WorldWideScience

Sample records for seismogram 1-d generation

  1. Programming for seismogram 1-D generation, considering the attenuation and dispersing effects; Programa para gerar sismograma 1-D, considerando os efeitos da atenuacao e dispersao

    Rodrigues, Bruno de O.; Oliveira, Sergio A.M. de [Universidade Estadual do Norte Fluminense (UENF), Macae, RJ (Brazil). Lab. de Engenharia e Exploracao do Petroleo (LENEP)

    2004-07-01

    For a processing and an interpretation of correct seismic data, it is necessary to recognize and to know as the factors act that influence in the propagation of the seismic waves, as the attenuation and the dispersion, constituting in the biggest practical impediment for the use of seismic for targets the big depths, limiting the resolution of the method. However these phenomena little are taken in consideration in the analysis of the data, thus the necessity of its bigger agreement, because if attenuation and dispersion they confuse the application of the seismic, if convenient understood and measures, can be valuable sources of information about the constitution of the rocks. Therefore, in this work the effect of the attenuation and dispersion in the data of reflection seismic had been simulated on a program, in Mat-Lab. Being able to generate 1-D seismograms, in the domain of the time, considering the normal incidence of plain wave in a package of plain, horizontal and isotropic layers, taking in account the physical attributes of the way, being able to simulate the effects of ghost and of multiples of free surface, if considering the source in the water. (author)

  2. Generation of Vertically Incident Seismograms,

    1985-09-01

    p. 106, equation 3.38.) %lPHASE Flag: If set, Minimum- phase filter required; otherwise, Zero phase %ILNR Counter of model file input lines, used in... PHASE ) FILTER -TYPE DB SLOPE CUT-OFF FREQUENCY 1 72 70 2 72 30 4’ 4 GENERATION OF VERTICALLY INCIDENT SEISMOGRAMS VISP; PLOTS OF PARAMETERS TEST I...FILTER PHASE 1 (MINIMUM PHASE ) FILTER -TYPE DB SLOPE CUT-OFF FREQUENCY 1 96 50 2 96 10 Table 6. Input data used to test a high-cult filter with zero phase

  3. Streaming Seismograms into Earth-Science Classrooms

    Ammon, C. J.

    2011-12-01

    Seismograms are the fundamental observations upon which seismology is based; they are central to any course in seismology and important for any discussion of earthquake-related phenomena based on seismic observations. Advances in the collection and distribution of seismic data have made the use of research-quality seismograms in any network capable classroom feasible. The development of large, deep seismogram archives place an unprecedented quantity of high-quality data within reach of the modern classroom environment. I describe and discuss several computer tools and classroom activities that I use in introductory (general education) and advanced undergraduate courses that present near real-time research-quality seismic observations in the classroom. The Earth Motion Monitor Application (EMMA), is a MacOS application that presents a visually clear seismogram display that can be projected in classrooms with internet access. Seismic signals from thousands of station are available from the IRIS data center and the bandwidth can be tailored to the particular type of signal of interest (large event, low frequencies; small event, high frequencies). In introductory classes for non-science students, the near realtime display routinely shows magnitude 4.0-5.0 earthquake-generated signals, demonstrating to students the frequency of earthquake occurrence. Over the next few minutes as the waves travel through and across the planet, their arrival on the seismogram display provides some basic data for a qualitative estimate of the event's general location. When a major or great earthquake occurs, a broad-band display of signals from nearby stations can dramatically and dynamically illuminate the frequent activity associated with the aftershock sequence. Routine use of the display (while continuing the traditional classroom activities) provides students with a significant dose of seismogram study. Students generally find all the signals, including variations in seismic

  4. Generation of Multiband Chorus in the Earth's Magnetosphere: 1-D PIC Simulation

    Gao, Xinliang; Ke, Yangguang; Lu, Quanming; Chen, Lunjin; Wang, Shui

    2017-01-01

    Multiband chorus waves, where the frequency of upper band chorus is about twice that of lower band chorus, have recently been reported based on THEMIS observations. The generation of multiband chorus waves is attributed to the mechanism of lower band cascade, where upper band chorus is excited via the nonlinear coupling process between lower band chorus and the associated density mode with the frequency equal to that of lower band chorus. In this letter, with a one-dimensional (1-D) particle-in-cell (PIC) simulation model, we have successfully reproduced multiband chorus waves. During the simulation, the significant density fluctuation is driven by the fluctuating electric field along the wave vector of the pump wave (lower band chorus), which can be directly observed in this self-consistent plasma system. Then, the second harmonic of the pump whistler-mode wave (upper band chorus) is generated. After quantitatively analyzing resonant conditions among wave numbers, we can confirm that the generation is caused due to the coupling between the pump wave and the density fluctuation along its wave vector. The third harmonic can also be excited through lower band cascade if the pump whistler-mode wave has a sufficiently large amplitude. Our simulation results not only provide a theoretical support to the mechanism of lower band cascade to generate multiband chorus but also propose a new pattern of evolution for whistler-mode waves in the Earth's magnetosphere.

  5. A seismogram digitization and database management system

    2001-01-01

    This paper introduces a 2Seismogram Digitization and Database Management System2 (SDDMS), which is devel-oped using Delphi3, and present the key technique of automatically extracting wave data from paper seismograms. The system has various functions, such as paper seismogram digitization, database management and data analysis, etc. With this system it is possible to analyze historical paper seismograms using modern computers. Application of this system will be of help to the progress in earthquake prediction and seismological researches.

  6. From 1D to 3D: A new route to fabricate tridimensional structures via photo-generation of silver networks

    Wang, Zhanhua; Shen, Huaizhong; Wu, Yuxin; Fang, Liping; Ye, Shunsheng; Wang, Zhaoyi; Liu, Wendong; Cheng, Zhongkai; Zhang, Junhu; Yang, Bai

    2015-01-01

    A rapid and cost effective method has been developed to fabricate 3 dimensional (3D) ordered structures by photo-generating silver networks inside a 1D layered heterogeneous laminate composed of poly(vinyl alcohol) (PVA) and poly(methyl methacrylate) (PMMA). By designing the photo-mask meticulously,

  7. Parameter Analysis For A High-Gain Harmonic Generation FEL By Numerical Calculation Based On 1D Theory

    Li, Yuhui; Zhang, Shancai

    2004-01-01

    The high-gain harmonic generation (HGHG) free-electron laser (FEL) is an important candidate for a fourth-generation light source. Lots of theoretical work has been performed. Recently a further 1D theory about HGHG FEL has been developed. It considers the effects of different parameters for the whole process. An initial program based on this theory has been made. In this paper, a brief comparison of the results from this 1D program and from TDA (3D code) is discussed. It also analyses the parameters for Shanghai deep ultra violate free-electron laser source (SDUV-FEL), including electron beam energy spread, seed laser power, strength of dispersion section etc.

  8. Review of Methods for Generating Synthetic Seismograms,

    1985-06-01

    range A is the angular separation between source and receiver positions measured fromm the center of the earth (horizontal range at the surface is x...into the region of interest. Boore (1972) recommends that num- erical experiments using different distances to the imposed boundaries be done in order

  9. Bloch oscillations as generators of polarons in a 1D crystal

    Nazareno, H.N. [International Center for Condensed Matter Physics, Universidade de Brasília, P.O. Box 04513, 70910-900 Brasília, DF (Brazil); Brito, P.E. de, E-mail: pedebrito@unb.br [Universidade de Brasília, PPG-CIMA, Campus Planaltina, 73345-010 Brasília, DF (Brazil)

    2016-08-01

    The main purpose of this work is to characterize the kind of propagation/localization of carriers in a one-dimensional crystalline structure along the tight-binding model while the electron–phonon interaction is taken into account through a deformation potential and the system is under the action of a dc electric field. The lattice was treated in the classical formalism of harmonic vibrations. A remarkable effect is obtained due to the presence of the electric field. On one side the particle performs Bloch oscillations and at the same time it interacts with the lattice and as a result at each turning point of its trajectory phonons are generated that carry with them a fraction of the electronic wave packet, it is the polaron formation. This way the Bloch oscillations pump polarons into the system. We explain why the polaron is formed at returning points of the oscillations.

  10. A new program on digitizing analog seismograms

    Wang, Maofa; Jiang, Qigang; Liu, Qingjie; Huang, Meng

    2016-08-01

    Historical seismograms contain a great variety of useful information which can be used in the study of earthquakes. It is necessary for researchers to digitize analog records and extract the information just as modern computing analysis requires. Firstly, an algorithm based on color scene filed method is presented in order to digitize analog seismograms. Secondly, an interactive software program using C# has been developed to digitize seismogram traces from raster files quickly and accurately. The program can deal with gray-scale images stored in a suitable file format and it offers two different methods: manual digitization and automatic digitization. The test result of the program shows that the methods presented in this paper can lead to good performance.

  11. Research on anisotropic parameters by synthetic seismogram

    FAN Xiao-ping; LI Qing-he; YANG Cong-jie

    2005-01-01

    ased on the extensive-dilatancy anisotropy theory, the method of synthetic seismogram is used to estimate the anisotropic parameters. The advantages of the method lie in that it avoids the singularity resolution and saves calculation time of computer by using the eigenvalue and eigenvector analytical expressions of Christoffel equation, at the same time, the result is tested by coherence function. The test result reveals there exists a fine linear relation between original records and synthetic records, indicating the anisotropic parameters estimated by synthetic seismogram can reflect and describe the anisotropic characteristics of the given region medium.

  12. CAV_KO: a Simple 1-D Langrangian Hydrocode for MS EXCEL™ with Automatic Generation of X-T Diagrams

    Tsembelis, K.; Ramsden, B.; Proud, W. G.; Borg, J.

    2007-12-01

    Hydrocodes are widely used to predict or simulate highly dynamic and transient events such as blast and impact. Codes such as GRIM, CTH or AUTODYN are well developed and involve complex numerical methods and in many cases require a large computing infrastructure. In this paper we present a simple 1-D Langrangian hydrocode developed at the University of Cambridge, called CAV_KO written in Visual Basic. The motivation being to produce a code which, while being relatively simple, is useful for both experimental planning and teaching. The code has been adapted from the original KO code written in FORTRAN by J. Borg, which, in turn, is based on the algorithm developed by Wilkins [1]. The developed GUI within MS Excel™ and the automatic generation of x-t diagrams allow CAV_KO to be a useful tool for quick calculations of plate impact events and teaching purposes. The VB code is licensed under the GNU General Public License and a MS Excel™ spreadsheet containing the code can be downloaded from www.shockphysics.com together with a copy of the user guide.

  13. A Multi­Discipline Approach to Digitizing Historic Seismograms

    Bartlett, Andrew [Retriever Technology, Sante Fe, NM (United States)

    2016-04-07

    Retriever Technology has developed and has made available free of charge a seismogram digitization software package called SKATE (Seismogram Kit for Automatic Trace Extraction). We have developed an extensive set of algorithms that process seismogram image files, provide editing tools, and output time series data. The software is available online and free of charge at seismo.redfish.com. To demonstrate the speed and cost effectiveness of the software, we have processed over 30,000 images.

  14. Seismogram Construction to Fit the Recorded B032593c Earthquake, Japan on Observation Station Bfo, Germany

    Bagus Jaya Santosa

    2005-04-01

    Full Text Available In this research the model of earth layers between earthquake's epicenter in Hokkaido Japan and observation station in Black Forest of Observatory (BFO, Germany is investigated. The earth model is 1-D that represents the average speed model. The earth model is obtained by seismogram comparison between data and synthetic seismogram in time domain and three components simultaneously. Synthetic Seismogram is calculated with the Green's function of the Earth by MINor Integration (GEMINI program, where program's input is initially the earth model IASPEI91, PREMAN and also the Centroid Moment Tensor (CMT solution of the earthquake. A Butterworth low-pass filter with corner frequency of 20 mHz is imposed to measured and synthetic seismogram. On seismogram comparison we can find unsystematic discrepancies, covering the travel time and waveform of all wave phases, namely on P, S, SS wave and surface wave of Rayleigh and Love. Solution to the above mentioned discrepancies needs correction to the earth structure, that covering the change of earth crust thickness, the gradient of βh and value of zero order coefficient in βh and βv in upper mantle, to get the fitting on the surface wave of Love and Rayleigh. Further correction to accomplish the discrepancies on body waves is conducted on layers beneath upper mantle down to depth of 630 km, where a little change at speed model of P and S wave is carried out. The number of oscillation amount especially on Love wave is influenced by earth crust depth earth. Good fitting is obtained at phase and amplitude of Love wave, but also at amplitude of some body wave too. This effect is not yet been exploited for the determination of moment tensor.

  15. Fully digital 1-D, 2-D and 3-D multiscroll chaos as hardware pseudo random number generators

    Mansingka, Abhinav S.

    2012-10-07

    This paper introduces the first fully digital implementation of 1-D, 2-D and 3-D multiscroll chaos using the sawtooth nonlinearity in a 3rd order ODE with the Euler approximation. Systems indicate chaotic behaviour through phase space boundedness and positive Lyapunov exponent. Low-significance bits form a PRNG and pass all tests in the NIST SP. 800-22 suite without post-processing. Real-time control of the number of scrolls allows distinct output streams with 2-D and 3-D multiscroll chaos enabling greater controllability. The proposed PRNGs are experimentally verified on a Xilinx Virtex 4 FPGA with logic utilization less than 1.25%, throughput up to 5.25 Gbits/s and up to 512 distinct output streams with low cross-correlation.

  16. Development of a 1D thermal-hydraulic analysis code for once-through steam generator in SMRs using straight tubes

    Park, Youngjae; Kim, Iljin; Kim, Hyungdae [Kyung Hee University, Yongin (Korea, Republic of)

    2015-10-15

    Diverse integral/small-modular reactors (SMRs) have been developed. Once-through steam generator (OTSG) which generates superheated steam without steam separator and dryer was used in the SMRs to reduce volume of steam generator. It would be possible to design a new steam generator with best estimate thermal-hydraulic codes such as RELAP and MARS. However, it is not convenience to use the general purpose thermal-hydraulic analysis code to design a specific component of nuclear power plants. A widely used simulation tool for thermal-hydraulic analysis of drum-type steam generators is ATHOS, which allows 3D analysis. On the other hand, a simple 1D thermal-hydraulic analysis code might be accurate enough for the conceptual design of OTSG. In this study, thermal-hydraulic analysis code for conceptual design of OTSG was developed using 1D homogeneous equilibrium model (HEM). A benchmark calculation was also conducted to verify and validate the prediction accuracy of the developed code by comparing with the analysis results with MARS. Finally, conceptual design of OTSG was conducted by the developed code. A simple 1D thermal-hydraulic analysis code was developed for the purpose of conceptual design OTSG for SMRs. A set of benchmark calculations was conducted to verify and validate the analysis accuracy of the developed code by comparing results obtained with a best-estimated thermal-hydraulic analysis code, MARS. Finally, analysis of two different OTSG design concepts with superheating and recirculation was demonstrated using the developed code.

  17. Digitization of Nuclear Explosion Seismograms from the Former Soviet Union

    2015-03-30

    AFRL-RV-PS- AFRL-RV-PS- TR-2015-0089 TR-2015-0089 DIGITIZATION OF NUCLEAR EXPLOSION SEISMOGRAMS FROM THE FORMER SOVIET UNION Paul G. Richards...2014 4. TITLE AND SUBTITLE Digitization of Nuclear Explosion Seismograms from the Former Soviet Union 5a. CONTRACT NUMBER FA9453-12-C-0206 5b...These signals, including thousands recorded at regional distances from nuclear explosions in Eurasia, have been scanned, digitized , and

  18. Seismogram Analysis of Indonesian Earthquakes at DAV Observation Station

    Bagus Jaya Santosa

    2009-01-01

    The S-wave velocity across the earth structure under Indonesia for Indonesia earthquakes has been investigated through seismogram analysis, simultaneously in the time domain and three Cartesian components. The data were recorded at DAV observational station, the Philippines. The main data set is the seismogram comparison between the measured and synthetic seismogram, instead of travel time data, as commonly used in other seismological research. The synthetic seismogram is calculated using the GEMINI method, which is equivalent to Mode Summation.The above seismogram comparison shows that the global earth mantle of PREMAN gives a deviating synthetic seismogram and has earlier arrival times than those of the measurement. The gradient of βh in the upper mantle layers is altered into a positive, rather than negative slope as stated in the PREMAN model, and negative corrections are imposed to the zero order of the polynomial's coefficients in all earth mantle layers. The excellent fitting, as well as travel time or waveform, is obtained from the surface waves of Love and Rayleigh, surface wave to the S and SS mantle waves as well as the core reflected waves.This result expresses that part of the earth mantle, due to a collision between India and Asia tectonic released zones, has a negative anomaly in S-wave velocity and vertical anisotropy in all of the earth mantle layers.

  19. Digitized Database of Old Seismograms Recorder in Romania

    Paulescu Daniel

    2016-08-01

    Full Text Available The aim of this paper is to describe a managing system for a unique Romanian database of historical seismograms and complementary documentation (metadata and its dissemination and analysis procedure. For this study, 5188 historical seismograms recorded between 1903 and 1957 by the Romanian seismological observatories (Bucharest-Filaret, Focşani, Bacău, Vrincioaia, Câmpulung-Muscel, Iaşi were used. In order to reconsider the historical instrumental data, the analog seismograms are converted to digital images and digital waveforms (digitization/vectorialisation. First, we applied a careful scanning procedure of the seismograms and related material (seismic bulletins, station books, etc.. In a next step, the high resolution scanned seismograms will be processed to obtain the digital/numeric waveforms. We used a Colortrac Smartlf Cx40 scanner which provides images in TIFF or JPG format. For digitization the algorithm Teseo2 developed by the National Institute of Geophysics and Volcanology in Rome (Italy, within the framework of the SISMOS Project, will be used.

  20. Digitized Database of Old Seismograms Recorder in Romania

    Paulescu, Daniel; Rogozea, Maria; Popa, Mihaela; Radulian, Mircea

    2016-08-01

    The aim of this paper is to describe a managing system for a unique Romanian database of historical seismograms and complementary documentation (metadata) and its dissemination and analysis procedure. For this study, 5188 historical seismograms recorded between 1903 and 1957 by the Romanian seismological observatories (Bucharest-Filaret, Focşani, Bacău, Vrincioaia, Câmpulung-Muscel, Iaşi) were used. In order to reconsider the historical instrumental data, the analog seismograms are converted to digital images and digital waveforms (digitization/ vectorialisation). First, we applied a careful scanning procedure of the seismograms and related material (seismic bulletins, station books, etc.). In a next step, the high resolution scanned seismograms will be processed to obtain the digital/numeric waveforms. We used a Colortrac Smartlf Cx40 scanner which provides images in TIFF or JPG format. For digitization the algorithm Teseo2 developed by the National Institute of Geophysics and Volcanology in Rome (Italy), within the framework of the SISMOS Project, will be used.

  1. A hybrid method for the computation of quasi-3D seismograms.

    Masson, Yder; Romanowicz, Barbara

    2013-04-01

    The development of powerful computer clusters and efficient numerical computation methods, such as the Spectral Element Method (SEM) made possible the computation of seismic wave propagation in a heterogeneous 3D earth. However, the cost of theses computations is still problematic for global scale tomography that requires hundreds of such simulations. Part of the ongoing research effort is dedicated to the development of faster modeling methods based on the spectral element method. Capdeville et al. (2002) proposed to couple SEM simulations with normal modes calculation (C-SEM). Nissen-Meyer et al. (2007) used 2D SEM simulations to compute 3D seismograms in a 1D earth model. Thanks to these developments, and for the first time, Lekic et al. (2011) developed a 3D global model of the upper mantle using SEM simulations. At the local and continental scale, adjoint tomography that is using a lot of SEM simulation can be implemented on current computers (Tape, Liu et al. 2009). Due to their smaller size, these models offer higher resolution. They provide us with images of the crust and the upper part of the mantle. In an attempt to teleport such local adjoint tomographic inversions into the deep earth, we are developing a hybrid method where SEM computation are limited to a region of interest within the earth. That region can have an arbitrary shape and size. Outside this region, the seismic wavefield is extrapolated to obtain synthetic data at the Earth's surface. A key feature of the method is the use of a time reversal mirror to inject the wavefield induced by distant seismic source into the region of interest (Robertsson and Chapman 2000). We compute synthetic seismograms as follow: Inside the region of interest, we are using regional spectral element software RegSEM to compute wave propagation in 3D. Outside this region, the wavefield is extrapolated to the surface by convolution with the Green's functions from the mirror to the seismic stations. For now, these

  2. On the recovery and analysis of historical seismograms

    Barbara Palombo

    2013-08-01

    Full Text Available The analysis of historical seismograms has proven to be a fundamental tool to help with the definition of the seismic risk in specific regions. Indeed, modern quantitative reappraisal of relevant earthquakes that occurred before the 1960’s; i.e., prior to both the developments of modern recording instruments and the theoretical progress, has been essential for the assessment of the seismic potential of a source area. However, due to the characteristics (transducing and recording of the old analog seismographs, the data available are affected by intrinsic uncertainties, and errors can be introduced during the processing of waveform digitization. These drawbacks can seriously influence the quality and reliability of an investigation. In general, no standard technique can be applied when dealing with historical seismograms. Thus, specific tests and cross-checks have to be designed to estimate the limits of each specific analysis. Here, we aim to provide an overview of the whole procedure while focusing on the most crucial steps, from the seismogram recovery to the application of modern techniques for the retrieval of the seismic source information. We also suggest possible checks for the robustness of the data and for the available instrument characteristics, with a description of the effects of various uncertainties on the results that can be obtained. We thus provide useful indications for the analysis of historical seismograms, and also for the correct interpretation of the resulting characteristics of the seismic source.

  3. Wavelet analysis of the seismograms for tsunami warning

    A. Chamoli

    2010-10-01

    Full Text Available The complexity in the tsunami phenomenon makes the available warning systems not much effective in the practical situations. The problem arises due to the time lapsed in the data transfer, processing and modeling. The modeling and simulation needs the input fault geometry and mechanism of the earthquake. The estimation of these parameters and other aprior information increases the utilized time for making any warning. Here, the wavelet analysis is used to identify the tsunamigenesis of an earthquake. The frequency content of the seismogram in time scale domain is examined using wavelet transform. The energy content in high frequencies is calculated and gives a threshold for tsunami warnings. Only first few minutes of the seismograms of the earthquake events are used for quick estimation. The results for the earthquake events of Andaman Sumatra region and other historic events are promising.

  4. S-Wave Velocity Structure beneath Southwest North America from Seismogram Comparisons of the Mexico Earthquake on 22 June 1997

    Bagus Jaya Santosa

    2008-09-01

    Full Text Available This research investigates earth structure beneath the Southwest North America landmass, especially between Mexico and California. Models based on S wave velocities for this area were obtained by carrying out seismogram fitting in time domain and three Cartesian components simultaneously. The data used is from an event, coded as C052297B that occurred in the state of Guerrero, Mexico and it was fitted to synthetic data computed with the GEMINI program at TS network stations. Earth model IASPEI91 and SPREM were used as input to create the synthetic data. Real and synthetic seismograms were subjected to a low-pass filter with a frequency corner of 20 mHz.Waveform analysis results show very unsystematic and strong deviations in the waveform, arrival times, amount of oscillation and the height of the wave amplitude. Discrepancies are met on S, Love, Rayleigh and ScS waves, where the stations epicentral distances are below 300. Deviation in analysis waveform because of the usage of model 1-D of SPREM and IASPEI91, because the 1-D was a kind of average value an elastic property at one particular depth of global earth. With the method of waveform analysis we can see how sensitive waveform is to structures within the layers of the Earth.To explain the discrepancies, a correction to the earth structure is essential. The corrections account for the thickness of the crust, speed gradient of bh, the coefficient for the bh and bv in the upper mantle for surface wave fitting, a small variation of the S speed structure at a layer under the upper mantle above 771 km for S wave fitting, and a small variation at the base the mantle layers for ScS wave fitting. At some stations, a correction for S speed structure have yielded P wave fitting. Results of this research indicate that the 1-D earth model obtained through seismogram fitting at every hypocenter-observation station pair is unique. The S-wave velocity on the upper mantle has strong negative anomalies. This

  5. Syngine: On-Demand Synthetic Seismograms from the IRIS DMC based on AxiSEM & Instaseis

    van Driel, Martin; Hutko, Alex; Krischer, Lion; Trabant, Chad; Stähler, Simon; Nissen-Meyer, Tarje

    2016-04-01

    complete, new database, and this overall idea can thus be extended and applied quite easily to any choice of 1D model. AxiSEM is currently being extended to include local, regional and continental scale wave propagation such that regional databases (e.g. Europe or North America) are easily feasible at even higher frequencies. The enhancements resulting from the evolution of AxiSEM will be evaluated for use in Syngine and offered by IRIS as resources allow.

