans report high levels of combat exposure and PTSD. We aimed to extend findings suggesting that emotion regulation difficulties are a function of PTSD, rather than combat trauma exposure or common comorbidities, to OIF/OEF/OND veterans, in order to inform models of PTSD risk and recovery that can be applied to returning veterans. We tested differences in emotion regulation, measured with the Difficulties in Emotion Regulation Scale and Emotion Regulation Questionnaire, among trauma-exposed veterans with (n = 24) or without PTSD (n = 22) and healthy civilian comparison participants (n = 27) using multivariate analyses of covariance, adjusting for major depressive disorder, anxiety disorders, and demographic variables (age, sex, and ethnicity). Veterans with PTSD reported more use of expressive suppression and more difficulties with emotion regulation than veterans without PTSD and healthy comparison participants. Groups did not differ on cognitive reappraisal. Findings suggest the key role of PTSD above and beyond trauma exposure, depression, and anxiety in specific aspects of emotion dysregulation among OIF/OEF/OND veterans. Interventions that help veterans expand and diversify their emotion regulation skills may serve as helpful adjunctive treatments for PTSD among OIF/OEF/OND veterans.

[Ginkgo biloba extract (EGb 761). State of knowledge in the dawn of the year 2000].

Science.gov (United States)

Clostre, F

1999-07-01

stress-alleviating action of EGb 761: its facilitates behavioral adaptation to stress and may decrease the excess of cortisol release to stress. Moreover, EGb 761 shows a specific neuroprotective effects to hippocampic cells. Regarding the visual system, experimental studies have shown that EGb 761 can inhibit or reduce the functional retinal impairments resulting from ischemia-reperfusion, photo-degeneration, diabetic or proliferative retinopathy. Clinical studies have revealed that EGb 761 may be useful in treating visual activity impairments and damages to the visual field associated with chronic cerebrovascular insufficiency, senile macular degeneration and diabete mellitus. Regarding the vestibular and auditory systems, experimental and clinical studies have shown the efficacy of EGb 761 in treating hypoacusis, tinnitus, vertigo, dizziness and other symptoms of vestibulocochlear disorders. At least, adequatly controlled studies in patients with peripheral arterial occlusive disease have provided good evidence for therapeutic efficacy in intermittent claudication. The future of EGb 761 is undoubtedly in the promise in slowing the progression of Alzheimer's disease. Indeed, two recent american clinical studies have shown the efficacy and safety of EGb 761 in patients with mild to severe Alzheimer's disease and multi-infarct dementia. In clinical terms, progression of symptoms was delayed by approximately 6 months. Actually new clinical studies are undertaken in USA and Europe. At the dawn of the third millenium (the Sixth for Ginkgo biloba) we propose a state of art about it.

Leaf Starch Turnover Occurs in Long Days and in Falling Light at the End of the Day.

Science.gov (United States)

Fernandez, Olivier; Ishihara, Hirofumi; George, Gavin M; Mengin, Virginie; Flis, Anna; Sumner, Dean; Arrivault, Stéphanie; Feil, Regina; Lunn, John E; Zeeman, Samuel C; Smith, Alison M; Stitt, Mark

2017-08-01

We investigated whether starch degradation occurs at the same time as starch synthesis in Arabidopsis ( Arabidopsis thaliana ) leaves in the light. Starch accumulated in a linear fashion for about 12 h after dawn, then accumulation slowed and content plateaued. Following decreases in light intensity, the rate of accumulation of starch declined in proportion to the decline in photosynthesis if the decrease occurred 14 h after dawn and in response to decreases in light intensity that occurred >10 h after dawn. Starch measurements in circadian clock mutants suggested that the clock influences the timing of onset of degradation. We conclude that the propensity for leaf starch to be degraded increases with time after dawn. The importance of this phenomenon for efficient use of carbon for growth in long days and for prevention of starvation during twilight is discussed. © 2017 American Society of Plant Biologists. All Rights Reserved.

Seasonal patterns in the nocturnal distributionand behavior of the mesopelagic fish Maurolicus muelleri at high latitudes

KAUST Repository

Prihartato, Perdana; Aksnes, Dag L.; Kaartvedt, Stein

2015-01-01

'midnight sinking', followed by a dawn ascent before a return to the daytime habitat. Light levels were ∼1 order of magnitude lower during the dawn ascent than for ascent in the afternoon, with the latter terminating before fish reached upper layers on ∼1

Targeting Androgen Receptor in Breast Cancer: Enzalutamide as a Novel Breast Cancer Therapeutic

Science.gov (United States)

2016-09-01

Publications, Abstracts, and Presentations: Papers: Dawn R. Cochrane, Sebastian Bernales, Britta M. Jacobsen, Diana M. Cittelly, Erin N. Howe, Nicholas C...Dawn R. Cochrane, Sebastian Bernales, Britta M. Jacobsen, Diana M. Cittelly, Erin N. Howe, Nicholas C. D’Amato, Nicole S. Spoelstra, Annie Jean

Pop / Tristan Priimägi

Index Scriptorium Estoniae

Priimägi, Tristan, 1976-

2007-01-01

Heliplaatidest: Pink Floyd "The Piper At The Gates Of Dawn", Build An Ark "Dawn", Underworld "Oblivion with Bells", Mum "Go Go Smear the Poison Ivy", Himsa "Summon in Thunder", Öökülm "Välk selgest taevast", Queen "Queen Rock Montreal", Rosta Aknad "Rosta Aknad"

Le albe di Oswald von Wolkenstein: inquadramento storico-letterario, analisi testuale e traduzione in italiano (Prima parte

Directory of Open Access Journals (Sweden)

Alessandra Molinari

2010-07-01

Full Text Available This paper is the first part of an enquiry on the tageliet, the medieval German version of the erotic dawn-song. After introducing the problems and issues concerning the definition of the concept of text-type and poetic genre, the paper sketches out the possible origin and sources of European dawn-songs and their diffusion in medieval France. A survey on the German tageliet follows. It analyses their position within medieval German love lyrics and their relationship to French dawn-songs. It then focuses on some of the texts which were probably perceived by a medieval German speaking audience as being ‘typical’. The second part of this enquiry will follow in Linguæ & 1/2010. It will contain a discussion on variants and parodies of the tageliet as well as an analysis of the dawn-songs composed by the great Tyrolean poet Oswald von Wolkenstein (1376/78-1445.

Fostering personal relationships with the wild: Oral history's role in recreation management

Science.gov (United States)

Alison Steiner; Daniel R. Williams

2017-01-01

Sequoia and Kings Canyon National Parks (SEKI) encompass much of central California's most stunning scenery. Dramatic peaks and passes, perennial snowfields, remote lake basins, alpine meadows, steep canyons, and shockingly big trees characterize the more than 800,000 acres of wild land that lie within the parks. Drought-resistant chaparral and blue oak woodlands...

[Phylogenetic relationships among the genera of Taxodiaceae and Cupressaceae from 28S rDNA sequences].

Science.gov (United States)

Li, Chun-Xiang; Yang, Qun

2003-03-01

DNA sequences from 28S rDNA were used to assess relationships between and within traditional Taxodiaceae and Cupressaceae s.s. The MP tree and NJ tree generally are similar to one another. The results show that Taxodiaceae and Cupressaceae s.s. form a monophyletic conifer lineage excluding Sciadopitys. In the Taxodiaceae-Cupressaceae s.s. monophyletic group, the Taxodiaceae is paraphyletic. Taxodium, Glyptostrobus and Cryptomeria forming a clade(Taxodioideae), in which Glyptostrobus and Taxodium are closely related and sister to Cryptomeria; Sequoia, Sequoiadendron and Metasequoia are closely related to each other, forming another clade (Sequoioideae), in which Sequoia and Sequoiadendron are closely related and sister to Metasequoia; the seven genera of Cupressaceae s.s. are found to be closely related to form a monophyletic lineage (Cupressoideae). These results are basically similar to analyses from chloroplast gene data. But the relationships among Taiwania, Sequoioideae, Taxodioideae, and Cupressoideae remain unclear because of the slow evolution rate of 28S rDNA, which might best be answered by sequencing more rapidly evolving nuclear genes.

Gender differences in service utilization among Operations Enduring Freedom, Iraqi Freedom, and New Dawn Veterans Affairs patients with severe mental illness and substance use disorders.

Science.gov (United States)

Painter, Janelle M; Brignone, Emily; Gilmore, Amanda K; Lehavot, Keren; Fargo, Jamison; Suo, Ying; Simpson, Tracy; Carter, Marjorie E; Blais, Rebecca K; Gundlapalli, Adi V

2018-02-01

Severe mental illness (SMI) and substance use disorders (SUD) are among the more chronic and costly mental health conditions treated in the Department of Veterans Affairs (VA). Service use patterns of returning veterans with SMI and SUD have received little attention. We examined gender differences in the utilization of VA services among a national sample of Operations Enduring Freedom, Iraqi Freedom, and New Dawn (OEF/OIF/OND) VA patients with SMI, SUD, and their comorbidity (SMI/SUD) in their first year of established VA care (N = 24,166). Outpatient services and acute-residential stays were modeled using negative binomial and logistic regression, respectively. Among all diagnostic categories, men used outpatient services less often than did women, including primary care (adjusted rate ratio [ARR] = .71, 95% confidence interval CI [.68, .74]), mental health (ARR = .85, 95% CI [.80, .91]), and addiction (ARR = .91, 95% CI [.83, .99]) services. For emergency department (ED) and psychiatric inpatient services, gender interacted significantly with diagnosis. The combination of SMI/SUD compared to either SMI or SUD conferred greater risk of ED utilization among men than women (adjusted odds ratio [AOR] = 2.09, 95% CI [1.24, 3.51], and 1.95, 95% CI [1.17, 3.26], respectively). SMI versus SUD conferred greater risk of psychiatric inpatient utilization among men than women (AOR = 1.83, 95% CI [1.43, 2.34]). Our findings point to gender differences in outpatient and acute service utilization among OEF/OIF/OND VA patients with some of the more chronic and costly mental health conditions. Further investigation of health care utilization patterns is needed to understand factors driving these gender differences to ensure that veterans have appropriate access to the services they need. (PsycINFO Database Record (c) 2018 APA, all rights reserved).

Changing conditions on wilderness campsites: Seven case studies of trends over 13 to 32 years

Science.gov (United States)

David N. Cole

2013-01-01

This report brings together seven case studies of trends in the number and condition of wilderness campsites over periods ranging from 13 to 32 years. Case examples come from five mountainous wilderness areas in the western United States: Sequoia-Kings Canyon Wilderness in California, the Eagle Cap Wilderness in Oregon, the Frank Church-River of No Return Wilderness in...

Policy Evaluation: Use of the PSB-Aptitude Test as an Admission Requirement for the LVN Program.

Science.gov (United States)

Firstman, Aranga

A study was conducted to assess the use of the Psychological Services Bureau's Aptitude Test for Practical Nursing (PSB Aptitude Test) as an entrance requirement for the licensed vocational nurse (LVN) program at College of the Sequoias. The study sought to determine whether the PSB Aptitude Test was a valid indicator of success in the LVN…

Annosus Root disease of Western Conifers (FIDL)

Science.gov (United States)

Craig L. Schmitt; John R. Parmeter; John T. Kliejunas

2000-01-01

Annosus root disease is found on all western conifer species but is of most concern on true firs, hemlocks, and pines. Incense cedar, coast redwood and sequoia are sometimes infected in California. Western juniper is infected throughout its range. Annosus is common and causes extensive decay in old-growth western and mountain hemlock stands. Many mixed conifer stands...

Forest Resources of the Caucasian Black Sea Coast: Problems and Prospects of Rational Use

Directory of Open Access Journals (Sweden)

S. M. Bebia

2015-02-01

Full Text Available More than 70 % of the Caucasian Black Sea Coast (CBSC forests grow in mountainous conditions of the Colchis phytogeographical province and perform primary environmental functions. In these forests for a long period of time excessively intense logging has been in practice, which caused serious damage to their health. The main issues of forestry here are the introduction of effective methods of harvesting, using rational technology in logging operations, restoring native forest types at past logging sites, increasing the productivity and sustainability of forests on the bioecological biogeocenotical level, and preserving the riparian-protective role of forests. In the article, the author analyzes the results of many years of research in forests of the CBSC, that consider the question of condition of forests, peculiarity the multifunctional values and priority direction forestry in them. The author also considers the basic conformity of structure and com-position of forest stands, and presents evidence about the natural renewal of logging sites in fir and beech forests. It has been established that high intensity selective logging more than 50 % canopy cover and bringing the stand after logging 0.5 and below leads to degradation of forests, except for the possibility of natural regeneration felling areas for over 70 years. The study substantiates the effectiveness of selective forms of forest management in the uneven-aged stands and the importance of a multi-purpose and sustainable use of forest resources. The study emphasizes the need for a rational technology of logging operations and silvicultural demands strict compliance with the development of cutting areas and suggests ways to improve the productivity of forests, using introduced valuable tree species. For example, Sequoia sempervirens Endl. in the plantings of forest monocultures on the Abkhazian Research Forest Experimental Station (Ochamchira at age of 50 years forms a valuable timber of

Undermining Patriarchal Ideology in African Literature: A Study of Ngozi Chuma-Udeh’s Echoes of a New Dawn

Directory of Open Access Journals (Sweden)

Ujowundu Cornel O.

2013-11-01

��s sexual passion; and worst of all, not consulted in the decision making processes in their communities. The women as wives are expected to be submissive, obedient, unquestioning and servile while any challenge to these attributes attracts social disfavour. So the clearly defined roles for women are passed on to the girl-child as she grows. As soon as she is able to do things for herself, she starts assuming the roles society has mapped out for her: learning how to cook, care for the home, helping with everything else the mother does, and preparing for womanhood and matrimony. This paper, therefore, takes a critical look into Ngozi Chuma-Udeh’s novel that advocates a new dawn for the women. The novelist wants the men to reconsider their negative notions about women and to also appreciate their contributions in the well-being of their societies, their families and the upbringing of the children.

Estaquillas leñosas de fácil enraizamiento: Estudio del Esclerenquima Estaquillas leñosas de fácil enraizamiento: Estudio del Esclerénquima

Directory of Open Access Journals (Sweden)

González Elena

1986-12-01

Full Text Available An anatomy study was made of following wood easy-to-root species: Aucuba japonica Thunb., Buddleja  japonica Hemsley,  Buxus sempervirens L., Citrus aurantium.  L., Citrus limon (L. Burm. fil.,  Cvdonia oblonga Miller,  Erica arborea L., Escallonia rubra (Ruiz & Pavón Pers., Euonymus japonicus L. fil., Forsythia viridissima Lindl., Hydrangea macrophylla Ser., Morus alba L., Populus nigra L.,  Rhododendron ponticum L., Salix atrocinerea Brot., Salix  viminalis L., Sambucus nigra L. and Symphoricarpos albus (L. S. F. Blake.  It was observed the presence or absence of a discontinous sclerenchyma ring so the species studied had not a mechanical barrier to the emergence of adventitious roots. Se realizó un estudio histológico de las siguientes especies leñosas de fácil enraizamiento: Aucuba japonica Thumb, Buddleja japonica Hemsley, Buxus sempervirens L., Citrus aurantium L., Citrus limon (L. Burm, fil., Cydonia oblonga Miller, Erica arborea L., Escallonia rubra (Ruiz & Pavón Pers., Euonymus japonicus L. fil., Forsythia viridissima Lindl., Hydrangea macrophylla Ser., Morus alba L. Populus nigra L., Rhododendron ponticum L., Salix atrocinerea Brot., Salix viminalis L., Sambucus nigra L. y Syrnphoricarpos albus (L. S. F. Blake. Se observó la presencia o ausencia de un anillo discontinuo de esclerénquima, por lo tanto dichas especies no poseen ningún impedimento mecánico para la emergencia de las raíces adventicias.

Links between belowground and aboveground resource-related traits reveal species growth strategies that promote invasive advantages.

Science.gov (United States)

Smith, Maria S; Fridley, Jason D; Goebel, Marc; Bauerle, Taryn L

2014-01-01

Belowground processes are rarely considered in comparison studies of native verses invasive species. We examined relationships between belowground fine root production and lifespan, leaf phenology, and seasonal nitrogen dynamics of Lonicera japonica (non-native) versus L. sempervirens (native) and Frangula alnus (non-native) versus Rhamnus alnifolia (native), over time. First and second order fine roots were monitored from 2010 to 2012 using minirhizotron technology and rhizotron windows. 15N uptake of fine roots was measured across spring and fall seasons. Significant differences in fine root production across seasons were seen between Lonicera species, but not between Frangula and Rhamnus, with both groups having notable asynchrony in regards to the timing of leaf production. Root order and the number of root neighbors at the time of root death were the strongest predictors of root lifespan of both species pairs. Seasonal 15N uptake was higher in spring than in the fall, which did not support the need for higher root activity to correspond with extended leaf phenology. We found higher spring 15N uptake in non-native L. japonica compared to native L. sempervirens, although there was no difference in 15N uptake between Frangula and Rhamnus species. Our findings indicate the potential for fast-growing non-native Lonicera japonica and Frangula alnus to outcompete native counterparts through differences in biomass allocation, root turnover, and nitrogen uptake, however evidence that this is a general strategy of invader dominance is limited.

Links between belowground and aboveground resource-related traits reveal species growth strategies that promote invasive advantages.

Directory of Open Access Journals (Sweden)

Maria S Smith

Full Text Available Belowground processes are rarely considered in comparison studies of native verses invasive species. We examined relationships between belowground fine root production and lifespan, leaf phenology, and seasonal nitrogen dynamics of Lonicera japonica (non-native versus L. sempervirens (native and Frangula alnus (non-native versus Rhamnus alnifolia (native, over time. First and second order fine roots were monitored from 2010 to 2012 using minirhizotron technology and rhizotron windows. 15N uptake of fine roots was measured across spring and fall seasons. Significant differences in fine root production across seasons were seen between Lonicera species, but not between Frangula and Rhamnus, with both groups having notable asynchrony in regards to the timing of leaf production. Root order and the number of root neighbors at the time of root death were the strongest predictors of root lifespan of both species pairs. Seasonal 15N uptake was higher in spring than in the fall, which did not support the need for higher root activity to correspond with extended leaf phenology. We found higher spring 15N uptake in non-native L. japonica compared to native L. sempervirens, although there was no difference in 15N uptake between Frangula and Rhamnus species. Our findings indicate the potential for fast-growing non-native Lonicera japonica and Frangula alnus to outcompete native counterparts through differences in biomass allocation, root turnover, and nitrogen uptake, however evidence that this is a general strategy of invader dominance is limited.

Dawn of e-government

DEFF Research Database (Denmark)

Henriksen, Helle Zinner; Damsgaard, Jan

2007-01-01

Most countries have defined strategies for e-government. The objectives for implementing e-government are often defined but the means for fuelling the adoption and diffusion of e-government are typically less well clear in the policy statements. The present study assesses the impact of latest...... internally and externally. The e-Day initiative represents a drastic change in the former policy statements concerning IT adoption and diffusion in Danish government. The policy statements had previously been based on voluntary adoption focusing on visions and pedagogical intervention in governmental...

Aircraft observations of aerosols O3 and NOy in a nighttime urban plume

International Nuclear Information System (INIS)

Berkowitz, C.M.; Zaveri, R.A.; Xindi Bian; Shiyuan Zhong; Disselkamp, R.S.; Laulainen, N.S.; Chapman, E.G.

2001-01-01

Nighttime measurements of aerosol surface area, O 3 , NO y and moisture were made downwind of Portland, Oregon, as part of a study to characterize the chemistry in a nocturnal urban plume. Air parcels sampled within the urban plume soon after sunset had positive correlations between O 3 , relative humidity, NO y and aerosol number density. However, the air parcels sampled within the urban plume just before dawn had O 3 mixing ratios that were highly anti-correlated with aerosol number density, NO y and relative humidity. Back-trajectories from a mesoscale model show that both the post-sunset and pre-dawn parcels came from a common maritime source to the northwest of Portland. The pre-dawn parcels with strong anti-correlations passed directly over Portland in contrast to the other parcels that were found to pass west of Portland. Several gas-phase mechanisms and a heterogeneous mechanism involving the loss of O 3 to the aerosol surface, are examined to explain the observed depletion in O 3 within the pre-dawn parcels that had passed over Portland. (Author)

Kdo rozhoduje v českých politických stranách? Vzestup nových politických podnikatelů ve srovnávací perspektivě

Directory of Open Access Journals (Sweden)

Lubomír Kopeček

2015-08-01

Full Text Available This article focuses on a comparative analysis of the organization of contemporary Czech parliamentary parties. It emphasizes the structural and functional differences between the new parties—ANO (meaning “yes” in Czech and Dawn of Direct Democracy—and older parties. The theoretical section presents the basic organizational types – in particular, the concept of the business-firm party. The following organizational aspects of parties are then compared: membership, form of funding, the role played by ground organizations, the position and composition of top party bodies, the role played by the party leader, and media resources. This analysis reveals that ANO and Dawn have a more exclusive membership than older parties and have centralized more power into the hands of the party leader, who is supported both by formal statutes and by informal structures. In the case of ANO, the central leadership dominates over lower-level ground organizations; Dawn forgoes them altogether. Its missing institutional base accelerated Dawn’s implosion in 2015. ANO is characterised by a high degree of professionalism and control over key media, both of which were missing in the case of Dawn.