  6. SEISMOGRAM ANALYSIS OF EARTHQUAKES IN SUMATRA-JAVA AT HYB OBSERVATORY STATION

    B.J. B.J. Santosa

    2012-12-01

    Full Text Available Dalam penelitian ini struktur bumi di bawah lempeng Lautan Hindia Timur Laut dikaji melalui analisis seismogram atas seismogram gempa-gempa bumi yang terjadi di Sumatra dan direkam di stasiun observasi HYB, India. Analisis seismogram dilaksanakan dalam domain waktu dan ketiga komponen-komponen Kartesian secara simultan. Perbandingan seismogram menunjukkan bahwa model bumi global PREM memberikan seismogram sintetik yang menyimpang dari seismogram terukur dan waktu tiba gelombang S yang lebih lambat dibandingkan waktu tiba terukur. Untuk mencapai pencocokan seismogram, gradient βh di upper mantle diubah dari positif menjadi negative, sebagaimana dinyatakan dalam model bumi PREMAN, dan koreksi kecepatan positif ditambahkan pada koefisien-koefisien kecepatan orde nol pada struktur kecepatan S dalam semua lapisan mantel bumi. Pengepasan yang bagus dicapai pada gelombang ruang S, gelombang permukaan Love dan Rayleigh, begitu juga dengan gelombang terpantul inti bumi ScS dan ScS2.In this research, the earth structure beneath North East Indian Ocean plates is investigated using waveform analysis of Sumatra’s earthquakes recorded in HYB station. Seismogram analysis was conducted in the time domain and three Cartesians components simultaneously. The seismogram comparison shows that the global earth mantle of PREM provides deviating synthetic seismogram and has later arrival times than those from the measurement. To achieve the seismogram fitting, the gradient βh in the upper mantle layers was altered to positive from its negative slope as stated in the PREM model, and positive corrections are added to the zero order of polynomials coefficients of S velocity structure in all earth mantle layers. The excellent fitting, as well as travel time and waveform, were achieved on the S wave, Love and Rayleigh surface waves, as well as the ScS and ScS2 core reflected waves.

  7. Imaging source process of earthquakes from back-projection of high frequency seismograms

    Pulido, N.

    2007-12-01

    Standard methodologies for calculation of the earthquakes source process, are based on inversion procedures which require the calculation of complete source-stations Greens functions. On the other hand alternative procedures have been developed in order to directly retrieve an image of the rupture process from high frequency seismograms (Spudich et. al. 1984, Kao and Shan 2004, Ishii et. al. 2005). In this study we extend the Isochron- Backprojection methodology (Festa et al., 2006), to image the source process of earthquakes, by incorporating the use of high frequency seismograms around the source area. We take full advantage of the dense strong motion networks available in Japan to model the source process of recent Japanese earthquakes. The IBM method differs from conventional earthquake source inversion approaches, in that the calculation of Green's functions is not required. The idea of the procedure is to directly back-project amplitudes of seismograms envelopes around the source into a space image of the earthquake rupture (Pulido et al. 2007). The method requires the calculation of theoretical travel times between a set of grids points distributed across the fault plane, and every station. For this purpose and for simplicity we assume a multi-layered 1D model. All travel times are adjusted by a station correction factor, calculated by taking the difference between observed and theoretical travel times at each station. Next we calculate the rupture time of every grid within the fault plane by assuming some arbitrary constant rupture velocity value, and obtain the isochrones distribution across the fault plane by adding subfaults rupture times and the corresponding travel times for every station. We select waveforms that have clear P and S wavelets, which means stations located approximately between 40 km and 100km from the epicenter. We extract P-wave windows between the origin time of the earthquake and the theoretical arrival of the S-wave, and taper 1s of

  8. Simultaneous inversion of layered compressional velocity and shear velocity by using plane wave seismogram

    宋海斌; 马在田; 张关泉

    1996-01-01

    A layer-stripping method is presented for simultaneous inversion of compressional velocity and shear velocity in layered medium from single precritical-incident-angle data of P-P and P-SV plane wave seismogram. A finite bandwidth algorithm is provided and results obviously better than previous research work are obtained by the numerical experiments for band-limited seismogram and synthetic data including noise.

  9. Local Effects on Strain Seismogram at Matsushiro Seismological Observatory - 1. Love Waves

    Taishi Okamoto

    2007-01-01

    Full Text Available We proposed a simple method to evaluate local effects on a strain seismogram, and applied the method to investigation of the effects at Matsushiro Seismological Observatory, Japan Meteorological Agency, central Japan, for a Love wave in a period range of 170 - 400 sec. First, we took a ratio of EW to NS component strain for a Love wave on a timefrequency plane. Although NS and EW component strain for a Love wave travelling in any direction have the same amplitude theoretically, the ratio of observed EW to NS component strain was 0.7. Next, we compared the strain seismogram with a velocity seismogram recorded with STS-1 broadband seismometer. A ratio of a partial derivative of a displacement field with respect to time to that with respect to wave propagation direction equals a phase velocity of the wave theoretically. Utilizing the fact, we estimated the phase velocity of a Love wave using the observed velocity and strain seismogram, after NS component strain had been multiplied by 0.7. The result was 24% smaller than the theoretical phase velocity. Finally, we compared the velocity seismogram with other velocity seismograms recorded by STS-1 seismometers at F-net observation stations near Matsushiro and by STS-2 seismometer at Matsushiro, and found that the every deviation from Matsushiro was less than 10%. From these results, we conclude that the EW and NS component strain seismograms have been amplified by factors of 1.32 and 1.88 for a Love wave, respectively. This fact, which may be because of local geology and/or topography effects, must be taken into account when the strain seismogram is used for seismological applications such as the CMT inversion and research on earth¡¦s free oscillations.

  10. Local Effects on Strain Seismograms at Matsushiro Seismological Observatory - 2. Rayleigh Waves

    Taishi Okamoto

    2007-01-01

    Full Text Available We evaluate local effects on strain seismograms for a Rayleigh wave observed at Matsushiro Seismological Observatory, Japan Meteorological Agency, central Japan, by applying a method proposed in a previous report (Okamoto et al. 2007. The method involves examination of polarization angles, local phase velocity, and accuracy of velocity seismograms. The results are as follows: 1 Polarization angles of observed strain seismograms agree with expected ones from those of velocity seismograms also observed at Matsushiro; 2 Local phase velocity estimated by comparison between strain and velocity seismograms is 54% larger than the theoretical value calculated from the PREM velocity model; 3 Velocity spectra observed at Matsushiro have almost the same amplitude as an average of those at F-net observation stations near Matsushiro. These results indicate that both EW and NS component strain seismograms observed at Matsushiro have been reduced by 35% in amplitude for a Rayleigh wave due to local heterogeneity. The local effects on a Rayleigh wave are quite different from that on a Love wave obtained in the previous report.

  11. Seismogram Analysis of C052198B Earthquake, Minahasa at Observatory Stations in Australia

    Bagus Jaya Santosa

    2012-03-01

    Full Text Available The earth structure between the Minahasa earthquake, coded as C052198B, and observatory stations in Australia has been investigated through analysis in the time domain of three-component seismograms. The synthetic seismograms are constructed from an earth model, the CMT solution of the earthquake and station locations. The calculation is based on the GEMINI method, and the corner frequency is set at 20 mHz. Using deconvolutions of the station instruments responses, the measured and synthetic seismogram can be compared with the same units. The seismogram comparison indicates discre-pancies between recorded data and synthetic seismograms calculated from the anisotropic PREM model, in the travel times of Rayleigh and Love surface wave, as well as the S and core reflected ScS and ScS2 body waves. Discrepancies of Love wave travel time and the number of oscillations are explained by changes in the crustal velocity model and by setting the positive gradient of h in the upper mantle. While for Rayleigh waves and arrival times of body waves, corrections to the zero order coefficients of  are needed at layers in the mantle. The interpretation of the results of the waveform analyses indicates strong anisotropy in the upper mantle. The anisotropy also occurs, to a lesser extent, at layers beneath the upper mantle.

  12. Ray synthetic seismograms: a useful tool in the International Data Center environment

    P. Firbas

    1994-06-01

    Full Text Available In this paper some of the results of a feasibility study on ray synthetic seismograms usage are reported. A computational method, ways of composing synthetic traces, an application of the source wavelet and the radiation pattern and integration of such an approach into the Center for Seismic Studies (CSS revision 3.0 structure are outlined. Further on, results obtained for model examples, nuclear explosions, and earthquakes are presented. Conclusions of the undertaken feasibility study help to understand that ray synthetic seismograms represent a very fast tool (results in “no time” and simultaneously represent a complex tool with all needed features. The ray synthetic seismograms can be implemented in various ways: to be computed automatically and used within the Intelligent Monitoring System, to be computed automatically and provided to the analyst, to provide a database of master events, to be computed interactively by an analyst during routine daily analysis.

  13. Source mechanisms and near-source wave propagation from broadband seismograms

    J. Perrot

    1994-06-01

    Full Text Available Recording seismic events at teleseismic distances with broadband and high dynamic range instruments provides new high-quality data that allow us to interpret in more detail the complexity of seismic rupture as well as the heterogeneous structure of the medium surrounding the source where waves are initially propagating. Wave propagation analysis is performed by ray tracing in a local cartesian coordinate system near the source and in a global spherical coordinate system when waves enter the mantle. Seismograms are constructed at each station for a propagation in a 2.5-D medium. Many phases can be included and separately analyzed; this is one of the major advantages of ray tracing compared to other wave propagation techniques. We have studied four earthquakes, the 1988 Spitak Armenia Earthquake (Ms = 6.9, the 1990 Iran earthquake (Ms = 7.7, the 1990 romanian earthquake (Ms = 5.8 and the 1992 Erzincan, Turkey earthquake (Ms = 6.8. These earthquakes exhibit in different ways the complexity of the rupture and the signature of the medium surrounding the source. The use of velocity seismograms, the time derivative of displacement, increases the difficulty of the fit between synthetic seismograms and real seismograms but provides clear evidence for a need of careful time delay estimations of the different converted phases. We find that understanding of the seismic rupture as well as the influence of the medium surrounding the source for teleseismically recorded earthquakes requires a multi-stop procedure: starting with ground displacement seismograms, one is able to give a first description of the rupture as well as of the first-order influence of the medium. Then, considering the ground velocity seismograms makes the fit more difficult to obtain but increases our sensitivity to the rupture process and early converted phases. With increasing number of worldwide broadband stations, a complex rupture description is possible independently of field

  14. Generation of stable 'low phytic acid' transgenic rice through antisense repression of the 1D-myo-inositol 3-phosphate synthase gene (RINO1) using the 18-kDa oleosin promoter.

    Kuwano, Mio; Mimura, Tetsuro; Takaiwa, Fumio; Yoshida, Kaoru T

    2009-01-01

    Phytic acid acts as the major storage form of phosphorus in plant seeds and is poorly digested by monogastric animals. The degradation of phytic acid in animal diets is necessary to overcome both environmental and nutritional issues. The enzyme 1D-myo-inositol 3-phosphate [Ins(3)P(1)] synthase (EC 5.5.1.4) catalyses the first step of myo-inositol biosynthesis and directs phytic acid biosynthesis in seeds. The rice Ins(3)P(1) synthase gene (RINO1) is highly expressed in developing seed embryos and in the aleurone layer, where phytic acid is synthesized and stored. In rice seeds, 18-kDa oleosin (Ole18) is expressed in a seed-specific manner, and its transcripts are restricted to the embryo and the aleurone layer. Therefore, to effectively suppress phytic acid biosynthesis, antisense RINO1 cDNA was expressed under the control of the Ole18 promoter, directing the same spatial pattern in seeds as RINO1 in transgenic rice plants. The generated transgenic rice plants showed strong 'low phytic acid' (lpa) phenotypes, in which seed phytic acid was reduced by 68% and free available phosphate was concomitantly increased. No negative effects on seed weight, germination or plant growth were observed. The available phosphate levels of the stable transgenic plants surpassed those of currently available rice lpa mutants.

  15. Synthetic seismograms of ground motion near earthquake fault using simulated Green's function method

    ZHAO Zhixin; ZHAO Zhao; XU Jiren; Ryuji Kubota

    2006-01-01

    Seismograms near source fault were synthesized using the hybrid empirical Green's function method where he discretely simulated seismic waveforms are used for Green's functions instead of the observed waveforms of small earthquakes. The Green's function seismic waveforms for small earthquake were calculated by solving wave equation using the pseudo-spectral method with the staggered grid real FFT strategy under a detailed 2-D velocity structure in Kobe region. Magnitude and seismic moment of simulated Green's function waveforms were firstly determined by using the relationship between fault length and corner frequency of source spectrum. The simulated Green's function waveforms were employed to synthesize seismograms of strong ground motion near the earthquake fault. The synthetic seismograms of the target earthquake were performed based on the model with multiple source rupture processes. The results suggest that synthesized seismograms coincide well with observed seismic waveforms of the 1995 Hyogo-ken Nanbu earthquake. The simulated Green's function method is very useful for prediction of the strong ground motion in region without observed seismic waveforms.The present technique spreads application field of the empirical Green's function method.

  16. Study on the Method for Obtaining Acceleration Waveform Records from Velocity Type Seismograms of the Digital Seismograph Network

    Yao Lanyu; Nie Yongan; Zhao Jinghua; Bian Zhenfu

    2004-01-01

    The authors proposed a method for obtaining high-quality acceleration seismograms from velocity type seismograms of digital Seismographic network, and took as an example the analysis and processing of the seismograms of a same earthquake that was simultaneously recorded by velocity seismograph CTS1-EDAS24 and strong motion seismograph EST-Q4128installed in Jixian Station, Tianjin. The calculation steps and the processing method have been discussed in detail. From the analysis and the comparison of the obtained results, it is concluded that the proposed method is simple and effective, and it broadens the application of digital seismographic network.

  17. Seismic moment of the 1891 Nobi, Japan, earthquake estimated from historical seismograms

    Fukuyama, E.; Muramatu, I.; Mikumo, T.

    2007-06-01

    The seismic moment of the 1891 Nobi, Japan, earthquake has been evaluated from the historical seismogram recorded at the Central Meteorological Observatory in Tokyo. For this purpose, synthetic seismograms from point and finite source models with various fault parameters have been calculated by a discrete wave-number method, incorporating the instrumental response of the Gray-Milne-Ewing seismograph, and then compared with the original records. Our estimate of the seismic moment (Mo) is 1.8 × 1020 N m corresponding to a moment magnitude (Mw) 7.5. This is significantly smaller than the previous estimates from the distribution of damage, but is consistent with that inferred from geological field survey (Matsuda, 1974) of the surface faults.

  18. The damping of seismic waves and its determination from reflection seismograms

    Engelhard, L.

    1979-01-01

    The damping in theoretical waveforms is described phenomenologically and a classification is proposed. A method for studying the Earth's crust was developed which includes this damping as derived from reflection seismograms. Seismic wave propagation by absorption, attenuation of seismic waves by scattering, and dispersion relations are considered. Absorption of seismic waves within the Earth as well as reflection and transmission of elastic waves seen through boundary layer absorption are also discussed.

  19. Develop an X-Windows Tool to Compute Gaussian Beam Synthetic Seismograms

    2007-11-02

    through the medium. A second module, called GBseis, reads the raytracing results created by Xgb and computes synthetic seismograms according to...allow raytracing results and velocity models to be stored within an Oracle database like that which exists within the software environment at the...Figure 1 the position of two receivers at x=4000 and x=4200 km respectively can just be seen. The results of dynamic raytracing have been preserved

  20. Identification method of seismic phase in three-component seismograms on the basis of wavelet transform

    2000-01-01

    This paper puts forward wavelet transform method to identify P and S phases in three component seismograms using polarization information contained in the wavelet transform coefficients of signal. The P and S wave locator functions are constructed by using eigenvalue analysis method to wavelet transform coefficient across several scales. Locator functions formed by wavelet transform have stated noise resistance capability, and is proved to be very effective in identifying the P and S arrivals of the test data and actual earthquake data.

  1. Digital Filming of the Seismograms Held in the Jakarta Archives: A Pilot Program

    Okal, E. A.; Kirby, S. H.

    2014-12-01

    Because of the long duration of most seismic cycles with respect to thehistory of seismological instrumentation,seismograms from the first half of the 20th century constitute an invaluableresource, allowing significant constraints on the regional chronologyof earthquake occurrence as well as the modern quantification of their sizethrough the calculation of seismic moments. This is especially true in theSouthern hemisphere which hosted few seismic stations before the 1930s. In this context, the preservation of seismograms in a digital format allowing their seamless exchange is an important challenge to the scientific community. Under funding from the Earth Observatory of Singapore, we initiated in July2014 a pilotproject, administered by IASPEI, to test the feasibility ofphotographically scanning records of the Wiechert and Bosch instruments operatedat the Jakarta (ex-Batavia) station since 1910 and archivedat the BMKG regional office in Ciputat. We used a 24 MP SONY alphaNEXT 7 camera with a nearly distortion-free wide angle lens mounted on a copystand with underside light-table illumination. We encounteredmany challenges, including the fragility of acidic paper,serious dark-brown age-toning of the paper, as well as many missing records.However, this pilot test showed that this inexpensive systemis effective in providing well-resolved waveforms, and reaped more than 500digital copies of seismograms of earthquakes earmarked for theirglobal or regional importance, going back to 1910.Including the compilation of metadata necessary for futuresearch capability, 15 to 20 seismograms can be scanned per hour.Following successful capacity building through on-site training of BMKG Staff,it is hoped that this project can be pursued at BMKG, and complementsimilar endeavors, especially in the critically important Southern Hemisphere,either ongoing (e.g., at Canberra, Silverton), or desirable (e.g., at Lower Hutt,La Paz).

  2. Seismogram Analysis of Earthquakes Around Indonesia In UGM Observational Station: S Velocity Structure.

    Bagus Jaya Santosa

    2008-11-01

    Full Text Available The seismogram comparison between the measured and synthetics seismogram has been carried out in observation station of UGM, where the seismograms are excited by earthquakes that occurred at North Sumatra, Sumbawa, Sunda Strait, around North Celebes and PNG. The ray paths from earthquake's hypocenter to UGM give opportunity to understand the earth structure alongside the front area of subduction zone. The calculation of synthetic seismogram needs input in the form of earth model, the Centroid Moment Tensor (CMT solution of the earthquake and location of observation station, as well as the relevant date file response of the observation station. Waveform comparison and fitting at surface wave indicate that speed's anomalies in the lithosphere have negative character in front area of subducted zone, but become positive for northern area of subduction zone. By paying attention to waveform of Love surface wave, it is obtained, that this waveform are sensitive to the change of earth crust thickness, while Rayleigh waveform is not sensitive. Heterogeneity is not only occurred in the lithosphere, but also in deeper earth layers, until Core Mantle Boundary (CMB. Different corrections are needed to make the fitting at S secondary wave, but also at depth wave and its repetitions. The result of this research shows that the research area, which is located in the front of subduction zone has anomalies at S speed of at deeper earth layers which than the lithosphere. The earth structure as the result of this research differs from the other seismological results, where they used the methods, which are based on inversion of arrival time data of body wave and dispersion analysis on surface wave.

  3. Simulation of seismograms in a 2-D viscoelastic Earth by pseudospectral methods

    Carcione, Jose M [Istituto Nazionale di Oceanografia e di Geofisica Sperimentale (OGS), Trieste (Italy); Helle, Hans B [Norsk Hydro a.s., 0 and E Research Centre, Bergen (Norway); Seriani, Geza [Istituto Nazionale di Oceanografia e di Geofisica Sperimentale (OGS), Trieste (Italy); Plasencia Linares, Milton P [Facultad de Ciencias Astronomicas y Geofisicas, Universidad Nacional de La Plata, La Plata (Argentina)

    2005-04-15

    Using an improved global pseudospectral modeling algorithm we synthesize seismograms generated by oceanic and continental earthquakes. Attention is given to attenuation, to explicit modeling of boundary conditions at the ocean-bottom interface, simulation of the Rayleigh window and interface-wave propagation. The algorithm is based on Fourier and Chebyshev differential operators and a domain-decomposition technique - one grid for the fluid and another grid for the solid. Wave propagation in the oceanic and continent crusts and mantle is modeled by using a viscoelastic stress-strain relation based on memory variables. The main physical phenomena associated with an ocean-crust system are modeled, including Scholte waves, leaking Rayleigh waves, dispersive modes, and the Rayleigh-window phenomenon due to a minimum in the reflection coefficient of the ocean bottom, which has not been simulated with direct methods. In particular, we model Rayleigh modes (mainly the M11 mode), and coupled Rayleigh-Scholte waves, for which the dispersion relation is solved in simple cases. Also, we model the effects of random. [Spanish] El algoritmo de modulacion seudoespectral es mejorado y aplicado a la simulacion de sismogramas generados por sismos oceanicos y continentales, como atencion a la atenuacion y a la modelacion explicita de condiciones a la frontera en el fondo oceanico y a la simulacion de la ventana de Rayleigh y la propagacion en interfases. El algoritmo se basa en los operadores diferenciales de Fourier y de Chebyshev con una tecnica de decomposicion de dominios, una malla para el fluido y otra para el solido. Para la propagacion se usa una relacion de esfuerzo-deformacion basada en variables de memoria. Entre los fenomenos modelados se incluyen las ondas de Scholte, las ondas evanescentes de Rayleigh y los modos dispersivos, asi como la ventana de Rayleigh, un minimo del coeficiente de reflexion en el fondo oceanico que nunca ha sido simulado con metodos directos. Hemos

  4. Seismogram Analysis and Fitting of Three Earthquakes, West Papua, Recorded at Stations ENH and KMI, China

    Bagus Jaya Santosa

    2008-01-01

    The S wave velocity structure of the earth below Eastern Southeast Asia has been investigated by analyzing the seismogram from surface wave to multiple depth waves in the time domain and three Cartesian components simultaneously. The wave passes across the front area of subduction zone between the Philippine plate and the Asian plate. The main data are waveform comparisons, instead of the arrival times. The synthetic seismogram is calculated using the GEMINI method. The synthetic seismogram constructed by PREMAN global earth model deviates greatly from the measured one. To solve this problem, corrections are needed for the β speed structure. Corrections cover the gradient change of βh>, which turns from negative to positive in upper mantle layers as in the PREMAN, change of earth crust depth and change of zero order coefficients of β velocity function in all earth mantle layers. So, the fitting is obtained, as well as the arrival time or the waveform of Love and Rayleigh surface waves, the S wave and the repetitive depth waves ScS2> and ScS3. This result reveals that the Southeast Asia, being stretched due to tectonic release, has a mantle in some parts with negative anomaly of S wave velocity and vertical anisotropy in all earth mantle layers.

  5. Reconstruction of 2D seismic wavefield from Long-Period Seismogram and Short-Period Seismogram Envelope by Seismic Gradiometry applied to the Hi-net Array

    Maeda, Takuto; Nishida, Kiwamu; Takagi, Ryota; Obara, Kazushige

    2016-04-01

    The high-sensitive seismograph network (Hi-net) operated by National Research Institute for Earth Science and Disaster Prevention (NIED) has about 800 stations with average separation of 20 km all over the Japanese archipelago. Although it is equipped with short-period seismometers, we also can observe long-period seismic wave up to 100 s in periods for significantly large earthquakes. In this case, we may treat long-period seismic waves as a 2D wavefield with station separations shorter than wavelength rather than individual traces at stations. In this study, we attempt to reconstruct 2D wavefield and obtain its propagation properties from seismic gradiometry (SG) method. The SG estimates the wave amplitude and its spatial derivative coefficients from discrete station record by the Taylor series approximation with an inverse problem. By using spatial derivatives in horizontal directions, we can obtain properties of propagating wave packet such as the arrival direction, slowness, geometrical spreading and radiation pattern. In addition, by using spatial derivatives together with free-surface boundary condition, we may decompose the vector elastic 2D wavefield estimated by the SG into divergence and rotation components. First, we applied the seismic gradiometry to a synthetic long-period (20-50 s) seismogram dataset computed by numerical simulation in realistic 3D medium at the Hi-net station layout as a feasibility test. We confirmed that the wave amplitude and its spatial derivatives are very well reproduced with average correlation coefficients higher than 0.99 in this period range. Applications to a real large earthquakes show that the amplitude and phase of the wavefield are well reconstructed with additional information of arrival direction and its slowness. The reconstructed wavefield contained a clear contrast in slowness between body and surface waves, regional non-great-circle-path wave propagation which may be attributed to scattering. Slowness

  6. Measuring the misfit between seismograms using an optimal transport distance: application to full waveform inversion

    Métivier, L.; Brossier, R.; Mérigot, Q.; Oudet, E.; Virieux, J.

    2016-04-01

    Full waveform inversion using the conventional L2 distance to measure the misfit between seismograms is known to suffer from cycle skipping. An alternative strategy is proposed in this study, based on a measure of the misfit computed with an optimal transport distance. This measure allows to account for the lateral coherency of events within the seismograms, instead of considering each seismic trace independently, as is done generally in full waveform inversion. The computation of this optimal transport distance relies on a particular mathematical formulation allowing for the non-conservation of the total energy between seismograms. The numerical solution of the optimal transport problem is performed using proximal splitting techniques. Three synthetic case studies are investigated using this strategy: the Marmousi 2 model, the BP 2004 salt model, and the Chevron 2014 benchmark data. The results emphasize interesting properties of the optimal transport distance. The associated misfit function is less prone to cycle skipping. A workflow is designed to reconstruct accurately the salt structures in the BP 2004 model, starting from an initial model containing no information about these structures. A high-resolution P-wave velocity estimation is built from the Chevron 2014 benchmark data, following a frequency continuation strategy. This estimation explains accurately the data. Using the same workflow, full waveform inversion based on the L2 distance converges towards a local minimum. These results yield encouraging perspectives regarding the use of the optimal transport distance for full waveform inversion: the sensitivity to the accuracy of the initial model is reduced, the reconstruction of complex salt structure is made possible, the method is robust to noise, and the interpretation of seismic data dominated by reflections is enhanced.

  7. Self-Adaptive Filon's Integration Method and Its Application toComputing Synthetic Seismograms

    ZHANG Hai-Ming; CHEN Xiao-Fei

    2001-01-01

    Based on the principle of the self-adaptive Simpson integration method, and by incorporating the ‘fifth-order'Filon's integration algorithm [Bull. Seism. Soc. Am. 73(1983)913], we have proposed a simple and efficient numerical integration method, i.e., the self-adaptive Filon's integration method (SAFIM), for computing synthetic seismograms at large epicentral distances. With numerical examples, we have demonstrated that the SAFIM is not only accurate but also very efficient. This new integration method is expected to be very useful in seismology,as well as in computing similar oscillatory integrals in other branches of physics.

  8. Synthetic Seismograms Derived from Oceanographic Data in the Campeche Canyon, Deepwater Gulf of Mexico

    Gonzalez-Orduno, A.; Fucugauchi, J. U.; Monreal, M.; Perez-Cruz, G.; Salas de León, D. A.

    2013-05-01

    The seismic reflection method has been successfully applied worldwide to investigate subsurface conditions to support important business decisions in the oil industry. When applied in the marine environment, useful reflection information is limited to events on and below the sea floor; Information from the water column, if any, is disregarded. Seismic oceanography is emerging as a new technique that utilize the reflection information within the water column to infer thermal-density contrasts associated with oceanographic processes, such as cyclonic-anticyclonic eddies, ascending-descending water flows, and water flows related to rapid topographic changes on the sea floor. A seismic investigation to infer such oceanographic changes in one sector of the Campeche Canyon is in progress as a research matter at the Instituto de Ciencias del Mar y Limnologia from the University of Mexico (UNAM). First steps of the investigation consisted of creating synthetic seismograms based on oceanographic information (temperature and density) derived from direct observation on a series of close spaced depth points along vertical profiles. Details of the selected algorithms used for the transformation of the oceanographic data to acoustic impedances data sets and further construction of synthetic seismograms on each site and their representation as synthetic seismic sections, are presented in this work, as well as the road ahead in the investigation.

  9. Ophiolites, synthetic seismograms, and oceanic crustal structure: 2. A comparison of synthetic seismograms of the Samail Ophiolite, Oman, and the ROSE refraction data from the East Pacific Rise

    Kempner, William C.; Gettrust, Joseph F.

    1982-10-01

    Synthetic seismograms for the Samail ophiolite, computed using the full reflectivity technique, are used to test the hypothesis that this ophiolite complex can serve as a prototype for young oceanic crust. If so, then this ophiolite complex can be compared with the older (45 m.y.) Bay of Islands (BOI) ophiolite to develop an aging model for oceanic crust. Synthetics for this young emplacement age (5-8 m.y.) ophiolite are compared with ocean bottom hydrophone data from 0.5- and 4.5-m.y.-age crust obtained during the Rivera Ocean Seismic Experiment. Second-arrival phases from reflected refractions from one ophiolite velocity-depth model and data from 4.5-m.y.-age crust are in excellent agreement; this agreement suggests that the Samail ophiolite is a good working model for young oceanic crust. Earlier work has shown that the BOI ophiolite is a good prototype for mature oceanic crust. The BOI ophiolite data also suggest that alteration of the lower oceanic crust and upper mantle is limited. We use the petrologic and geochemical properties of the Samail and BOI ophiolites to develop a two-stage model for crustal aging that directly limits alteration of the lower crust and upper mantle materials.

  10. ANALISIS SEISMOGRAM TIGA KOMPONEN TERHADAP MOMENT TENSOR GEMPA BUMI DI MANOKWARI PAPUA 03 JANUARI 2009

    Irwan Setyowidodo, Bagus Jaya Santosa

    2012-03-01

    Full Text Available Penelitian ini melakukan analisis inversi waveform 3 komponen terhadap data gempa bumi yang  terjadi  di  Manokwari  Papua  pada  tanggal  3  Januari  2009  pukul  19:43:55  GMT  dengan magnitude  7.1  Mw  yang  episentrumnya  berada  pada  lattitude  -0.70541,  longitude  125.8455  dan kedalaman 25 km. Data yang digunakan dalam penelitian ialah, data seismik lokal yang diunduh dari data  gempa  IA.  Selanjutnya  dilakukan  proses   inversi  data  waveform  tiga  komponen  dengan menggunakan  metode  iterasi  dekonvolusi.  Metode  ini  diimplementasikan  dalam  software  ISOLA yang  dikembangkan   untuk  mendapatkan  parameter-parameter  sumber  gempa  bumi.  Parameter- parameter  gempa ini tergambarkan dalam Centroid Moment Tensor dan parameter sesar penyebab gempa. Selanjutnya, hasil parameter-patameter  tersebut digunakan untuk  mengetahui arah  patahan yang sebenarnya (fault-plane dengan menggunakan metode H-C. Seismogram sintetik dihitung dengan ISOLA yang inputnya adalah model bumi dan data seismogram yang  direkam  oleh  stasiun  seismologi  BAK,  LBM  dan  JAY.  Hasil   interpretasi  atas  analisis seismogram   waveform   tiga   komponen   menunjukkan   bahwa   orientasi   bidang   patahan   gempa Manokwari Papua pada tanggal 3 Januari 2009 memiliki sudut dip 54o       terhadap bidang  horizontal yang menyebabkan zona patahan di daerah tersebut mudah bergeser dan mudah terjadi gempa. Hasil analisis  ini  diketahui  bahwa  sesar  penyebab  gempa  bumi  ini  ialah  sesar  strike-slip  oblique  yang bergerak dari  arah barat  laut - tenggara. Sumber  gempa  bumi  yang terjadi tersebut terjadi akibat aktivitas Sesar Sorong yang terdapat di bagian utara Manokwari.

  11. One-Dimensional (1-D) Nanoscale Heterostructures

    Guozhen SHEN; Di CHEN; Yoshio BANDO; Dmitri GOLBERG

    2008-01-01

    One-dimensional (1-D) nanostructures have been attracted much attention as a result of their exceptional properties, which are different from bulk materials. Among 1-D nanostructures, 1-D heterostructures with modulated compositions and interfaces have recently become of particular interest with respect to potential applications in nanoscale building blocks of future optoelectronic devices and systems. Many kinds of methods have been developed for the synthesis of 1-D nanoscale heterostructures. This article reviews the most recent development, with an emphasize on our own recent efforts, on 1-D nanoscale heterostructures, especially those synthesized from the vapor deposition methods, in which all the reactive precursors are mixed together in the reaction chamber. Three types of 1-D nanoscale heterostructures, defined from their morphologies characteristics, are discussed in detail, which include 1-D co-axial core-shell heterostructures, 1-D segmented heterostructures and hierarchical heterostructures. This article begins with a brief survey of various methods that have been developed for synthesizing 1-D nanoscale heterostructures and then mainly focuses on the synthesis, structures and properties of the above three types of nanoscale heterostructures. Finally, this review concludes with personal views towards the topic of 1-D nanoscale heterostructures.

  12. High-frequency Born synthetic seismograms based on coupled normal modes

    Pollitz, Fred F.

    2011-01-01

    High-frequency and full waveform synthetic seismograms on a 3-D laterally heterogeneous earth model are simulated using the theory of coupled normal modes. The set of coupled integral equations that describe the 3-D response are simplified into a set of uncoupled integral equations by using the Born approximation to calculate scattered wavefields and the pure-path approximation to modulate the phase of incident and scattered wavefields. This depends upon a decomposition of the aspherical structure into smooth and rough components. The uncoupled integral equations are discretized and solved in the frequency domain, and time domain results are obtained by inverse Fourier transform. Examples show the utility of the normal mode approach to synthesize the seismic wavefields resulting from interaction with a combination of rough and smooth structural heterogeneities. This approach is applied to an ∼4 Hz shallow crustal wave propagation around the site of the San Andreas Fault Observatory at Depth (SAFOD).

  13. Using a Fractal Analysis and Polarization Method for Phase Identification in Three-Component Seismograms

    Boi-Yee Liao

    2010-01-01

    Full Text Available This study presents the automatic P-wave and S-wave arrivals picking algorithm which is essentially based on the fractal dimension and polarized method. With an estimate of the spectral exponent £^ in a 1/f process, an interval that indicates the preferred intersection containing both noise and the P-wave is well-detected by corresponding to the minimum absolute spectral exponent £^ value along the trace. Based on the different properties of background noise and deterministic signal, the fractal dimension technique can detect the position of the P-wave. The place where the fractal dimension value changes suddenly within the intersection interval indicates the location of arrival of the P-wave. Testing that adds various levels of noise to the seismic signal shows the method can prove able to tolerate noise to a signal-to-noise (S/N ratio 1.5. Based on the P-wave arrival, the polarized P-wave could be detected by a genetic algorithm (GA with the strength of polarization and phase difference between the vertical and horizontal components as constraints. Using the first arrival phase as the basis phase, this study combines a polarization filter including rectilinearity functions, linear polarization, phase difference and directionality with GA to detect polarized S-wave of seismograms. Finally, the technique was applied to teleseismic data and near-field motion to verify the accuracy and wide applicability of this method. To conclude, this proposed method, an efficient and brand-new method of associating signal processing technique with physical wave motion properties, may be of importance in finding P-wave and S-wave phase arrivals accurately using three-component seismograms.

  14. Tomography S Velocity Structure between Washington’s Earthquake C022801l and Observational Station Tuc through Seismogram Analysis

    Bagus Jaya Santosa

    2005-11-01

    Full Text Available In this research the S speed structure is investigated by seismogram analysis of Washington's earthquake, C022801L using data of TUC station, Tucson, Arizona, U.S.A. The seismogram comparison between the observed and the synthetic seismogram is conducted in time domain and three components simultaneously. The initially input for the calculation of synthetic seismogram is earth model of PREMAN and CMT solution from the earthquake. A low-pass Butterworth filter with corner frequency of 20 mHz is convolved to observed and synthetic seismogram. Waveform comparison shows a real deviation when travel time and waveform of some wave phase are compared, namely on S wave, surface wave of Love and Rayleigh and wave ScS and ScS-2. This research shows, how sensitive the waveform is to the earth model, better than the method of travel time or the dispersion analysis. Research hereinafter is addressed to finish the found discrepancies at S wave, surface wave of Love and Rayleigh and ScS and ScS-2 wave, in observation station TUC. To obtain the seismogram fitting, correction for S speed structure in earth model is needed, that are changes of earth crust thickness, the speed model of β in upper mantle covering the speed gradient of βh and value of zeroeth order coefficient for the βh and βv, for accomplishing the discrepancies at surface wave of Love and Rayleigh. Further correction on S speed is conducted to accomplish the deviation at S wave at earth layering systems from Upper Mantle up to a 630 km depth. Mean while for the ScS and ScS-2 wave phase the correction is carried out on S speed in the earth layers up to CMB. Fitting Seismogram is obtained at waveform of various wave phases that is S wave, surface wave of Love and Rayleigh and ScS, ScS-2 wave, either on travel time or especially also at oscillation number in Love wave. This result indicates that the anisotropy is occurred not only in upper mantle but till deeper earth layers, till CMB.

  15. Wavelet transform analysis of transient signals: the seismogram and the electrocardiogram

    Anant, K.S.

    1997-06-01

    In this dissertation I quantitatively demonstrate how the wavelet transform can be an effective mathematical tool for the analysis of transient signals. The two key signal processing applications of the wavelet transform, namely feature identification and representation (i.e., compression), are shown by solving important problems involving the seismogram and the electrocardiogram. The seismic feature identification problem involved locating in time the P and S phase arrivals. Locating these arrivals accurately (particularly the S phase) has been a constant issue in seismic signal processing. In Chapter 3, I show that the wavelet transform can be used to locate both the P as well as the S phase using only information from single station three-component seismograms. This is accomplished by using the basis function (wave-let) of the wavelet transform as a matching filter and by processing information across scales of the wavelet domain decomposition. The `pick` time results are quite promising as compared to analyst picks. The representation application involved the compression of the electrocardiogram which is a recording of the electrical activity of the heart. Compression of the electrocardiogram is an important problem in biomedical signal processing due to transmission and storage limitations. In Chapter 4, I develop an electrocardiogram compression method that applies vector quantization to the wavelet transform coefficients. The best compression results were obtained by using orthogonal wavelets, due to their ability to represent a signal efficiently. Throughout this thesis the importance of choosing wavelets based on the problem at hand is stressed. In Chapter 5, I introduce a wavelet design method that uses linear prediction in order to design wavelets that are geared to the signal or feature being analyzed. The use of these designed wavelets in a test feature identification application led to positive results. The methods developed in this thesis; the

  16. Duration of deep earthquakes determined by stacking of Global Seismograph Network seismograms

    Bos, A. G.; Nolet, G.; Rubin, A.; Houston, H.; Vidale, J. E.

    1998-09-01

    The duration of each subevent of 48 earthquakes with magnitude larger than 5.5 and depth greater than 100 km was determined from stacked traces of broadband records of Global Seismograph Network stations. We fitted the source time function by one or more triangles convolved with attenuation. We found that global stacks of displacement seismograms yield reliable estimates of the rupture duration. The durations, scaled to a moment of 1019 N m, of both the subevents and the entire earthquake show a slight decrease with depth from 9 s for events at 100 km depth to about 7 s for events at 600 km depth. Assuming that the rupture velocity is a constant fraction of the shear wave speed, this decrease can be completely explained by the increase in shear velocity of 20%. In this sense, deep earthquakes are comparable to intermediate ones. For some intermediate-depth events, Vidale and Houston [1993] found durations up to twice as long. We find that almost all of their slow events have been recorded at large epicentral distances. At these distances, we conjecture that the end of the P wave train may be extended by the arrival of reflections from the D″ layer.

  17. EUROSEISMOS 2002-2003 a project for saving and studying historical seismograms in the Eeuro-mediterranean area

    Ferrari, G.; Pino, N. A.

    2003-04-01

    The study of the great earthquakes and the analysis of their tectonic significance are very important elements in the evaluation of seismic potential, seismic hazard and risk. The analysis of the seismograms of historical earthquakes plays a crucial role in understanding the patterns of deformation energy release, the characteristics of propagation and interaction of the seismic waves with the inhabited areas, in the areas affected by these events. The recovery and reproduction of historical seismograms and the indispensable information contained therein, on the instruments that recorded them and their related characteristics, often become difficult and laborious operations that deprive research of a disproportionate amount of human and economic resources in relation to the objective complexity of the matter. These difficulties have so far much reduced the number of study cases and have been a disincentive to researchers interested in dealing with this important research strand. In order to overcome these difficulties the EUROSEISMOS has been started up (http://80.117.141.2/Es_web); this is a project for collaboration between researchers and research bodies having a long tradition of seismic monitoring, with the following main objectives: 1) the recovery, with the reproduction at the SISMOS centre of the INGV, of the seismograms of the most important historical earthquakes (1895 1980) in the Euro-Mediterranean area in the 20th century; 2) benchmarking of experiences on the processing of seismographic historical data; 3) creation of a permanent workgroup on these aspects. So far 29 researchers belonging to 26 countries from Finland to Algeria, and from Georgia to Portugal, have joined the project. The approximately 300 earthquakes of primary interest for the researchers involved have been collected in a catalogue, and early in 2003 the first reproductions of seismograms were started.

  18. Analysis of seismogram envelopes. State of the art and future developments; Jishin hakei no envelope kaiseki. Genjo to kongo no kadai

    Sato, H. [Tohoku University, Sendai (Japan)

    1998-10-01

    Reviewed herein are researches on seismogram envelopes of small earthquakes and observations. The physical exploration tries to search for coherent portions in the waves by array observation, to detect strong contrasts in underground structures. Analysis of seismogram envelopes is much different from the above. The coda wave in the seismogram of local earthquake is characterized by a structure of random short-waves overlapping three-dimensionally the upper surface of a gradually changing structure. This paper describes characteristics of heterogeneous earth structures and coda waves, modeling based on the radiation propagation theories, and simulation and analysis examples of 3-component, total waveform envelopes, based on the Born approximation in the theory of elasticity. It also outlines the envelopes, in the seismograms of earthquakes which have occurred in the Kanto and Tokai districts, changing from a pulse-shape to spindle-shape, theoretical models developed by diffractiometry for strongly random heterogeneous structures, and future research prospects. 37 refs., 28 figs.

  19. Generation of 1D interference patterns of Bloch surface waves

    Kadomina, E. A.; Bezus, E. A.; Doskolovich, L. L.

    2016-09-01

    Interference patterns of Bloch surface waves with a period that is significantly less than the wavelength of incident radiation are formed using dielectric diffraction gratings located on the surface of photonic crystal. The simulation based on electromagnetic diffraction theory is used to demonstrate the possibility of high-quality interference patterns due to resonant enhancement of higher evanescent diffraction orders related to the excitation of the Bloch surface waves. The contrast of the interference patterns is close to unity, and the period is less than the period of the diffraction structure by an order of magnitude.

  20. 1D Josephson quantum interference grids: diffraction patterns and dynamics

    Lucci, M.; Badoni, D.; Corato, V.; Merlo, V.; Ottaviani, I.; Salina, G.; Cirillo, M.; Ustinov, A. V.; Winkler, D.

    2016-02-01

    We investigate the magnetic response of transmission lines with embedded Josephson junctions and thus generating a 1D underdamped array. The measured multi-junction interference patterns are compared with the theoretical predictions for Josephson supercurrent modulations when an external magnetic field couples both to the inter-junction loops and to the junctions themselves. The results provide a striking example of the analogy between Josephson phase modulation and 1D optical diffraction grid. The Fiske resonances in the current-voltage characteristics with voltage spacing {Φ0}≤ft(\\frac{{\\bar{c}}}{2L}\\right) , where L is the total physical length of the array, {Φ0} the magnetic flux quantum and \\bar{c} the speed of light in the transmission line, demonstrate that the discrete line supports stable dynamic patterns generated by the ac Josephson effect interacting with the cavity modes of the line.

  1. Study of East Kazakh explosions and propagation in Central Asia using regional Chinese seismograms

    Patton, H.J.; Mills, J.M. Jr.

    1984-03-01

    Seismograms recorded at the Urumchi Station in northwestern China from eleven Asian events including seven presumed East Kazakh nuclear explosions were analyzed. Group velocity dispersion curves of Rayleigh waves were measured at short periods on paths through basin and fold belt terrains. At 10 sec period, the velocities on paths over sedimentary basins are 25% slower than velocities on paths over fold belts. We interpret those differences in velocities to be due to the great thicknesses of sedimentary deposits in basin terrains. Epicentral locations were estimated using differential travel times between P/sub n/ and L/sub g/ and particle motions of Rayleigh waves measured on a single three-component record. For a 1000 km path, the location errors (one standad deviation) are about +-125 km in azimuth and +-30 km in distance. In addition, systematic errors due to structural effects on surface-wave paths and on velocities of regional phases are shown to seriously bias location estimates of several events. We applied a differential phase method to Rayleigh waves from the East Kazakh explosions and found that signals of all events are in-phase with signals from the reference event on 10/12/80. Thus, there is no evidence for phase reversals or shifts at the Urumchi station in the frequency band where signal to noise ratio is good and where assumptions of the method are valid. Seismic moments of explosions were estimated using models of explosion sources with associated tectonic release. Observed amplitude spectra of Rayleigh waves were richer in high frequencies than predicted by the model. This could be a source effect related to source medium excitation (i.e., Green's functions) or a path effect caused by energy focussing and/or amplifications. We discuss the potential bias in the estimates of moment due to assumptions/limitations. 24 references, 16 figures, 6 tables.

  2. A comparison of two methods for earthquake source inversion using strong motion seismograms

    G. C. Beroza

    1994-06-01

    Full Text Available In this paper we compare two time-domain inversion methods that have been widely applied to the problem of modeling earthquake rupture using strong-motion seismograms. In the multi-window method, each point on the fault is allowed to rupture multiple times. This allows flexibility in the rupture time and hence the rupture velocity. Variations in the slip-velocity function are accommodated by variations in the slip amplitude in each time-window. The single-window method assumes that each point on the fault ruptures only once, when the rupture front passes. Variations in slip amplitude are allowed and variations in rupture velocity are accommodated by allowing the rupture time to vary. Because the multi-window method allows greater flexibility, it has the potential to describe a wider range of faulting behavior; however, with this increased flexibility comes an increase in the degrees of freedom and the solutions are comparatively less stable. We demonstrate this effect using synthetic data for a test model of the Mw 7.3 1992 Landers, California earthquake, and then apply both inversion methods to the actual recordings. The two approaches yield similar fits to the strong-motion data with different seismic moments indicating that the moment is not well constrained by strong-motion data alone. The slip amplitude distribution is similar using either approach, but important differences exist in the rupture propagation models. The single-window method does a better job of recovering the true seismic moment and the average rupture velocity. The multi-window method is preferable when rise time is strongly variable, but tends to overestimate the seismic moment. Both methods work well when the rise time is constant or short compared to the periods modeled. Neither approach can recover the temporal details of rupture propagation unless the distribution of slip amplitude is constrained by independent data.

  3. Heat Capacity of 1D Molecular Chains

    Bagatskii, M. I.; Barabashko, M. S.; Sumarokov, V. V.; Jeżowski, A.; Stachowiak, P.