Aircraft observations of aerosols O{sub 3} and NO{sub y} in a nighttime urban plume

Energy Technology Data Exchange (ETDEWEB)

Berkowitz, C.M.; Zaveri, R.A.; Xindi Bian; Shiyuan Zhong; Disselkamp, R.S.; Laulainen, N.S.; Chapman, E.G. [Pacific Northwest National Lab., Richland, WA (United States)

2001-05-01

Nighttime measurements of aerosol surface area, O{sub 3}, NO{sub y} and moisture were made downwind of Portland, Oregon, as part of a study to characterize the chemistry in a nocturnal urban plume. Air parcels sampled within the urban plume soon after sunset had positive correlations between O{sub 3}, relative humidity, NO{sub y} and aerosol number density. However, the air parcels sampled within the urban plume just before dawn had O{sub 3} mixing ratios that were highly anti-correlated with aerosol number density, NO{sub y} and relative humidity. Back-trajectories from a mesoscale model show that both the post-sunset and pre-dawn parcels came from a common maritime source to the northwest of Portland. The pre-dawn parcels with strong anti-correlations passed directly over Portland in contrast to the other parcels that were found to pass west of Portland. Several gas-phase mechanisms and a heterogeneous mechanism involving the loss of O{sub 3} to the aerosol surface, are examined to explain the observed depletion in O{sub 3} within the pre-dawn parcels that had passed over Portland. (Author)

Spouse READI (Resilience Education and Deployment Information): Randomized Clinical Trial Formerly Reintegration: The Role of Spouse Telephone BATTLEMIND Randomized Clinical Trial

Science.gov (United States)

2014-10-01

OIF and Operation New Dawn - OND) and Afghanistan (Operation Enduring Freedom – OEF). The goal was to build spouses’ resilience to cope with...mental or physical health, self- reported/perceived health, medical conditions (diabetes, depressive symptoms, hypertension , heart disease, cancer...at least one month post deployment from serving in Iraq (Operation Iraqi Freedom – OIF, Operation New Dawn – OND) or Afghanistan (Operation Enduring

Moonshine: Diurnally varying hydration through natural distillation on the Moon, detected by the Lunar Exploration Neutron Detector (LEND).

Science.gov (United States)

Livengood, T A; Chin, G; Sagdeev, R Z; Mitrofanov, I G; Boynton, W V; Evans, L G; Litvak, M L; McClanahan, T P; Sanin, A B; Starr, R D; Su, J J

2015-07-15

The Lunar Exploration Neutron Detector (LEND), on the polar-orbiting Lunar Reconnaissance Orbiter (LRO) spacecraft, has detected suppression in the Moon's naturally-occurring epithermal neutron leakage flux that is consistent with the presence of diurnally varying quantities of hydrogen in the regolith near the equator. Peak hydrogen concentration (neutron flux suppression) is on the dayside of the dawn terminator and diminishes through the dawn-to-noon sector. The minimum concentration of hydrogen is in the late afternoon and dusk sector. The chemical form of hydrogen is not determinable from these measurements, but other remote sensing methods and anticipated elemental availability suggest water molecules or hydroxyl ions. Signal-to-noise ratio at maximum contrast is 5.6 σ in each of two detector systems. Volatiles are deduced to collect in or on the cold nightside surface and distill out of the regolith after dawn as rotation exposes the surface to sunlight. Liberated volatiles migrate away from the warm subsolar region toward the nearby cold nightside surface beyond the terminator, resulting in maximum concentration at the dawn terminator. The peak concentration within the upper ~1 m of regolith is estimated to be 0.0125 ± 0.0022 weight-percent water-equivalent hydrogen (wt% WEH) at dawn, yielding an accumulation of 190 ± 30 ml recoverable water per square meter of regolith at each dawn. Volatile transport over the lunar surface in opposition to the Moon's rotation exposes molecules to solar ultraviolet radiation. The short lifetime against photolysis and permanent loss of hydrogen from the Moon requires a resupply rate that greatly exceeds anticipated delivery of hydrogen by solar wind implantation or by meteoroid impacts, suggesting that the surface inventory must be continually resupplied by release from a deep volatile inventory in the Moon. The natural distillation of water from the regolith by sunlight and its capture on the cold night surface may

Development of High Resolution Eddy Current Imaging Using an Electro-Mechanical Sensor (Preprint)

Science.gov (United States)

2011-11-01

The Fluxgate Magnetometer ,” J. Phys. E: Sci. Instrum., Vol. 12: 241-253. 13. A. Abedi, J. J. Fellenstein, A. J. Lucas, and J. P. Wikswo, Jr., “A...206 (2006). 11. Ripka, P., 1992, Review of Fluxgate Sensors, Sensors and Actuators, A. 33, Elsevier Sequoia: 129-141. 12. Primdahl, F., 1979...superconducting quantum interference device magnetometer system for quantitative analysis and imaging of hidden corrosion activity in aircraft aluminum

Detection of Oil in Water Column, Final Report: Detection Prototype Tests

Science.gov (United States)

2014-07-01

nautical miles per hour) LED Light-emitting diode LISST Laser In Situ Scattering and Transmissometry LUT Look-up table μm Micron or micrometer...nozzles are attached to an electrically actuated solenoid valve. When a remotely operated switch energizes the valve, oil flows through the nozzles...smaller droplet sizes below 70 μm. Ohmsett personnel used a Sequoia Laser In Situ Scattering and Transmissometry (LISST) 100X off-the-shelf particle

Dextromethorphan Abuse in Adolescence

Science.gov (United States)

Bryner, Jodi K.; Wang, Uerica K.; Hui, Jenny W.; Bedodo, Merilin; MacDougall, Conan; Anderson, Ilene B.

2008-01-01

Objectives To analyze the trend of dextromethorphan abuse in California and to compare these findings with national trends. Design A 6-year retrospective review. Setting California Poison Control System (CPCS), American Association of Poison Control Centers (AAPCC), and Drug Abuse Warning Network (DAWN) databases from January 1, 1999, to December 31, 2004. Participants All dextromethorphan abuse cases reported to the CPCS, AAPCC, and DAWN. The main exposures of dextromethorphan abuse cases included date of exposure, age, acute vs long-term use, coingestants, product formulation, and clinical outcome. Main Outcome Measure The annual proportion of dextromethorphan abuse cases among all exposures reported to the CPCS, AAPCC, and DAWN databases. Results A total of 1382 CPCS cases were included in the study. A 10-fold increase in CPCS dextromethorphan abuse cases from 1999 (0.23 cases per 1000 calls) to 2004 (2.15 cases per 1000 calls) (odds ratio, 1.48; 95% confidence interval, 1.43–1.54) was identified. Of all CPCS dextromethorphan abuse cases, 74.5% were aged 9 to 17 years; the frequency of cases among this age group increased more than 15-fold during the study (from 0.11 to 1.68 cases per 1000 calls). Similar trends were seen in the AAPCC and DAWN databases. The highest frequency of dextromethorphan abuse occurred among adolescents aged 15 and 16 years. The most commonly abused product was Coricidin HBP Cough & Cold Tablets. Conclusions Our study revealed an increasing trend of dextromethorphan abuse cases reported to the CPCS that is paralleled nationally as reported to the AAPCC and DAWN. This increase was most evident in the adolescent population. PMID:17146018

Decorative values of selected cultivars of climbing roses (Rosa L. with regard to thermal conditions

Directory of Open Access Journals (Sweden)

Zofia Włodarczyk

2012-12-01

Full Text Available In the years 2004-2006 in Kraków, phenological observations of climbing roses were conducted in order to determine the length and dates of their flowering period. The diameters of their flowers were also compared. Eight flowering repeating cultivars were selected for the experiment: 'Climbing Souvenir de la Malmaison', 'Dortmund', 'Golden Showers', 'Goldstern', 'New Dawn', 'Parade', 'Sympathie' and 'White New Dawn'. During the studies, the shrub roses were not artificially watered in order to create conditions similar to those prevailing in public green areas. It was observed that irrespective of the air temperature pattern in a given year, the studied cultivars did not bloom before 15 June. In 2006 high temperatures (above 20oC, which continued throughout the whole flowering period, caused its shortening, and the interval between the first and the next flowering in the season lasted longer than in the previous years. In the years 2004-2006, the cultivar 'New Dawn' bloomed the longest. In 2005 the studied cultivars produced larger flowers than the next year. The cultivars 'Dortmund' and 'White New Dawn' were characterised by the smallest diameter of flowers, whereas 'Climbing Souvenir de la Malmaison', 'Golden Showers' and 'Parade' were marked by the largest diameter.

At the dawn of geodesy

Science.gov (United States)

Fischer, Irene K.

1981-06-01

The first land surveyors were rope stretchers and rope knotters, remembered in ancient documents and tomb paintings and also in some terminology. The L-shaped carpenter’s square, one of the earliest and most versatile basic tools, represents the observed direction of the plumb line versus the water level and appears as the shadow-casting gnomon and also as the geometrical gnomon in magically-restricted enlargements of altars. The related “Pythagorean” theorem was known in antiquity centuries before Pythagoras, with algebraic proofs in Babylonia and China. The spherical shape of the earth, deduced from the observation of circumpolar stars, was part of a complete equatorial astronomical system in ancient China. But although shadow measurements were generally used to establish north-south distances, only the Greeks derived from them the size of the earth. The striking difference between the abstract, geometric approach of Greece and the concrete, algebraic approach of Babylonia and China represents not a difference in talents but a difference in culture-bound interests.

Dawn of the Social Cyborg

Science.gov (United States)

Campbell, Joe; Finegan, William

2011-01-01

Corporate learning environments have undergone disruptive changes over the last 20 years due to the explosion of information technology, globalization of the workforce, and shrinking travel and training budgets. Those disruptions are accelerating with the introduction of new technologies such as social media. Potentially the most disruptive change…

A new dawn for CMS

CERN Multimedia

2007-01-01

Supported by a gigantic crane and a factory-size room full of enthusiasm, the central barrel of CMS made its final journey underground on 28 February. The central section of the CMS detector starts its dramatic 10-hour descent underground.Several hours (and 100 metres) later, the massive barrel rests on the cavern floor. CMS scientists, journalists, photographers and members of the transport crew basked in the final rays of the 'solenoid-set' on 28 February as the central barrel of the CMS detector sinks below the horizon and began its ten-hour descent into the cavern 100 metres below. Thirteen metres long and weighing as much as five jumbo jets (1920 tonnes), the barrel is the largest of the 15 chunks of CMS detector that are being lowered one by one into the cavern. 'This is a challenging feat of engineering, as there are just 20 cm of leeway between the detector and the walls of the shaft,' said Austin Ball, Technical Coordinator of CMS. The section of the detector, which contains the solenoid of the magne...

The hazy dawn of brachytherapy

International Nuclear Information System (INIS)

Dutreix, J.; Tubiana, M.; Pierquin, B.

1998-01-01

The discovery of radium by Pierre and Marie Curie in December 1898 opened a new era in science and within a few years provided medicine with a new means of tumor treatment. Their personal contribution to the start and early development of clinical applications should not be overlooked. The Curies did not limit their support to providing radium sources to medical pioneers but took a deep interest in the horizons of radiumtherapy. Pierre was one of the first to search for and demonstrate a biological effect of radium radiation. He investigated the radioactivity of the waters of hydrotherapeutic resorts. Marie took care of the measurement of the medical sources personally, convinced that the result of the treatment depends on the precise knowledge of the amount of radium applied. Her perseverance resulted in the establishment of the Institut du Radium (1909) in which, besides the physico-chemical laboratory, a biological department was set up. The latter became the Fondation Curie (1920), a leading medical center of treatment and training, with an integrated team of physicists, radiobiologists and clinicians led by Regaud. One hundred years after the discovery of radium, patients benefit today from the extensive clinical experience that has been collected over the years and from sophisticated developments in application techniques, dosimetry and quality assurance; the professional risk has been precisely assessed and the improvements in material and procedure have enabled the medical personnel to work in hazard-free conditions. This outcome results from the continuous progress that the pioneers gave impulse to. This paper intends to recall their efforts and achievements, as well as the difficulties and the problems they encountered during the first 2 decades when the sturdy foundations of brachytherapy were built. (Copyright (c) 1998 Elsevier Science B.V., Amsterdam. All rights reserved.)

RELICS of the Cosmic Dawn

Science.gov (United States)

Bradac, Marusa; Coe, Dan; Strait, Victoria; Salmon, Brett; Hoag, Austin; Bradley, Larry; Ryan, Russell; Dawson, Will; Zitrin, Adi; Jones, Christine; Sharon, Keren; Trenti, Michele; Stark, Daniel; Oesch, Pascal; Lam, Danel; Carrasco Nunez, Daniela Patricia; Paterno-Mahler, Rachel; Frye, Brenda

2018-05-01

When did galaxies start forming stars? What is the role of distant galaxies in galaxy formation models and epoch of reionization? Recent observations indicate at least two critical puzzles in these studies. (1) First galaxies might have started forming stars earlier than previously thought (knowledge of stellar masses, ages, and star formation rates at this epoch requires measuring both rest-frame UV and optical light, which only Spitzer and HST can probe at z 6-11 for a large enough sample of typical galaxies. To address this cosmic puzzle, we propose to complete deep Spitzer imaging of the fields behind the 10 most powerful cosmic telescopes selected using HST, Spitzer, and Planck data from the RELICS and SRELICS programs (Reionization Lensing Cluster Survey; 41 clusters, 190 HST orbits, 440 Spitzer hours). 6 clusters out of 10 are still lacking deep data. This proposal will be a valuable Legacy complement to the existing IRAC deep surveys, and it will open up a new parameter space by probing the ordinary yet magnified population with much improved sample variance. The program will allow us to study stellar properties of a large number, 60 galaxies at z 6-11. Deep Spitzer data will be crucial to unambiguously measure their stellar properties (age, SFR, M*). Finally this proposal will establish the presence (or absence) of an unusually early established stellar population, as was recently observed in MACS1149JD at z 9. If confirmed in a larger sample, this result will require a paradigm shift in our understanding of the earliest star formation.

RELICS of the Cosmic Dawn

Science.gov (United States)

Bradac, Marusa; Coe, Dan; Huang, Kuang-Han; Salmon, Brett; Hoag, Austin; Bradley, Larry; Ryan, Russell; Dawson, Will; Zitrin, Adi; Jones, Christine; Sharon, Keren; Trentu, Michele; Stark, Daniel; Bouwens, Rychard; Oesch, Pascal; Lam, Daniel; Patricia Carasco Nunez, Daniela; Paterno-Mahler, Rachel; Strait, Victoria

2017-10-01

When did galaxies start forming stars? What is the role of distant galaxies in galaxy formation models and epoch of reionization? Recent observations indicate at least two critical puzzles in these studies. (1) First galaxies might have started forming stars earlier than previously thought (Big Bang). (2) It is still unclear what is their star formation history and whether these galaxies can reionize the Universe. Accurate knowledge of stellar masses, ages, and star formation rates at this epoch requires measuring both rest-frame UV and optical light, which only Spitzer and HST can probe at z 6-11 for a large enough sample of typical galaxies. To address this cosmic puzzle, we propose Spitzer imaging of the fields behind the most powerful cosmic telescopes selected using HST, Spitzer, and Planck data from the RELICS and SRELICS programs (Reionization Lensing Cluster Survey; 41 clusters, 190 HST orbits, 550 Spitzer hours). This proposal will be a valuable Legacy complement to the existing IRAC deep surveys, and it will open up a new parameter space by probing the ordinary yet magnified population with much improved sample variance. The program will allow us to study stellar properties of a large number, 20 galaxies at z 6-11. Deep Spitzer data will be crucial to unambiguously measure their stellar properties (age, SFR, M*). Finally this proposal is a unique opportunity to establish the presence (or absence) of an unusually early established stellar population, as was recently observed in MACS1149JD at z 9. If confirmed, this result will require a paradigm shift in our understanding of the earliest star formation.

The dawn of chelonian research

OpenAIRE

MacCord, Kate; Caniglia, Guido; Moustakas-Verho, Jacqueline; Burke, Ann

2015-01-01

Many evo-devo studies of the turtle's shell draw hypotheses and support from historical sources. The groundbreaking works of Cuvier, Geoffroy St. Hilaire, Carus, Rathke, Owen, and others are being revived in modern research, and their centuries-old understanding of the turtle's shell reconsidered. In the works of these eminent biologists of the 19th century, comparative anatomy and embryology of turtle morphology set the stage for future studies in developmental biology, histology, and paleon...

Development of High Resolution Eddy Current Imaging Using an Electro-Mechanical Sensor (Postprint)

Science.gov (United States)

2011-08-01

Primdahl, F., 1979, “The Fluxgate Magnetometer ,” J. Phys. E: Sci. Instrum., Vol. 12: 241-253. 13. A. Abedi, J. J. Fellenstein, A. J. Lucas, and J. P...Issues 1-2, Pages 203-206 (2006). 11. Ripka, P., 1992, Review of Fluxgate Sensors, Sensors and Actuators, A. 33, Elsevier Sequoia: 129-141. 12...Wikswo, Jr., “A superconducting quantum interference device magnetometer system for quantitative analysis and imaging of hidden corrosion activity in

Introduction to some “further adventures into the restless universe” of contemporary American fiction

Directory of Open Access Journals (Sweden)

Brigitte Félix

2011-04-01

Full Text Available The present selection is composed of three articles (on Dawn Raffel, Shelley Jackson and Matthew Derby and an interview of Dawn Raffel conducted by Monica Manolescu. Those texts are part of the collective ongoing project of French researchers in American literature who, for the past four decades, have been exploring the ceaselessly expanding galaxy of what is somewhat loosely termed “contemporary American fiction”. The composition of this dossier, entitled “New American Voices”, raises som...

Contaminant studies in the Sierra Nevadas

Science.gov (United States)

Sparling, D.W.; Fellers, G.

2002-01-01

full text: Several species of anuran amphibians (frogs and toads) are experiencing severe population declines in even seemingly pristine areas of the Sierra Mountains of California. Among the most severely depressed species are the redlegged frog, the foothill and mountain yellow-legged frogs, the Yosemite toad, and the Cascades frog. Several factors, such as habitat fragmentation, introduced predators (especially fish), and disease, have been linked to these declines. But recent evidence from a USGS-led study shows that contaminants are a primary factor. During the past three years, researchers from the USGS Patuxent Wildlife Research Center, the Western Ecology Research Center, the USDA Beltsville Agriculture Research Center, and the Texas A&M University have teamed up to conduct an extensive study on airborne pesticides and their effects on amphibian populations in the Sierra Nevada Mountains. Previous work on environmental chemistry demonstrated that pesticides from the intensely agricultural Central Valley of California are being blown into the more pristine Sierra Nevada Mountains, especially around Sequoia and Yosemite National Parks. Several pesticides, including diazinon, chlorpyrifos, malathion and endosulfan, can be measured in snow, rainfall, and pond waters in these national parks. With the exception of endosulfan, these pesticides affect and even kill both invertebrates and vertebrate species by inhibiting cholinesterase, an enzyme essential to proper nervous system functioning. In the summer of 2001, we published a paper showing that these same pesticides are now found in adults and the tadpoles of Pacific treefrogs. The results of this landmark study showed that more than 50 percent of the tadpoles and adults sampled in Yosemite and Sequoia National Parks had detectable levels of diazinon or chlorpyrifos and that 86 percent of the Pacific treefrogs sampled in the Lake Tahoe region had detectable levels of endosulfan. In contrast, frogs that were

Determination of the swelling velocity of different wood species and tissues depending on the cutting direction on microtome section level

Science.gov (United States)

Stuckenberg, Peter; Wenderdel, Christoph; Zauer, Mario

2018-06-01

Swelling velocity in dependence on the anatomical cutting direction of yew [Taxus baccata L.] and boxwood [Buxus sempervirens L.] was determined at temperature of 20 °C and at relative humidity of 10% and 100%. The investigations, conducted on a microtome section level, showed a similar behaviour for specimens of both wood species. It was possible to determine that the swelling velocity for yew and boxwood increases in its anatomical cutting directions. The longitudinal direction showed the lowest value, the tangential direction, by distinction, the highest value. Furthermore, a significant influence of early wood and late wood content on the swelling velocity for yew was detected.

Scalable Engineering of Quantum Optical Information Processing Architectures (SEQUOIA)

Science.gov (United States)

2016-12-13

fast: recently, it was demonstrated experimentally that photonic cluster states can be produced deterministically by photon scattering off a lambda ...U. The CNOT gate operation corresponds to the sub- matrix of the logic states, shown in solid-color bars and marked with red axis labels. Plots (c

Effect of fasting on renal physiology

OpenAIRE

Achraf Hendawy

2014-01-01

Total abstention from food and water from sunrise to sunset during the month of Ramadan, is practiced by hundreds of millions of Muslims throughout the world. This pattern of fasting during Ramadan is different from the usual fasting as people are allowed to eat and drink between sunset and dawn but not after dawn. The amount and type of food (rich in protein, fat and sugar) eaten during the night may also be significantly different to that usually consumed during the rest of the year, while ...

Simulations of the neutral structure within the dusk side aurora

Directory of Open Access Journals (Sweden)

H. F. Parish

2006-10-01

Full Text Available Observations of neutral winds from rocket release experiments within the premidnight and postmidnight substorm recovery phase aurora, show very large E-region neutral winds of several hundred m/s, where winds measured on the dusk side are even larger than those on the dawn side. These large winds are also associated with strong shears, and there is evidence that some of the regions below these shears may be unstable. The mechanisms which generate this strong vertical structure are not well understood. It is also not known whether the acceleration conditions in the pre and post midnight sectors of the aurora may produce significantly different neutral responses on the dawn and dusk sides. Simulations have been performed using a three-dimensional high resolution limited area thermosphere model to try to understand the neutral structure within the dawn and dusk side aurora. When simulations are performed using auroral forcing alone, for equivalent conditions within the dawn and dusk sectors, differences are found in the simulated response on each side. When measured values of auroral forcing parameters, and background winds and tides consistent with recent observations, are used as model inputs, some of the main features of the zonal and meridional wind observations are reproduced in the simulations, but the magnitude of the peak zonal wind around 140 km tends to be too small and the maximum meridional wind around 130 km is overestimated. The winds above 120 km altitude are found to be sensitive to changes in electric fields and ion densities, as was the case for the dawn side, but the effects of background winds and tides on the magnitudes of the winds above 120 km are found to be relatively small on the dusk side. The structure below 120 km appears to be related mainly to background winds and tides rather than auroral forcing, as was found in earlier studies on the dawn side, although the peak magnitudes of simulated wind variations in the 100 to

Spatial distribution of upstream magnetospheric ≥50 keV ions

Directory of Open Access Journals (Sweden)

G. C. Anagnostopoulos

2000-01-01

Full Text Available We present for the first time a statistical study of \\geq50 keV ion events of a magnetospheric origin upstream from Earth's bow shock. The statistical analysis of the 50-220 keV ion events observed by the IMP-8 spacecraft shows: (1 a dawn-dusk asymmetry in ion distributions, with most events and lower intensities upstream from the quasi-parallel pre-dawn side (4 LT-6 LT of the bow shock, (2 highest ion fluxes upstream from the nose/dusk side of the bow shock under an almost radial interplanetary magnetic field (IMF configuration, and (3 a positive correlation of the ion intensities with the solar wind speed and the index of geomagnetic index Kp, with an average solar wind speed as high as 620 km s-1 and values of the index Kp > 2. The statistical results are consistent with (1 preferential leakage of ~50 keV magnetospheric ions from the dusk magnetopause, (2 nearly scatter free motion of ~50 keV ions within the magnetosheath, and (3 final escape of magnetospheric ions from the quasi-parallel dawn side of the bow shock. An additional statistical analysis of higher energy (290-500 keV upstream ion events also shows a dawn-dusk asymmetry in the occurrence frequency of these events, with the occurrence frequency ranging between ~16%-~34% in the upstream region.Key words. Interplanetary physics (energetic particles; planetary bow shocks

Spatial distribution of upstream magnetospheric ≥50 keV ions

Directory of Open Access Journals (Sweden)

G. Kaliabetsos

Full Text Available We present for the first time a statistical study of geq50 keV ion events of a magnetospheric origin upstream from Earth's bow shock. The statistical analysis of the 50-220 keV ion events observed by the IMP-8 spacecraft shows: (1 a dawn-dusk asymmetry in ion distributions, with most events and lower intensities upstream from the quasi-parallel pre-dawn side (4 LT-6 LT of the bow shock, (2 highest ion fluxes upstream from the nose/dusk side of the bow shock under an almost radial interplanetary magnetic field (IMF configuration, and (3 a positive correlation of the ion intensities with the solar wind speed and the index of geomagnetic index Kp, with an average solar wind speed as high as 620 km s-1 and values of the index Kp > 2. The statistical results are consistent with (1 preferential leakage of ~50 keV magnetospheric ions from the dusk magnetopause, (2 nearly scatter free motion of ~50 keV ions within the magnetosheath, and (3 final escape of magnetospheric ions from the quasi-parallel dawn side of the bow shock. An additional statistical analysis of higher energy (290-500 keV upstream ion events also shows a dawn-dusk asymmetry in the occurrence frequency of these events, with the occurrence frequency ranging between ~16%-~34% in the upstream region.Key words. Interplanetary physics (energetic particles; planetary bow shocks

Studying internal and external magnetic fields in Japan using MAGSAT data

Science.gov (United States)

Fukushima, N. (Principal Investigator); Maeda, H.; Yukutake, T.; Tanaka, M.; Oshima, S.; Ogawa, K.; Kawamura, M.; Miyazaki, Y.; Uyeda, S.; Kobayashi, K.

1980-01-01

Examination of the total intensity data of CHRONIT on a few paths over Japan and its neighboring sea shows MAGSAT is extremely useful for studying the local magnetic anomaly. In high latitudes, the signatures of field aligned currents are clearly recognized. These include (1) the persistent basic pattern of current flow; (2) the more intense currents in the summer hemisphere than in the winter hemisphere; (3) more fluctuations in current intensities in summer dawn hours; and (4) apparent dawn-dusk asymmetry in the field-aligned current intensity between the north and south polar regions.

Assessing and ranking the flammability of some ornamental plant species to select firewise plants for landscaping in WUI (SE France).

Science.gov (United States)

Ganteaume, A.; Jappiot, M.; Lampin, C.

2012-04-01

The increasing urbanization of Wildland-Urban Interfaces (WUI) as well as the high fire occurrence in these areas requires the assessment and the ranking of the flammability of the ornamental vegetation surrounding houses especially that planted in hedges. Thus, the flammability of seven species, among those most frequently planted in hedges in Provence (South-Eastern France), were studied at particle level and at dead surface fuel level (litters) under laboratory conditions. The flammability parameters (ignition frequency, time-to-ignition, flaming duration) of the very fine particles (live leaves and particles fire bench. Burning experiments using the epiradiator showed that live leaves of Phyllostachys sp., Photinia frasei and Prunus laurocerasus had the shortest time-to-ignition and the highest ignition frequency and flaming duration whereas Pittosporum tobira and Nerium oleander were the longest to ignite with a low frequency. Phyllostachys sp. and Nerium oleander litters were the shortest to ignite while Prunus laurocerasus litter had the lowest bulk density and long time-to-ignition, but high flame propagation. Photinia fraseri litter ignited frequently and had a high flame spread while Pittosporum tobira litter ignited the least frequently and for the shortest duration. Cupressus sempervirens litter had the highest bulk density and the longest flaming duration but the lowest flame propagation. Pyracantha coccinea litter was the longest to ignite and flame propagation was low but lasted a long time. Hierarchical cluster analysis performed on the flammability parameters of live leaves and of litters ranked the seven species in four distinct clusters from the most flammable (Prunus laurocerasus and Pyracantha coccinea) to the least flammable (Pittosporum tobira and Nerium oleander); the other species displaying two groups of intermediate flammabilities (Phyllostachys sp.- Photinia fraseri and Cupressus sempervirens ). The species with highly flammable

Prediction of Five Softwood Paper Properties from its Density using Support Vector Machine Regression Techniques

Directory of Open Access Journals (Sweden)

Esperanza García-Gonzalo

2016-01-01

Full Text Available Predicting paper properties based on a limited number of measured variables can be an important tool for the industry. Mathematical models were developed to predict mechanical and optical properties from the corresponding paper density for some softwood papers using support vector machine regression with the Radial Basis Function Kernel. A dataset of different properties of paper handsheets produced from pulps of pine (Pinus pinaster and P. sylvestris and cypress species (Cupressus lusitanica, C. sempervirens, and C. arizonica beaten at 1000, 4000, and 7000 revolutions was used. The results show that it is possible to obtain good models (with high coefficient of determination with two variables: the numerical variable density and the categorical variable species.

Dog and Cat Interactions in a Remote Aboriginal Community

Directory of Open Access Journals (Sweden)

Brooke Kennedy

2018-04-01

Full Text Available This study examined dog and cat demographics, roaming behaviours, and interspecific interactions in a remote Aboriginal island community using multiple methods. Our results revealed temporal differences between the roaming behaviours of dogs, cats, and wildlife. Dogs showed crepuscular behaviour, being active around dawn (5:30 a.m. to 9:30 a.m. and dusk (6:00 p.m. and 11:35 p.m.. The majority of cats were active between dawn (6:30 a.m. and dusk (7:30 p.m. and travelled shorter distances than dogs. However, some cats were also observed roaming between dusk and dawn, and were likely to be hunting since flightless wildlife were also recorded on our remote-sensing cameras during this time. These baseline data provide evidence to suggest that new management programs are needed to reduce the number of roaming cats and therefore their potential impacts on native wildlife. Collaborations between Aboriginal owners and other stakeholders is necessary to design innovative and effective animal management and policy on the island.

Transcriptional patterns in both host and bacterium underlie a daily rhythm of anatomical and metabolic change in a beneficial symbiosis.

Science.gov (United States)

Wier, Andrew M; Nyholm, Spencer V; Mandel, Mark J; Massengo-Tiassé, R Prisca; Schaefer, Amy L; Koroleva, Irina; Splinter-Bondurant, Sandra; Brown, Bartley; Manzella, Liliana; Snir, Einat; Almabrazi, Hakeem; Scheetz, Todd E; Bonaldo, Maria de Fatima; Casavant, Thomas L; Soares, M Bento; Cronan, John E; Reed, Jennifer L; Ruby, Edward G; McFall-Ngai, Margaret J

2010-02-02

Mechanisms for controlling symbiont populations are critical for maintaining the associations that exist between a host and its microbial partners. We describe here the transcriptional, metabolic, and ultrastructural characteristics of a diel rhythm that occurs in the symbiosis between the squid Euprymna scolopes and the luminous bacterium Vibrio fischeri. The rhythm is driven by the host's expulsion from its light-emitting organ of most of the symbiont population each day at dawn. The transcriptomes of both the host epithelium that supports the symbionts and the symbiont population itself were characterized and compared at four times over this daily cycle. The greatest fluctuation in gene expression of both partners occurred as the day began. Most notable was an up-regulation in the host of >50 cytoskeleton-related genes just before dawn and their subsequent down-regulation within 6 h. Examination of the epithelium by TEM revealed a corresponding restructuring, characterized by effacement and blebbing of its apical surface. After the dawn expulsion, the epithelium reestablished its polarity, and the residual symbionts began growing, repopulating the light organ. Analysis of the symbiont transcriptome suggested that the bacteria respond to the effacement by up-regulating genes associated with anaerobic respiration of glycerol; supporting this finding, lipid analysis of the symbionts' membranes indicated a direct incorporation of host-derived fatty acids. After 12 h, the metabolic signature of the symbiont population shifted to one characteristic of chitin fermentation, which continued until the following dawn. Thus, the persistent maintenance of the squid-vibrio symbiosis is tied to a dynamic diel rhythm that involves both partners.

At the Dawn of Radio Communications

Directory of Open Access Journals (Sweden)

V. P. Samokhin

2017-01-01

Full Text Available A brief review of the history of radio communications, which were used before the advent of humanity tubes, in the context of the essays in the series "At the root of media", published in the "History of Technical Progress" section of the supplement to our journal "Science and Education". The review covers the main stages of the development of spark radio-telegraph systems, the creation of the first powerful arc and electric machine generators of non-stopping oscillations of the carrier frequency for radiotelephony and the detection features. The first experiments of Mahlon Loomis, scientific and technical achievements of James Maxwell, Henry Hertz, Eduard Branly, Alexander Popov, Oliver Lodge, Jagadish Bosch, Karl Brown, Lee de Forest, Louis Austin, Herman Simon, William Duddel, Valdemar Paulsen, Ernst Alexander, Valentin Vologdin, Semyon Eisenstein and other creators of the nascent radio engineering. Particular attention is paid to the intersections of their work with the work of Thomas Edison, Nikola Tesla, Guglielmo Marconi, Reginald Fessenden and other heroes of our essays.

Marketing. The Dawn of the fan.

Science.gov (United States)

Shepherd, Stuart

2008-08-21

The government and NHS are using websites such as YouTube and Facebook to communicate with the public. Trusts believe such websites help them keep in touch with younger people better than other methods. They are open to abuse with unofficial groups appearing in the name of NHS organisations.

The dawn of X‐ray spectroscopy

DEFF Research Database (Denmark)

Gerward, Leif

2013-01-01

This paper describes a few episodes from the early days of X‐ray spectroscopy. It relies on contemporary publications, especially those by Barkla, Moseley, Siegbahn, and Compton. The paper addresses the subject from the vantage point of physics and should be of interest to the X‐ray spectroscopist...

Prospects of detection of the first sources with SKA using matched filters

Science.gov (United States)

Ghara, Raghunath; Choudhury, T. Roy; Datta, Kanan K.; Mellema, Garrelt; Choudhuri, Samir; Majumdar, Suman; Giri, Sambit K.

2018-05-01

The matched filtering technique is an efficient method to detect H ii bubbles and absorption regions in radio interferometric observations of the redshifted 21-cm signal from the epoch of reionization and the Cosmic Dawn. Here, we present an implementation of this technique to the upcoming observations such as the SKA1-low for a blind search of absorption regions at the Cosmic Dawn. The pipeline explores four dimensional parameter space on the simulated mock visibilities using a MCMC algorithm. The framework is able to efficiently determine the positions and sizes of the absorption/H ii regions in the field of view.

Relationship between PC index and magnetospheric field-aligned currents measured by Swarm satellites

DEFF Research Database (Denmark)

Troshichev, О.; Sormakov, D.; Behlke, R.

2018-01-01

Abstract The relationship between the magnetospheric field-aligned currents (FAC) monitored by the Swarm satellites and the magnetic activity PC index (which is a proxy of the solar wind energy incoming into the magnetosphere) is examined. It is shown that current intensities measured in the R1...... between the PC index and the intensity of field-aligned currents in the R1 dawn and dusk layers: increase of FAC intensity in the course of substorm development is accompanied by increasing the PC index values. Correlation between PC and FAC intensities in the R2 dawn and dusk layers is also observed...

36 CFR 7.8 - Sequoia and Kings Canyon National Parks.

Science.gov (United States)

2010-07-01

... National Parks. (a) Dogs and cats. Dogs and cats are prohibited on any park land or trail except within one-fourth mile of developed areas which are accessible by a designated public automobile road. (b) Fishing. (1) Fishing restrictions, based on management objectives described in the parks' Resources Management...

La predicación dominicana del Rosario. El Rosario de la aurora de Zafra en el siglo XVIII (Dominican preaching of the rosary: The dawn rosary of Zafra in 18 th Century

Directory of Open Access Journals (Sweden)

Carlos José Romero Mensaque

2016-01-01

Full Text Available Resumen: El Rosario, signo de identidad misional de la Orden de Predicadores, desborda los cauces conventuales ya desde el siglo XVI al universalizarse el rezo y devoción. Los dominicos predican el Rosario en sendas misiones y fundan numerosas hermandades adscritas a la Orden en parroquias e iglesias diocesanas, pero ya en el siglo XVII el rezo avemariano rebasa incluso los espacios sagrados para ser predicado en las calles. El proceso culmina en el siglo XVIII con un protagonismo del pueblo en la predicación del rosario, asumiendo en gran parte la responsabilidad de la misión que comenzaran los dominicos. En el extremo de la Provincia Bética, Zafra se convierte en escenario de esta Misión Popular con el Rosario de la Aurora y su hermandad, una corporación claramente misional y asistencial, que no duda en dar mayoría de edad a la mujer en su gobierno.Abstract: The rosary is an important sign of missionary identity for the Dominican Order, whose use has not been limited to the convent since the 16th century when preach and devotion became universal. Dominic monks preach the rosary in all their missions and found several brotherhoods affiliated with the Order in parishes and diocesans churches, but in the 17th century the Hail Mary can be found outside sacred places, it is preached even in the streets. This process end up in the 18th century when common people take a bigger responsibility and continue with the mission started by Dominic monks. Zafra, situated at the limit of the Baetica Province, becomes the stage of this Popular Mission thanks to the dawn rosary and its brotherhood, which clearly was a corporation dedicated to the mission and the assistant of people in need. This brotherhood does not hesitate before giving majority of age to the women in their government, even though they faced a strong social exclusion.

Le albe di Oswald von Wolkenstein: inquadramento storico-letterario, analisi testuale e traduzione in italiano (Seconda parte

Directory of Open Access Journals (Sweden)

Alessandra Molinari

2011-02-01

Full Text Available This article is the Second Part of an enquiry on the Tagelied, the medieval German version of the erotic dawn-song, published in Linguæ & (2/2009. This Second part offers a survey on the deviations from the “typical” Tagelied and discusses the main variant text-types. For each variant one instance is analysed in detail. A discussion on the reasons for such variance but also for the popularity of the Tagelied through several centuries of German poetry (from the 11th up to the 17th century follows. It contains a critical survey on the state of the art on these issues and a preview on the author’s theses. The Third Part shall appear in a future issue of this journal, with the author’s views on the reasons for the long life of the Tagelied within German poetry and with an enquiry on Oswald von Wolkenstein’s Tagelieder, which conclude the era of the German courtly dawn-songs and smooths the path for the great production of bourgeois and popular dawn-songs in the German speaking areas up to the 17th century.

Local time asymmetry of Pc 4--5 pulsations and associated particle modulations at synchronous orbit

International Nuclear Information System (INIS)

Kokubun, S.; Erickson, K.N.; Fritz, T.A.; McPherron, R.L.

1989-01-01

Magnetic field and particle flux observations on board ATS 6 at synchronous altitude are used to examine the dawn-dusk asymmetry of characteristics of Pc 4--5 waves and associated particle flux modulation. Most waves at synchronous orbit having ground correlations are polarized in the azimuthal direction (A class) and are usually detected in the dawn sector. Waves with a radially oriented polarization ellipse (R-class) are almost never observed near the subsatellite point on the ground, except for the regular pulsations known as giant pulsation Pg, observed in the early morning. R class Pc 4 waves occur at all local times and have an occurrence peak in the afternoon

Magnetospheric magnetic field modelling for the 2011 and 2012 HST Saturn aurora campaigns – implications for auroral source regions

Directory of Open Access Journals (Sweden)

E. S. Belenkaya

2014-06-01

Full Text Available A unique set of images of Saturn's northern polar UV aurora was obtained by the Hubble Space Telescope in 2011 and 2012 at times when the Cassini spacecraft was located in the solar wind just upstream of Saturn's bow shock. This rare situation provides an opportunity to use the Kronian paraboloid magnetic field model to examine source locations of the bright auroral features by mapping them along field lines into the magnetosphere, taking account of the interplanetary magnetic field (IMF measured near simultaneously by Cassini. It is found that the persistent dawn arc maps to closed field lines in the dawn to noon sector, with an equatorward edge generally located in the inner part of the ring current, typically at ~ 7 Saturn radii (RS near dawn, and a poleward edge that maps variously between the centre of the ring current and beyond its outer edge at ~ 15 RS, depending on the latitudinal width of the arc. This location, together with a lack of response in properties to the concurrent IMF, suggests a principal connection with ring-current and nightside processes. The higher-latitude patchy auroras observed intermittently near to noon and at later local times extending towards dusk are instead found to straddle the model open–closed field boundary, thus mapping along field lines to the dayside outer magnetosphere and magnetopause. These emissions, which occur preferentially for northward IMF directions, are thus likely associated with reconnection and open-flux production at the magnetopause. One image for southward IMF also exhibits a prominent patch of very high latitude emissions extending poleward of patchy dawn arc emissions in the pre-noon sector. This is found to lie centrally within the region of open model field lines, suggesting an origin in the current system associated with lobe reconnection, similar to that observed in the terrestrial magnetosphere for northward IMF.