    2017-04-01

    The heat capacity of 1D chains of nitrogen and methane molecules (adsorbed in the outer grooves of bundles of closed-cap single-walled carbon nanotubes) has been studied in the temperature ranges 2-40 and 2-60 K, respectively. The temperature dependence of the heat capacity of 1D chains of nitrogen molecules below 3 K is close to a linear. It was found that the rotational heat capacity of methane molecules is a significant part of the total heat capacity of the chains throughout the whole investigated temperature range, whereas in the case of nitrogen, the librations are significant only above 15 K. The dependence of the heat capacity for methane below 10 K indicates the presence of a Schottky anomaly caused by the tunneling between the lowest energy levels of the CH4 molecule rotational spectra. Characteristic features observed in the temperature dependence of the heat capacity of 1D methane crystals are also discussed.

  4. Social exploration of 1D games

    Valente, Andrea; Marchetti, Emanuela

    2013-01-01

    In this paper the apparently meaningless concept of a 1 dimensional computer game is explored, via netnography. A small number of games was designed and implemented, in close contact with online communities of players and developers, providing evidence that 1 dimension is enough to produce intere...... interesting gameplay, to allow for level design and even to leave room for artistic considerations on 1D rendering. General techniques to re-design classic 2D games into 1D are also emerging from this exploration....

  5. Automatic simulation of 1D and 2D chaotic oscillators

    Tlelo-Cuautle, E; Munoz-Pacheco, J-M [Department of Electronics, INAOE, Luis Enrique Erro No. 1, Tonantzintla, Puebla, 72840 MEXICO (Mexico)], E-mail: e.tlelo@ieee.org, E-mail: mpacheco@inaoep.mx

    2008-02-15

    A new method is introduced for automatic simulation of three kinds of chaotic oscillators: Chua's circuit, generalized Chua's circuit and chaotic oscillator implemented with saturated functions. The former generates the double-scroll, and the others 1D n-scroll attractors. The third chaotic oscillator is modified to generate 2D n-scrolls attractors. The oscillators are modelled by applying state variables and piecewise-linear approximation. Basically, the method computes the eigenvalues of the oscillators to begin time simulation and to make control of step-size automatically.

  6. First Observation of Upsilon(1D) States

    Csorna, S E; Bonvicini, G; Cinabro, D; Dubrovin, M; McGee, S; Bornheim, A; Lipeles, E; Pappas, S P; Shapiro, A; Sun, W M; Weinstein, A J; Mahapatra, R; Briere, R A; Chen, G P; Ferguson, T; Tatishvili, G T; Vogel, H; Adam, N E; Alexander, J P; Berkelman, K; Boisvert, V; Cassel, David G; Drell, P S; Duboscq, J E; Ecklund, K M; Ehrlich, R; Galik, R S; Gibbons, L; Gittelman, B; Gray, S W; Hartill, D L; Heltsley, B K; Hsu, L; Jones, C D; Kandaswamy, J; Kreinick, D L; Magerkurth, A; Mahlke-Krüger, H; Meyer, T O; Mistry, N B; Nordberg, E; Patterson, J R; Peterson, D; Pivarski, J; Riley, D; Sadoff, A J; Schwarthoff, H; Shepherd, M R; Thayer, J G; Urner, D; Viehhauser, G; Warburton, A; Weinberger, M; Athar, S B; Avery, P; Breva-Newell, L; Potlia, V; Stöck, H; Yelton, J; Brandenburg, G; Kim, D Y J; Wilson, R; Benslama, K; Eisenstein, B I; Ernst, J; Gollin, G D; Hans, R M; Karliner, I; Lowrey, N; Plager, C; Sedlack, C; Selen, M; Thaler, J J; Williams, J; Edwards, K W; Ammar, R; Besson, D; Zhao, X; Anderson, S; Frolov, V V; Kubota, Y; Lee, S J; Li, S Z; Poling, R A; Smith, A; Stepaniak, C J; Urheim, J; Metreveli, Z V; Seth, K K; Tomaradze, A G; Zweber, P; Ahmed, S; Alam, M S; Jian, L; Saleem, M; Wappler, F; Eckhart, E; Gan, K K; Gwon, C; Hart, T; Honscheid, K; Hufnagel, D; Kagan, H; Kass, R; Pedlar, T K; Thayer, J B; Von Törne, E; Wilksen, T; Zoeller, M M; Muramatsu, H; Richichi, S J; Severini, H; Skubic, P L; Dytman, S A; Müller, J A; Nam, S; Savinov, V; Chen, S; Hinson, J W; Lee, J; Miller, D H; Pavlunin, V; Shibata, E I; Shipsey, I P J; Cronin-Hennessy, D; Lyon, A L; Park, C S; Park, W; Thorndike, E H; Coan, T E; Gao, Y S; Liu, F; Maravin, Y; Stroynowski, R; Artuso, M; Boulahouache, C; Bukin, K; Dambasuren, E; Khroustalev, K; Mountain, R; Nandakumar, R; Skwarnicki, T; Stone, S; Wang, J C; Mahmood, A H

    2002-01-01

    The CLEO III experiment has recently accumulated a large statistics sample of 4.73 x 10^6 Upsilon(3S) decays. We present the first evidence for the production of the triplet Upsilon(1D) states in the four-photon cascade, Upslion(3S) -> gamma chi_b(2P), chi_b(2P) -> gamma Upsilon(1D), Upsilon(1D) -> gamma chi_b(1P), chi_b(1P) -> gamma Upsilon(1S), followed by the Upsilon(1S) annihilation to e+ e- or mu+ mu-. The signal has a significance of 9.7 standard deviations. The measured product branching ratio for these five decays, (3.3 +- 0.6 +- 0.5) x 10^{-5}, is consistent with the theoretical estimates. We see a 6.8 standard deviation signal for a state with a mass of 10162.2 +- 1.6 MeV/c^2, consistent with the Upsilon(1D_2) assignment. We also present improved measurements of the Upsilon(3S) -> pi0 pi0 Upsilon(1S) branching ratio and the associated di-pion mass distribution.

  7. Calibration of a 1D/1D urban flood model using 1D/2D model results in the absence of field data.

    Leandro, J; Djordjević, S; Chen, A S; Savić, D A; Stanić, M

    2011-01-01

    Recently increased flood events have been prompting researchers to improve existing coupled flood-models such as one-dimensional (1D)/1D and 1D/two-dimensional (2D) models. While 1D/1D models simulate sewer and surface networks using a one-dimensional approach, 1D/2D models represent the surface network by a two-dimensional surface grid. However their application raises two issues to urban flood modellers: (1) stormwater systems planning/emergency or risk analysis demands for fast models, and the 1D/2D computational time is prohibitive, (2) and the recognized lack of field data (e.g. Hunter et al. (2008)) causes difficulties for the calibration/validation of 1D/1D models. In this paper we propose to overcome these issues by calibrating a 1D/1D model with the results of a 1D/2D model. The flood-inundation results show that: (1) 1D/2D results can be used to calibrate faster 1D/1D models, (2) the 1D/1D model is able to map the 1D/2D flood maximum extent well, and the flooding limits satisfactorily in each time-step, (3) the 1D/1D model major differences are the instantaneous flow propagation and overestimation of the flood-depths within surface-ponds, (4) the agreement in the volume surcharged by both models is a necessary condition for the 1D surface-network validation and (5) the agreement of the manholes discharge shapes measures the fitness of the calibrated 1D surface-network.

  8. Fast computation of synthetic seismograms within a medium containing remote localized perturbations: A numerical solution to the scattering problem

    Masson, Yder; Romanowicz, Barbara

    2016-11-01

    We derive a fast discrete solution to the scattering problem. This solution allows us to compute accurate synthetic seismograms or waveforms for arbitrary locations of sources and receivers within a medium containing localized perturbations. The key to efficiency is that wave propagation modeling does not need to be carried out in the entire volume that encompasses the sources and the receivers but only within the sub-volume containing the perturbations or scatterers. The proposed solution has important applications, for example, it permits the imaging of remote targets located in regions where no sources or receivers are present. Our solution relies on domain decomposition: within a small volume that contains the scatterers, wave propagation is modeled numerically, while in the surrounding volume, where the medium isn't perturbed, the response is obtained through wavefield extrapolation. The originality of this work is the derivation of discrete formulas for representation theorems and Kirchhoff-Helmholtz integrals that naturally adapt to the numerical scheme employed for modeling wave propagation. Our solution applies, for example, to finite difference methods or finite/spectral elements methods. The synthetic seismograms obtained with our solution can be considered "exact" as the total numerical error is comparable to that of the method employed for modeling wave propagation. We detail a basic implementation of our solution in the acoustic case using the finite difference method and present numerical examples that demonstrate the accuracy of the method. We show that ignoring some terms accounting for higher order scattering effects in our solution has a limited effect on the computed seismograms and significantly reduces the computational effort. Finally, we show that our solution can be used to compute localised sensitivity kernels and we discuss applications to target oriented imaging. Extension to the elastic case is straightforward and summarised in a

  9. YORP torques with 1D thermal model

    Breiter, Slawomir; Czekaj, Maria

    2010-01-01

    A numerical model of the Yarkovsky-O'Keefe-Radzievskii-Paddack (YORP) effect for objects defined in terms of a triangular mesh is described. The algorithm requires that each surface triangle can be handled independently, which implies the use of a 1D thermal model. Insolation of each triangle is determined by an optimized ray-triangle intersection search. Surface temperature is modeled with a spectral approach; imposing a quasi-periodic solution we replace heat conduction equation by the Helmholtz equation. Nonlinear boundary conditions are handled by an iterative, FFT based solver. The results resolve the question of the YORP effect in rotation rate independence on conductivity within the nonlinear 1D thermal model regardless of the accuracy issues and homogeneity assumptions. A seasonal YORP effect in attitude is revealed for objects moving on elliptic orbits when a nonlinear thermal model is used.

  10. Glass-based 1-D dielectric microcavities

    Chiasera, Alessandro; Scotognella, Francesco; Valligatla, Sreeramulu; Varas, Stefano; Jasieniak, Jacek; Criante, Luigino; Lukowiak, Anna; Ristic, Davor; Gonçalves, Rogeria Rocha; Taccheo, Stefano; Ivanda, Mile; Righini, Giancarlo C.; Ramponi, Roberta; Martucci, Alessandro; Ferrari, Maurizio

    2016-11-01

    We have developed a reliable RF sputtering techniques allowing to fabricate glass-based one dimensional microcavities, with high quality factor. This property is strongly related to the modification of the density of states due to the confinement of the gain medium in a photonic band gap structure. In this short review we present some of the more recent results obtained by our team exploiting these 1D microcavities. In particular we present: (1) Er3+ luminescence enhancement of the 4I13/2 → 4I15/2 transition; (2) broad band filters based on disordered 1-D photonic structures; (3) threshold defect-mode lasing action in a hybrid structure.

  11. Seismogram Analysis of the Earthquakes in Sumatra on WRAB Observation Station: S Wave Velocity Structure on Subduction Zone of Sumatra-Java

    Bagus Jaya Santosa

    2008-03-01

    Full Text Available The S wave velocity structure at subduction zone under Sumatra-Java was investigated through seismogram analysis in time domain and three Cartesian’s components simultaneously. The main data set was the comparison between the measured seismogram and the synthetic one, not the travel time data. The synthetic seismogram was calculated with the GEMINI method. The seismogram comparison shows that the global earth mantle of PREMAN gives deviating synthetic seismogram and has later arrival times than the measured one. The gradient bh in the upper mantle is altered to positive from its negative slope as in the PREMAN model, and positive corrections are added to the zero order of polynomial’s coefficients in all earth mantle layers. The excellent fitting, as well as travel time or waveform, were obtained on the surface waves of Love and Rayleigh, the S and SS mantle and repetitive depth waves. The additional positive corrections were also confirmed by a well fitting on the repetitive depth waves. This result expresses that part of the earth mantle that due to tectonic processes has positive anomaly on S wave velocity and vertical anisotropy in all of the earth mantle layers.

  12. ESO science data product standard for 1D spectral products

    Micol, Alberto; Arnaboldi, Magda; Delmotte, Nausicaa A. R.; Mascetti, Laura; Retzlaff, Joerg

    2016-07-01

    The ESO Phase 3 process allows the upload, validation, storage, and publication of reduced data through the ESO Science Archive Facility. Since its introduction, 2 million data products have been archived and published; 80% of them are one-dimensional extracted and calibrated spectra. Central to Phase3 is the ESO science data product standard that defines metadata and data format of any product. This contribution describes the ESO data standard for 1d-spectra, its adoption by the reduction pipelines of selected instrument modes for in-house generation of reduced spectra, the enhanced archive legacy value. Archive usage statistics are provided.

  13. 1-D EQUILIBRIUM DISCRETE DIFFUSION MONTE CARLO

    T. EVANS; ET AL

    2000-08-01

    We present a new hybrid Monte Carlo method for 1-D equilibrium diffusion problems in which the radiation field coexists with matter in local thermodynamic equilibrium. This method, the Equilibrium Discrete Diffusion Monte Carlo (EqDDMC) method, combines Monte Carlo particles with spatially discrete diffusion solutions. We verify the EqDDMC method with computational results from three slab problems. The EqDDMC method represents an incremental step toward applying this hybrid methodology to non-equilibrium diffusion, where it could be simultaneously coupled to Monte Carlo transport.

  14. Diamond-based 1-D imaging arrays

    Lansley, S.P.; Williams, O.A.; Ye, H. [Electronic and Electrical Engineering, University College London, Torrington Place, London WC1E 7JE (United Kingdom); Rizvi, N.; Whitfield, M.D.; Jackman, R.B. [Exitech Limited, Hanborough Park, Long Hanborough, Oxford OX8 8LH (United Kingdom); McKeag, R.D. [Centronic Ltd., Centronic House, King Henry' s Drive, New Addington, Croydon CR9 OBG (United Kingdom)

    2002-10-16

    Diamond has shown great promise for the fabrication of high sensitivity, low dark current, fast and visible-blind deep UV photodetectors. In addition to careful choice of substrate material, defect passivation treatments applied to the diamond after growth have been found to considerably enhance the detector characteristics achieved. In this paper we report on the first purposefully designed 1-D CVD diamond imaging array for the detection of nanosecond 193 nm excimer laser pulses using this approach. It is shown to perform extremely well, giving less than 2% pixel-to-pixel variation in signal response, and is fast enough to avoid any sign of charge build up during prolonged operation. (Abstract Copyright [2002], Wiley Periodicals, Inc.)

  15. Study of the 11th July, 1915, Portuguese offshore earthquake, in the Atlantic from contemporary seismograms and bulletins

    Batllo-Ortiz, J.; Custodio, S.; Macia, R.; Teves-Costa, P.

    2012-12-01

    The seismicity rate in the contact of the Nubian and Euro-Asiatic plates along the Azores-Gibraltar region can be considered moderate. Nevertheless, large earthquakes do occur, as is well known from historical records. The sensibility of seismographic networks to earthquakes with oceanic origin has been extremely low until recent times. Oceanic M5 earthquakes have not been consistently recorded up to the second third of the XX century, precluding a proper knowledge of seismicity rates and other parameters of interest for earthquake hazard. Nevertheless, information for some events does exist, most of which remains to be properly studied. In this paper we analyze historical data for the 11th July, 1915 earthquake, which occurred offshore and was felt over the whole mainland Portugal. This event is one of the largest occurred during the instrumental period in the region of diffuse seismicity around the Gorringe bank. However it has been little studied, probably because it did not cause serious damage. The 11th July, 1915 earthquake is of great interest due to its size, estimated on the order of M6, and to its unique location with respect to the regions of large earthquakes in the Atlantic. In this paper, we present source parameters for this earthquake based on the analysis of the available contemporary seismograms and related documents. After throughout collection and selection, 23 seismograms obtained at 11 different European stations were digitized and processed. The event was relocated and its magnitude recalculated. Its focal mechanism has also been studied through waveform modeling and first motion polarity. We present the results of this analysis, compare the source of the 1915 earthquake with that of present earthquakes in the same region, and interpret the new results in light of the regional seismicity and seismo-tectonics.

  16. Scaled Energies of ML > = 5.1 Aftershocks of the 1999 Chi-Chi, Taiwan, Earthquake Measured from Local Seismograms

    Ming-Wey Huang and Jeen-Hwa Wang

    2009-01-01

    Full Text Available In this study, we measure the seismic radiation energy, Es, and seismic moment, Mo, of twenty-two larger-sized after shocks with 5.1 < = ML < = 6.5 of the 1999 Ms 7.6 Chi-Chi, Taiwan, earthquake from high-quality digital strong-motion data recorded at stations with epicentral distances of less than 50 km through a method proposed by Andrews (1986. We also eliminate the effects on the measures of Es and Mo due to site amplification and finite frequency band width limitation. Comparison of the values of Mo obtained in this study and those listed in the Harvard CMT catalogue shows that _ method to measure Mo from local seismograms is acceptable. The measured values are Es = 2.0 * 10 ^18 _ 8.9 * 10^21 g cm^2 sec^-2 and Mo = 1.3 * 10^23 _ 1.4 * 10^26 g cm sec^-2 cm^-1, which give the scaled energy to be Es/Mo = 7.4 * 10^-6 _ 2.6 * 10^-4. The scaled energies of the 22 events are dependent upon earthquake magnitude, Ms, when both Es and Mo are evaluated from local seismograms; yet, independent of Ms when Mo is estimated from teleseismic data. Scaled energy slightly depends on the depth, h (in km, through the following form: Es/Mo = 1.92 * 10^-5e^0.09h. In addition, the corner frequency, fc, is also measured. Its value ranges from 0.15 to 1.34. The scaling law between Mo and fc is: Mo ~ fc-3.65.

  17. Relaxation of a 1-D gravitational system

    Valageas, P

    2006-01-01

    We study the relaxation towards thermodynamical equilibrium of a 1-D gravitational system. This OSC model shows a series of critical energies $E_{cn}$ where new equilibria appear and we focus on the homogeneous ($n=0$), one-peak ($n=\\pm 1$) and two-peak ($n=2$) states. Using numerical simulations we investigate the relaxation to the stable equilibrium $n=\\pm 1$ of this $N-$body system starting from initial conditions defined by equilibria $n=0$ and $n=2$. We find that in a fashion similar to other long-range systems the relaxation involves a fast violent relaxation phase followed by a slow collisional phase as the system goes through a series of quasi-stationary states. Moreover, in cases where this slow second stage leads to a dynamically unstable configuration (two peaks with a high mass ratio) it is followed by a new sequence ``violent relaxation/slow collisional relaxation''. We obtain an analytical estimate of the relaxation time $t_{2\\to \\pm 1}$ through the mean escape time of a particle from its potent...

  18. 1D-1D Coulomb drag in a 6 Million Mobility Bi-layer Heterostructure

    Bilodeau, Simon; Laroche, Dominique; Xia, Jian-Sheng; Lilly, Mike; Reno, John; Pfeiffer, Loren; West, Ken; Gervais, Guillaume

    We report Coulomb drag measurements in vertically-coupled quantum wires. The wires are fabricated in GaAs/AlGaAs bilayer heterostructures grown from two different MBE chambers: one at Sandia National Laboratories (1.2M mobility), and the other at Princeton University (6M mobility). The previously observed positive and negative drag signals are seen in both types of devices, demonstrating the robustness of the result. However, attempts to determine the temperature dependence of the drag signal in the 1D regime proved challenging in the higher mobility heterostructure (Princeton), in part because of difficulties in aligning the wires within the same transverse subband configuration. Nevertheless, this work, performed at the Microkelvin laboratory of the University of Florida, is an important proof-of-concept for future investigations of the temperature dependence of the 1D-1D drag signal down to a few mK. Such an experiment could confirm the Luttinger charge density wave interlocking predicted to occur in the wires. Sandia National Laboratories is a multi-program laboratory managed and operated by Sandia Corporation, a wholly owned subsidiary of Lockheed Martin Corporation, for the U.S. Department of Energy's National Nuclear Security Administration under Contract DE-AC04-94AL8500.

  19. Generations.

    Chambers, David W

    2005-01-01

    Groups naturally promote their strengths and prefer values and rules that give them an identity and an advantage. This shows up as generational tensions across cohorts who share common experiences, including common elders. Dramatic cultural events in America since 1925 can help create an understanding of the differing value structures of the Silents, the Boomers, Gen Xers, and the Millennials. Differences in how these generations see motivation and values, fundamental reality, relations with others, and work are presented, as are some applications of these differences to the dental profession.

  20. Analysis list: Nr1d2 [Chip-atlas[Archive

    Full Text Available Nr1d2 Liver + mm9 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Nr1d2.1.tsv... http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Nr1d2.5.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Nr1d...2.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Nr1d2.Liver.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Liver.gml ...

  1. Analysis list: Nr1d1 [Chip-atlas[Archive

    Full Text Available Nr1d1 Adipocyte,Cardiovascular,Liver,Neural + mm9 http://dbarchive.biosciencedbc.jp.../kyushu-u/mm9/target/Nr1d1.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Nr1d1.5.tsv http://db...archive.biosciencedbc.jp/kyushu-u/mm9/target/Nr1d1.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Nr1d1....Adipocyte.tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Nr1d1.C...ardiovascular.tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Nr1d1.Liver.tsv,http://dbarchive.biosc

  2. Engineered Solution-Liquid-Solid Growth of a "Treelike" 1D/1D TiO2 Nanotube-CdSe Nanowire Heterostructure: Photoelectrochemical Conversion of Broad Spectrum of Solar Energy.

    Mukherjee, Bratindranath; Sarker, Swagotom; Crone, Eric; Pathak, Pawan; Subramanian, Vaidyanathan R

    2016-12-07

    This work presents a hitherto unreported approach to assemble a 1D oxide-1D chalcogenide heterostructured photoactive film. As a representative system, bismuth (Bi) catalyzed 1D CdSe nanowires are directly grown on anodized 1D TiO2 nanotube (T_NT). A combination of the reductive successive-ionic-layer-adsorption-reaction (R-SILAR) and the solution-liquid-solid (S-L-S) approach is implemented to fabricate this heterostructured assembly, reported in this 1D/1D form for the first time. XRD, SEM, HRTEM, and elemental mapping are performed to systematically characterize the deposition of bismuth on T_NT and the growth of CdSe nanowires leading to the evolution of the 1D/1D heterostructure. The resulting "treelike" photoactive architecture demonstrates UV-visible light-driven electron-hole pair generation. The photoelectrochemical results highlight: (i) the formation of a stable n-n heterojunction between TiO2 nanotube and CdSe nanowire, (ii) an excellent correlation between the absorbance vis-à-vis light conversion efficiency (IPCE), and (iii) a photocurrent density of 3.84 mA/cm(2). This proof-of-concept features the viability of the approach for designing such complex 1D/1D oxide-chalcogenide heterostructures that can be of interest to photovoltaics, photocatalysis, environmental remediation, and sensing.

  3. Vlasov-Poisson in 1D: waterbags

    Colombi, Stéphane

    2014-01-01

    We revisit in one dimension the waterbag method to solve numerically Vlasov-Poisson equations. In this approach, the phase-space distribution function $f(x,v)$ is initially sampled by an ensemble of patches, the waterbags, where $f$ is assumed to be constant. As a consequence of Liouville theorem it is only needed to follow the evolution of the border of these waterbags, which can be done by employing an orientated, self-adaptive polygon tracing isocontours of $f$. This method, which is entropy conserving in essence, is very accurate and can trace very well non linear instabilities as illustrated by specific examples. As an application of the method, we generate an ensemble of single waterbag simulations with decreasing thickness, to perform a convergence study to the cold case. Our measurements show that the system relaxes to a steady state where the gravitational potential profile is a power-law of slowly varying index $\\beta$, with $\\beta$ close to $3/2$ as found in the literature. However, detailed analys...

  4. One-Dimensional (1D) ZnS Nanomaterials and Nanostructures

    Xiaosheng FANG; Lide ZHANG

    2006-01-01

    One-dimensional (1D) nanomaterials and nanostructures have received much attention due to their potential interest for understanding fundamental physical concepts and for applications in constructing nanoscale electric and optoelectronic devices. Zinc sulfide (ZnS) is an important semiconductor compound of Ⅱ-Ⅵ group,and the synthesis of 1D ZnS nanomaterials and nanostructures has been of growing interest owing to their promising application in nanoscale optoelectronic devices. This paper reviews the recent progress on 1D ZnS nanomaterials and nanostructures, including nanowires, nanowire arrays, nanorods, nanobelts or nanoribbons,nanocables, and hierarchical nanostructures etc. This article begins with a survey of various methods that have been developed for generating 1D nanomaterials and nanostructures, and then mainly focuses on structures,synthesis, characterization, formation mechanisms and optical property tuning, and luminescence mechanisms of 1D ZnS nanomaterials and nanostructures. Finally, this review concludes with personal views towards future research on 1D ZnS nanomaterials and nanostructures.

  5. Diffusion and particle mobility in 1D system

    Borman, V. D.; Johansson, B.; Skorodumova, N. V.; Tronin, I. V.; Tronin, V. N.; Troyan, V. I.

    2006-01-01

    The transport properties of one-dimensional (1D) systems have been studied theoretically. Contradictory experimental results on molecular transport in quasi-1D systems, such as zeolite structures, when both diffusion transport acceleration and the existence of the diffusion mode with lower particle

  6. Interaction of environmental contaminants with zebrafish organic anion transporting polypeptide, Oatp1d1 (Slco1d1)

    Popovic, Marta; Zaja, Roko [Laboratory for Molecular Ecotoxicology, Division for Marine and Environmental Research, Rudjer Boskovic Institute, Bijenicka 54, 10 000 Zagreb (Croatia); Fent, Karl [University of Applied Sciences Northwestern Switzerland, School of Life Sciences, Gründenstrasse 40, CH-4132 Muttenz (Switzerland); Swiss Federal Institute of Technology (ETH Zürich), Department of Environmental System Sciences, Institute of Biogeochemistry and Pollution Dynamics, CH-8092 Zürich (Switzerland); Smital, Tvrtko, E-mail: smital@irb.hr [Laboratory for Molecular Ecotoxicology, Division for Marine and Environmental Research, Rudjer Boskovic Institute, Bijenicka 54, 10 000 Zagreb (Croatia)

    2014-10-01

    Polyspecific transporters from the organic anion transporting polypeptide (OATP/Oatp) superfamily mediate the uptake of a wide range of compounds. In zebrafish, Oatp1d1 transports conjugated steroid hormones and cortisol. It is predominantly expressed in the liver, brain and testes. In this study we have characterized the transport of xenobiotics by the zebrafish Oatp1d1 transporter. We developed a novel assay for assessing Oatp1d1 interactors using the fluorescent probe Lucifer yellow and transient transfection in HEK293 cells. Our data showed that numerous environmental contaminants interact with zebrafish Oatp1d1. Oatp1d1 mediated the transport of diclofenac with very high affinity, followed by high affinity towards perfluorooctanesulfonic acid (PFOS), nonylphenol, gemfibrozil and 17α-ethinylestradiol; moderate affinity towards carbaryl, diazinon and caffeine; and low affinity towards metolachlor. Importantly, many environmental chemicals acted as strong inhibitors of Oatp1d1. A strong inhibition of Oatp1d1 transport activity was found by perfluorooctanoic acid (PFOA), chlorpyrifos-methyl, estrone (E1) and 17β-estradiol (E2), followed by moderate to low inhibition by diethyl phthalate, bisphenol A, 7-acetyl-1,1,3,4,4,6-hexamethyl-1,2,3,4 tetrahydronapthalene and clofibrate. In this study we identified Oatp1d1 as a first Solute Carrier (SLC) transporter involved in the transport of a wide range of xenobiotics in fish. Considering that Oatps in zebrafish have not been characterized before, our work on zebrafish Oatp1d1 offers important new insights on the understanding of uptake processes of environmental contaminants, and contributes to the better characterization of zebrafish as a model species. - Highlights: • We optimized a novel assay for determination of Oatp1d1 interactors • Oatp1d1 is the first SLC characterized fish xenobiotic transporter • PFOS, nonylphenol, diclofenac, EE2, caffeine are high affinity Oatp1d1substrates • PFOA, chlorpyrifos

  7. Synthetic Seismogram Modeling.

    1982-11-15

    various phases ( designated A, B, C, etc.) are indicated on the seismic record section at the top of the diagram. The observed travel times show a good...structure of the Yellowstone aperture seismic array (LAS), Moatana, U.S. region and experiment design , J. Geophys. Geol. Suwv. Open File Rep. 1671, 1972. Res...also display little For clarity in both typography and conitext, we coherence in waveform or even in the envelope of shall henceforth write -P-bar in

  8. From nonfinite to finite 1D arrays of origami tiles.

    Wu, Tsai Chin; Rahman, Masudur; Norton, Michael L

    2014-06-17

    average solution structures for blocks is more readily achieved using computer models than using direct imaging methods. The development of scalable 1D-origami arrays composed of uniquely addressable components is a logical, if not necessary, step in the evolution of higher order fully addressable structures. Our research into the fabrication of arrays has led us to generate a listing of several important areas of future endeavor. Of high importance is the re-enforcement of the mechanical properties of the building blocks and the organization of multiple arrays on a surface of technological importance. While addressing this short list of barriers to progress will prove challenging, coherent development along each of these lines of inquiry will accelerate the appearance of commercial scale molecular manufacturing.

  9. Running On-Demand Strong Ground Motion Simulations with the Second-Generation Broadband Platform

    Callaghan, S.; Maechling, P. J.; Graves, R. W.; Somerville, P. G.; Collins, N.; Olsen, K. B.; Imperatori, W.; Jones, M.; Archuleta, R. J.; Schmedes, J.; Jordan, T. H.; Broadband Platform Working Group

    2010-12-01

    We have developed the second-generation Southern California Earthquake Center (SCEC) Broadband Platform by integrating scientific modeling codes into a system capable of computing broadband seismograms (0-10 Hz) for historical and scenario earthquakes in California. The SCEC Broadband Platform is a collaborative software development project involving SCEC researchers, graduate students, and the SCEC Community Modeling Environment (SCEC/CME) software development group. SCEC scientific groups have contributed software modules to the Broadband Platform including rupture generation, low-frequency deterministic seismogram synthesis, high-frequency stochastic seismogram synthesis, and non-linear site effects. These complex scientific codes have been integrated into a system that supports easy on-demand computation of broadband seismograms. The SCEC Broadband Platform is designed to be used by both scientific and engineering researchers familiar with ground motion simulations. Users may calculate broadband seismograms for both historical earthquakes (validation events including Northridge, Loma Prieta, and Landers) and user-defined earthquakes. Users may select among various codebases for rupture generation, low-frequency synthesis, high-frequency synthesis, and incorporation of site effects, with the option of running a goodness-of-fit comparison against observed or simulated seismograms. The platform produces a variety of data products, including broadband seismograms, rupture visualizations, and goodness-of-fit plots. The Broadband Platform was implemented using software development best practices that support software accuracy, reliability, and ease of use, including version control, user documentation, acceptance tests, and formal software releases. Users can install the platform on their own machine, verify that it is installed correctly, and run their own simulations on demand. The Broadband Platform enables users to run complex ground motion modeling codes without

  10. The Gain Properties of 1-D Active Photonic Crystal

    2003-01-01

    The terminology 'ID frequency'(w ID) is proposed after analyzing the 1D active photonic crystal based on the transfer matrix method. The relationship between wID and the structure parameters of the photonic crystal is investigated.

  11. Severe Hypertriglyceridemia in Glut1D on Ketogenic Diet.

    Klepper, Joerg; Leiendecker, Baerbel; Heussinger, Nicole; Lausch, Ekkehart; Bosch, Friedrich

    2016-04-01

    High-fat ketogenic diets are the only treatment available for Glut1 deficiency (Glut1D). Here, we describe an 8-year-old girl with classical Glut1D responsive to a 3:1 ketogenic diet and ethosuximide. After 3 years on the diet a gradual increase of blood lipids was followed by rapid, severe asymptomatic hypertriglyceridemia (1,910 mg/dL). Serum lipid apheresis was required to determine liver, renal, and pancreatic function. A combination of medium chain triglyceride-oil and a reduction of the ketogenic diet to 1:1 ratio normalized triglyceride levels within days but triggered severe myoclonic seizures requiring comedication with sultiam. Severe hypertriglyceridemia in children with Glut1D on ketogenic diets may be underdiagnosed and harmful. In contrast to congenital hypertriglyceridemias, children with Glut1D may be treated effectively by dietary adjustments alone.

  12. Yield and depth Estimation of Selected NTS Nuclear and SPE Chemical Explosions Using Source Equalization by modeling Local and Regional Seismograms (Invited)

    Saikia, C. K.; Roman-nieves, J. I.; Woods, M. T.

    2013-12-01

    Source parameters of nuclear and chemical explosions are often estimated by matching either the corner frequency and spectral level of a single event or the spectral ratio when spectra from two events are available with known source parameters for one. In this study, we propose an alternative method in which waveforms from two or more events can be simultaneously equalized by setting the differential of the processed seismograms at one station from any two individual events to zero. The method involves convolving the equivalent Mueller-Murphy displacement source time function (MMDSTF) of one event with the seismogram of the second event and vice-versa, and then computing their difference seismogram. MMDSTF is computed at the elastic radius including both near and far-field terms. For this method to yield accurate source parameters, an inherent assumption is that green's functions for the any paired events from the source to a receiver are same. In the frequency limit of the seismic data, this is a reasonable assumption and is concluded based on the comparison of green's functions computed for flat-earth models at various source depths ranging from 100m to 1Km. Frequency domain analysis of the initial P wave is, however, sensitive to the depth phase interaction, and if tracked meticulously can help estimating the event depth. We applied this method to the local waveforms recorded from the three SPE shots and precisely determined their yields. These high-frequency seismograms exhibit significant lateral path effects in spectrogram analysis and 3D numerical computations, but the source equalization technique is independent of any variation as long as their instrument characteristics are well preserved. We are currently estimating the uncertainty in the derived source parameters assuming the yields of the SPE shots as unknown. We also collected regional waveforms from 95 NTS explosions at regional stations ALQ, ANMO, CMB, COR, JAS LON, PAS, PFO and RSSD. We are

  13. TBC1D24 genotype–phenotype correlation

    Balestrini, Simona; Milh, Mathieu; Castiglioni, Claudia; Lüthy, Kevin; Finelli, Mattea J.; Verstreken, Patrik; Cardon, Aaron; Stražišar, Barbara Gnidovec; Holder, J. Lloyd; Lesca, Gaetan; Mancardi, Maria M.; Poulat, Anne L.; Repetto, Gabriela M.; Banka, Siddharth; Bilo, Leonilda; Birkeland, Laura E.; Bosch, Friedrich; Brockmann, Knut; Cross, J. Helen; Doummar, Diane; Félix, Temis M.; Giuliano, Fabienne; Hori, Mutsuki; Hüning, Irina; Kayserili, Hulia; Kini, Usha; Lees, Melissa M.; Meenakshi, Girish; Mewasingh, Leena; Pagnamenta, Alistair T.; Peluso, Silvio; Mey, Antje; Rice, Gregory M.; Rosenfeld, Jill A.; Taylor, Jenny C.; Troester, Matthew M.; Stanley, Christine M.; Ville, Dorothee; Walkiewicz, Magdalena; Falace, Antonio; Fassio, Anna; Lemke, Johannes R.; Biskup, Saskia; Tardif, Jessica; Ajeawung, Norbert F.; Tolun, Aslihan; Corbett, Mark; Gecz, Jozef; Afawi, Zaid; Howell, Katherine B.; Oliver, Karen L.; Berkovic, Samuel F.; Scheffer, Ingrid E.; de Falco, Fabrizio A.; Oliver, Peter L.; Striano, Pasquale; Zara, Federico

    2016-01-01

    Objective: To evaluate the phenotypic spectrum associated with mutations in TBC1D24. Methods: We acquired new clinical, EEG, and neuroimaging data of 11 previously unreported and 37 published patients. TBC1D24 mutations, identified through various sequencing methods, can be found online (http://lovd.nl/TBC1D24). Results: Forty-eight patients were included (28 men, 20 women, average age 21 years) from 30 independent families. Eighteen patients (38%) had myoclonic epilepsies. The other patients carried diagnoses of focal (25%), multifocal (2%), generalized (4%), and unclassified epilepsy (6%), and early-onset epileptic encephalopathy (25%). Most patients had drug-resistant epilepsy. We detail EEG, neuroimaging, developmental, and cognitive features, treatment responsiveness, and physical examination. In silico evaluation revealed 7 different highly conserved motifs, with the most common pathogenic mutation located in the first. Neuronal outgrowth assays showed that some TBC1D24 mutations, associated with the most severe TBC1D24-associated disorders, are not necessarily the most disruptive to this gene function. Conclusions: TBC1D24-related epilepsy syndromes show marked phenotypic pleiotropy, with multisystem involvement and severity spectrum ranging from isolated deafness (not studied here), benign myoclonic epilepsy restricted to childhood with complete seizure control and normal intellect, to early-onset epileptic encephalopathy with severe developmental delay and early death. There is no distinct correlation with mutation type or location yet, but patterns are emerging. Given the phenotypic breadth observed, TBC1D24 mutation screening is indicated in a wide variety of epilepsies. A TBC1D24 consortium was formed to develop further research on this gene and its associated phenotypes. PMID:27281533

  14. 1D photonic crystal sensor integrated in a microfluidic system

    Nunes, Pedro; Mortensen, Asger; Kutter, Jörg Peter

    2009-01-01

    A refractive index sensor was designed as a 1D resonator incorporated in a microfluidic channel, where aqueous solutions were injected. A sensitivity of 480 nm/RIU and a minimum difference of Deltan = 0.002 were determined.......A refractive index sensor was designed as a 1D resonator incorporated in a microfluidic channel, where aqueous solutions were injected. A sensitivity of 480 nm/RIU and a minimum difference of Deltan = 0.002 were determined....

  15. Supported plasma-made 1D heterostructures: perspectives and applications

    Borras, Ana; Macias-Montero, Manuel; Romero-Gomez, Pablo; Gonzalez-Elipe, Agustin R.

    2011-01-01

    Abstract Plasma related methods have been widely used in the fabrication of carbon nanotubes and nanofibres and semiconducting inorganic nanowires. A natural progression of the research in the field of 1D nanostructures is the synthesis of multicomponent nanowires and nanofibres. In this article we review the state of the art of the fabrication by plasma methods of 1D heterostructures including applications and perspectives. Furthermore, recent developments on the use of metal seeds (Ag, A...

  16. New Scotogenic Model of Neutrino Mass with $U(1)_D$ Gauge Interaction

    Ma, Ernest; Radovcic, Branimir

    2013-01-01

    We propose a new realization of the one-loop radiative model of neutrino mass generated by dark matter (scotogenic), where the particles in the loop have an additional $U(1)_D$ gauge symmetry, which may be exact or broken to $Z_2$. This model is relevant to a number of astrophysical observations, including AMS-02 and the dark matter distribution in dwarf galactic halos.

  17. Constraining the source location of the 30 May 2015 (Mw 7.9) Bonin deep-focus earthquake using seismogram envelopes of high-frequency P waveforms: Occurrence of deep-focus earthquake at the bottom of a subducting slab

    Takemura, Shunsuke; Maeda, Takuto; Furumura, Takashi; Obara, Kazushige

    2016-05-01

    In this study, the source location of the 30 May 2015 (Mw 7.9) deep-focus Bonin earthquake was constrained using P wave seismograms recorded across Japan. We focus on propagation characteristics of high-frequency P wave. Deep-focus intraslab earthquakes typically show spindle-shaped seismogram envelopes with peak delays of several seconds and subsequent long-duration coda waves; however, both the main shock and aftershock of the 2015 Bonin event exhibited pulse-like P wave propagations with high apparent velocities (~12.2 km/s). Such P wave propagation features were reproduced by finite-difference method simulations of seismic wave propagation in the case of slab-bottom source. The pulse-like P wave seismogram envelopes observed from the 2015 Bonin earthquake show that its source was located at the bottom of the Pacific slab at a depth of ~680 km, rather than within its middle or upper regions.

  18. 1D nanocrystals with precisely controlled dimensions, compositions, and architectures

    Pang, Xinchang; He, Yanjie; Jung, Jaehan; Lin, Zhiqun

    2016-09-01

    The ability to synthesize a diverse spectrum of one-dimensional (1D) nanocrystals presents an enticing prospect for exploring nanoscale size- and shape-dependent properties. Here we report a general strategy to craft a variety of plain nanorods, core-shell nanorods, and nanotubes with precisely controlled dimensions and compositions by capitalizing on functional bottlebrush-like block copolymers with well-defined structures and narrow molecular weight distributions as nanoreactors. These cylindrical unimolecular nanoreactors enable a high degree of control over the size, shape, architecture, surface chemistry, and properties of 1D nanocrystals. We demonstrate the synthesis of metallic, ferroelectric, upconversion, semiconducting, and thermoelectric 1D nanocrystals, among others, as well as combinations thereof.

  19. Quantum electrodynamics with 1D arti cial atoms

    Javadi, Alisa

    atom. One of the signatures and functions of a 1D atom is the nonlinear optical response at the single-photon level. A PCW chip is designed to experimentally study the transmission spectrum of an embedded QD. The transmission spectrum is shown to be modi_ed by 30% around the resonance of the QD......A 1D atom, a single quantum emitter coupled to a single optical mode, exhibits rich quantum electrodynamic (QED) e_ects and is thought to be the key ingredient for many applications in quantuminformation processing. Single quantum dots (QD) in photonic-crystal waveguides (PCW) constitute a robust...... platform for realizing a 1D atom, and are the subject of theoretical and experimental investigations in this thesis. We use _nite element method in 3D to calculate the local density of states (LDOS) in photonic-crystal membranes. The detailed spatial maps show strong inhibition of LDOS in the bandgap...

  20. Diffusion and particle mobility in 1D system

    Borman, V.D. [Moscow Engineering Physics Institute (State University), Kashirskoe shosse, 31, 115409 Moscow (Russian Federation); Johansson, B. [Condensed Matter Theory Group, Department of Physics, Box 530, Uppsala University, S-75121 Uppsala (Sweden); Applied Materials Physics, Department of Materials and Engineering, Royal Institute of Technology (KTH), S-10044 Stockholm (Sweden); Skorodumova, N.V. [Condensed Matter Theory Group, Department of Physics, Box 530, Uppsala University, S-75121 Uppsala (Sweden); Tronin, I.V. [Moscow Engineering Physics Institute (State University), Kashirskoe shosse, 31, 115409 Moscow (Russian Federation)]. E-mail: ivt@rbcmail.ru; Tronin, V.N. [Moscow Engineering Physics Institute (State University), Kashirskoe shosse, 31, 115409 Moscow (Russian Federation); Troyan, V.I. [Moscow Engineering Physics Institute (State University), Kashirskoe shosse, 31, 115409 Moscow (Russian Federation)

    2006-12-04

    The transport properties of one-dimensional (1D) systems have been studied theoretically. Contradictory experimental results on molecular transport in quasi-1D systems, such as zeolite structures, when both diffusion transport acceleration and the existence of the diffusion mode with lower particle mobility (single-file diffusion ({approx}t{sup 1/2})) have been reported, are consolidated in a consistent model. Transition from the single-file diffusion mode to an Einstein-like diffusion {approx}t with diffusion coefficient increasing with the density has been predicted to occur at large observation times.

  1. GIS-BASED 1-D DIFFUSIVE WAVE OVERLAND FLOW MODEL

    KALYANAPU, ALFRED [Los Alamos National Laboratory; MCPHERSON, TIMOTHY N. [Los Alamos National Laboratory; BURIAN, STEVEN J. [NON LANL

    2007-01-17

    This paper presents a GIS-based 1-d distributed overland flow model and summarizes an application to simulate a flood event. The model estimates infiltration using the Green-Ampt approach and routes excess rainfall using the 1-d diffusive wave approximation. The model was designed to use readily available topographic, soils, and land use/land cover data and rainfall predictions from a meteorological model. An assessment of model performance was performed for a small catchment and a large watershed, both in urban environments. Simulated runoff hydrographs were compared to observations for a selected set of validation events. Results confirmed the model provides reasonable predictions in a short period of time.

  2. On the D1-D5 conformal field theory

    Dijkgraaf, Robbert

    2000-03-01

    I give a review of some aspects of the D1-D5 conformal field theory that is dual to string theory on AdS 3 . Particular attention is paid to the gravitational interpretation of the elliptic genus as a sum over 3-manifolds.

  3. Suppression of spin-orbit effects in 1D system

    Entin, M. V.; Magarill, L. I.

    2004-01-01

    We report the absence of spin effects such as spin-galvanic effect, spin polarization and spin current under static electric field and inter-spin-subband absorption in 1D system with spin-orbit interaction of arbitrary form. It was also shown that the accounting for the direct interaction of electron spin with magnetic field violates this statement.

  4. Quantitative 1D saturation profiles on chalk by NMR

    Olsen, Dan; Topp, Simon; Stensgaard, Anders;

    1996-01-01

    Quantitative one-dimensional saturation profiles showing the distribution of water and oil in chalk core samples are calculated from NMR measurements utilizing a 1D CSI spectroscopy pulse sequence. Saturation profiles may be acquired under conditions of fluid flow through the sample. Results reveal...

  5. Ultracold spherical horizons in gauged N=1, d=4 supergravity

    Meessen, Patrick, E-mail: meessenpatrick@uniovi.e [Department of Physics, University of Oviedo, Avda. Calvo Sotelo s/n, E-33007 Oviedo (Spain); Ortin, Tomas, E-mail: Tomas.Ortin@cern.c [Instituto de Fisica Teorica UAM/CSIC, Facultad de Ciencias C-XVI, C.U. Cantoblanco, E-28049 Madrid (Spain)

    2010-10-04

    We show that the near-horizon limit of ultracold magnetic Reissner-Nordstroem-De Sitter black holes, whose geometry is the direct product of 2-dimensional Minkowski spacetime and a 2-sphere, preserves half of the supersymmetries of minimal R-gauged N=1, d=4 supergravity.

  6. Simulation of Organic Solar Cells Using AMPS-1D Program

    Samah G. Babiker

    2012-03-01

    Full Text Available The analysis of microelectronic and photonic structure in one dimension program [AMPS-1D] program has been successfully used to study inorganic solar cells. In this work the program has been used to optimize the performance of the organic solar cells. The cells considered consist of poly(2-methoxy-5-(3,7- dimethyloctyloxy-1,4-phenylenevinylene [MDMO-PPV

  7. Active damping of the 1D rocking mode

    Babakhani, Bayan; Vries, de Theo

    2010-01-01

    Active damping of a rotational vibration mode in the linear guidance of a precision machine in a one dimensional (1D) setting is considered in this paper. This so-called rocking mode presents itself in machines having linear actuation. The limitation this vibration mode imposes on the machine precis

  8. Nonclassical Particle Transport in the 1-D Diffusive Limit

    Vasques, Richard; Krycki, Kai

    2016-01-01

    This paper provides numerical results that demonstrate the validity of the nonclassical diffusion approximation to the nonclassical transport equation in certain 1-D diffusive systems. This result provides a more solid foundation in which to improve this theory for relevant nuclear applications.