Consistency of Self-Reported Neurocognitive Symptoms, Post-Traumatic Stress Disorder Symptoms, and Concussive Events From End of First Deployment to Veteran Health Administration Comprehensive Traumatic Brain Injury Evaluation by Operations Enduring Freedom/Iraqi Freedom/New Dawn Veterans.

Science.gov (United States)

Russo, Arthur C; Fingerhut, Esther C

2017-03-01

This study examined the consistency of self-reported symptoms and concussive events in combat veterans who reported experiencing concussive events. One hundred and forty, single deployed, Operation Enduring Freedom, Operation Iraqi Freedom and Operation New Dawn combat veterans with Veteran Health Administration (VHA) Comprehensive Traumatic Brain Injury Evaluations (CTBIE) and no post-deployment head injury were examined to assess consistency of self-reported (a) traumatic brain injury (TBI)-related symptoms, (b) post-traumatic stress disorder (PTSD)-related symptoms, and (c) TBI-related concussive events from soon after deployment to time of VHA CTBIE. Compared to their self-report of symptoms and traumatic events at the time of their Post-Deployment Health Assessment, at the time of their comprehensive VHA evaluation, subjects reported significantly greater impairment in concentration, decision making, memory, headache, and sleep. In addition, although half the subjects denied any PTSD symptoms post-deployment, approximately three quarters reported experiencing all four PTSD screening symptoms near the time of the VHA CTBIEs. At the latter time, subjects also reported significantly more TBI-related concussive events, as well as more post-concussive sequelae such as loss of consciousness immediately following these concussive events. Finally, although 84% reported a level of impairment so severe as to render all but the simplest activity doable, the vast majority simultaneously reported working and/or attending college. These findings raise questions regarding the accuracy of veteran self-report of both near and distant traumatic events, and argue for the inclusion of contemporaneous Department of Defense (DOD) records in veteran assessment and treatment planning. Published by Oxford University Press 2016. This work is written by (a) US Government employee(s) and is in the public domain in the US.

75 FR 15721 - Back Bay National Wildlife Refuge, City of Virginia Beach, VA

Science.gov (United States)

2010-03-30

... advance scheduling, group educational opportunities. Outdoor facilities are open daily dawn to dusk... during January 2002. Meetings were advertised locally through news releases, paid [[Page 15722...

Pliocene taxodiaceous fossil wood from southwestern Ukraine and its palaeoenvironmental implications

Directory of Open Access Journals (Sweden)

Yi Tiemei

2013-10-01

Full Text Available Mineralized wood collected from Late Pliocene strata near Gorbki village in the Transcarpathian region of Beregovo Kholmogor'e in southwestern Ukraine was anatomically studied and identified. The wood possesses distinctive anatomical features and has distinct growth rings with an abrupt transition from early- to late-wood. Wood consists of tracheids with 1–3 seriate, dominating bi-seriate, opposite pits on the radial walls and taxodioid cross-field pitting, indentures present. Rays are uni-seriate and 1 to 73 cells high. Ray parenchyma horizontal walls thin and smooth. Axial parenchyma distributed in early- and late-wood and is solitary and diffuse, with end walls nearly smooth or slightly nodular. The combination of features observed in the wood indicates it belongs to the conifer family Taxodiaceae and is most similar to modern Sequoia and assigned to the fossil genus Sequoioxylon. Comparison with species of Sequoioxylon show it is most similar to Sequoioxylon burejense, but ray tracheids were not found in our specimens. We describe the specimens here as Sequoioxylon cf. s. burejense noting this similarity. Extant Sequoia is distributed in the northern California coastal forest eco-region of northern California and southern Oregon in the United States where they usually grow in a unique environment with heavy seasonal precipitation (2500 mm annually, cool coastal air and fog drip. This study supplies magafossil evidence of Sequoioxylon as an element of the Late Pliocene forest community in Ukraine and indicates a climate with heavy seasonal precipitation and fog drip.

The Value of SysML Modeling During System Operations: A Case Study

Science.gov (United States)

Dutenhoffer, Chelsea; Tirona, Joseph

2013-01-01

System models are often touted as engineering tools that promote better understanding of systems, but these models are typically created during system design. The Ground Data System (GDS) team for the Dawn spacecraft took on a case study to see if benefits could be achieved by starting a model of a system already in operations. This paper focuses on the four steps the team undertook in modeling the Dawn GDS: defining a model structure, populating model elements, verifying that the model represented reality, and using the model to answer system-level questions and simplify day-to-day tasks. Throughout this paper the team outlines our thought processes and the system insights the model provided.

Contrasting dynamics of leaf potential and gas exchange during progressive drought cycles and recovery in Amorpha fruticosa and Robinia pseudoacacia.

Science.gov (United States)

Yan, Weiming; Zheng, Shuxia; Zhong, Yangquanwei; Shangguan, Zhouping

2017-06-30

Leaf gas exchange is closely associated with water relations; however, less attention has been given to this relationship over successive drought events. Dynamic changes in gas exchange and water potential in the seedlings of two woody species, Amorpha fruticosa and Robinia pseudoacacia, were monitored during recurrent drought. The pre-dawn leaf water potential declined in parallel with gas exchange in both species, and sharp declines in gas exchange occurred with decreasing water potential. A significant correlation between pre-dawn water potential and gas exchange was observed in both species and showed a right shift in R. pseudoacacia in the second drought. The results suggested that stomatal closure in early drought was mediated mainly by elevated foliar abscisic acid (ABA) in R. pseudoacacia, while a shift from ABA-regulated to leaf-water-potential-driven stomatal closure was observed in A. fruticosa. After re-watering, the pre-dawn water potential recovered quickly, whereas stomatal conductance did not fully recover from drought in R. pseudoacacia, which affected the ability to tightly control transpiration post-drought. The dynamics of recovery from drought suggest that stomatal behavior post-drought may be restricted mainly by hydraulic factors, but non-hydraulic factors may also be involved in R. pseudoacacia.

Observation and theory of Pc 5 waves with harmonically related transverse and compressional components

International Nuclear Information System (INIS)

Takahashi, K.; McEntire, R.W.; Cheng, C.Z.; Kistler, L.M.

1990-01-01

The properties of 23 magnetic pulsation events observed by the AMPTE CCE spacecraft are studies. The events have a second harmonic period of 80-600 s (roughly the Pc 5 range), are observed in cluster in the dawn (0300-0800 magnetic local time, MLT) and dusk (1,600 -2,100 MLT) sectors, and are localized near the magnetic equator. Although the azimuthal wave number, m, estimated from an ion finite Larmor radius effect, is generally large (|m| ∼ 50), there is a marked difference between the events observed in the dawn and dusk sectors. In the dawn sector the waves have low frequencies (1-5 mHz), indicate right-hand polarization, and propagate westward. The authors suggest that the waves are all westward propagating in the plasma rest frame and that local-time-dependent Doppler shift is the reason for the local time dependence of the wave properties. The drift mirror instability is considered to be the mechanism for exciting the westward propagation waves. An analytical formula for the ion flux oscillations is derived on the basis of the nonlinear gyrokinetic theory. The observed correlation between the ion flux and the parallel magnetic field perturbation δB parallel can be adequately explained with this analytical formula

Return to the little kingdom Steve Jobs, the creation of Apple, and how it changed the world

CERN Document Server

Moritz, Michael

2010-01-01

Almost thirty years ago, Michael Moritz, then a young journalist at Time magazine, was allowed exclusive access to the inner workings of a cutting-edge technology company to tell the story of its first decade in business. The Little Kingdom: The Private Story of Apple Computer brought readers into the childhood homes of Steve Jobs and Steve Wozniak, showed how they dropped out of college and founded Apple in 1976, and charted the company's rise from basement brainstorming to colossal empire. Now, after spending almost twenty-five years at Sequoia Capital, the much admired private investm

Defense.gov Special Report: Operation Odyssey Dawn

Science.gov (United States)

, and supporting Libyans' efforts for political change, said Secretary of State Hillary Rodham Clinton Clinton Urges Aid to Libya, Pressure on Gadhafi WASHINGTON, March 29, 2011 - The international community

The Dawns of the Spanish Geo technic

International Nuclear Information System (INIS)

Serrano Gonzalez, A.

2013-01-01

From a personal perspective, there are analyzed the first steps of the spanish Geotechnical Engineering history understood as an academic discipline but also linked in a very directly way the profession. This evolution is not foreign to the own history of the Geneticist in other countries of our cultural or geographical environment. The contributions discover that our predecessors transmitted important achievements to the international community. The direct presence in the international congresses of that time of the spanish geo technicians is analysed. Three consecutive stages are distinguished, personalizing in each of them the participation of celebrated spanish Civil Engineers. (Author)

AHP 45: REVIEW: THE DAWN OF TIBET

Directory of Open Access Journals (Sweden)

Ivette M. Vargas-O'Bryan

2017-03-01

Full Text Available If you want to learn more about the pre-Buddhist heritage of Tibet and the Western Himalayas, one name stands out: John Vincent Bellezza. Unlike any other, we encounter a uniqueness in Bellezza's works, a breadth of detail, insight, and personal struggle that has been unsurpassed in archaeology and Tibetan Studies these days. Bellezza's numerous publications that include such groundbreaking works as Divine Dyads (1997, Calling Down the Gods (2005, the significant contributions of Zhang Zhung: Foundations of Civilization in Tibet (2008, Death and Beyond in Ancient Tibet, and the critical two volume set, Antiquities of Zhang Zhung (2010, have provided robust studies on Tibet's pre-Buddhist heritage in an unconventional style that at once incorporates his skills as an archaeologist with one of cultural historian, anthropologist, travel journalist, explorer, and storyteller.

Light Dawns on Dark Gamma-ray Bursts

Science.gov (United States)

2010-12-01

Gamma-ray bursts are among the most energetic events in the Universe, but some appear curiously faint in visible light. The biggest study to date of these so-called dark gamma-ray bursts, using the GROND instrument on the 2.2-metre MPG/ESO telescope at La Silla in Chile, has found that these gigantic explosions don't require exotic explanations. Their faintness is now fully explained by a combination of causes, the most important of which is the presence of dust between the Earth and the explosion. Gamma-ray bursts (GRBs), fleeting events that last from less than a second to several minutes, are detected by orbiting observatories that can pick up their high energy radiation. Thirteen years ago, however, astronomers discovered a longer-lasting stream of less energetic radiation coming from these violent outbursts, which can last for weeks or even years after the initial explosion. Astronomers call this the burst's afterglow. While all gamma-ray bursts [1] have afterglows that give off X-rays, only about half of them were found to give off visible light, with the rest remaining mysteriously dark. Some astronomers suspected that these dark afterglows could be examples of a whole new class of gamma-ray bursts, while others thought that they might all be at very great distances. Previous studies had suggested that obscuring dust between the burst and us might also explain why they were so dim. "Studying afterglows is vital to further our understanding of the objects that become gamma-ray bursts and what they tell us about star formation in the early Universe," says the study's lead author Jochen Greiner from the Max-Planck Institute for Extraterrestrial Physics in Garching bei München, Germany. NASA launched the Swift satellite at the end of 2004. From its orbit above the Earth's atmosphere it can detect gamma-ray bursts and immediately relay their positions to other observatories so that the afterglows could be studied. In the new study, astronomers combined Swift data with new observations made using GROND [2] - a dedicated gamma-ray burst follow-up observation instrument, which is attached to the 2.2-metre MPG/ESO telescope at La Silla in Chile. In doing so, astronomers have conclusively solved the puzzle of the missing optical afterglow. What makes GROND exciting for the study of afterglows is its very fast response time - it can observe a burst within minutes of an alert coming from Swift using a special system called the Rapid Response Mode - and its ability to observe simultaneously through seven filters covering both the visible and near-infrared parts of the spectrum. By combining GROND data taken through these seven filters with Swift observations, astronomers were able to accurately determine the amount of light emitted by the afterglow at widely differing wavelengths, all the way from high energy X-rays to the near-infrared. The astronomers used this information to directly measure the amount of obscuring dust that the light passed through en route to Earth. Previously, astronomers had to rely on rough estimates of the dust content [3]. The team used a range of data, including their own measurements from GROND, in addition to observations made by other large telescopes including the ESO Very Large Telescope, to estimate the distances to nearly all of the bursts in their sample. While they found that a significant proportion of bursts are dimmed to about 60-80 percent of the original intensity by obscuring dust, this effect is exaggerated for the very distant bursts, letting the observer see only 30-50 percent of the light [4]. The astronomers conclude that most dark gamma-ray bursts are therefore simply those that have had their small amount of visible light completely stripped away before it reaches us. "Compared to many instruments on large telescopes, GROND is a low cost and relatively simple instrument, yet it has been able to conclusively resolve the mystery surrounding dark gamma-ray bursts," says Greiner. Notes [1] Gamma-ray bursts lasting longer than two seconds are referred to as long bursts and those with a shorter duration are known as short bursts. Long bursts, which were observed in this study, are associated with the supernova explosions of massive young stars in star-forming galaxies. Short bursts are not well understood, but are thought to originate from the merger of two compact objects such as neutron stars. [2] The Gamma-Ray burst Optical and Near-infrared Detector (GROND) was designed and built at the Max-Planck Institute for Extraterrestrial Physics in collaboration with the Tautenburg Observatory, and has been fully operational since August 2007. [3] Other studies relating to dark gamma-ray bursts have been released. Early this year, astronomers used the Subaru Telescope to observe a single gamma-ray burst, from which they hypothesised that dark gamma-ray bursts may indeed be a separate sub-class that form through a different mechanism, such as the merger of binary stars. In another study published last year using the Keck Telescope, astronomers studied the host galaxies of 14 dark GRBs, and based on the derived low redshifts they infer dust as the likely mechanism to create the dark bursts. In the new work reported here, 39 GRBs were studied, including nearly 20 dark bursts, and it is the only study in which no prior assumptions have been made and the amount of dust has been directly measured. [4] Because the afterglow light of very distant bursts is redshifted due to the expansion of the Universe, the light that left the object was originally bluer than the light we detect when it gets to Earth. Since the reduction of light intensity by dust is greater for blue and ultraviolet light than for red, this means that the overall dimming effect of dust is greater for the more distant gamma-ray bursts. This is why GROND's ability to observe near-infrared radiation makes such a difference. More information This research is presented in a paper to appear in the journal Astronomy & Astrophysics on 16 December 2010 The team is composed of: J. Greiner (Max-Planck-Institut für extraterrestrische Physik [MPE], Germany), T. Krühler (MPE, Universe Cluster, Technische Universität München), S. Klose (Thüringer Landessternwarte, Germany), P. Afonso (MPE), C. Clemens (MPE), R. Filgas (MPE), D.H. Hartmann (Clemson University, USA), A. Küpcü Yoldaş¸ (University of Cambridge, UK), M. Nardini (MPE), F. Olivares E. (MPE), A. Rau (MPE), A. Rossi (Thüringer Landessternwarte, Germany), P. Schady (MPE), and A. Updike (Clemson University, USA) ESO, the European Southern Observatory, is the foremost intergovernmental astronomy organisation in Europe and the world's most productive astronomical observatory. It is supported by 14 countries: Austria, Belgium, the Czech Republic, Denmark, France, Finland, Germany, Italy, the Netherlands, Portugal, Spain, Sweden, Switzerland and the United Kingdom. ESO carries out an ambitious programme focused on the design, construction and operation of powerful ground-based observing facilities enabling astronomers to make important scientific discoveries. ESO also plays a leading role in promoting and organising cooperation in astronomical research. ESO operates three unique world-class observing sites in Chile: La Silla, Paranal and Chajnantor. At Paranal, ESO operates the Very Large Telescope, the world's most advanced visible-light astronomical observatory and VISTA, the world's largest survey telescope. ESO is the European partner of a revolutionary astronomical telescope ALMA, the largest astronomical project in existence. ESO is currently planning a 42-metre European Extremely Large optical/near-infrared Telescope, the E-ELT, which will become "the world's biggest eye on the sky".

Evaluation of irradiated essential oils to control of Sitophilus zeamais Mots. (Coleoptera: Curculionidae) and Blatella germanica (L.) (Dictyopera: Blattellidae); Avaliacao de produtos naturais irradiados para o controle de Sitophilus zeamais Mots. (Coleoptera: Curculionidae) e Blatella germanica (L.) (Dictyopera: Blattellidae)

Energy Technology Data Exchange (ETDEWEB)

Potenza, Marcos Roberto

2004-07-01

This work aimed to evaluate the effect of irradiated essential oils of Eucalyptus citriodora, Eucalyptus globulus, Pinus sp., Azadirachta indica, Cymbopogon nardus, Cupressus sempervirens, Cymbopogons citratus and Juniperus communis and aqueous, hexanic and ethanolic irradiated extracts of Solanum paniculatum, Dahlia pinnata, Lycopersicon esculentum, Nephrolepis pectinata, Ruta graveolens, Ficus elastica, Lavandula angustifolia, Rhododendron simsii, Agave angustifolia, Ocimum basilicum, Allamanda cathartica, Dieffenbachia brasiliensis, Pennisetum purpureum, Annona squamosa, Coffea arabica and Hibiscus rosa-sinensis, in order to identify new substances to integrated pest management (IPM) and to observe possible effects of gamma radiation about extracts and essential oils efficiency such as increase, reduction, activation and inactivation of the same to the pest control. It evaluated the effect of contact on Sitophilus zeamais and by ingestion in Blattella germanica. To irradiation was used an experimental irradiator of Cobalt-60, type Gammacell 220. The essential oils were submitted increasing doses of gamma radiation: 2.5; 5.0; 7.5 and 10.0 kGy. The bioassay with B. germanica demonstrated efficiency between 22.0 e 30.0% and between 30.0 and 42.0%, respectively, to irradiated essential oils of E. citriodora and E. globulus and they demonstrated too repellency to the nymphs. The gamma radiation used promoted changes in essential oils of E. citriodora e E. globulus that they began to show efficiency on B. germanica nymphs besides a significant reduction of repellency. Essential oils of Pinus sp., A. indica, C. sempervirens and J. communis did not display efficiency. The essential oils of C. nardus, and C. citratus had low efficiency. The gamma radiation increased the efficiency of ethanolic extract of D. Pinnata with dose of 7.5 kGy, showing 48.0% of efficiency on B. germanica nymphs. The gamma radiation showed adverse effect on the aqueous extract of R. Graveolens

Evaluation of irradiated essential oils to control of Sitophilus zeamais Mots. (Coleoptera: Curculionidae) and Blatella germanica (L.) (Dictyopera: Blattellidae); Avaliacao de produtos naturais irradiados para o controle de Sitophilus zeamais Mots. (Coleoptera: Curculionidae) e Blatella germanica (L.) (Dictyopera: Blattellidae)

Energy Technology Data Exchange (ETDEWEB)

Potenza, Marcos Roberto

2004-07-01

This work aimed to evaluate the effect of irradiated essential oils of Eucalyptus citriodora, Eucalyptus globulus, Pinus sp., Azadirachta indica, Cymbopogon nardus, Cupressus sempervirens, Cymbopogons citratus and Juniperus communis and aqueous, hexanic and ethanolic irradiated extracts of Solanum paniculatum, Dahlia pinnata, Lycopersicon esculentum, Nephrolepis pectinata, Ruta graveolens, Ficus elastica, Lavandula angustifolia, Rhododendron simsii, Agave angustifolia, Ocimum basilicum, Allamanda cathartica, Dieffenbachia brasiliensis, Pennisetum purpureum, Annona squamosa, Coffea arabica and Hibiscus rosa-sinensis, in order to identify new substances to integrated pest management (IPM) and to observe possible effects of gamma radiation about extracts and essential oils efficiency such as increase, reduction, activation and inactivation of the same to the pest control. It evaluated the effect of contact on Sitophilus zeamais and by ingestion in Blattella germanica. To irradiation was used an experimental irradiator of Cobalt-60, type Gammacell 220. The essential oils were submitted increasing doses of gamma radiation: 2.5; 5.0; 7.5 and 10.0 kGy. The bioassay with B. germanica demonstrated efficiency between 22.0 e 30.0% and between 30.0 and 42.0%, respectively, to irradiated essential oils of E. citriodora and E. globulus and they demonstrated too repellency to the nymphs. The gamma radiation used promoted changes in essential oils of E. citriodora e E. globulus that they began to show efficiency on B. germanica nymphs besides a significant reduction of repellency. Essential oils of Pinus sp., A. indica, C. sempervirens and J. communis did not display efficiency. The essential oils of C. nardus, and C. citratus had low efficiency. The gamma radiation increased the efficiency of ethanolic extract of D. Pinnata with dose of 7.5 kGy, showing 48.0% of efficiency on B. germanica nymphs. The gamma radiation showed adverse effect on the aqueous extract of R. Graveolens

Evaluation of irradiated essential oils to control of Sitophilus zeamais Mots. (Coleoptera: Curculionidae) and Blatella germanica (L.) (Dictyopera: Blattellidae)

International Nuclear Information System (INIS)

Potenza, Marcos Roberto

2004-01-01

This work aimed to evaluate the effect of irradiated essential oils of Eucalyptus citriodora, Eucalyptus globulus, Pinus sp., Azadirachta indica, Cymbopogon nardus, Cupressus sempervirens, Cymbopogons citratus and Juniperus communis and aqueous, hexanic and ethanolic irradiated extracts of Solanum paniculatum, Dahlia pinnata, Lycopersicon esculentum, Nephrolepis pectinata, Ruta graveolens, Ficus elastica, Lavandula angustifolia, Rhododendron simsii, Agave angustifolia, Ocimum basilicum, Allamanda cathartica, Dieffenbachia brasiliensis, Pennisetum purpureum, Annona squamosa, Coffea arabica and Hibiscus rosa-sinensis, in order to identify new substances to integrated pest management (IPM) and to observe possible effects of gamma radiation about extracts and essential oils efficiency such as increase, reduction, activation and inactivation of the same to the pest control. It evaluated the effect of contact on Sitophilus zeamais and by ingestion in Blattella germanica. To irradiation was used an experimental irradiator of Cobalt-60, type Gammacell 220. The essential oils were submitted increasing doses of gamma radiation: 2.5; 5.0; 7.5 and 10.0 kGy. The bioassay with B. germanica demonstrated efficiency between 22.0 e 30.0% and between 30.0 and 42.0%, respectively, to irradiated essential oils of E. citriodora and E. globulus and they demonstrated too repellency to the nymphs. The gamma radiation used promoted changes in essential oils of E. citriodora e E. globulus that they began to show efficiency on B. germanica nymphs besides a significant reduction of repellency. Essential oils of Pinus sp., A. indica, C. sempervirens and J. communis did not display efficiency. The essential oils of C. nardus, and C. citratus had low efficiency. The gamma radiation increased the efficiency of ethanolic extract of D. Pinnata with dose of 7.5 kGy, showing 48.0% of efficiency on B. germanica nymphs. The gamma radiation showed adverse effect on the aqueous extract of R. Graveolens

Muusika valib Tristan Priimägi / Tristan Priimägi

Index Scriptorium Estoniae

Priimägi, Tristan, 1976-

2004-01-01

Heliplaatidest: Roy Ayers "Virgin Ubiquity - Unreleased Recordings 1976-1981", "Ibadan People", "A Journey to the Dawn", The Matthew Herbert Big Band "Goodbye Swingtime", Amp Fiddler "Waltz of a Ghetto Fly"

Unsteady Computation of the Plasma of Nested-Channel Hall Thrusters

Data.gov (United States)

National Aeronautics and Space Administration — Since the dawn of mankind scientific discoveries have improved our way of living, understanding of the world around us and understanding of ourselves. Significant...

Using Approximate Dynamic Programming to Solve the Military Inventory Routing Problem with Direct Delivery

Science.gov (United States)

2015-03-26

Appendix C. Computational Example: 3-COP . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 94 Appendix D. Storyboard ...COP myopic policy. 105 Appendix D. Storyboard 106 Bibliography 1. Barnes-Schuster, Dawn, & Bassok, Yehuda. 1997. Direct shipping and the dynamic

Insight into the nature and formation of the organic matter observed on Ceres

Science.gov (United States)

Ammannito, E.; Vinogradoff, V.; De Sanctis, M. C.; De Angelis, S.; Ferrari, M.; Ciarniello, M.; Raponi, A.; Raymond, C. A.; Russell, C. T.

2017-12-01

Observed by the Dawn spacecraft since March 2015, Ceres is a fascinating world [1]. Its surface, covered by phyllosilicates, carbonates, ammoniated-bearing hydrated minerals, water ice, salts and opaque materials indicates a complex chemical environment [1,2,3]. VIR, the Visible and InfraRed mapping spectrometer onboard the Dawn mission, has revealed the presence of aliphatic carbons with the 3.3-3.5 µm bands, near the Ernutet crater [4]. The origin of this OM is likely related to an endogenous source [4] and new issues are raised: what is the origin formation and the true nature of the OM hidden behind these aliphatic signatures? We used the spectral imaging (SPIM) facility in use at the laboratory of IAPS-INAF (spare of the VIR instrument onboard Dawn) to measure organic materials in the range 0.2-5.1 µm. These materials, such as insoluble organic matter (IOM) of chondrites, synthetic polymers, asphaltite, as well as spectra from literature data have been compared to VIR data. The Ceres aliphatic bands might match with an aliphatic branched polymer structure, i.e. with a 1.3 Science, 353 (6303) 1008-1010. [2] De Sanctis et al., (2015) Nature 528, 241-244. [3] De Sanctis et al., (2016) Nature 536, 54- 57. [4] De Sanctis et al., (2017) Science, 355, 719-722. [5] Holm et al., (2015), Astrobiology, 15, 587-600.

A numerical modeling study of the interaction between the tides and the circulation forced by high-latitude plasma convection

International Nuclear Information System (INIS)

Mikkelsen, I.S.; Larsen, M.F.

1991-01-01

A spectral, time-varying thermospheric general circulation model has been used to study the nonlinear interaction at high latitudes between the tides propagating into the thermosphere from below and the circulation induced by magnetospheric forcing and in situ solar heating. The model is discrete in the vertical with 27 layers spaced by half a scale height. In the horizontal, the fields are expanded in a series of spherical harmonics using a triangular truncation at wave number 31, equivalent to a homogeneous global resolution with a minimum wavelength of 1,270 km. A hypothetical uniform grid point model would require a horizontal spacing of 417 km to describe the same minimum wavelength. In the high-latitude F region the tides affect the dusk vortex of the neutral flow very little, but the dawn vortex is either suppressed or amplified dependent upon the universal time and tidal phase. In the E region neutral flow, both the dusk and dawn vortices are shifted in local time by the tides, again as a function of universal time and tidal phase. At dusk a nonlinear amplification of the sunward winds occurs for certain combination of parameters, and at dawn the winds may be completely suppressed. Below 120 km altitude the magnetospheric forcing creates a single cyclonic vortex which is also sensitive to the high-latitude tidal structure

A theoretical and empirical study of the response of the high latitude thermosphere to the sense of the 'Y' component of the interplanetary magnetic field

International Nuclear Information System (INIS)

Rees, D.; Fuller-Rowell, T.J.; Gordon, R.

1986-01-01

The strength and direction of the Interplanetary Magnetic Field (IMF) controls the transfer of solar wind momentum and energy to the high latitude thermosphere in a direct fashion. The sense of ''Y'' component of the IMF (BY) creates a significant asymmetry of the magnetospheric convection pattern as mapped onto the high latitude thermosphere and ionosphere. The resulting response of the polar thermospheric winds during periods when BY is either positive or negative is quite distinct, with pronounced changes in the relative strength of thermospheric winds in the dusk-dawn parts of the polar cap and in the dawn part of the auroral oval. In a study of four periods when there was a clear signature of BY, observed by the ISEE-3 satellite, with observations of polar winds and electric fields from the Dynamics Explorer-2 satellite and with wind observations by a ground-based Fabry-Perot interferometer located in Kiruna, Northern Sweden, it is possible to explain features of the high latitude thermospheric circulation using three dimensional global models including BY dependent, asymmetric, polar convection fields. Anomalously zonal wind velocities are often observed, for BY positive and when BY is negative. These are matched by the observation of strong anti-sunward polar-cap wind jets from the DE-2 satellite, on the dusk side with BY negative, and on the dawn side with BY positive. (author)

INVESTIGATION OF PARALLAX ISSUES FOR MULTI-LENS MULTISPECTRAL CAMERA BAND CO-REGISTRATION

Directory of Open Access Journals (Sweden)

J. P. Jhan

2017-08-01

Full Text Available The multi-lens multispectral cameras (MSCs, such as Micasense Rededge and Parrot Sequoia, can record multispectral information by each separated lenses. With their lightweight and small size, which making they are more suitable for mounting on an Unmanned Aerial System (UAS to collect high spatial images for vegetation investigation. However, due to the multi-sensor geometry of multi-lens structure induces significant band misregistration effects in original image, performing band co-registration is necessary in order to obtain accurate spectral information. A robust and adaptive band-to-band image transform (RABBIT is proposed to perform band co-registration of multi-lens MSCs. First is to obtain the camera rig information from camera system calibration, and utilizes the calibrated results for performing image transformation and lens distortion correction. Since the calibration uncertainty leads to different amount of systematic errors, the last step is to optimize the results in order to acquire a better co-registration accuracy. Due to the potential issues of parallax that will cause significant band misregistration effects when images are closer to the targets, four datasets thus acquired from Rededge and Sequoia were applied to evaluate the performance of RABBIT, including aerial and close-range imagery. From the results of aerial images, it shows that RABBIT can achieve sub-pixel accuracy level that is suitable for the band co-registration purpose of any multi-lens MSC. In addition, the results of close-range images also has same performance, if we focus on the band co-registration on specific target for 3D modelling, or when the target has equal distance to the camera.

A Concept of Operations for the Use of Emergent Open Internet Technologies as the Basis for a Network-Centric Environment

National Research Council Canada - National Science Library

O'Sullivan, Joshua D

2006-01-01

.... With the dawn of the Information Age a similar revolution has begun, with the realization of the science of networks and their effects on complex systems, such as command and control and sharing...

The Dardanelles Campaign - Failure Through Strategic Indecision

National Research Council Canada - National Science Library

Cariker, Thomas

2001-01-01

At the dawn of the 21st century, the United States faces a strategic paradox: as our national strategy relies increasingly on military engagement and intervention, our forward basing and presence is decreasing...

Average thermospheric wind patterns over the polar regions, as observed by CHAMP

Directory of Open Access Journals (Sweden)

H. Lühr

2007-06-01

Full Text Available Measurements of the CHAMP accelerometer are utilized to investigate the average thermospheric wind distribution in the polar regions at altitudes around 400 km. This study puts special emphasis on the seasonal differences in the wind patterns. For this purpose 131 days centered on the June solstice of 2003 are considered. Within that period CHAMP's orbit is precessing once through all local times. The cross-track wind estimates of all 2030 passes are used to construct mean wind vectors for 918 equal-area cells. These bin averages are presented in corrected geomagnetic coordinates. Both hemispheres are considered simultaneously providing summer and winter responses for the same prevailing geophysical conditions. The period under study is characterized by high magnetic activity (Kp=4− but moderate solar flux level (F10.7=124. Our analysis reveals clear wind features in the summer (Northern Hemisphere. Over the polar cap there is a fast day-to-night flow with mean speeds surpassing 600 m/s in the dawn sector. At auroral latitudes we find strong westward zonal winds on the dawn side. On the dusk side, however, an anti-cyclonic vortex is forming. The dawn/dusk asymmetry is attributed to the combined action of Coriolis and centrifugal forces. Along the auroral oval the sunward streaming plasma causes a stagnation of the day-to-night wind. This effect is particularly clear on the dusk side. On the dawn side it is evident only from midnight to 06:00 MLT. The winter (Southern Hemisphere reveals similar wind features, but they are less well ordered. The mean day-to-night wind over the polar cap is weaker by about 35%. Otherwise, the seasonal differences are mainly confined to the dayside (06:00–18:00 MLT. In addition, the larger offset between geographic and geomagnetic pole in the south also causes hemispheric differences of the thermospheric wind distribution.

Average thermospheric wind patterns over the polar regions, as observed by CHAMP

Directory of Open Access Journals (Sweden)

H. Lühr

2007-06-01

Full Text Available Measurements of the CHAMP accelerometer are utilized to investigate the average thermospheric wind distribution in the polar regions at altitudes around 400 km. This study puts special emphasis on the seasonal differences in the wind patterns. For this purpose 131 days centered on the June solstice of 2003 are considered. Within that period CHAMP's orbit is precessing once through all local times. The cross-track wind estimates of all 2030 passes are used to construct mean wind vectors for 918 equal-area cells. These bin averages are presented in corrected geomagnetic coordinates. Both hemispheres are considered simultaneously providing summer and winter responses for the same prevailing geophysical conditions. The period under study is characterized by high magnetic activity (K_p=4− but moderate solar flux level (F10.7=124. Our analysis reveals clear wind features in the summer (Northern Hemisphere. Over the polar cap there is a fast day-to-night flow with mean speeds surpassing 600 m/s in the dawn sector. At auroral latitudes we find strong westward zonal winds on the dawn side. On the dusk side, however, an anti-cyclonic vortex is forming. The dawn/dusk asymmetry is attributed to the combined action of Coriolis and centrifugal forces. Along the auroral oval the sunward streaming plasma causes a stagnation of the day-to-night wind. This effect is particularly clear on the dusk side. On the dawn side it is evident only from midnight to 06:00 MLT. The winter (Southern Hemisphere reveals similar wind features, but they are less well ordered. The mean day-to-night wind over the polar cap is weaker by about 35%. Otherwise, the seasonal differences are mainly confined to the dayside (06:00–18:00 MLT. In addition, the larger offset between geographic and geomagnetic pole in the south also causes hemispheric differences of the thermospheric wind distribution.

Common Terms

Science.gov (United States)

... Generic name: nateglinide) dawn phenomenon (feh-NAH-meh-nun) the early-morning (4 a.m. to 8 ... energy. Diabetes Control and Complications Trial (DCCT) a study by the National Institute of Diabetes and Digestive ...

Electronic Health Information Legal Epidemiology Protocol 2014

Data.gov (United States)

U.S. Department of Health & Human Services — Authors: Cason Schmit, JD, Gregory Sunshine, JD, Dawn Pepin, JD, MPH, Tara Ramanathan, JD, MPH, Akshara Menon, JD, MPH, Matthew Penn, JD, MLIS The Health Information...

A Virtual Observatory Approach to Planetary Data for Vesta and Ceres

Science.gov (United States)

Giardino, M.; Fonte, S.; Politi, R.; Ivanovski, S.; Longobardo, A.; Capria, M. T.; Erard, S.; De Sanctis, M. C.

2018-04-01

A virtual observatory service for DAWN/VIR spectral dataset is presented, based upon the IVOA standards adapted to the planetary field. Advantages of such an approach will be discussed, especially concerning interoperability and availability.

Antioxidant and Antiacetylcholinesterase Activities of Some Commercial Essential Oils and Their Major Compounds

Directory of Open Access Journals (Sweden)

Smail Aazza

2011-09-01

Full Text Available The commercial essential oils of Citrus aurantium L., Cupressus sempervirens L., Eucalyptus globulus Labill., Foeniculum vulgare Mill. and Thymus vulgaris L., isolated by steam distillation by a company of Morocco were evaluated in terms of in vitro antioxidant activity through several methods. In vitro acetylcholinesterase inhibitory activity was also determined. Citrus limon (L. Burm. f. oil was also studied, but it was obtained by peel expression. The best antioxidant was T. vulgaris oil, independent of the method used, mainly due to the presence of the phenolic monoterpenes thymol and carvacrol, which when studied as single compounds also presented the best activities. Concerning the acetylcholinesterase inhibition activity, E. globulus was the most effective. Nevertheless its main components 1,8-cineole and limonene were not the most active, a feature that corresponded to d-3-carene.

Utilization of silicifed Tertiary wood as raw material for the natural stone industry. [German Democratic Republic

Energy Technology Data Exchange (ETDEWEB)

Bellmann, H J; Schuettler, J; Jakisch, E

1981-11-01

This paper discusses the occurrence of silicified tree trunks and stumps in the Boehlen brown coal field. The trees, mainly Taxodium and Sequoia 25 million years old, are located within the top brown coal seam of the deposit and present a major obstacle to excavator operation, together with other forms of so-called 'brown coal quartzite'. The quartz of the silicified trees occurs as opal, cryptocrystalline quartz and low temperature quartz. The separate removal and disposal of this wood as well as efforts made to use selected wood as raw material are briefly summarized. Various products for interior house decoration have been manufactured from the wood. (4 refs.)

Smart grids are advancing, light and supple

International Nuclear Information System (INIS)

Petitot, Pauline

2016-01-01

While indicating some innovations produced by the Greenlys laboratory (SmartScan to localize losses by means of smart counters, a system for grid self-healing, Sequoia to manage a low voltage network, a tool for the prediction of photovoltaic production in real time), and also the main smart grid projects in France (Nice Grid, Solenn, SoGrid, Smart Electric Lyon, Poste intelligent, Greenlys, Smart Grids Vendee, BienVEnu), this article comments the emergence of several experiments on smart grids in France, the first drawn conclusions and recommendations. Some issues for this new architecture are discussed: the active demand management, cut-offs and flexibility, and the search for profitability

Mineralogical Mapping of the Av-5 Floronia Quadrangle of Asteroid 4 Vesta

Science.gov (United States)

Combe, J.-Ph.; Fulchinioni, M.; McCord, T. B.; Ammannito, E.; De Sanctis, M. C.; Nathues, A.; Capaccioni, F.; Frigeri, A.; Jaumann, R.; Le Corre, L.; Palomba, E.; Preusker, F.; Reddy, V.; Stephan, K.; Tosi, F.; Zambon, F.; Raymond, C. A.; Russell, C. T.

2012-04-01

Asteroid 4 Vesta is currently under investigation by NASA's Dawn orbiter. The Dawn Science Team is conducting mineralogical mapping of Vesta's surface in the form of 15 quadrangle maps, and here we report results from the mapping of Floronia quadrangle Av-5. The maps are based on the data acquired by the Visible and Infrared Mapping Spectrometer (VIR-MS) and the Framing Camera (FC) (De Sanctis et al., this meeting). This abstract is focused on the analysis of band ratios, as well as the depth and position of the 2-µm absorption band of pyroxenes, but additional information will be presented. Absorption band depth is sensitive to abundance, texture and multiple scattering effects. Absorption band position is controlled by composition, shorter wavelength positions indicate less Calcium (and more Magnesium) in pyroxenes. The inferred composition is compared with that of Howardite, Eucite and Diogenite meteorites (HEDs). Diogenites are Mg-rich with large orthopyroxene crystals suggesting formation in depth; Eucrites are Ca-poor pyroxene, with smaller crystals. Av-5 Floronia Quadrangle is located between ~20-66˚N and 270˚-360˚E. It covers a portion of the heavily-cratered northern hemisphere of Vesta, and part of it is in permanent night, until August 2012. Long shadows make the visualization of albedo variations difficult, because of limited effectiveness of photometric corrections. Most of the variations of the band depth at 2 µm are partly affected by illumination geometry in this area. Only regional tendencies are meaningful at this time of the analysis. The 2-µm absorption band depth seems to be deeper towards the south of the quadrangle, in particular to the south of Floronia crater. It is not possible to interpret the value of the band depth in the floor the craters because of the absence of direct sunlight. However, the illuminated rims seem to have a deeper 2-µm absorption band, as does the ejecta from an unnamed crater located further south, within

Statistical study of ion pitch-angle distributions

International Nuclear Information System (INIS)

Sibeck, D.G.; Mcentire, R.W.; Lui, A.T.Y.; Krimigis, S.M.