  9. Velocity analysis and application of synthetic seismograms in the area of the Vranovice and the Nesvačilka troughs (Bohemian Massif

    Bibiana Brixová

    2016-06-01

    Full Text Available The paper presents the results of velocity analysis performed in the Nesvačilka and Vranovice troughs. The troughs extend in the south-eastern part of the Bohemian Massif (the Moravian Block. As both belong to the most promising areas of the Bohemian Massif in the search for and production of hydrocarbons, their geological and geophysical survey is very important. Therefore, one of the key points is to determine the accurate data on the depth of the significant geological and stratigraphic units, which form the Nesvačilka and the Vranovice troughs. For this purpose the velocity analysis and the application of synthetic seismograms have been defined and applied. The results indicate that the lithostratigraphic units of the studied region are characterized by a large velocity interval. Based on the data from well log measurements (check shots and synthetic seismograms the following velocities of seismic waves were determined in single lithostratigraphic units: 2.4–3.3 km/s in sediments of Flysch nappes, 2.7–3.6 km/s in the Palaeogene sediments, 3.3–4.3 km/s in the Jurassic sediments (3.7–5.1 km/s in carbonates and 3.5–4.8 km/s in pelites and conglomerates, 4–5.4 km/s in the Carboniferous sediments, and 4.6–6.6 km/s in the Devonian carbonates. Moreover, the synthetic seismograms and check shot results point to significant velocity interfaces. We discovered that: (a within the sediments of Flysch nappes velocities in Menilitic Formation are higher than in the Submenilitic and the Ždánice-Hustopeče formations, (b interface sediment of the Flysch nappes and Palaeogene deposits is characterized by a decrease of velocity, and (c big contrast of velocity reflects the boundary between the carbonates (the Devonian and the Jurassic and their surrounding rocks. The velocity analysis helps significantly for mapping of the Outer Carpathian Flysch nappes (the Pouzdřany Unit and especially the Ždánice Unit, the Neogene deposits, the

  10. Effect of the twist operator in the D1D5 CFT

    Carson, Zaq; Mathur, Samir D; Turton, David

    2014-01-01

    The D1D5 CFT has been very useful in the study of black holes. The interaction in this theory involves a twist operator, which links together different copies of a free CFT. For the bosonic fields, we examine the action of this twist when it links together CFT copies with winding numbers M and N to produce a copy with winding M+N. Starting with the vacuum state generates a squeezed state, which we compute. Starting with an initial excitation on one of the copies gives a linear combination of excitations on the final state, which we also compute. These results generalize earlier computations where these quantities were computed for the special case M=N=1. Our results should help in understanding the thermalization process in the D1D5 CFT, which gives the dual of black hole formation in the bulk.

  11. Design, implementation and analysis of fully digital 1-D controllable multiscroll chaos

    Mansingka, Abhinav S.

    2011-12-01

    This paper introduces the fully digital implementation of a 1-D multiscroll chaos generator based on a staircase nonlinearity in the 3rd-order jerk system using the Euler approximation. For the first time, digital design is exploited to provide real-time controllability of (i) number of scrolls, (ii) position in 1-D space, (iii) Euler step size and (iv) system parameter. The effect of variations in these fields on the maximum Lyapunov exponent (MLE) is analyzed. The system is implemented using Verilog HDL and synthesized on an Xilinx Virtex 4 FPGA, exhibiting area utilization less than 3.5% and high performance with experimentally verified throughput up to 3.33 Gbits/s. This fully digital system enables applications in modulation schemes and chaos-based cryptosystems without analog to digital conversion. © 2011 IEEE.

  12. Correction of lunar seismograms for instrumental and near-surface effects and constraints on the velocity structure of the lunar interior

    Horvath, P.

    1982-01-01

    Long-period lunar seismograms were studied with the aim of identifying consistent sets of direct shear and secondary wave arrivals, thus constraining the velocities in the lunar mantle and the depths of the velocity discontinuities. Two velocity models were used to locate the natural impacts and the shallow moonquakes and to obtain the travel time residuals. Seismic sections were made of the radial, transverse, and vertical components of ground motion for impacts, shallow, and deep moonquakes in order to search for consistent sets of secondary wave arrivals. No conclusive set of secondary arrivals could be recognized on the seismic sections and thus the velocities and depths of the velocity discontinuities cannot be severely constrained by secondary arrivals. It is likely that the crust is thinner than 50 km and that a first-order discontinuity separates the upper and lower crust at a depth of between 20 and 30 km.

  13. D1-D5-P microstates at the cap

    Giusto, Stefano; Mathur, Samir D; Turton, David

    2012-01-01

    The geometries describing D1-D5-P bound states in string theory have three regions: flat asymptotics, an anti-de Sitter throat, and a 'cap' region at the bottom of the throat. We identify the CFT description of a known class of supersymmetric D1-D5-P microstate geometries which describe degrees of freedom in the cap region. The class includes both regular solutions and solutions with conical defects, and generalizes configurations with known CFT descriptions: a parameter related to spectral flow in the CFT is generalized from integer to fractional values. We provide strong evidence for this identification by comparing the massless scalar excitation spectrum between gravity and CFT and finding exact agreement.

  14. New D1-D5-P geometries from string amplitudes

    Giusto, Stefano; Turton, David

    2011-01-01

    We derive the long range supergravity fields sourced by a D1-D5-P bound state from disk amplitudes for massless closed string emission. We suggest that since the parameter controlling the string perturbation expansion for this calculation decreases with distance from the bound state, the resulting asymptotic fields are valid even in the regime of parameters in which there is a classical black hole solution with the same charges. The supergravity fields differ from the black hole solution by multipole moments and are more general than those contained within known classes of solutions in the literature, whilst still preserving four supersymmetries. Our results support the conjecture that the black hole solution should be interpreted as a coarse-grained description rather than an exact description of the gravitational field sourced by D1-D5-P bound states in this regime of parameters.

  15. Phase diagram of a bulk 1d lattice Coulomb gas

    Démery, V.; Monsarrat, R.; Dean, D. S.; Podgornik, R.

    2016-01-01

    The exact solution, via transfer matrix, of the simple one-dimensional lattice Coulomb gas (1d LCG) model can reproduce peculiar features of ionic liquid capacitors, such as overscreening, layering, and camel- and bell-shaped capacitance curves. Using the same transfer matrix method, we now compute the bulk properties of the 1d LCG in the constant voltage ensemble. We unveil a phase diagram with rich structure exhibiting low-density disordered and high-density ordered phases, separated by a first-order phase transition at low temperature; the solid state at full packing can be ordered or not, depending on the temperature. This phase diagram, which is strikingly similar to its three-dimensional counterpart, also sheds light on the behaviour of the confined system.

  16. Iron-based 1D nanostructures by electrospinning process.

    Eid, Cynthia; Brioude, Arnaud; Salles, Vincent; Plenet, Jean-Claude; Asmar, Roy; Monteil, Yves; Khoury, Randa; Khoury, Antonio; Miele, Philippe

    2010-03-26

    Iron-based 1D nanostructures have been successfully prepared using an electrospinning technique and varying the pyrolysis atmospheres. Hematite (Fe(2)O(3)) nanotubes and polycrystalline Fe(3)C nanofibers were obtained by simple air or mixed gas (H(2), Ar) annealing treatments. Using the air annealing treatment, a high control of the morphology as well as of the wall thickness of the nanotubes was demonstrated with a direct influence of the starting polymer concentration. When mixed gases (H(2) and Ar) were used for the annealing treatments, for the first time polycrystalline Fe(3)C nanofibers composed of carbon graphitic planes were obtained, ensuring Fe(3)C nanoparticle stability and nanofiber cohesion. The morphology and structural properties of all these iron-based 1D nanostructures were fully characterized by SEM, TEM, XRD and Raman spectroscopy.

  17. Developing 1D nanostructure arrays for future nanophotonics

    Cooke DG

    2006-01-01

    Full Text Available AbstractThere is intense and growing interest in one-dimensional (1-D nanostructures from the perspective of their synthesis and unique properties, especially with respect to their excellent optical response and an ability to form heterostructures. This review discusses alternative approaches to preparation and organization of such structures, and their potential properties. In particular, molecular-scale printing is highlighted as a method for creating organized pre-cursor structure for locating nanowires, as well as vapor–liquid–solid (VLS templated growth using nano-channel alumina (NCA, and deposition of 1-D structures with glancing angle deposition (GLAD. As regards novel optical properties, we discuss as an example, finite size photonic crystal cavity structures formed from such nanostructure arrays possessing highQand small mode volume, and being ideal for developing future nanolasers.

  18. Polaron in a quasi 1D cylindrical quantum wire

    I.Nsangou

    2005-01-01

    Full Text Available Polaron states in a quasi 1D cylindrical quantum wire with a parabolic confinement potential are investigated applying the Feynman variational principle. The effect of the wire radius on the polaron ground state energy level, the mass and the Fröhlich electron-phonon-coupling constant are obtained for the case of a quasi 1D cylindrical quantum wire. The effect of anisotropy of the structure on the polaron ground state energy level and the mass are also investigated. It is observed that as the wire radius tends to zero, the polaron mass and energy diverge logarithmically. The polaron mass and energy differ from the canonical strong-coupling behavior by the Fröhlich electron-phonon coupling constant and the radius of the quasi 1D cylindrical quantum wire that are expressed through a logarithmic function. Moreover, it is observed that the polaron energy and mass for strong coupling for the case of the quasi 1D cylindrical quantum wire are greater than those for bulk crystals. It is also observed that the anisotropy of the structure considerably affects both the polaron ground state energy level and the mass. It is found that as the radius of the cylindrical wire reduces, the regimes of the weak and intermediate coupling polaron shorten while the region of the strong coupling polaron broadens and extends into those of the weak and intermediate ones. Analytic expressions for the polaron ground state energy level and mass are derived for the case of strong coupling polarons.

  19. Ultrahigh-Q nanocavity with 1D photonic gap.

    Notomi, M; Kuramochi, E; Taniyama, H

    2008-07-21

    Recently, various wavelength-sized cavities with theoretical Q values of approximately 10(8) have been reported, however, they all employ 2D or 3D photonic band gaps to realize strong light confinement. Here we numerically demonstrate that ultrahigh-Q (2.0x10(8)) and wavelength-sized (V(eff) approximately 1.4(lambda/n)3) cavities can be achieved by employing only 1D periodicity.

  20. Development of 1D Liner Compression Code for IDL

    Shimazu, Akihisa; Slough, John; Pancotti, Anthony

    2015-11-01

    A 1D liner compression code is developed to model liner implosion dynamics in the Inductively Driven Liner Experiment (IDL) where FRC plasmoid is compressed via inductively-driven metal liners. The driver circuit, magnetic field, joule heating, and liner dynamics calculations are performed at each time step in sequence to couple these effects in the code. To obtain more realistic magnetic field results for a given drive coil geometry, 2D and 3D effects are incorporated into the 1D field calculation through use of correction factor table lookup approach. Commercial low-frequency electromagnetic fields solver, ANSYS Maxwell 3D, is used to solve the magnetic field profile for static liner condition at various liner radius in order to derive correction factors for the 1D field calculation in the code. The liner dynamics results from the code is verified to be in good agreement with the results from commercial explicit dynamics solver, ANSYS Explicit Dynamics, and previous liner experiment. The developed code is used to optimize the capacitor bank and driver coil design for better energy transfer and coupling. FRC gain calculations are also performed using the liner compression data from the code for the conceptual design of the reactor sized system for fusion energy gains.

  1. Enhancing Solar Cell Efficiencies through 1-D Nanostructures

    Yu Kehan

    2008-01-01

    Full Text Available Abstract The current global energy problem can be attributed to insufficient fossil fuel supplies and excessive greenhouse gas emissions resulting from increasing fossil fuel consumption. The huge demand for clean energy potentially can be met by solar-to-electricity conversions. The large-scale use of solar energy is not occurring due to the high cost and inadequate efficiencies of existing solar cells. Nanostructured materials have offered new opportunities to design more efficient solar cells, particularly one-dimensional (1-D nanomaterials for enhancing solar cell efficiencies. These 1-D nanostructures, including nanotubes, nanowires, and nanorods, offer significant opportunities to improve efficiencies of solar cells by facilitating photon absorption, electron transport, and electron collection; however, tremendous challenges must be conquered before the large-scale commercialization of such cells. This review specifically focuses on the use of 1-D nanostructures for enhancing solar cell efficiencies. Other nanostructured solar cells or solar cells based on bulk materials are not covered in this review. Major topics addressed include dye-sensitized solar cells, quantum-dot-sensitized solar cells, and p-n junction solar cells.

  2. The stability of 1-D soliton in transverse direction

    Verma, Deepa; Bera, Ratan Kumar; Das, Amita; Kaw, Predhiman

    2016-12-01

    The complete characterization of the exact 1-D solitary wave solutions (both stationary and propagating) for light plasma coupled system have been studied extensively in the parameter space of light frequency and the group speed [Poornakala et al., Phys. Plasmas 9(5), 1820 (2002)]. It has been shown in 1-D that solutions with single light wave peak and paired structures are stable and hence long lived. However, solutions having multiple peaks of light wave are unstable due to Raman scattering instability [Saxena et al., Phys. Plasmas 14, 072307 (2007)]. Here, we have shown with the help of 2-D fluid simulation that single peak and paired solutions too get destabilized by the transverse filamentation instability. The numerical growth rates obtained from simulations is seen to compare well with the analytical values. It is also shown that multiple peaks solitons first undergo the regular 1-D forward Raman scattering instability. Subsequently, they undergo a distinct second phase of destabilization through transverse filamentation instability. This is evident from the structure as well as the plot of the perturbed energy which shows a second phase of growth after saturating initially. The growth rate of the filamentation instability being comparatively slower than the forward Raman instability this phase comes quite late and is clearly distinguishable.

  3. Homogenization of 1D and 2D magnetoelastic lattices

    Schaeffer Marshall

    2015-01-01

    Full Text Available This paper investigates the equivalent in-plane mechanical properties of one dimensional (1D and two dimensional (2D, periodic magneto-elastic lattices. A lumped parameter model describes the lattices using magnetic dipole moments in combination with axial and torsional springs. The homogenization procedure is applied to systems linearized about stable configurations, which are identified by minimizing potential energy. Simple algebraic expressions are derived for the properties of 1D structures. Results for 1D lattices show that a variety of stiffness changes are possible through reconfiguration, and that magnetization can either stiffen or soften a structure. Results for 2D hexagonal and re-entrant lattices show that both reconfigurations and magnetization have drastic effects on the mechanical properties of lattice structures. Lattices can be stiffened or softened and the Poisson’s ratio can be tuned. Furthermore for certain hexagonal lattices the sign of Poisson’s ratio can change by varying the lattice magnetization. In some cases presented, analytical and numerically estimated equivalent properties are validated through numerical simulations that also illustrate the unique characteristics of the investigated configurations.

  4. Supported plasma-made 1D heterostructures: perspectives and applications

    Borras, Ana; Macias-Montero, Manuel; Romero-Gomez, Pablo; Gonzalez-Elipe, Agustin R, E-mail: anaisabel.borras@icmse.csic.es [Materials Science Institute of Seville (CSIC-Universidad Sevilla), C/Americo Vespucio 49 41092, Sevilla (Spain)

    2011-05-04

    Plasma-related methods have been widely used in the fabrication of carbon nanotubes and nanofibres (NFs) and semiconducting inorganic nanowires (NWs). A natural progression of the research in the field of 1D nanostructures is the synthesis of multicomponent NWs and NFs. In this paper we review the state of the art of the fabrication by plasma methods of 1D heterostructures including applications and perspectives. Furthermore, recent developments on the use of metal seeds (Ag, Au, Pt) to obtain metal-oxide nanostructures are also extensively described. Results are shown for various metal substrates, either metal foils or supported nanoparticles/thin films of the metal where the effects of the size, surface coverage, percolation degree and thickness of the metal seeds have been systematically evaluated. The possibilities of the process are illustrated by the preparation of nanostructured films and supported NFs of different metal-oxides (Ag, Au and SiO{sub 2}, TiO{sub 2}, ZnO). Particularly, in the case of silver, the application of an oxygen plasma treatment prior to the deposition of the oxide was critical for efficiently controlling the growth of the 1D heterostructures. A phenomenological model is proposed to account for the thin-film nanostructuring and fibre formation by considering basic phenomena such as stress relaxation, inhomogeneities in the plasma sheath electrical field and the local disturbance of the oxide growth.

  5. Molecular characterization of zebrafish Oatp1d1 (Slco1d1), a novel organic anion-transporting polypeptide.

    Popovic, Marta; Zaja, Roko; Fent, Karl; Smital, Tvrtko

    2013-11-22

    The organic anion-transporting polypeptide (OATP/Oatp) superfamily includes a group of polyspecific transporters that mediate transport of large amphipathic, mostly anionic molecules across cell membranes of eukaryotes. OATPs/Oatps are involved in the disposition and elimination of numerous physiological and foreign compounds. However, in non-mammalian species, the functional properties of Oatps remain unknown. We aimed to elucidate the role of Oatp1d1 in zebrafish to gain insights into the functional and structural evolution of the OATP1/Oatp1 superfamily. We show that diversification of the OATP1/Oatp1 family occurs after the emergence of jawed fish and that the OATP1A/Oatp1a and OATP1B/Oatp1b subfamilies appeared at the root of tetrapods. The Oatp1d subfamily emerged in teleosts and is absent in tetrapods. The zebrafish Oatp1d1 is similar to mammalian OATP1A/Oatp1a and OATP1B/Oatp1b members, with the main physiological role in transport and balance of steroid hormones. Oatp1d1 activity is dependent upon pH gradient, which could indicate bicarbonate exchange as a mode of transport. Our analysis of evolutionary conservation and structural properties revealed that (i) His-79 in intracellular loop 3 is conserved within OATP1/Oatp1 family and is crucial for the transport activity; (ii) N-glycosylation impacts membrane targeting and is conserved within the OATP1/Oatp1 family with Asn-122, Asn-133, Asn-499, and Asn-512 residues involved; (iii) the evolutionarily conserved cholesterol recognition interaction amino acid consensus motif is important for membrane localization; and (iv) Oatp1d1 is present in dimeric and possibly oligomeric form in the cell membrane. In conclusion, we describe the first detailed characterization of a new Oatp transporter in zebrafish, offering important insights into the functional evolution of the OATP1/Oatp1 family and the physiological role of Oatp1d1.

  6. Coupling of Nod1D and HOTCHANNEL: static case; Acoplamiento de Nod1D y HOTCHANNEL: caso estatico

    Gomez T, A.M. [IPN-ESFM, 07738 Mexico D.F. (Mexico); Ovando C, R. [IIE-Gcia. de Energia Nuclear, Cuernavaca, Morelos (Mexico)]. e-mail: rovando@iie.org.mx

    2003-07-01

    In this work the joining of the programs Nod1D and HOTCHANNEL, developed in the National Polytechnic Institute (IPN) and in the Electrical Research Institute (IIE) respectively is described. The first one allows to study the neutronic of a nuclear reactor and the second one allows to carry out the analysis of hot channel of a Boiling Water Reactor (BWR). Nod1 D is a program that it solves by nodal methods type finite element those diffusion equations in multigroup, and it is the static part of Nod Kin that it solves the diffusion equation in their time dependent part. For another side HOTCHANNEL is based on a mathematical model constituted by four conservation equations (two of mass conservation, one of motion quantity and one of energy), which are solved applying one discretization in implicit finite differences. Both programs have been verified in independent form using diverse test problems. In this work the modifications that were necessary to carry out to both for obtaining a coupled program that it provides the axial distribution of the neutron flux, the power, the burnup and the void fraction, among others parameters as much as neutronic as thermal hydraulics are described. Those are also mentioned limitations, advantages and disadvantages of the final product to which has been designated Nod1 D-HotChn. Diverse results for the Cycle 1 of the Laguna Verde Unit 1 reactor of the Nucleo electric central comparing them with those obtained directly with the CoreMasterPresto code are provided. (Author)

  7. Numerical simulation of Ge solar cells using D-AMPS-1D code

    Barrera, Marcela, E-mail: barrera@tandar.cnea.gov.ar [Comision Nacional de Energia Atomica, Avenida General Paz 1499, San Martin 1650, Buenos Aires (Argentina); Consejo Nacional de Investigaciones Cientificas y Tecnicas (CONICET) (Argentina); Rubinelli, Francisco [Instituto de Desarrollo Tecnologico para la Industria Quimica (INTEC)-CONICET, Gueemes 3450, Santa Fe 3000 (Argentina); Rey-Stolle, Ignacio [Instituto de Energia Solar, Universidad Politecnica de Madrid, Avenida Complutense 30, Madrid 28040 (Spain); Pla, Juan [Comision Nacional de Energia Atomica, Avenida General Paz 1499, San Martin 1650, Buenos Aires (Argentina); Consejo Nacional de Investigaciones Cientificas y Tecnicas (CONICET) (Argentina)

    2012-08-15

    A solar cell is a solid state device that converts the energy of sunlight directly into electricity by the photovoltaic effect. When light with photon energies greater than the band gap is absorbed by a semiconductor material, free electrons and free holes are generated by optical excitation in the material. The main characteristic of a photovoltaic device is the presence of internal electric field able to separate the free electrons and holes so they can pass out of the material to the external circuit before they recombine. Numerical simulation of photovoltaic devices plays a crucial role in their design, performance prediction, and comprehension of the fundamental phenomena ruling their operation. The electrical transport and the optical behavior of the solar cells discussed in this work were studied with the simulation code D-AMPS-1D. This software is an updated version of the one-dimensional (1D) simulation program Analysis of Microelectronic and Photonic Devices (AMPS) that was initially developed at The Penn State University, USA. Structures such as homojunctions, heterojunctions, multijunctions, etc., resulting from stacking layers of different materials can be studied by appropriately selecting characteristic parameters. In this work, examples of cells simulation made with D-AMPS-1D are shown. Particularly, results of Ge photovoltaic devices are presented. The role of the InGaP buffer on the device was studied. Moreover, a comparison of the simulated electrical parameters with experimental results was performed.

  8. BGK electron solitary waves: 1D and 3D

    L.-J. Chen

    2002-01-01

    Full Text Available This paper presents new results for 1D BGK electron solitary wave (phase-space electron hole solutions and, based on the new results, extends the solutions to include the 3D electrical interaction (E ~ 1/r 2 of charged particles. Our approach for extending to 3D is to solve the nonlinear 3D Poisson and 1D Vlasov equations based on a key feature of 1D electron hole (EH solutions; the positive core of an EH is screened by electrons trapped inside the potential energy trough. This feature has not been considered in previous studies. We illustrate this key feature using an analytical model and argue that the feature is independent of any specific model. We then construct azimuthally symmetric EH solutions under conditions where electrons are highly field-aligned and ions form a uniform background along the magnetic field. Our results indicate that, for a single humped electric potential, the parallel cut of the perpendicular component of the electric field (E⊥ is unipolar and that of the parallel component (E|| bipolar, reproducing the multi-dimensional features of the solitary waves observed by the FAST satellite. Our analytical solutions presented in this article capture the 3D electric interaction and the observed features of (E|| and E⊥. The solutions predict a dependence of the parallel width-amplitude relation on the perpendicular size of EHs. This dependence can be used in conjunction with experimental data to yield an estimate of the typical perpendicular size of observed EHs; this provides important information on the perpendicular span of the source region as well as on how much electrostatic energy is transported by the solitary waves.

  9. Phase-sensitive detection of Bragg scattering at 1D optical lattices

    Slama, S; Deh, B; Ludewig, A; Zimmermann, C; Courteille, P W; Courteille, Ph.W.

    2004-01-01

    We report on the observation of Bragg scattering at 1D atomic lattices. Cold atoms are confined by optical dipole forces at the antinodes of a standing wave generated by the two counter-propagating modes of a laser-driven high-finesse ring cavity. By heterodyning the Bragg-scattered light with a reference beam, we obtain detailed information on phase shifts imparted by the Bragg scattering process. Being deep in the Lamb-Dicke regime, the scattered light is not broadened by the motion of individual atoms. In contrast, we have detected signatures of global translatory motion of the atomic grating.

  10. Cold beam of isotopically pure Yb atoms by deflection using 1D-optical molasses

    Rathod, K. D.; Singh, P. K.; Natarajan, Vasant

    2014-09-01

    We demonstrate generation of an isotopically pure beam of laser-cooled Yb atoms by deflection using 1D-optical molasses. Atoms in a collimated thermal beam are first slowed using a Zeeman Slower. They are then subjected to a pair of molasses beams inclined at $45^\\circ$ with respect to the slowed atomic beam. The slowed atoms are deflected and probed at a distance of 160 mm. We demonstrate selective deflection of the bosonic isotope $^{174}$Yb, and the fermionic isotope $^{171}$Yb. Using a transient measurement after the molasses beams are turned on, we find a longitudinal temperature of 41 mK.

  11. Cold beam of isotopically pure Yb atoms by deflection using 1D-optical molasses

    K D Rathod; P K Singh; Vasant Natarajan

    2014-09-01

    We demonstrate the generation of an isotopically pure beam of laser-cooled Yb atoms by deflection using 1D-optical molasses. Atoms in a collimated thermal beam are first slowed using a Zeeman slower. They are then subjected to a pair of molasses beams inclined at 45° with respect to the slowed atomic beam. The slowed atoms are deflected and probed at a distance of 160 mm. We demonstrate the selective deflection of the bosonic isotope 174Yb and the fermionic isotope 171Yb. Using a transient measurement after the molasses beams are turned on, we find a longitudinal temperature of 41 mK.