1987-01-01

Preliminary results of a statistical study of energetic (34-50 keV) ion pitch-angle distributions (PADs) within 9 Re of earth provide evidence for an orderly pattern consistent with both drift-shell splitting and magnetopause shadowing. Normal ion PADs dominate the dayside and inner magnetosphere. Butterfly PADs typically occur in a narrow belt stretching from dusk to dawn through midnight, where they approach within 6 Re of earth. While those ion butterfly PADs that typically occur on closed drift paths are mainly caused by drift-shell splitting, there is also evidence for magnetopause shadowing in observations of more frequent butterfly PAD occurrence in the outer magnetosphere near dawn than dusk. Isotropic and gradient boundary PADs terminate the tailward extent of the butterfly ion PAD belt. 9 references

Influenza or not influenza: Analysis of a case of high fever that happened 2000 years ago in Biblical time

Directory of Open Access Journals (Sweden)

Leung Ting F

2010-07-01

Full Text Available Abstract The Bible describes the case of a woman with high fever cured by our Lord Jesus Christ. Based on the information provided by the gospels of Mark, Matthew and Luke, the diagnosis and the possible etiology of the febrile illness is discussed. Infectious diseases continue to be a threat to humanity, and influenza has been with us since the dawn of human history. If the postulation is indeed correct, the woman with fever in the Bible is among one of the very early description of human influenza disease. Infectious diseases continue to be a threat to humanity, and influenza has been with us since the dawn of human history. We analysed a case of high fever that happened 2000 years ago in Biblical time and discussed possible etiologies.

Long-term acoustical observations of the mesopelagic fish Maurolicus muelleri reveal novel and varied vertical migration patterns

KAUST Repository

Staby, A; Rø stad, Anders; Kaartvedt, Stein

2011-01-01

. The data revealed known patterns as normal diel vertical migration (DVM), midnight sinking between dusk and dawn, and periods without migrations, as well as novel behaviours consisting of early morning ascents, reverse diel vertical migrations

Comparing Alternative U.S. Counterterrorism Strategies: Can Assumption-Based Planning Help Elevate the Debate?

National Research Council Canada - National Science Library

Lempert, Robert J; Trujillo, Horacio R; Aaron, David; Dewar, James A; Berry, Sandra H; Popper, Steven W

2008-01-01

At the dawn of the 21st century, the United States faces numerous, significant, long-term, and novel challenges, not the least of which is countering the threat from today's virulent new strain of terrorism...

Electronic Health Information Legal Epidemiology Data Set 2014

Data.gov (United States)

U.S. Department of Health & Human Services — Authors: Cason Schmit, JD, Gregory Sunshine, JD, Dawn Pepin, JD, MPH, Tara Ramanathan, JD, MPH, Akshara Menon, JD, MPH, Matthew Penn, JD, MLIS This legal data set...

Abuse, Maltreatment and PTSD and Their Relationship to Migraine

Science.gov (United States)

... pain, injury, or mental anguish. Examples: neglect, threats, harassment, controlling behavior, attempts to isolate and bullying. Sexual ... Institute of Medical Research, Adjunct Clinical Professor, Jefferson School of Medicine Dawn C. Buse, PhD, Director of ...

The Last of the Gem Elixir (Research).

Science.gov (United States)

Otto, Wayne

1988-01-01

Draws a humorous analogy between the Harmonic Convergence ushering in the dawn of the New Age and the convergence of a whole set of different views of reading instruction with established views and practices. (RS)

JUST 27 No. 3 December 2007

African Journals Online (AJOL)

User

2007-12-03

Dec 3, 2007 ... weight hydrocarbon of like asphalts, taps, pitches and asphaltenes. In general, tar ... have been recorded in these areas since the dawn of this century. .... The hippopotamus, elephant, giraffe, leopard, and lion now remain.

Basics of SCI Rehabilitation

Medline Plus

Full Text Available ... Cord Injury Diane M. Rowles, MS, NP How Family Life Changes After Spinal Cord Injury Nancy Rosenberg, ... Children with Spinal Cord Injury Patricia Mucia, RN Family Life After Pediatric Spinal Injury Dawn Sheaffer, MSW ...

Spinal Cord Injury 101

Medline Plus

Full Text Available ... Cord Injury Diane M. Rowles, MS, NP How Family Life Changes After Spinal Cord Injury Nancy Rosenberg, ... Children with Spinal Cord Injury Patricia Mucia, RN Family Life After Pediatric Spinal Injury Dawn Sheaffer, MSW ...

Preventing Pressure Sores

Medline Plus

Full Text Available ... Cord Injury Diane M. Rowles, MS, NP How Family Life Changes After Spinal Cord Injury Nancy Rosenberg, ... Children with Spinal Cord Injury Patricia Mucia, RN Family Life After Pediatric Spinal Injury Dawn Sheaffer, MSW ...

Sex and Fertility After SCI

Medline Plus

Full Text Available ... Cord Injury Diane M. Rowles, MS, NP How Family Life Changes After Spinal Cord Injury Nancy Rosenberg, ... Children with Spinal Cord Injury Patricia Mucia, RN Family Life After Pediatric Spinal Injury Dawn Sheaffer, MSW ...

Hyperglycemia (High Blood Glucose)

Medline Plus

Full Text Available ... Complications DKA (Ketoacidosis) & Ketones Kidney Disease (Nephropathy) Gastroparesis Mental Health Step On Up Treatment & Care Blood Glucose ... glucose) Dawn Phenomenon Checking for Ketones Tight Diabetes Control donate en -- A Future Without Diabetes - a-future- ...

MESSENGER MASCS/UVVS Observations of Cold Exospheric Calcium

Science.gov (United States)

Cassidy, T. A.

2018-05-01

Exospheric calcium is primarily ejected by a high energy process on the dawn hemisphere. UVVS data also show a sporadic cold component at low altitudes. Its temperature is consistent with laboratory measurements of photodesorption of calcium sulfide.

Hyperglycemia (High Blood Glucose)

Medline Plus

Full Text Available ... for energy. When your body breaks down fats, waste products called ketones are produced. Your body cannot ... glucose) Dawn Phenomenon Checking for Ketones Tight Diabetes Control donate en -- A Future Without Diabetes - a-future- ...

Hyperglycemia (High Blood Glucose)

Medline Plus

Full Text Available ... Your best bet is to practice good diabetes management and learn to detect hyperglycemia so you can ... glucose) Dawn Phenomenon Checking for Ketones Tight Diabetes Control donate en -- A Future Without Diabetes - a-future- ...

76 FR 9537 - Sequoia National Forest; California; Piute Mountains Travel Management Plan

Science.gov (United States)

2011-02-18

... camping, hunting, sightseeing, horseback riding, hiking, rock climbing, rock hounding, and vegetation and... providing benefits equal to or better than the current condition. Alternatives being considered at this time...

Global Ultra-Low-Frequency Geomagnetic Pulsations Associated with the March 24, 1991 Geomagnetic Storm

Directory of Open Access Journals (Sweden)

Nan-Wei Chen Jann-Yenq Liu

2008-01-01

Full Text Available On 24 March 1991, global ultra-low-frequency (ULF pulsations (1.1 - 3.3 mHz observed in the magnetosphere as well as on the ground were studied via analyzing magnetic field data obtained from a global network, comprising ground-based observatories and geosynchronous satellites. In the magnetosphere, the compressional and transverse components of the magnetic fields recorded at two satellites, GOES 6 and GOES 7, showed dominant fluctuations when they were in the vicinity of the noon sector, whereas the transverse fluctuations became dominant when they were at the dawn side. Similarly, on the ground, the H and D components had major fluctuations along with an increase in amplitude from low to high geomagnetic latitudes. In addition, the amplitude of the ULF pulsation was enhanced at the dawn and dusk sides. The geomagnetic pulsations propagated anti-sunward and were of counterclockwise and clockwise elliptical polarizations at the dawn and dusk sides respectively. The counterclockwise elliptical polarization reversed to a clockwise elliptical polarization at geomagnetic local noon and linear polarization was observed during the reversal. It appears that the analysis of the global network data not only provided us with a study of the characteristics of the waves in the magnetosphere and on the ground but also provided us with correlations between the geosynchronous and ground observations, which should be essential to the determination of possible mechanisms of this storm-related wave event.

Globalization on Trial: The Human Condition and the Information ...

International Development Research Centre (IDRC) Digital Library (Canada)

What is the human condition at the dawning of the global age? ... scholars,and students in the social sciences and, particularly, the humanities; donors, ... affecting the nature of human civilization, and with the interaction between Islamic and ...

FY 2000 Blue Book: High Performance Computing and Communications: Information Technology Frontiers for a New Millennium

Data.gov (United States)

Networking and Information Technology Research and Development, Executive Office of the President — As we near the dawn of a new millennium, advances made possible by computing, information, and communications research and development R and D ? once barely...

Sex and Fertility After SCI

Medline Plus

Full Text Available ... Life After Pediatric Spinal Injury Dawn Sheaffer, MSW Rehabilitation Psychological Realities after Spinal Cord Injury Toby Huston, ... Rose, PhD The Basics of Spinal Cord Injury Rehabilitation Kristine Cichowski, MS Occupational Therapy after Spinal Cord ...

Hybrid Differential Dynamic Programming with Stochastic Search

Science.gov (United States)

Aziz, Jonathan; Parker, Jeffrey; Englander, Jacob

2016-01-01

Differential dynamic programming (DDP) has been demonstrated as a viable approach to low-thrust trajectory optimization, namely with the recent success of NASAs Dawn mission. The Dawn trajectory was designed with the DDP-based Static Dynamic Optimal Control algorithm used in the Mystic software. Another recently developed method, Hybrid Differential Dynamic Programming (HDDP) is a variant of the standard DDP formulation that leverages both first-order and second-order state transition matrices in addition to nonlinear programming (NLP) techniques. Areas of improvement over standard DDP include constraint handling, convergence properties, continuous dynamics, and multi-phase capability. DDP is a gradient based method and will converge to a solution nearby an initial guess. In this study, monotonic basin hopping (MBH) is employed as a stochastic search method to overcome this limitation, by augmenting the HDDP algorithm for a wider search of the solution space.

[Emotional distress and quality of life in people with diabetes and their families].

Science.gov (United States)

Beléndez Vázquez, Marina; Lorente Armendáriz, Iñaki; Maderuelo Labrador, Mercedes

2015-01-01

The daily experience of living with diabetes can adversely affect the quality of life of people with diabetes and their families. We present the results for Spain of the DAWN2 study related to quality of life and wellbeing of patients and their families. The DAWN2 study is an observational, cross-sectional study. In the present study, we used the Spanish sample of patients (N=502) and their relatives (N=123). A total of 13.9% of patients were at risk of possible depression while 50.0% of people with diabetes and 45.5% of family members reported a high level of diabetes-related emotional stress. People with diabetes experience high levels of stress and the psychosocial impact of diabetes also affects family members. Copyright © 2014 SESPAS. Published by Elsevier Espana. All rights reserved.

Cosmic Dawn: The First Star in the Universe

Energy Technology Data Exchange (ETDEWEB)

Abel, Tom

2008-04-29

What was the first thing in the Universe? A black hole or a star? How did it form? Even our biggest and best telescopes cannot tell us. Direct calculation with supercomputers, however, can. The first luminous objects in the Universe were very massive stars shining one million times as brightly as our sun. They died quickly and seeded the cosmos with the chemical elements necessary for life. One star at a time, galaxies started to assemble just one hundred million years after the Big Bang, and they are still growing now. Join Dr. Abel in a fascinating journey through the early universe, where he uses the latest computer animations of early star formation, supernovae explosions and the buildup of the first galaxies.

The Globe of Science and Innovation at dawn

CERN Multimedia

Maximilien Brice

2006-01-01

CERN's exhibition centre 'the Globe of Science and Innovation' is seen just after sunrise. This wooden building was given to CERN in 2004 as a gift from the Swiss Confederation to mark 50 years since the Organisation's foundation.

MJMS at the Dawn of Its Electronic Era

Science.gov (United States)

Dewiputri, Wan Ilma; Mohamad, Irfan

2011-01-01

This special editorial assessed the recent developments in Malaysian Journal of Medical Sciences (MJMS) and examined the characteristics of the submission, peer review, and publication processes for MJMS. This retrospective analysis used information about the manuscripts submitted to MJMS during the one-year period (from 1 June 2010 to 31 May 2010) since the start of current online submission and review system (ScholarOne™ Manuscripts, Thomson Reuters). In addition, we also discussed the future directions of MJMS. Finally, we would like to recommend an annual internal audit for MJMS, which is very useful to monitor the growth of this journal progressively. PMID:22135566

The Dawning of the Ethics of Environmental Robots.

Science.gov (United States)

van Wynsberghe, Aimee; Donhauser, Justin

2017-10-23

Environmental scientists and engineers have been exploring research and monitoring applications of robotics, as well as exploring ways of integrating robotics into ecosystems to aid in responses to accelerating environmental, climatic, and biodiversity changes. These emerging applications of robots and other autonomous technologies present novel ethical and practical challenges. Yet, the critical applications of robots for environmental research, engineering, protection and remediation have received next to no attention in the ethics of robotics literature to date. This paper seeks to fill that void, and promote the study of environmental robotics. It provides key resources for further critical examination of the issues environmental robots present by explaining and differentiating the sorts of environmental robotics that exist to date and identifying unique conceptual, ethical, and practical issues they present.

The Dawning of the Ethics of Environmental Robots

NARCIS (Netherlands)

Robbins-van Wynsberghe, A.L.; Donhauser, Justin

2017-01-01

Environmental scientists and engineers have been exploring research and monitoring applications of robotics, as well as exploring ways of integrating robotics into ecosystems to aid in responses to accelerating environmental, climatic, and biodiversity changes. These emerging applications of

Dawn of small worlds dwarf planets, asteroids, comets

CERN Document Server

Moltenbrey, Michael

2016-01-01

This book gives a detailed introduction to the thousands and thousands of smaller bodies in the solar system. Written for interested laymen, amateur astronomers and students it describes the nature and origin of asteroids, dwarf planets and comets, and gives detailed information about their role in the solar system. The author nicely reviews the history of small-world-exploration and describes past, current and future space craft missions studying small worlds, and presents their results. Readers will learn that small solar system worlds have a dramatically different nature and appearance than the planets. Even though research activity on small worlds has increased in the recent past many of their properties are still in the dark and need further research.

The Dawn of physics beyond the standard model

CERN Multimedia

Kane, Gordon

2003-01-01

"The Standard Model of particle physics is at a pivotal moment in its history: it is both at the height of its success and on the verge of being surpassed [...] A new era in particle physics could soon be heralded by the detection of supersymmetric particles at the Tevatron collider at Fermi National Accelerator Laboratory in Batavia, Ill." (8 pages)

Social Studies. Dawn: The Birth of Selected Civilizations.

Science.gov (United States)

Cold, Ron

The Quinmester world studies course for grades 7 through 9 investigates concepts of prehistory, culture, and civilization, offering an in depth understanding of the reasons why and how civilizations rise and fall. Emphasis is on comparing past and present civilizations. One major purpose of the course is for students to comprehend that…

Probing individual sources during reionization and cosmic dawn ...

Indian Academy of Sciences (India)

40

The emergence of first galaxies, quasars in the Universe is one of the significant .... Left panel: The differential brightness temperature profile around an isolated ..... The system noise (NS), HI fluctuations (HF) and the foregrounds (FG) all con-.

The dawn of sustainable forestry in the South

Science.gov (United States)

James P. Barnett; Mason C. Carter

2017-01-01

In the late 19th century, virgin southern pine forests in the West Gulf Coast Region remained virtually untouched. After the Civil War, this land was made available by the government for homesteading and sale. Pine timberland was offered for sale at $1.25 per acre. Primarily northern lumbermen and land speculators purchased the land. Lumbering then became the economic...

IJAAAR 2011 VOL 7

African Journals Online (AJOL)

Faculty of Agricultural Sciences Lautech Ogbomoso

It was therefore concluded that locust bean enterprise is profitable and attention should be focused on boosting quantity ... “Fabaceae” sub family “Mimosoidea” and ... a lot of challenges despite the dawn of ... by women; the production has not.

77 FR 77035 - Proposed Information Collection; Comment Request; Malcolm Baldrige National Quality Award and...

Science.gov (United States)

2012-12-31

... to Dawn Bailey, Baldrige Performance Excellence Program, 100 Bureau Drive, Stop 1020, National... Commerce is responsible for the Baldrige Performance Excellence Program (BPEP) and the Malcolm Baldrige... Collection; Comment Request; Malcolm Baldrige National Quality Award and Examiner Applications AGENCY...

Youth Sports Safety Statistics

Science.gov (United States)

... 6):794-799. 31 American Heart Association. CPR statistics. www.heart.org/HEARTORG/CPRAndECC/WhatisCPR/CPRFactsandStats/CPRpercent20Statistics_ ... Mental Health Services Administration, Center for Behavioral Health Statistics and Quality. (January 10, 2013). The DAWN Report: ...

Blockchain-based Smart Contracts in Waste Management : A Silver Bullet?

NARCIS (Netherlands)

G. (Guido) Ongena; Koen Smit; Jarno Boksebeld; Gerben Adams; Yorin Roelofs; Pascal Ravesteijn

2018-01-01

From the article: Blockchain technology may have the potential to fundamentally change society and we might currently witness the dawn of a cryptographically secured trust-free transactions economy. One relatively unexplored application domain is waste management. Incorrect waste management

Basics of SCI Rehabilitation

Medline Plus

Full Text Available ... Spinal Cord Injury 101 Lawrence Vogel, MD The Basics of Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children with Spinal Cord Injury Patricia Mucia, RN Family Life After Pediatric Spinal Injury Dawn Sheaffer, MSW Rehabilitation ...

Preventing Pressure Sores

Medline Plus

Full Text Available ... Spinal Cord Injury 101 Lawrence Vogel, MD The Basics of Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children with Spinal Cord Injury Patricia Mucia, RN Family Life After Pediatric Spinal Injury Dawn Sheaffer, MSW Rehabilitation ...

Sex and Fertility After SCI

Medline Plus

Full Text Available ... Spinal Cord Injury 101 Lawrence Vogel, MD The Basics of Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children with Spinal Cord Injury Patricia Mucia, RN Family Life After Pediatric Spinal Injury Dawn Sheaffer, MSW Rehabilitation ...

Spinal Cord Injury 101

Medline Plus

Full Text Available ... Spinal Cord Injury 101 Lawrence Vogel, MD The Basics of Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children with Spinal Cord Injury Patricia Mucia, RN Family Life After Pediatric Spinal Injury Dawn Sheaffer, MSW Rehabilitation ...

Wild food plants used on the Dubrovnik coast (south-eastern Croatia

Directory of Open Access Journals (Sweden)

Katija Dolina

2014-09-01

Full Text Available Croatia’s versatile plant use traditions are still not sufficiently documented. The aim of this study was to record local traditions of wild food plant use on the Dubrovnik coast. We interviewed 40 inhabitants of 23 villages, mainly knowledgeable informants. On average 19 species were listed, which in total produced an inventory of 95 food plant species (including species whose leaves or inflorescences are used as recreational teas. The most commonly collected are: Sonchus oleraceus and S. asper, Asparagus acutifolius, Dioscorea communis, Cichorium intybus, Crepis zacintha, Allium ampeloprasum, Picris echioides and Foeniculum vulgare (all of them used as vegetables, the fruits of Rubus ulmifolius (mainly eaten raw, the fruits of roses (Rosa sempervirens and R. canina and the leaves of Salvia officinalis (both roses and salvia are used for making recreational teas. A particular feature of the local gastronomy is the collection of young Ruscus aculeatus shoots.

FY 2001 Blue Book: Information Technology: The 21st Century Revolution

Data.gov (United States)

Networking and Information Technology Research and Development, Executive Office of the President — At the dawn of the 21st century, the U.S. is enjoying an era of unprecedented possibilities and prosperity built on dramatic advances in science and technology....

Controversial EU deportation programme subjected to academic scrutiny

DEFF Research Database (Denmark)

Lemberg-Pedersen, Martin; McClelland, Ian

2013-01-01

On 3 May 2013, the Refugee Studies Centre hosted a workshop in Oxford, co-convened by Martin Lemberg-Pedersen (University of Copenhagen) and Dawn Chatty (RSC), to shed light on the little-publicised European Return Platform for Unaccompanied Minors (ERPUM)...

Hyperglycemia (High Blood Glucose)

Medline Plus

Full Text Available ... Carbohydrate Counting Make Your Carbs Count Glycemic Index Low-Calorie Sweeteners Sugar and Desserts Fitness Exercise & Type ... Checking Your Blood Glucose A1C and eAG Hypoglycemia (Low blood glucose) Hyperglycemia (High blood glucose) Dawn Phenomenon ...

The cat is out of the bag

KAUST Repository

Ananthanarayanan, Rajagopal; Esser, Steven K.; Simon, Horst D.; Modha, Dharmendra S.

2009-01-01

In the quest for cognitive computing, we have built a massively parallel cortical simulator, C2, that incorporates a number of innovations in computation, memory, and communication. Using C2 on LLNL's Dawn Blue Gene/P supercomputer with 147, 456

Effect of altered eating habits and periods during Ramadan fasting on intraocular pressure, tear secretion, corneal and anterior chamber parameters

NARCIS (Netherlands)

Kerimoglu, H.; Ozturk, B.; Gunduz, K.; Bozkurt, B.; Kamis, U.; Okka, M.

Purpose To determine whether altered eating habits and periods, especially the pre-dawn meal, during Ramadan fasting have any significant effect on intraocular pressure (IOP), tear secretion, corneal and anterior chamber parameters. Methods IOP, basal tear secretion (BTS), reflex tear secretion

Medical Surveillance Monthly Report (MSMR). Volume 22, Number 4, April 2015

Science.gov (United States)

2015-04-01

Health Surveillance Center. Causes of medical evacuations from Operations Iraqi Freedom (OIF), New Dawn (OND) and Enduring Freedom (OEF), active and...source of health- care burden; and of cardiovascular diseases, essential hypertension , cerebrovascular dis- ease, and ischemic heart disease accounted

Digital privacy in Asia: Setting the agenda | IDRC - International ...

International Development Research Centre (IDRC) Digital Library (Canada)

2016-06-09

Jun 9, 2016 ... The report, A New Dawn: Privacy in Asia, summarizes the findings of the research. ... among citizens about protecting their personal data and Internet privacy. ... A study on mobile phone use by the poor has resulted in the ...

A Day in the Life of American Adolescents: Substance Use Facts Update

Science.gov (United States)

... day. ” 10 Data in this report from NSDUH, TEDS, and DAWN are for adolescents aged 12 to 17; data from N-SSATS are for youths aged 17 or younger. IN BRIEF X X This CBHSQ Report presents facts about adolescent ...

From Les Chevaliers du Ciel to Steely-Eyed Killers: Intersecting Influences of Hollywood and Reality on the Romanticization of Fighter Pilots

Science.gov (United States)

2013-12-01

is critical to establishing his heroic identity . Authority Issues: Whether portrayed via confrontation (e.g., Fighter Squadron, The Dawn Patrol...traits throughout the subject’s cinema history has solidified the archetype into the public’s subconscious. Some combination of youthfulness

Recent results from Barn Swallow Hirundo rustica ringing in Iringa ...

African Journals Online (AJOL)

the lake, we found that capture rates improved when nets were opened just before dawn to ... Obrowiec in Gogolin, Poland, and at Lake Atanasovsko in Burgas, Bulgaria. (Table 1). ... Notes on nesting herons and other birds of interest at Lake.

Communicating climate change in Africa through the theatre for ...

African Journals Online (AJOL)

The reality of climate change has started dawning on various parts of the world. ... has resulted in the thawing of the ice at the polar regions, which has caused the ... and the disruption of services essential for human existence and continuity.

to view fulltext PDF

Indian Academy of Sciences (India)

profile around individual sources during the cosmic dawn and re-ionization epoch. In subsection .... where the radiation from the uniform background HI distribution with HI fraction .... 〈E〉 is non-zero only if an ionized bubble is present. Sf (Ua ...

LHC: installation du plus grand trajectographe au silicium du monde

CERN Multimedia

2008-01-01

The installation of the largest silicon trajectograph of the world was concluded at CERN. Thursday December 13 at dawn, the silicon trajectograph with ribbons of CMS (*) began its trip from the principal site of CERN to its installation of experimentation.

Instant-on scientific data warehouses: Lazy ETL for data-intensive research

NARCIS (Netherlands)

Y. Kargin (Yagiz); H. Pirk (Holger); M.G. Ivanova (Milena); S. Manegold (Stefan); M.L. Kersten (Martin)

2012-01-01

textabstractIn the dawning era of data intensive research, scientific discovery deploys data analysis techniques similar to those that drive business intelligence. Similar to classical Extract, Transform and Load (ETL) processes, data is loaded entirely from external data sources (repositories)

Instant-on scientific data warehouses lazy ETL for data-intensive research

NARCIS (Netherlands)

Y. Kargin (Yagiz); H. Pirk (Holger); M.G. Ivanova (Milena); S. Manegold (Stefan); M.L. Kersten (Martin)

2013-01-01

textabstractIn the dawn of the data intensive research era, scientific discovery deploys data analysis techniques similar to those that drive business intelligence. Similar to classical Extract, Transform and Load (ETL) processes, data is loaded entirely from external data sources (repositories)

Tree water potentials supporting an explanation for the occurrence of Vachellia erioloba in the Namib Desert (Namibia

Directory of Open Access Journals (Sweden)

Joachim H. A. Krug

2017-09-01

Full Text Available Background Site-vegetation relations of Vachellia erioloba, Faidherbia albida, Euclea pseudebenus and Tamarix usneoides in two contrasting locations in the Namib Desert (Namibia were evaluated with the goal to relate soil water availability to the occurrence of trees under hyper-arid conditions. Methods Plant water potentials were measured using a pressure chamber in the field. Pre-dawn water potentials were assessed to reflect the soil water potential of the rhizosphere. Midday water potentials were measured to assess the strongest negative water potential applied by the sample trees. Results Pre-dawn water potentials and midday water potentials indicated access to soil water in the rhizosphere and by this, provide an explanation for an occurrence of V. erioloba within the extreme environmental conditions of sand dunes in the Namib Desert. Diurnal ranges seem to reflect more and less suitable stands, in terms of soil water availability, within the sampling sites. While the impact of the ephemeral Kuiseb river on soil water availability was assessed through the four species’ plant-internal water relations, comparable pre-dawn water potentials of V. erioloba at both sites indicate soil water availability also in the dunes of Namibrand. The extreme midday water potentials of the dune plants possibly show the upper limit of tolerance for V. erioloba. Conclusions The preliminary data provide an explanation of the occurrence and distribution of the investigated species in beds of ephemeral rivers and on dunes under the hyper-arid climatic conditions of the Namib Desert and qualify suitability within the assessed sites. Understanding the plant-physiological processes and assessing the plant-internal water potential provides a valuable tool to evaluate soil water availability within the rhizosphere and to describe an adaptation potential of investigated species. The comparability of pre-dawn water potentials at both sites indicates unexpected soil

Hyperglycemia (High Blood Glucose)

Medline Plus

Full Text Available ... as a cold or flu. You have other stress, such as family conflicts or school or dating problems. You may have experienced the dawn phenomenon (a surge of hormones that the body produces daily around 4:00 a.m. to ...

76 FR 39318 - Controlled Substances and List I Chemical Registration and Reregistration Fees

Science.gov (United States)

2011-07-06

... the Drug Addiction Treatment Act, permitting qualified physicians to treat narcotic dependence with... Future National Results on Adolescent Drug Use: Overview of Key Findings, 2010,'' Institute for Social... (SAMHSA) on emergency room visits. According to their latest data, ``Drug Abuse Warning Network (DAWN...

A History of Market Performance from Ancient Babylonia to the Modern World

NARCIS (Netherlands)

van der Spek, R.J.; van Leeuwen, B.; van Zanden, J.L.

2014-01-01

This exciting new volume examines the development of market performance from Antiquity until the dawn of the Industrial Revolution. Efficient market structures are agreed by most economists to serve as evidence of economic prosperity, and to be prerequisites for further economic growth. However,

Libertus Fromondus' Christian Psychology. Medicine and Natural Philosophy in the Philosophia christiana de anima

NARCIS (Netherlands)

Cellamare, D.; Bakker, P.J.J.M.

2015-01-01

This article discusses Libertus Fromondus’ strictly hylomorphic account of the human soul. At a time when psychology (the study of the soul) was dominated by the erosion of Aristotelianism and the dawning of Cartesian philosophy, Fromondus sought to reconcile hylomorphism with new philosophical

Kujundame roosiaeda / Mart Ojasalu

Index Scriptorium Estoniae

Ojasalu, Mart

2004-01-01

5 ill.: Aleksander Niine kavandatud massiivsete paesõõridega Jäneda rosaarium, väänroos "Climbing Queen" kaarväraval Rosmakori roosiaias Harjumaal, väänroosi "Coral Dawn" toetab Jäneda pargis karprauast püramiid, roosipeenar Marzahni puhkepargis Berliinis

Towards a playful organization ideal-type : Values of a playful organizational culture

NARCIS (Netherlands)

Warmelink, H.J.G.

2011-01-01

Numerous organizations have embarked on playful endeavors such as serious gaming (playing games with a learning/training purpose) and ‘gamification’ (applying game technology and principles to make existing practices more game-like). One could consequently theorize about the dawn of playful or

Living the Electronics Revolution: 60 Years of Fun with Radio

OpenAIRE

Bostian, Charles W.

2012-01-01

46 slides. This presentation is an autobiographical history of the career of Professor Charles W. Bostian, whose tenure at Virginia Tech coincided with the electronics revolution of the latter half of the twentieth century, and the dawn of the twenty-first century.

Visualization drivers for Geant4

International Nuclear Information System (INIS)

Beretvas, Andy

2005-01-01

This document is on Geant 4 visualization tools (drivers), evaluating pros and cons of each option, including recommendations on which tools to support at Fermilab for different applications. Four visualization drivers are evaluated. They re OpenGL, HepRep, DAWN and VRML. They all have good features, OpenGL provides graphic output with out an intermediate file. HepRep provides menus to assist the user. DAWN provides high quality plots and even for large files produces output quickly. VRML uses the smallest disk space for intermediate files. Large experiments at Fermilab will want to write their own display. They should proceed to make this display graphics independent. Medium experiment will probably want to use HepRep because of it's menu support. Smaller scale experiments will want to use OpenGL in the spirit of having immediate response, good quality output and keeping things simple

Is the sex communication of two pyralid moths, Plodia interpunctella and Ephestia kuehniella, under circadian clock regulation?

Science.gov (United States)

Závodská, Radka; Fexová, Silvie; von Wowern, Germund; Han, Gui-Biao; Dolezel, David; Sauman, Ivo

2012-06-01

Females of the Indian meal moth, Plodia interpunctella, and females of the Mediterranean flour month, Ephestia kuehniella (both Lepidoptera: Pyralidae), exhibit daily rhythms in calling behavior. The peak in P. interpunctella calling occurs at dusk, whereas E. kuehniella calls preferentially at dawn. This behavior turned arrhythmic in P. interpunctella females in constant darkness (DD) and remained arrhythmic in constant light (LL), whereas E. kuehniella females showed a persistent rhythm in DD and suppression of the behavior in LL, indicating regulation by a circadian clock mechanism. The rhythm of male locomotor activity corresponded well with the sexual activity of females, reaching the peak at dusk in P. interpunctella and at dawn in E. kuehniella. An immunohistochemical study of the pheromone biosynthesis activating neuropeptide, corazonin, and pigment dispersing factor revealed distinct sets of neurons in the brain-subesophageal complex and in the neurohemal organs of the 2 species.

Practical Management of Diabetes during Ramadan Fast

Directory of Open Access Journals (Sweden)

Sherif IH

2007-01-01

Full Text Available Fasting in Ramadan is obligatory for all healthy Muslim adults. No food or drink may be consumed between dawn and sunset [1]. Strictly speaking, the fast of Ramadan is a period of “intermittent fasting” or daily cycles of “alternating” fasting and feeding periods. The periods of the fasting and feeding vary by the geographical locations and by time of the year. During the month of Ramadan, there are two main meals in most Moslem communities. These are commonly referred to by their Arabic origin, namely the “Iftar” (i.e. break of fast immediately after sunset and “Sohur or Suhoor” (i.e. pre-dawn meal. As the Islamic calendar year is lunar, Ramadan (the ninth month therefore starts approximately 10 days earlier each year on the Gregorian calendar. This year, 2007, Ramadan is likely to start between 12th and 14th September.

The Magnetic Local Time Distribution of Energetic Electrons in the Radiation Belt Region

Science.gov (United States)

Allison, H. J.

2017-12-01

Using fourteen years of electron flux data from the National Oceanic and Atmospheric Administration Polar Operational Environmental Satellites (POES), a statistical study of the magnetic local time (MLT) distribution of the electron population is performed across a range of activity levels, defined by AE, AE*, Kp, solar wind velocity (Vsw), and VswBz. Three electron energies (>30, >100, and >300 keV) are considered. Dawn-dusk flux asymmetries larger than order of magnitude were observed for >30 and >100 keV electrons. For >300 keV electrons, dawn-dusk asymmetries were primarily due to a decrease in the average dusk-side flux beyond L* ˜ 4.5 that arose with increasing activity. For the >30 keV population, substorm injections enhance the dawn-side flux, which may not reach the dusk-side as the electrons can be on open drift paths and lost to the magnetopause. The asymmetries in the >300 keV population are attributed to the combination of magnetopause shadowing and >300 keV electron injections by large electric fields. We suggest that 3D radiation belt models could set the minimum energy boundary (Emin) to 30 keV or above at L* ˜6 during periods of low activity. However, for more moderate conditions, Emin should be larger than 100 keV and, for very extreme activities, ˜300 keV. Our observations show the extent that in-situ electron flux readings may vary during active periods due to the MLT of the satellite and highlight the importance of 4D radiation belt models to fully understand radiation belt processes.

Local time dependence of the thermal structure in the Venusian equatorial region revealed by Akatsuki radio occultation measurements

Science.gov (United States)

Ando, H.; Fukuhara, T.; Takagi, M.; Imamura, T.; Sugimoto, N.; Sagawa, H.

2017-12-01

The radio occultation technique is one of the most useful methods to retrieve vertical temperature profiles in planetary atmospheres. Ultra-Stable Oscillator (USO) onboard Venus Climate Orbiter, Akatsuki, enables us to investigate the thermal structure of the Venus atmosphere between about 40-90 km levels. It is expected that 35 temperature profiles will be obtained by the radio occultation measurements of Akatsuki until August 2017. Static stability derived from the temperature profiles shows its local time dependence above the cloud top level at low-latitudes equatorward of 25˚. The vertical profiles of the static stability in the dawn and dusk regions have maxima at 77 km and 82 km levels, respectively. A general circulation model (GCM) for the Venus atmosphere (AFES-Venus) reproduced the thermal structures above the cloud top qualitatively consistent with the radio occultation measurements; the maxima of the static stability are seen both in the dawn and dusk regions, and the local maximum of the static stability in the dusk region is located at a highler level than in the dawn region. Comparing the thermal structures between the radio occultation measurements and the GCM results, it is suggested that the distribution of the static stability above the cloud top could be strongly affected by the diurnal tide. The thermal tide influences on the thermal structure as well as atmospheric motions above the cloud level. In addition, it is shown that zonally averaged zonal wind at about 80 km altitude could be roughly estimated from the radio occultation measurements using the dispersion relation of the internal gravity wave.

Sodium Velocity Maps on Mercury

Science.gov (United States)

Potter, A. E.; Killen, R. M.

2011-01-01

The objective of the current work was to measure two-dimensional maps of sodium velocities on the Mercury surface and examine the maps for evidence of sources or sinks of sodium on the surface. The McMath-Pierce Solar Telescope and the Stellar Spectrograph were used to measure Mercury spectra that were sampled at 7 milliAngstrom intervals. Observations were made each day during the period October 5-9, 2010. The dawn terminator was in view during that time. The velocity shift of the centroid of the Mercury emission line was measured relative to the solar sodium Fraunhofer line corrected for radial velocity of the Earth. The difference between the observed and calculated velocity shift was taken to be the velocity vector of the sodium relative to Earth. For each position of the spectrograph slit, a line of velocities across the planet was measured. Then, the spectrograph slit was stepped over the surface of Mercury at 1 arc second intervals. The position of Mercury was stabilized by an adaptive optics system. The collection of lines were assembled into an images of surface reflection, sodium emission intensities, and Earthward velocities over the surface of Mercury. The velocity map shows patches of higher velocity in the southern hemisphere, suggesting the existence of sodium sources there. The peak earthward velocity occurs in the equatorial region, and extends to the terminator. Since this was a dawn terminator, this might be an indication of dawn evaporation of sodium. Leblanc et al. (2008) have published a velocity map that is similar.

From Darkness to Light: Posttraumatic Growth among Recently Deployed Army National Guard Soldiers

Science.gov (United States)

2013-02-14

Stress and Associated Functioning of Army National Guard Following Exposure to Iraq Warzone Trauma,” Traumatology 14 (2008): 51. 9. Army National...Associated Functioning of Army National Guard Following Exposure to Iraq Warzone Trauma.” Traumatology , 14 (2008): 51–56. Ouimette, Paige, Dawne Vogt

Google Search and the Law on Dominance in the EU : An Assessment of the Compatibility of Current Methodology with Multi-Sided Platforms in Online Search

NARCIS (Netherlands)

Herz, Martin

2014-01-01

Business platforms that utilise, or are based upon, internet technology are omnipresent in consumers daily lives. Since the dawn of the World Wide Web, the amount of web content has increased greatly. Simultaneously, business interests have sparked, meeting the arisen demand for particular online

78 FR 34160 - Proposed Collection; Comment Request; Office of Financial Stability

Science.gov (United States)

2013-06-06

... Purchase Program (CPP) under which the Department has purchased qualifying capital in U.S. banking... Treasury has invested through the CPP. Consequently, the Treasury is seeking responses from banking..., maintenance, and purchase of services to provide information. Dated: June 3, 2013. Dawn D. Wolfgang, Treasury...

CORRECTED MARCH EDITON 2009 F...

African Journals Online (AJOL)

User

Haemorrhoids, symptomatic vascular cushions i.e. engorgement of haemorrhoidal venous plexuses with redundancy of their coverings, are a problem that has plagued man kind since the dawn of civilization. The detailed description of haemorrhoids dates back to Hippocrates, who treated the condition with suppositories, ...

Resonance journal of science education

Indian Academy of Sciences (India)

Resonance journal of science education. May 2012 Volume 17 Number 5. SERIES ARTICLES. 436 Dawn of Science. The Quest for Power. T Padmanabhan. GENERAL ARTICLES. 441 Bernoulli Runs Using 'Book Cricket' to Evaluate. Cricketers. Anand Ramalingam. 454 Wilhelm Ostwald, the Father of Physical Chemistry.

The Contribution of Kawada to the Analytical Solution for the Velocity Induced by a Helical Vortex Filament and Modern Applications of Helical Vortices

DEFF Research Database (Denmark)

Fukumoto, Yasuhide; Okulov, Valery; Wood, David H.

2017-01-01

a comprehensive treatment of deriving the induced velocity by helical vortices with a view to applying it to the propeller theory. This paper recollects Kawada’s contribution, together with his life devoted to lead the Japanese aeronautical engineering in the time of its dawning....

Measuring Self-Advocacy Skills among Student Veterans with Disabilities: Implications for Success in Postsecondary Education

Science.gov (United States)

Kinney, Adam R.; Eakman, Aaron M.

2017-01-01

Veterans of Operation Enduring Freedom, Operation Iraqi Freedom, and Operation New Dawn enrolled in postsecondary education may experience disabilities that impact their successful participation in the academic environment. Accommodations are made available to college students with disabilities to provide opportunities for success in this…

African Journal of AIDS Research - Vol 5, No 2 (2006)

African Journals Online (AJOL)

Talking about sex in Botswana: social desirability bias and possible implications for HIV-prevention research · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Kata Chillag, Greg Guest, Arwen Bunce, Laura Johnson, Peter H Kilmarx, Dawn K Smith, 123-131.

75 FR 5865 - Proposed Collection; Comment Request for Publication 1075

Science.gov (United States)

2010-02-04

... Publication 1075 AGENCY: Internal Revenue Service (IRS), Treasury. ACTION: Notice and request for comments... Publication 1075, Tax Information Security Guidelines for Federal, State, and Local Agencies. [[Page 5866... information or copies of the publication should be directed to Dawn Bidne at Internal Revenue Service, room...