  12. Excitation of multiple resonances in 1D Anderson localized systems for efficient light amplification.

    Choi, Seung Ho; Byun, Kyung Min; Kim, Young L

    2015-03-01

    Excitation of hybridized multiple resonances can be an effective route for coherent light generation in irregular 1D systems larger than the localization length of light. Necklace states are often considered to have nonlocalized states. However, we propose that some hybridized/coupled states can have high-resonant tunneling with spatially extended fields. If strong localization properties are preserved in hybridized resonances, the excitation of such states allows for deposition of the excitation energy deep into the structure and spatial overlap with local gain regions. This result could allow for better utilizing hybridized resonances in biological or natural photonic systems.

  13. Nonlocal order parameters for the 1D Hubbard model.

    Montorsi, Arianna; Roncaglia, Marco

    2012-12-07

    We characterize the Mott-insulator and Luther-Emery phases of the 1D Hubbard model through correlators that measure the parity of spin and charge strings along the chain. These nonlocal quantities order in the corresponding gapped phases and vanish at the critical point U(c)=0, thus configuring as hidden order parameters. The Mott insulator consists of bound doublon-holon pairs, which in the Luther-Emery phase turn into electron pairs with opposite spins, both unbinding at U(c). The behavior of the parity correlators is captured by an effective free spinless fermion model.

  14. Main: 1D6R [RPSD[Archive

    Full Text Available 1D6R 大豆 Soybean Glycine max (L.) Merrill Bowman-Birk Type Proteinase Inhibitor Precursor Glycine Ma...x Molecule: Trypsinogen; Chain: A; Fragment: Cationic Precursor; Molecule: Bowman-Birk Prote...inase Inhibitor Precursor; Chain: I Hydrolase 3.4.21.4 (Bowman-Birk Proteinase Inhibitor Precursor) J.Koepke...r Crystal Structure Of Cancer Chemopreventive Bowman-Birk Inhibitor In Ternary Complex With Bovine Trypsin A... 477 2000 Protease Inhibitor, Serine Protease, Bowman-Birk Inhibitor SWS:TRY1_BOV

  15. Restrained Dark $U(1)_d$ at Low Energies

    Correia, F C

    2016-01-01

    We investigate a spontaneously broken $U(1)_d$ gauge symmetry with a muon-specific dark Higgs. Our first goal is to verify how the presence of a new dark Higgs, $\\phi$, and a dark gauge boson, $V$, can simultaneously face the anomalies from the muon magnetic moment and the proton charge radius. Secondly, by assuming that $V$ must decay to an electron-positron pair, we explore the corresponding parameter space determined with the low energy constraints coming from $ K \\to \\mu X$, electron $(g-2)_e$, $K \\to \\mu \

  16. Breakdown of 1D water wires inside Charged Carbon Nanotubes

    Pant, Shashank

    2016-01-01

    Using Molecular Dynamics approach we investigated the structure, dynamics of water confined inside pristine and charged 6,6 carbon nanotubes (CNTs). This study reports the breakdown of 1D water wires and the emergence of triangular faced water on incorporating charges in 6,6 CNTs. Incorporation of charges results in high potential barriers to the flipping of water molecules due to the formation of a large number of hydrogen bonds. The PMF analyses show the presence of ~2 kcal/mol barrier for the movement of water inside pristine CNT and almost negligible barrier in charged CNTs.

  17. Modeling atrazine transport in soil columns with HYDRUS-1D

    John Leju CELESTINO LADU

    2011-09-01

    Full Text Available Both physical and chemical processes affect the fate and transport of herbicides. It is useful to simulate these processes with computer programs to predict solute movement. Simulations were run with HYDRUS-1D to identify the sorption and degradation parameters of atrazine through calibration from the breakthrough curves (BTCs. Data from undisturbed and disturbed soil column experiments were compared and analyzed using the dual-porosity model. The study results show that the values of dispersivity are slightly lower in disturbed columns, suggesting that the more heterogeneous the structure is, the higher the dispersivity. Sorption parameters also show slight variability, which is attributed to the differences in soil properties, experimental conditions and methods, or other ecological factors. For both of the columns, the degradation rates were similar. Potassium bromide was used as a conservative non-reactive tracer to characterize the water movement in columns. Atrazine BTCs exhibited significant tailing and asymmetry, indicating non-equilibrium sorption during solute transport. The dual-porosity model was verified to best fit the BTCs of the column experiments. Greater or lesser concentration of atrazine spreading to the bottom of the columns indicated risk of groundwater contamination. Overall, HYDRUS-1D successfully simulated the atrazine transport in soil columns.

  18. Tunability and Sensing Properties of Plasmonic/1D Photonic Crystal.

    Shaban, Mohamed; Ahmed, Ashour M; Abdel-Rahman, Ehab; Hamdy, Hany

    2017-02-08

    Gold/one-dimensional photonic crystal (Au/1D-PC) is fabricated and applied for sensitive sensing of glucose and different chemical molecules of various refractive indices. The Au layer thickness is optimized to produce surface plasmon resonance (SPR) at the right edge of the photonic band gap (PBG). As the Au deposition time increased to 60 sec, the PBG width is increased from 46 to 86 nm in correlation with the behavior of the SPR. The selectivity of the optimized Au/1D-PC sensor is tested upon the increase of the environmental refractive index of the detected molecules. The resonance wavelength and the PBG edges increased linearly and the transmitted intensity increased nonlinearly as the environment refractive index increased. The SPR splits to two modes during the detection of chloroform molecules based on the localized capacitive coupling of Au particles. Also, this structure shows high sensitivity at different glucose concentrations. The PBG and SPR are shifted to longer wavelengths, and PBG width is decreased linearly with a rate of 16.04 Å/(μg/mm(3)) as the glucose concentration increased. The proposed structure merits; operation at room temperature, compact size, and easy fabrication; suggest that the proposed structure can be efficiently used for the biomedical and chemical application.

  19. A Framework for Low-Communication 1-D FFT

    Ping Tak Peter Tang

    2013-01-01

    Full Text Available In high-performance computing on distributed-memory systems, communication often represents a significant part of the overall execution time. The relative cost of communication will certainly continue to rise as compute-density growth follows the current technology and industry trends. Design of lower-communication alternatives to fundamental computational algorithms has become an important field of research. For distributed 1-D FFT, communication cost has hitherto remained high as all industry-standard implementations perform three all-to-all internode data exchanges (also called global transposes. These communication steps indeed dominate execution time. In this paper, we present a mathematical framework from which many single-all-to-all and easy-to-implement 1-D FFT algorithms can be derived. For large-scale problems, our implementation can be twice as fast as leading FFT libraries on state-of-the-art computer clusters. Moreover, our framework allows tradeoff between accuracy and performance, further boosting performance if reduced accuracy is acceptable.

  20. Study of 1D Strange Charmed Meson Family Using HQET

    Pallavi Gupta

    2016-01-01

    Full Text Available Recently LHCb predicted spin 1 and spin 3 states Ds1⁎(2860 and Ds3⁎(2860 which are studied through their strong decays and are assigned to fit the 13D1 and 13D3 states in the charm spectroscopy. In this paper, using the heavy quark effective theory, we state that assigning Ds1⁎(2860 as the mixing of 13D1-23S1 states is rather a better justification to its observed experimental values than a pure state. We study its decay modes variation with hadronic coupling constant gxh and the mixing angle θ. We appoint spin 3 state Ds3⁎(2860 as the missing 1D  3-JP state and also study its decay channel behavior with coupling constant gyh. To appreciate the above results, we check the variation of decay modes for their spin partners states, that is, 1D2 and 1D2′, with their masses and strong coupling constant, that is, gxh and gyh. Our calculation using HQET approach gives mixing angle of the 13D1-23S1 state for Ds1⁎(2860 to lie in the range (-1.6 radians ≤θ≤-1.2 radians. Our calculation for coupling constant values gives gxh to lie within value range of 0.17–0.20 and gyh to be 0.40. We expect from experiments to observe this mixing angle to verify our results.

  1. Tunability and Sensing Properties of Plasmonic/1D Photonic Crystal

    Shaban, Mohamed; Ahmed, Ashour M.; Abdel-Rahman, Ehab; Hamdy, Hany

    2017-01-01

    Gold/one-dimensional photonic crystal (Au/1D-PC) is fabricated and applied for sensitive sensing of glucose and different chemical molecules of various refractive indices. The Au layer thickness is optimized to produce surface plasmon resonance (SPR) at the right edge of the photonic band gap (PBG). As the Au deposition time increased to 60 sec, the PBG width is increased from 46 to 86 nm in correlation with the behavior of the SPR. The selectivity of the optimized Au/1D-PC sensor is tested upon the increase of the environmental refractive index of the detected molecules. The resonance wavelength and the PBG edges increased linearly and the transmitted intensity increased nonlinearly as the environment refractive index increased. The SPR splits to two modes during the detection of chloroform molecules based on the localized capacitive coupling of Au particles. Also, this structure shows high sensitivity at different glucose concentrations. The PBG and SPR are shifted to longer wavelengths, and PBG width is decreased linearly with a rate of 16.04 Å/(μg/mm3) as the glucose concentration increased. The proposed structure merits; operation at room temperature, compact size, and easy fabrication; suggest that the proposed structure can be efficiently used for the biomedical and chemical application. PMID:28176799

  2. Transformation of 1-D Chiral-chained Titanium Phosphate to 2-D Layer Structure Through a 1-D Zigzag Chain

    CHEN Chao; YANG Yu-lin; LI Wei-sheng; LIU Yun-ling; YI Zhuo; GUO Yang-hong; PANG Wen-qin

    2005-01-01

    The transformation of titanium phosphate from 1-D chiral- chain(JTP-A) to 2-D layer(TP-J1) has been carefully investigated. Through a hydrolysis-condensation self-assembly pathway, the crystals of TP-J1 can be obtained from the JTP-A phase under hydrothermal conditions. An intermediate material with zigzag chain during the transformation was observed by XRD characterization. A hypothesis of the transformation mechanism is also described in this article. It is noteworthy that ethylenediamine plays an important role in the transformation.

  3. Global Control Methods for GHZ State Generation on 1-D Ising Chain

    Wang, Xiaoting; Bose, Sougato; Schirmer, Sophie

    2010-01-01

    We discuss how to prepare an Ising chain in a GHZ state using a single global control field only. This model does not require the spins to be individually addressable and is applicable to quantum systems such as cold atoms in optical lattices, some liquid- or solid-state NMR experiments, and many nano-scale quantum structures. We show that GHZ states can always be reached asymptotically from certain easy-to-prepare initial states using adiabatic passage, and under certain conditions finite-time reachability can be ensured. To provide a reference useful for future experimental implementations three different control strategies to achieve the objective, adiabatic passage, Lyapunov control and optimal control are compared, and their advantages and disadvantages discussed, in particular in the presence of realistic imperfections such as imperfect initial state preparation, system inhomogeneity and dephasing.

  4. Myofibrillar disruption and RNA-binding protein aggregation in a mouse model of limb-girdle muscular dystrophy 1D.

    Bengoechea, Rocio; Pittman, Sara K; Tuck, Elizabeth P; True, Heather L; Weihl, Conrad C

    2015-12-01

    Limb-girdle muscular dystrophy type 1D (LGMD1D) is caused by dominantly inherited missense mutations in DNAJB6, an Hsp40 co-chaperone. LGMD1D muscle has rimmed vacuoles and inclusion bodies containing DNAJB6, Z-disc proteins and TDP-43. DNAJB6 is expressed as two isoforms; DNAJB6a and DNAJB6b. Both isoforms contain LGMD1D mutant residues and are expressed in human muscle. To identify which mutant isoform confers disease pathogenesis and generate a mouse model of LGMD1D, we evaluated DNAJB6 expression and localization in skeletal muscle as well as generating DNAJB6 isoform specific expressing transgenic mice. DNAJB6a localized to myonuclei while DNAJB6b was sarcoplasmic. LGMD1D mutations in DNAJB6a or DNAJB6b did not alter this localization in mouse muscle. Transgenic mice expressing the LGMD1D mutant, F93L, in DNAJB6b under a muscle-specific promoter became weak, had early lethality and developed muscle pathology consistent with myopathy after 2 months; whereas mice expressing the same F93L mutation in DNAJB6a or overexpressing DNAJB6a or DNAJB6b wild-type transgenes remained unaffected after 1 year. DNAJB6b localized to the Z-disc and DNAJB6b-F93L expressing mouse muscle had myofibrillar disorganization and desmin inclusions. Consistent with DNAJB6 dysfunction, keratin 8/18, a DNAJB6 client also accumulated in DNAJB6b-F93L expressing mouse muscle. The RNA-binding proteins hnRNPA1 and hnRNPA2/B1 accumulated and co-localized with DNAJB6 at sarcoplasmic stress granules suggesting that these proteins maybe novel DNAJB6b clients. Similarly, hnRNPA1 and hnRNPA2/B1 formed sarcoplasmic aggregates in patients with LGMD1D. Our data support that LGMD1D mutations in DNAJB6 disrupt its sarcoplasmic function suggesting a role for DNAJB6b in Z-disc organization and stress granule kinetics.

  5. Data of evolutionary structure change: 1D6QA-2G4QA [Confc[Archive

    Full Text Available 1D6QA-2G4QA 1D6Q 2G4Q A A KVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYN...GRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQATNRNTD-GSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRCKGTDVQA...bID> A 2G4QA NRNTD-GS...> 1D6Q A 1D6QA

  6. Microlens Masses from 1-D Parallaxes and Heliocentric Proper Motions

    Gould, Andrew

    2014-01-01

    One-dimensional (1-D) microlens parallaxes can be combined with heliocentric lens-source relative proper motion measurements to derive the lens mass and distance, as suggested by Ghosh et al. (2004). Here I present the first mathematical anlysis of this procedure, which I show can be represented as a quadratic equation. Hence, it is formally subject to a two-fold degeneracy. I show that this degeneracy can be broken in many cases using the relatively crude 2-D parallax information that is often available for microlensing events. I also develop an explicit formula for the region of parameter space where it is more difficult to break this degeneracy. Although no mass/distance measurements have yet been made using this technique, it is likely to become quite common over the next decade.

  7. 1-D array of perforated diode neutron detectors

    McNeil, Walter J. [Kansas State University, Mechanical and Nuclear Engineering Department, Manhattan, KS 66506 (United States)], E-mail: wjm4444@ksu.edu; Bellinger, Steven L.; Unruh, Troy C.; Henderson, Chris M.; Ugorowski, Phil; Morris-Lee, Bryce [Kansas State University, Mechanical and Nuclear Engineering Department, Manhattan, KS 66506 (United States); Taylor, Russell D. [Electronics Design Laboratory, Kansas State University, Manhattan, KS 66506 (United States); McGregor, Douglas S. [Kansas State University, Mechanical and Nuclear Engineering Department, Manhattan, KS 66506 (United States)], E-mail: mcgregor@ksu.edu

    2009-06-01

    Performance of a 4 cm long 64-pixel perforated diode neutron detector array is compared with an identical array of thin-film coated diodes. The perforated neutron detector design has been adapted to a 1-D pixel array capable of 120 {mu}m spatial resolution and counting efficiency greater than 12%. Deep vertical trenches filled with {sup 6}LiF provide outstanding improvement in efficiency over thin-film coated diode designs limited to only 4.5%. This work marks the final step towards the construction of a much larger array consisting of 1024 pixels spanning 10 cm. The larger detector array will be constructed with a sub-array of 64-pixel sensors, and will be used for small-angle neutron scattering experiments at the Spallation Neutron Source of Oak Ridge National Laboratory.

  8. Identification of a T1D Susceptibility Gene

    Grant Morahan

    2001-01-01

    Full Text Available It is not known what causes type 1 diabetes (T1D, which affects over 1 million people in the U.S. alone. Each year, 30,000 young people in the U.S. develop this disease and depend on insulin injections thereafter. Because of the huge cost to the individual, the family, and to society in increased health care costs, it is important to find what makes these people susceptible. The disease process itself is clear: the individual’s immune system — T lymphocytes in particular — attack and destroy the body’s insulin-producing cells. But how and why this autoimmune process starts or proceeds unregulated is still not known.

  9. Coherent thermal conductance of 1-D photonic crystals

    Tschikin, Maria [Institut für Physik, Carl von Ossietzky Universität, D-26111 Oldenburg (Germany); Ben-Abdallah, Philippe [Laboratoire Charles Fabry, UMR 8501, Institut d' Optique, CNRS, Université Paris-Sud, 2, Avenue Augustin Fresnel, RD128, 91127 Palaiseau Cedex (France); Biehs, Svend-Age, E-mail: biehs@theorie.physik.uni-oldenburg.de [Institut für Physik, Carl von Ossietzky Universität, D-26111 Oldenburg (Germany)

    2012-10-01

    We present an exact calculation of coherent thermal conductance in 1-D multilayer photonic crystals using the S-matrix method. In particular, we study the thermal conductance in a bilayer structure of Si/vacuum or Al{sub 2}O{sub 3}/vacuum slabs by means of the exact radiative heat flux expression. Based on the results obtained for the Al{sub 2}O{sub 3}/vacuum structure we show by comparison with previous works that the material losses and (localized) surface modes supported by the inner layers play a fundamental role and cannot be omitted in the definition of thermal conductance. Our results could have significant implications in the conception of efficient thermal barriers.

  10. 1D-transport properties of single superconducting lead nanowires

    Michotte, S.; Mátéfi-Tempfli, Stefan; Piraux, L.

    2003-01-01

    We report on the transport properties of single superconducting lead nanowires grown by an electrodeposition technique, embedded in a nanoporous track-etched polymer membrane. The nanowires are granular, have uniform diameter of ̃40 nm and a very large aspect ratio (̃500). The diameter of the nan......We report on the transport properties of single superconducting lead nanowires grown by an electrodeposition technique, embedded in a nanoporous track-etched polymer membrane. The nanowires are granular, have uniform diameter of ̃40 nm and a very large aspect ratio (̃500). The diameter...... of the nanowire is small enough to ensure a 1D superconducting regime in a wide temperature range below T. The non-zero resistance in the superconducting state and its variation caused by fluctuations of the superconducting order parameter were measured versus temperature, magnetic field, and applied DC current...

  11. Phenomenological predictions of 3+1d anisotropic hydrodynamics

    Nopoush, Mohammad; Ryblewski, Radoslaw

    2016-01-01

    We make phenomenological predictions for particle spectra and elliptic flow in heavy-ion collisions using 3+1d anisotropic hydrodynamics (aHydro) including the effects of both shear and bulk viscosities. The dynamical equations necessary are derived by taking moments of the Boltzmann equation allowing for three distinct (diagonal) momentum-space anisotropy parameters. The formulation is based on relaxation-time approximation for the collisional kernel and a lattice-QCD-based equation of state. Evolving the system to late times, we calculate particle production using THERMINATOR 2, modified to account for an ellipsoidal distribution function. We obtain particle spectra for different particle species such as pions, kaons, and protons, and elliptic flow $v_2$ as a function of centrality, transverse momentum, and rapidity. In our model, we have four free parameters, i.e. freeze-out temperature, initial central energy density, initial momentum-space anisotropies, and shear viscosity to entropy density ratio. Using...

  12. Effective theory of Black Holes in the 1/D expansion

    Emparan, Roberto; Suzuki, Ryotaku; Tanabe, Kentaro; Tanaka, Takahiro

    2015-01-01

    The gravitational field of a black hole is strongly localized near its horizon when the number of dimensions D is very large. In this limit, we can effectively replace the black hole with a surface in a background geometry (eg Minkowski or Anti-deSitter space). The Einstein equations determine the effective equations that this 'black hole surface' (or membrane) must satisfy. We obtain them up to next-to-leading order in 1/D for static black holes of the Einstein-(A)dS theory. To leading order, and also to next order in Minkowski backgrounds, the equations of the effective theory are the same as soap-film equations, possibly up to a redshift factor. In particular, the Schwarzschild black hole is recovered as a spherical soap bubble. Less trivially, we find solutions for 'black droplets', ie black holes localized at the boundary of AdS, and for non-uniform black strings.

  13. Simulating three-dimensional seismograms in 2.5-dimensional structures by combining two-dimensional finite difference modelling and ray tracing

    Miksat, J.; Müller, T. M.; Wenzel, F.

    2008-07-01

    Finite difference (FD) simulation of elastic wave propagation is an important tool in geophysical research. As large-scale 3-D simulations are only feasible on supercomputers or clusters, and even then the simulations are limited to long periods compared to the model size, 2-D FD simulations are widespread. Whereas in generally 3-D heterogeneous structures it is not possible to infer the correct amplitude and waveform from 2-D simulations, in 2.5-D heterogeneous structures some inferences are possible. In particular, Vidale & Helmberger developed an approach that simulates 3-D waveforms using 2-D FD experiments only. However, their method requires a special FD source implementation technique that is based on a source definition which is not any longer used in nowadays FD codes. In this paper, we derive a conversion between 2-D and 3-D Green tensors that allows us to simulate 3-D displacement seismograms using 2-D FD simulations and the actual ray path determined in the geometrical optic limit. We give the conversion for a source of a certain seismic moment that is implemented by incrementing the components of the stress tensor. Therefore, we present a hybrid modelling procedure involving 2-D FD and kinematic ray-tracing techniques. The applicability is demonstrated by numerical experiments of elastic wave propagation for models of different complexity.

  14. Relationship between Pulmonary Airflow and Resistance in Patients with Airway Narrowing Using An 1-D Network Resistance and Compliance Model

    Choi, Sanghun; Choi, Jiwoong; Hoffman, Eric; Lin, Ching-Long

    2016-11-01

    To predict the proper relationship between airway resistance and regional airflow, we proposed a novel 1-D network model for airway resistance and acinar compliance. First, we extracted 1-D skeletons at inspiration images, and generated 1-D trees of CT unresolved airways with a volume filling method. We used Horsfield order with random heterogeneity to create diameters of the generated 1-D trees. We employed a resistance model that accounts for kinetic energy and viscous dissipation (Model A). The resistance model is further coupled with a regional compliance model estimated from two static images (Model B). For validation, we applied both models to a healthy subject. The results showed that Model A failed to provide airflows consistent with air volume change, whereas Model B provided airflows consistent with air volume change. Since airflows shall be regionally consistent with air volume change in patients with normal airways, Model B was validated. Then, we applied Model B to severe asthmatic subjects. The results showed that regional airflows were significantly deviated from air volume change due to airway narrowing. This implies that airway resistance plays a major role in determining regional airflows of patients with airway narrowing. Support for this study was provided, in part, by NIH Grants U01 HL114494, R01 HL094315, R01 HL112986, and S10 RR022421.

  15. 1-D Modeling of Massive Particle Injection (MPI) in Tokamaks

    Wu, W.; Parks, P. B.; Izzo, V. A.

    2008-11-01

    A 1-D Fast Current Quench (FCQ) model is developed to study current evolution and runaway electron suppression under massive density increase. The model consists of coupled toroidal electric field and energy equations, and it is solved numerically for DIII-D and ITER operating conditions. Simulation results suggest that fast shutdown by D2 liquid jet/pellet injection is in principle achievable for the desired plasma cooling time (˜15 ms for DIII-D and ˜50 ms for ITER) under ˜150x or higher densification. The current density and pressure profile are practically unaltered during the initial phase of jet propagation when dilution cooling dominates. With subsequent radiation cooling, the densified discharge enters the strongly collisional regime where Pfirsch-Schluter thermal diffusion can inhibit current contraction on the magnetic axis. Often the 1/1 kink instability, addressed by Kadomtsev's magnetic reconnection model, can be prevented. Our results are compared with NIMROD simulations in which the plasma is suddenly densified by ˜100x and experiences instantaneous dilution cooling, allowing for use of actual (lower) Lundquist numbers.

  16. 1-D Numerical Analysis of RBCC Engine Performance

    Han, Samuel S.