The Rhetoric of Investment Theory : The Story of Statistics and Predictability

NARCIS (Netherlands)

T. Pistorius (Thomas)

2016-01-01

markdownabstractUncertainty is a feeling of anxiety and a part of culture since the dawn of civilization. Civilizations have invented numerous ways to cope with uncertainty, statistics is one of those technologies. The rhetoric as the discourse of investment theory uncovers that the theory of

Resonance journal of science education

Indian Academy of Sciences (India)

Resonance journal of science education. February 2012 Volume 17 Number 2. SERIES ARTICLES. 106 Dawn of Science. Calculus is Developed in Kerala. T Padmanabhan. GENERAL ARTICLES. 117 Willis H Carrier: Father of Air Conditioning. R V Simha. 139 Refrigerants For Vapour Compression Refrigeration. Systems.

A sterile-female technique proposed for control of Striga hermonthica and other intractable weeds: Advantages, shortcomings, and risk management

Science.gov (United States)

Weeds have posed intractable challenges to farmers since the dawn of agriculture. This article describes in detail a proposed control strategy based on the introduction of genes conferring female-sterility into the genomes of intractable target weeds. Spread of these genes through target populations...

Contribution to the study of the insect fauna of some conifer species in the region of Western Traras (Tlemcen - Algeria)

International Nuclear Information System (INIS)

Nichane, M.; Bouchikhi Tani, Z.; Khelil, M.A.

2013-01-01

Within the framework of the study of Biocenotic insects related to conifer species in Traras, the Western region of Tlemcen, a comprehensive knowledge of the insect fauna hosted by the Aleppo pine (Pinus halepensisMill.), Thuya Barbary (Tetraclinis articulata(Vahl) Masters)) and Cypress green(Cupressus sempervirensL) is essential. The various methods used for capturing insects allowed the collection of a large number of species, but a large number still remains unknown. These species are distributed among 10 orders of which the most important are the Coleoptera, Hymenoptera and Lepidoptera. Through this list of insects and the nature of their food, six diets to which these species belong were identified. The most representative are herbivores, auxiliaries and borers. This inventory allows the compilation of a list of insects harmful to the conifer species studied in this region. They total species including 9 phytophagous, 8 xylophagous, 7 seed-eating species, 5 opophages and one gall species. The auxiliaries are present with 26 species. (author)

Molecular phylogeny of Acer monspessulanum L. subspecies from Iran inferred using the ITS region of nuclear ribosomal DNA

Directory of Open Access Journals (Sweden)

HANIF KHADEMI

2016-04-01

Full Text Available Abstract. Khademi H, Mehregan I, Assadi M, Nejadsatari T, Zarre S. 2015. Molecular phylogeny of Acer monspessulanum L. subspecies from Iran inferred using the ITS region of nuclear ribosomal DNA. Biodiversitas 17: 16-23. This study was carried out on the Acer monspessulanum complex growing wild in Iran. Internal transcribed spacer (ITS sequences for 75 samples representing five different subspecies of Acer monspessulanum were analyzed. Beside this, 86 previously published ITS sequences from GenBank were used to test the monophyly of the complex worldwide. Phylogenetic analyses were conducted using Bayesian inference and maximum parsimony. The results indicate that most samples of A. monspessulanum species from Iran were part of a monophyletic clade with 8 samples of A. ibericum from Georgia, A. hyrcanum from Iran and one of A. sempervirens from Greece (PP= 1; BS= 79%. Our results indicate that use of morphological characteristics coupled with molecular data will be most effective.

Ash properties of some dominant Greek forest species

International Nuclear Information System (INIS)

Liodakis, S.; Katsigiannis, G.; Kakali, G.

2005-01-01

The elemental and chemical wood ash compositions of six dominant Greek fuels was investigated using a variety of techniques, including thermal gravimetric analysis (TG), differential thermal analysis (DTA), atomic absorption spectroscopy (AAS) and X-ray diffraction (XRD). In addition, the alkalinity of wood ash was determined by titration. The ash was prepared by combustion at low (600 deg. C), middle (800 deg. C) and high temperatures (1000 deg. C). The ash composition is very important because thousands of hectares of wildlands are burned annually in Greece. The resulting deposits affect soil properties (i.e., pH) and provide a source of inorganic constituents (i.e., Ca, K, Na, Mg, etc.), while the most soluble compounds (i.e., sodium and potassium hydroxides and carbonates) do not persist through the wet season. The samples selected were: Pinus halepensis (Aleppo pine), Pinus brutia (Calabrian pine), Olea europaea (Olive), Cupressus sempervirens (Italian cypress), Pistacia lentiscus (Mastic tree), Quercus coccifera (Holly oak)

Ash properties of some dominant Greek forest species

Energy Technology Data Exchange (ETDEWEB)

Liodakis, S. [Laboratory of Inorganic and Analytical Chemistry, Department of Chemical Engineering, National Technical University of Athens (NTUA), 9 Iroon Polytechniou Street, Athens 157 73 (Greece)]. E-mail: liodakis@central.ntua.gr; Katsigiannis, G. [Laboratory of Inorganic and Analytical Chemistry, Department of Chemical Engineering, National Technical University of Athens (NTUA), 9 Iroon Polytechniou Street, Athens 157 73 (Greece); Kakali, G. [Laboratory of Inorganic and Analytical Chemistry, Department of Chemical Engineering, National Technical University of Athens (NTUA), 9 Iroon Polytechniou Street, Athens 157 73 (Greece)

2005-10-15

The elemental and chemical wood ash compositions of six dominant Greek fuels was investigated using a variety of techniques, including thermal gravimetric analysis (TG), differential thermal analysis (DTA), atomic absorption spectroscopy (AAS) and X-ray diffraction (XRD). In addition, the alkalinity of wood ash was determined by titration. The ash was prepared by combustion at low (600 deg. C), middle (800 deg. C) and high temperatures (1000 deg. C). The ash composition is very important because thousands of hectares of wildlands are burned annually in Greece. The resulting deposits affect soil properties (i.e., pH) and provide a source of inorganic constituents (i.e., Ca, K, Na, Mg, etc.), while the most soluble compounds (i.e., sodium and potassium hydroxides and carbonates) do not persist through the wet season. The samples selected were: Pinus halepensis (Aleppo pine), Pinus brutia (Calabrian pine), Olea europaea (Olive), Cupressus sempervirens (Italian cypress), Pistacia lentiscus (Mastic tree), Quercus coccifera (Holly oak)

What goes down must come up: symmetry in light-induced migration behaviour of Daphnia

NARCIS (Netherlands)

Van Gool, E.; Ringelberg, J.

2003-01-01

During a short period of the year, Daphnia may perform a phenotypically induced diel vertical migration. For this to happen, light-induced swimming reactions must be enhanced both at dawn and at dusk. Enhanced swimming in response to light intensity increase can be elicited by fish-associated

Peak Performance Through Nutrition and Exercise

Science.gov (United States)

1999-09-01

Keith Avery, J02 Cerise Fenton , Dr. Jeffrey Bennett, and Dawn Schultz. Also, many thanks to HM1 (FMF) Otis B. Brown, the USUHS Brigade, and Morale...ability to perform physical activities. Regular physical activity leads to improved physical fitness and many other physiologic, cosmetic , and

Do "Womanist" Identity Attitudes Influence College Women's Self-Esteem and Perception of Environmental Bias?

Science.gov (United States)

Ossana, Shelly M.; And Others

1992-01-01

Survey of undergraduate women (n=659) indicated questioning of previously held stereotypical views about gender and dawning awareness of alternative perspectives and active rejection of male supremacist values and beliefs and search for a positive self-affirming definition of womanhood attitudes were inversely related to perceptions of…

Mars from myth and mystery to recent discoveries

CERN Document Server

Hotakainen, Markus

2008-01-01

This absorbing book tells the story of Mars since the dawn of mankind's curiosity for celestial wonders. It covers everything, right from our ancient beliefs, through the revolution in our concepts of the cosmos around us in the 1600s, to the present day knowledge and beyond.

The 'fishery' in South Africa's remaining coastal stonewall fish traps ...

African Journals Online (AJOL)

Fishing takes place on pre-dawn, new-moon spring low tides. Fishers have replaced traditional spears with monofilament gillnets to remove fish from the vywers. Catches were and still are dominated by hardersLiza richardsonii, but occasional large harvests of elf Pomatomus saltatrix, white musselcracker Sparodon ...

diversity | News

Science.gov (United States)

taken throughout their careers. Celebrating Women's History Month at Fermilab March 12, 2018 | Kathrine , Lidija Kokoska Dawn Staszak, Roza Doubnik. Photo: Leticia Shaddix The Women's Initiative is starting a physicist March 19, 2018 | Fermilab As a child, Kirsty Duffy learned about the smallest building blocks that

Geochemistry and oxygen isotope composition of main-group pallasites and olivine-rich clasts in mesosiderites

DEFF Research Database (Denmark)

Greenwood, Richard C.; Barrat, Jean-Alix; Scott, Edward R. D.

2015-01-01

origin. Although the Dawn mission did not detect mesosiderite-like material on Vesta, evidence linking the mesosiderites and HEDs includes: (i) theirnearly identical oxygen isotope compositions; (ii) the presence in both of coarse-grained Mg-rich olivines; (iii) both have synchronous Lu-Hf and Mn-Cr ages...

Pop / Lauri Tikerpe

Index Scriptorium Estoniae

Tikerpe, Lauri

2005-01-01

Heliplaatidest: Tahiti 80 "Fosbury", Shelton San "EP", Foo Fighters "In Your Honor", Yourcodenameis: Milo "Ignoto", Ol' Dirty Bastard "The Definitive Ol' Dirty Bastard Story", SI-CUT.DB "From Tears: Beach Archive", Ryan Adams & The Cardinals "Cold Roses", Dawn Of Gehenna "The Night Dog Sessions", Zeitkratzer "electroniX"

FNAL Discovers New Physics

Science.gov (United States)

Discovery It is the dawn of a new era in particle physics. Physicists have incorporated decades of barriers of energy, precision and intensity to explore new frontiers in particle physics. Physicists look physics. The Standard Model is the current framework for our understanding of matter. Activities The

Morphological indicators of a mascon beneath Ceres' largest crater, Kerwan

Science.gov (United States)

Bland, Michael T.; Ermakov, Anton; Raymond, Carol A.; Williams, David A.; Bowling, Tim J.; Preusker, F.; Park, Ryan S.; Marchi, Simone; Castillo-Rogez, Julie C.; Fu, R.R.; Russell, Christopher T.

2018-01-01

Gravity data of Ceres returned by the National Aeronautics and Space Administration's Dawn spacecraft is consistent with a lower density crust of variable thickness overlying a higher density mantle. Crustal thickness variations can affect the long‐term, postimpact modification of impact craters on Ceres. Here we show that the unusual morphology of the 280 km diameter crater Kerwan may result from viscous relaxation in an outer layer that thins substantially beneath the crater floor. We propose that such a structure is consistent with either impact‐induced uplift of the high‐density mantle beneath the crater or from volatile loss during the impact event. In either case, the subsurface structure inferred from the crater morphology is superisostatic, and the mass excess would result in a positive Bouguer anomaly beneath the crater, consistent with the highest‐degree gravity data from Dawn. Ceres joins the Moon, Mars, and Mercury in having basin‐associated gravity anomalies, although their origin may differ substantially.

The cat is out of the bag

KAUST Repository

Ananthanarayanan, Rajagopal

2009-01-01

In the quest for cognitive computing, we have built a massively parallel cortical simulator, C2, that incorporates a number of innovations in computation, memory, and communication. Using C2 on LLNL\\'s Dawn Blue Gene/P supercomputer with 147, 456 CPUs and 144 TB of main memory, we report two cortical simulations - at unprecedented scale - that effectively saturate the entire memory capacity and refresh it at least every simulated second. The first simulation consists of 1.6 billion neurons and 8.87 trillion synapses with experimentally-measured gray matter thalamocortical connectivity. The second simulation has 900 million neurons and 9 trillion synapses with probabilistic connectivity. We demonstrate nearly perfect weak scaling and attractive strong scaling. The simulations, which incorporate phenomenological spiking neurons, individual learning synapses, axonal delays, and dynamic synaptic channels, exceed the scale of the cat cortex, marking the dawn of a new era in the scale of cortical simulations. Copyright 2009 ACM.

Divergent Geophysical Evolution of Vesta and Ceres

Science.gov (United States)

Raymond, C. A.; Ermakov, A.; Castillo, J. C.; Fu, R. R.; McSween, H. Y., Jr.; McCord, T. B.; Park, R. S.; Russell, C. T.; De Sanctis, M. C.; Jaumann, R.; Konopliv, A. S.

2017-12-01

The Dawn mission explored two massive protoplanets in the main asteroid belt, Vesta and Ceres, that are fossils from the earliest epoch of solar system formation. Dawn's data provide evidence that these bodies formed very early, within the first few million years after CAIs, yet they followed divergent evolutionary paths. Vesta formed globally homogeneous distribution of minerals across the surface indicates that Ceres' interior experienced pervasive alteration. Topography and morphology of the surface reveals smoother, apparently resurfaced areas, generally at lower elevation, and rougher areas with greater relief. Local morphology such as crater floor deposits, isolated mountains, and enigmatic bright areas indicate recently active processes on Ceres, likely driven by brine cryovolcanism. Causes of the divergent evolution of these bodies include their accretionary environment, timing of accretion and size. Acknowledgements: Part of this research was carried out at the Jet Propulsion Laboratory, California Institute of Technology, under contract to the National Aeronautics and Space Administration.

Morphological Indicators of a Mascon Beneath Ceres's Largest Crater, Kerwan

Science.gov (United States)

Bland, M. T.; Ermakov, A. I.; Raymond, C. A.; Williams, D. A.; Bowling, T. J.; Preusker, F.; Park, R. S.; Marchi, S.; Castillo-Rogez, J. C.; Fu, R. R.; Russell, C. T.

2018-02-01

Gravity data of Ceres returned by the National Aeronautics and Space Administration's Dawn spacecraft is consistent with a lower density crust of variable thickness overlying a higher density mantle. Crustal thickness variations can affect the long-term, postimpact modification of impact craters on Ceres. Here we show that the unusual morphology of the 280 km diameter crater Kerwan may result from viscous relaxation in an outer layer that thins substantially beneath the crater floor. We propose that such a structure is consistent with either impact-induced uplift of the high-density mantle beneath the crater or from volatile loss during the impact event. In either case, the subsurface structure inferred from the crater morphology is superisostatic, and the mass excess would result in a positive Bouguer anomaly beneath the crater, consistent with the highest-degree gravity data from Dawn. Ceres joins the Moon, Mars, and Mercury in having basin-associated gravity anomalies, although their origin may differ substantially.

Evidence for the interior evolution of Ceres from geologic analysis of fractures

Science.gov (United States)

Scully, Jennifer E. C.; Buczkowski, Debra; Schmedemann, Nico; Raymond, Carol A.; Castillo-Rogez, Julie C.; Scott King,; Bland, Michael T.; Ermakov, Anton; O'Brien, D.P.; Marchi, S.; Longobardo, A.; Russell, C.T.; Fu, R.R.; Neveu, M.

2017-01-01

Ceres is the largest asteroid belt object, and the Dawn spacecraft observed Ceres since 2015. Dawn observed two morphologically distinct linear features on Ceres's surface: secondary crater chains and pit chains. Pit chains provide unique insights into Ceres's interior evolution. We interpret pit chains called the Samhain Catenae as the surface expression of subsurface fractures. Using the pit chains' spacings, we estimate that the localized thickness of Ceres's fractured, outer layer is approximately ≥58 km, at least ~14 km greater than the global average. We hypothesize that extensional stresses, induced by a region of upwelling material arising from convection/diapirism, formed the Samhain Catenae. We derive characteristics for this upwelling material, which can be used as constraints in future interior modeling studies. For example, its predicted location coincides with Hanami Planum, a high-elevation region with a negative residual gravity anomaly, which may be surficial evidence for this proposed region of upwelling material.

The response of pot plants to reduction of energy consumption peaks in greenhouses. [Heating]. Potteplanters reaktion paa udjaevning af energiforbrugs spidser i vaeksthuse

Energy Technology Data Exchange (ETDEWEB)

Jacobsen, L.H.; Adriansen, E.; Amsen, M.G.; Nielsen, O.F. (Danish Research Service for Plant and Soil Science, Research Centre for Horticulture, Dept. Hort. Engineering, Institute of Glasshouse Crops, Aarslev (DK))

1989-01-01

This experiment was started to avoid difficulties in energy supply, when big areas of greenhouses were connected to district heating. The aim of the experiment was to find ways to reduce energy consumption peaks at dawn and at dusk by means of simple techniques. This paper reports on the results of an experiment where five different pot plants were grown by a temperature control strategy based upon low day and high night room temperature set points (14 deg./22 deg. C) combined with reduced opening speed of the mixing valves. In general it may be concluded that it is possible to produce Chrysanthemum, Begonia, Kalanchoe, Hedera and Ficus with a temperature control strategy which reduces energy consumption peaks at dawn and at dusk without affecting the plant quality. However, it is necessary to apply growth retardants to Chrysanthemum and Kalanchoe to secure a good quality. The production time is reduced for Kalanchoe, increased for Chrysanthemum and Hedera and unchanged for Begonia and Ficus. (author).

The Collapse of Political Economy and the Advent of Unlearning Society

DEFF Research Database (Denmark)

Bouchet, Dominique

2014-01-01

Just like the Christian societies at the dawn of the science of political economy, today’s societies are face to face with the fact that their modes of organi¬sation and representation are inadequate when confronted with the consequences of their own, earlier, decisions. The economy and politics...

State Regulation of Heliport Design

Science.gov (United States)

2001-05-01

Arpt Lgt Sked: Dusk-Dawn 81. Schedule for beacon; if lights on different from beacon list as a remark. If no beacon list light schedule. 82. Unicorn ...continued importance of hospital heliports and the rapidly growing use of instrument approach/departure procedures at such sites, is it appropriate

Dendrohyrax arboreus

African Journals Online (AJOL)

with red paper to reduce glare, were automatically switched on at dusk and off at dawn. A minimum-maximum thermo- ... Eight categories of behaviour patterns were recognized: (i) Resting; lying in various positions within or .... Communication in the bat-eared fox Otocyon mega/otis. Symposium on Animal Communication, ...

Long-term health effects on the next generation of Ramadan fasting during pregnancy

NARCIS (Netherlands)

van Ewijk, R.

2009-01-01

Each year, many pregnant women fast from dawn to sunset during the Islamic holy month of Ramadan. Medical theory suggests that this may have negative long-term health effects on their offspring. Building upon the work of Almond and Mazumder (2008), and using Indonesian crosssectional data, I show

Journal of Astrophysics and Astronomy | Indian Academy of Sciences

Indian Academy of Sciences (India)

Home; Journals; Journal of Astrophysics and Astronomy. Rajesh Mondal. Articles written in Journal of Astrophysics and Astronomy. Volume 37 Issue 4 December 2016 pp 29 Review. Modelling the 21-cm Signal from the Epoch of Reionization and Cosmic Dawn · T. Roy Choudhury Kanan Datta Suman Majumdar ...

~YESTERYEAR")

African Journals Online (AJOL)

transitory port for the ships and men of the Royal. Navy who .... Tailors worked hard and fast in those demanding days ... Sea Point in the cold and dark to board the little ship lying in ... the awful truth dawn on me that I, a professional sailor, had ...

Frontiers in sustainable consumption research

DEFF Research Database (Denmark)

Reisch, Lucia A.; Cohen, Maurie J.; Thøgersen, John

2016-01-01

While the field of sustainable consumption research is relatively young, it has already attracted scholars from all corners of the social sciences. The time has come to identify a new research agenda as trends in sustainable consumption research seem to suggest the dawning of a new phase. Not only...

Journal of Astrophysics and Astronomy | Indian Academy of Sciences

Indian Academy of Sciences (India)

Home; Journals; Journal of Astrophysics and Astronomy. T. Roy Choudhury. Articles written in Journal of Astrophysics and Astronomy. Volume 37 Issue 4 December 2016 pp 27 Review. Probing Individual Sources during Reionization and Cosmic Dawn using Square Kilometre Array HI 21-cm Observations · Kanan K. Datta ...

Air & Space Power Journal (ASPJ). Volume 26, Number 6

Science.gov (United States)

2012-12-01

and Reconnaissance Col Matthew M. Hurley, USAF Thirty years ago, at the dawn of the digital age, the notion of a synthetic , virtual realm where human...amphetamines, a refined, high-value drug made domestically and having advantages over both marijuana (which requires space to grow and whose bulk