    1998-01-01

    An RBCC engine combines air breathing and rocket engines into a single engine to increase the specific impulse over an entire flight trajectory. Considerable research pertaining to RBCC propulsion was performed during the 1960's and these engines were revisited recently as a candidate propulsion system for either a single-stage-to-orbit (SSTO) or two-stage-to-orbit (TSTO) launch vehicle. There are a variety of RBCC configurations that had been evaluated and new designs are currently under development. However, the basic configuration of all RBCC systems is built around the ejector scramjet engine originally developed for the hypersonic airplane. In this configuration, a rocket engine plays as an ejector in the air-augmented initial acceleration mode, as a fuel injector in scramjet mode and the rocket in all rocket mode for orbital insertion. Computational fluid dynamics (CFD) is a useful tool for the analysis of complex transport processes in various components in RBCC propulsion systems. The objective of the present research was to develop a transient 1-D numerical model that could be used to predict flow behavior throughout a generic RBCC engine following a flight path.

  17. Cavitation Influence in 1D Part-load Vortex Models

    Dörfler, P. K.

    2016-11-01

    Residual swirl in the draft tube of Francis turbines may cause annoying low- frequency pulsation of pressure and power output, in particular during part-load operation. A 1D analytical model for these dynamic phenomena would enable simulation by some conventional method for computing hydraulic transients. The proper structure of such a model has implications for the prediction of prototype behaviour based on laboratory tests. The source of excitation as well as the dynamic transmission behaviour of the draft tube flow may both be described either by lumped or distributed parameters. The distributed version contains more information and, due to limited possibilities of identification, some data must be estimated. The distributed cavitation compliance is an example for this dilemma. In recent publications, the customary assumption of a constant wave speed has produced dubious results. The paper presents a more realistic model for distributed compressibility. The measured influence of the Thoma number is applied with the local cavitation factor. This concept is less sensitive to modelling errors and explains both the Thoma and Froude number influence. The possible effect of the normally unknown non-condensable gas content in the vortex cavity is shortly commented. Its measurement in future tests is recommended. It is also recommended to check the available analytical vortex models for possible dispersion effects.

  18. Towards a consistent picture for quasi-1D organic superconductors

    Doiron-Leyraud, N. [Departement de physique and RQMP, Universite de Sherbrooke, Sherbrooke, Quebec, J1K 2R1 (Canada); Auban-Senzier, P. [Laboratoire de Physique des Solides, UMR 8502, CNRS - Univ. Paris-Sud, Bat. 510, 91405 Orsay (France); Rene de Cotret, S. [Departement de physique and RQMP, Universite de Sherbrooke, Sherbrooke, Quebec, J1K 2R1 (Canada); Bechgaard, K. [Department of Chemistry, H.C. Orsted Institute, Copenhagen (Denmark); Jerome, D., E-mail: jerome@lps.u-psud.f [Laboratoire de Physique des Solides, UMR 8502, CNRS - Univ. Paris-Sud, Bat. 510, 91405 Orsay (France); Canadian Institute for Advanced Research, Toronto, Ontario, M5G 1Z8 (Canada); Taillefer, L. [Departement de physique and RQMP, Universite de Sherbrooke, Sherbrooke, Quebec, J1K 2R1 (Canada); Canadian Institute for Advanced Research, Toronto, Ontario, M5G 1Z8 (Canada)

    2010-06-01

    The electrical resistivity of the quasi-1D organic superconductor (TMTSF){sub 2}PF{sub 6} was recently measured at low temperature from the critical pressure needed to suppress the spin-density-wave state up to a pressure where superconductivity has almost disappeared. This data revealed a direct correlation between the onset of superconductivity at T{sub c} and the strength of a non-Fermi-liquid linear term in the normal-state resistivity, going as {rho}(T)={rho}{sub 0}+AT+BT{sup 2} at low temperature, so that A{yields}0 as T{sub c{yields}}0. Here we show that the contribution of low-frequency antiferromagnetic fluctuations to the spin-lattice relaxation rate is also correlated with this non-Fermi-liquid term AT in the resistivity. These correlations suggest that anomalous scattering and pairing have a common origin, both rooted in the low-frequency antiferromagnetic fluctuations measured by NMR. A similar situation may also prevail in the recently discovered iron-pnictide superconductors.

  19. Sulfur chemistry: 1D modeling in massive dense cores

    Wakelam, V; Herpin, F

    2011-01-01

    The main sulfur-bearing molecules OCS, H2S, SO, SO2, and CS have been observed in four high mass dense cores (W43-MM1, IRAS 18264, IRAS 05358, and IRAS 18162). Our goal is to put some constraints on the relative evolutionary stage of these sources by comparing these observations with time-dependent chemical modeling. We used the chemical model Nahoon, which computes the gas-phase chemistry and gas-grain interactions of depletion and evaporation. Mixing of the different chemical compositions shells in a 1D structure through protostellar envelope has been included since observed lines suggest nonthermal supersonic broadening. Observed radial profiles of the temperature and density are used to compute the chemistry as a function of time. With our model, we underproduce CS by several orders of magnitude compared to the other S-bearing molecules, which seems to contradict observations, although some uncertainties in the CS abundance observed at high temperature remain. The OCS/SO2, SO/SO2, and H2S/SO2 abundance ra...

  20. Dynamic decoupling in the presence of 1D random walk

    Chakrabarti, Arnab; Chakraborty, Ipsita; Bhattacharyya, Rangeet

    2016-05-01

    In the recent past, many dynamic decoupling sequences have been proposed for the suppression of decoherence of spins connected to thermal baths of various natures. Dynamic decoupling schemes for suppressing decoherence due to Gaussian diffusion have also been developed. In this work, we study the relative performances of dynamic decoupling schemes in the presence of a non-stationary Gaussian noise such as a 1D random walk. Frequency domain analysis is not suitable to determine the performances of various dynamic decoupling schemes in suppressing decoherence due to such a process. Thus, in this work, we follow a time domain calculation to arrive at the following conclusions: in the presence of such a noise, we show that (i) the traditional Carr-Purcell-Meiboom-Gill (CPMG) sequence outperforms Uhrig’s dynamic decoupling scheme, (ii) CPMG remains the optimal sequence for suppression of decoherence due to random walk in the presence of an external field gradient. Later, the theoretical predictions are experimentally verified by using nuclear magnetic resonance spectroscopy on spin 1/2 particles diffusing in a liquid medium.

  1. Nonclassical Particle Transport in 1-D Random Periodic Media

    Vasques, Richard; Slaybaugh, Rachel N

    2016-01-01

    We investigate the accuracy of the recently proposed nonclassical transport equation. This equation contains an extra independent variable compared to the classical transport equation (the path-length $s$), and models particle transport taking place in homogenized random media in which a particle's distance-to-collision is not exponentially distributed. To solve the nonclassical equation one needs to know the $s$-dependent ensemble-averaged total cross section, $\\Sigma_t(\\mu,s)$, or its corresponding path-length distribution function, $p(\\mu,s)$. We consider a 1-D spatially periodic system consisting of alternating solid and void layers, randomly placed in the $x$-axis. We obtain an analytical expression for $p(\\mu,s)$ and use this result to compute the corresponding $\\Sigma_t(\\mu,s)$. Then, we proceed to numerically solve the nonclassical equation for different test problems in rod geometry; that is, particles can move only in the directions $\\mu=\\pm 1$. To assess the accuracy of these solutions, we produce ...

  2. Modeling of 1D Anomalous Diffusion in Fractured Nanoporous Media

    Albinali Ali

    2016-07-01

    Full Text Available Fractured nanoporous reservoirs include multi-scale and discontinuous fractures coupled with a complex nanoporous matrix. Such systems cannot be described by the conventional dual-porosity (or multi-porosity idealizations due to the presence of different flow mechanisms at multiple scales. More detailed modeling approaches, such as Discrete Fracture Network (DFN models, similarly suffer from the extensive data requirements dictated by the intricacy of the flow scales, which eventually deter the utility of these models. This paper discusses the utility and construction of 1D analytical and numerical anomalous diffusion models for heterogeneous, nanoporous media, which is commonly encountered in oil and gas production from tight, unconventional reservoirs with fractured horizontal wells. A fractional form of Darcy’s law, which incorporates the non-local and hereditary nature of flow, is coupled with the classical mass conservation equation to derive a fractional diffusion equation in space and time. Results show excellent agreement with established solutions under asymptotic conditions and are consistent with the physical intuitions.

  3. Benchmarking of a 1D Scrape-off layer code SOLF1D with SOLPS and its use in modelling long-legged divertors

    Havlickova, E; Subba, F; Coster, D; Wischmeier, M; Fishpool, G

    2013-01-01

    A 1D code modelling SOL transport parallel to the magnetic field (SOLF1D) is benchmarked with 2D simulations of MAST-U SOL performed via the SOLPS code for two different collisionalities. Based on this comparison, SOLF1D is then used to model the effects of divertor leg stretching in 1D, in support of the planned Super-X divertor on MAST. The aim is to separate magnetic flux expansion from volumetric power losses due to recycling neutrals by stretching the divertor leg either vertically or radially.

  4. Synthesis of 1-D ZnO nanorods and polypyrrole/1-D ZnO nanocomposites for photocatalysis and gas sensor applications

    PRITAM PATIL; GANESH GAIKWAD; D R PATIL; JITENDRA NAIK

    2016-06-01

    1-D ZnO nanorods and PPy/1-D ZnO nanocomposites were prepared by the surfactant-assisted precipitation and in situ polymerization method, respectively. The synthesized nanorods and nanocomposites were characterized by UV–Vis spectrophotometer, Fourier transform-infrared spectroscopy (FTIR), X-ray diffraction (XRD) and field emission scanning electron microscope (FE-SEM), which gave the evidence of 1-D ZnO nanorods, polymerization of pyrrole monomer and strong interaction between PPy and 1-D ZnO nanorods, respectively. Photocatalytic activity of 1-D ZnO nanorods was conducted by $3^3$ level full-factorial design to evaluate the effect of three independent process variables viz., dye concentration (crystal violet), catalyst concentration (1-D ZnO nanorods) and the reaction time on the preferred response: photodegradation efficiency (%). The PPy/1-D ZnO nanocompositeswere used for the sensing of NH$_3$, LPG, CO$_2$ and H$_2$S gases, respectively, at room temperature. It was observed that PPy/1-D ZnO nanocomposites with different 1-D ZnO nanorod weight ratios (15 and 25%) had better selectivity and sensitivity towards NH3 at room temperature.

  5. Absolute rate constant determinations for the deactivation of O/1D/ by time resolved decay of O/1D/ yields O/3P/ emission

    Davidson, J. A.; Sadowski, C. M.; Schiff, H. I.; Howard, C. J.; Schmeltekopf, A. L.; Jennings, D. A.; Streit, G. E.

    1976-01-01

    Absolute rate constants for the deactivation of O(1D) atoms by some atmospheric gases have been determined by observing the time-resolved emission of O(1D) at 630 nm. O(1D) atoms were produced by the dissociation of ozone via repetitive laser pulses at 266 nm. Absolute rate constants for the relaxation of O(1D) at 298 K are reported for N2, O2, CO2, O3, H2, D2, CH4, HCl, NH3, H2O, N2O, and Ne. The results obtained are compared with previous relative and absolute measurements reported in the literature.

  6. Atomic layer deposition of 1D and 2D nickel nanostructures on graphite

    Ryu, Seung Wook; Yoon, Jaehong; Moon, Hyoung-Seok; Shong, Bonggeun; Kim, Hyungjun; Lee, Han-Bo-Ram

    2017-03-01

    One-dimensional (1D) nanowires (NWs) and two-dimensional (2D) thin films of Ni were deposited on highly ordered pyrolytic graphite (HOPG) by atomic layer deposition (ALD), using NH3 as a counter reactant. Thermal ALD using NH3 gas forms 1D NWs along step edges, while NH3 plasma enables the deposition of a continuous 2D film over the whole surface. The lateral and vertical growth rates of the Ni NWs are numerically modeled as a function of the number of ALD cycles. Pretreatment with NH3 gas promotes selectivity in deposition by the reduction of oxygenated functionalities on the HOPG surface. On the other hand, NH3 plasma pretreatment generates surface nitrogen species, and results in a morphological change in the basal plane of graphite, leading to active nucleation across the surface during ALD. The effects of surface nitrogen species on the nucleation of ALD Ni were theoretically studied by density functional theory calculations. Our results suggest that the properties of Ni NWs, such as their density and width, and the formation of Ni thin films on carbon surfaces can be controlled by appropriate use of NH3.

  7. Spatio-temporal stability of 1D Kerr cavity solitons

    Gelens, L.; Parra-Rivas, P.; Leo, F.; Gomila, D.; Matias, Manuel A.; Coen, S.

    2014-05-01

    The Lugiato-Lefever equation (LLE) has been extensively studied since its derivation in 1987, when this meanfield model was introduced to describe nonlinear optical cavities. The LLE was originally derived to describe a ring cavity or a Fabry-Perot resonator with a transverse spatial extension and partially filled with a nonlinear medium but it has also been shown to be applicable to other types of cavities, such as fiber resonators and microresonators. Depending on the parameters used, the LLE can present a monostable or bistable input-output response curve. A large number of theoretical studies have been done in the monostable regime, but the bistable regime has remained widely unexplored. One of the reasons for this was that previous experimental setups were not able to works in such regimes of the parameter space. Nowadays the possibility of reaching such parameter regimes experimentally has renewed the interest in the LLE. In this contribution, we present an in-depth theoretical study of the different dynamical regimes that can appear in parameter space, focusing on the dynamics of localized solutions, also known as cavity solitons (CSs). We show that time-periodic oscillations of a 1D CS appear naturally in a broad region of parameter space. More than this oscillatory regime, which has been recently demonstrated experimentally,1 we theoretically report on several kinds of chaotic dynamics. We show that the existence of CSs and their dynamics is related with the spatial dynamics of the system and with the presence of a codimension-2 point known as a Fold-Hopf bifurcation point. These dynamical regimes can become accessible by using devices such as microresonators, for instance widely used for creating optical frequency combs.

  8. Modeling shear band interaction in 1D torsion

    Partom, Yehuda; Hanina, Erez

    2017-01-01

    When two shear bands are being formed at close distance from each other they interact, and further development of one of them may be quenched down. As a result there should be a minimum distance between shear bands. In the literature there are at least three analytical models for this minimum distance. Predictions of these models do not generally agree with each other and with test results. Recently we developed a 1D numerical scheme to predict the formation of shear bands in a torsion test of a thin walled pipe. We validated our code by reproducing results of the pioneering experiments of Marchand and Duffy, and then used it to investigate the mechanics of shear localization and shear band formation. We describe our shear band code in a separate publication, and here we use it only as a tool to investigate the interaction between two neighboring shear bands during the process of their formation. We trigger the formation of shear bands by specifying two perturbations of the initial strength. We vary the perturbations in terms of their amplitude and/or their width. Usually, the stronger perturbation triggers a faster developing shear band, which then prevails and quenches the development of the other shear band. We change the distance between the two shear bands and find, that up to a certain distance one of the shear bands becomes fully developed, and the other stays only partially developed. Beyond this distance the two shear bands are both fully developed. Finally, we check the influence of certain material and loading parameters on the interaction between the two shear bands, and compare the results to predictions of the analytical models from the literature.

  9. Restrained dark U (1 )d at low energies

    Correia, Fagner C.; Fajfer, Svjetlana

    2016-12-01

    We investigate a spontaneously broken U (1 )d gauge symmetry with a muon-specific dark Higgs. Our first goal is to verify how the presence of a new dark Higgs, ϕ , and a dark gauge boson, V , can simultaneously face the anomalies from the muon magnetic moment and the proton charge radius. Second, by assuming that V must decay to an electron-positron pair, we explore the corresponding parameter space determined with the low-energy constraints coming from K →μ X , electron (g -2 )e, K →μ νμe+e-, K →μ νμμ+μ-, and τ →ντμ νμe+e-. We focus on the scenario where the V mass is below ˜2 mμ and the ϕ mass runs from few MeV to 250 MeV, with V -photon mixing of the order ˜O (10-3). Among weak process at low energies, we check the influence of the new light vector on kaon decays as well as on the scattering e+e-→μ+μ-e+e- and discuss the impact of the dark Higgs on e+e-→μ+μ-μ+μ-. Finally, we consider contributions of the V -photon mixing in the decays π0→γ e+e-, η →γ e+e-, ρ →π e+e-, K*→K e+e-, and ϕ (1020 )→η e+e-.

  10. Multiple mobility edges in a 1D Aubry chain with Hubbard interaction in presence of electric field: Controlled electron transport

    Saha, Srilekha; Maiti, Santanu K.; Karmakar, S. N.

    2016-01-01

    Electronic behavior of a 1D Aubry chain with Hubbard interaction is critically analyzed in presence of electric field. Multiple energy bands are generated as a result of Hubbard correlation and Aubry potential, and, within these bands localized states are developed under the application of electric field. Within a tight-binding framework we compute electronic transmission probability and average density of states using Green's function approach where the interaction parameter is treated under...

  11. Resolution-optimized NMR measurement of (1)D(CH), (1)D(CC) and (2)D(CH) residual dipolar couplings in nucleic acid bases.

    Boisbouvier, Jérôme; Bryce, David L; O'neil-Cabello, Erin; Nikonowicz, Edward P; Bax, Ad

    2004-11-01

    New methods are described for accurate measurement of multiple residual dipolar couplings in nucleic acid bases. The methods use TROSY-type pulse sequences for optimizing resolution and sensitivity, and rely on the E.COSY principle to measure the relatively small two-bond (2)D(CH) couplings at high precision. Measurements are demonstrated for a 24-nt stem-loop RNA sequence, uniformly enriched in (13)C, and aligned in Pf1. The recently described pseudo-3D method is used to provide homonuclear (1)H-(1)H decoupling, which minimizes cross-correlation effects and optimizes resolution. Up to seven (1)H-(13)C and (13)C-(13)C couplings are measured for pyrimidines (U and C), including (1)D(C5H5), (1)D(C6H6), (2)D(C5H6), (2)D(C6H5), (1)D(C5C4), (1)D(C5C6), and (2)D(C4H5). For adenine, four base couplings ((1)D(C2H2), (1)D(C8H8), (1)D(C4C5), and (1)D(C5C6)) are readily measured whereas for guanine only three couplings are accessible at high relative accuracy ((1)D(C8H8), (1)D(C4C5), and (1)D(C5C6)). Only three dipolar couplings are linearly independent in planar structures such as nucleic acid bases, permitting cross validation of the data and evaluation of their accuracies. For the vast majority of dipolar couplings, the error is found to be less than +/-3% of their possible range, indicating that the measurement accuracy is not limiting when using these couplings as restraints in structure calculations. Reported isotropic values of the one- and two-bond J couplings cluster very tightly for each type of nucleotide.

  12. Comments on the Bifurcation Structure of 1D Maps

    Belykh, V.N.; Mosekilde, Erik

    1997-01-01

    -within-a-box structure of the total bifurcation set. This presents a picture in which the homoclinic orbit bifurcations act as a skeleton for the bifurcational set. At the same time, experimental results on continued subharmonic generation for piezoelectrically amplified sound waves, predating the Feigenbaum theory...

  13. Data of evolutionary structure change: 1D3AB-1LLDA [Confc[Archive

    Full Text Available 1D3AB-1LLDA 1D3A 1LLD B A -TKVSVVGAAGTVGAAAGYNIALRDIADEVVFVDIPDKE...PNAIYMLITNPVDIATHVAQKLTGLPENQIFGSGTNLDSARLRFLIAQQTGVNVKNVHAYIAGEHGDSEVPLWESATIGGVPMSDWTPLPGHDPLDADKREEIHQEVK... 1LLD A 1LLDA...> 1 1LLD A 1LLDA

  14. Photo-Thermal Effects in 1D Gratings of Gold Nanoparticles

    Giovanna Palermo

    2017-01-01

    Full Text Available This work investigates the heat delivered by a mono-layer 1D grating of gold nanoparticles (GNPs created by photo-reduction through two-photon direct laser writing (2P-DLW in a poly-vinyl alcohol (PVA matrix doped with HAuCl4, under resonant laser radiation. We drop cast a film of a PVA + HAuCl4 mixture onto a glass substrate, in which we create gratings of 1 mm2 made by stripes of GNPs characterized by high polydispersivity. We demonstrate that, by controlling the pitch of the GNP stripes, we obtain different values of the photo-induced temperature variations. In the framework of thermo-plasmonics, the experimental investigation of the heat generation from a monolayer of gold nanoparticles represents a key element as a starting point to design thermo-smart platforms for sensing, solar energy harvesting and thermo-catalysis.

  15. Formation of Gd coordination polymer with 1D chains mediated by Bronsted acidic ionic liquids

    Luo, Qianqian; Han, Ying; Lin, Hechun; Zhang, Yuanyuan; Duan, Chungang; Peng, Hui

    2017-03-01

    One dimensional coordination polymer Gd[(SO4)(NO3)(C2H6SO)2] (1) is prepared through the mediation of Bronsted acid ionic liquid, which crystallized in the monoclinic space of C2/c. In this polymer, adjacent Gd atoms are linked by two SO42- ions to generate a 1-D chain, and all oxygen atoms in SO42- groups are connected to three nearest Gd atoms in μ3:η1:η1:η2 fashion. Gd, S and N from SO42- and NO3- are precisely coplanar. The planar is coordinated by a pair of DMSO molecules, which is parallel and linked by hydrogen bonding to form a three-dimensional supramolecular network. Magnetic susceptibility measurement of 1 reveals weak antiferromagnetic interactions between the Gd (III) ions. It exhibits relatively large magneto-caloric effect with -ΔSm=28.8 J Kg-1 K-1 for ΔH=7 T.

  16. Controllable Photonic Band Gap and Defect Mode in a 1D CO2-Laser Optical Lattice

    ZHOU Qi; YIN Jian-Ping

    2008-01-01

    We Dropose a new method to form a novel controllable photonic crystal with cold atoms and study the photonic band gap(PBG)of an infinite 1D CO2-laser optical lattice of 85Rb atoms under the condition of quantum coherence.A significant gap generated near the resonant frequency of the atom is founded and its dependence on physical parameters is also discussed.Using the eigenquation of defect mode,we calculate the defect mode when a defect is introduced into such a lattice.Our study shows that the proposed new method can be used to optically probe optical lattice in situ and to design some novel and controllable photonic crystals.

  17. A low power, area efficient fpga based beamforming technique for 1-D CMUT arrays.

    Joseph, Bastin; Joseph, Jose; Vanjari, Siva Rama Krishna

    2015-08-01

    A low power area efficient digital beamformer targeting low frequency (2MHz) 1-D linear Capacitive Micromachined Ultrasonic Transducer (CMUT) array is developed. While designing the beamforming logic, the symmetry of the CMUT array is well exploited to reduce the area and power consumption. The proposed method is verified in Matlab by clocking an Arbitrary Waveform Generator(AWG). The architecture is successfully implemented in Xilinx Spartan 3E FPGA kit to check its functionality. The beamforming logic is implemented for 8, 16, 32, and 64 element CMUTs targeting Application Specific Integrated Circuit (ASIC) platform at Vdd 1.62V for UMC 90nm technology. It is observed that the proposed architecture consumes significantly lesser power and area (1.2895 mW power and 47134.4 μm(2) area for a 64 element digital beamforming circuit) compared to the conventional square root based algorithm.

  18. Explicit analytical wave solutions of unsteady 1D ideal gas flow with friction and heat transfer

    2001-01-01

    Several families of algebraically explicit analytical wavesolutions are derived for the unsteady 1D ideal gas flow with friction and heat-transfer, which include one family of travelling wave solutions, three families of standing wave solutions and one standing wave solution. \\{Among\\} them, the former four solution families contain arbitrary functions, so actually there are infinite analytical wave solutions having been derived. Besides their very important theoretical meaning, such analytical wave solutions can guide the development of some new equipment, and can be the benchmark solutions to promote the development of computational fluid dynamics. For example, we can use them to check the accuracy, convergence and effectiveness of various numerical computational methods and to improve the numerical computation skills such as differential schemes, grid generation ways and so on.

  19. Data of evolutionary structure change: 1D0GD-2RJLA [Confc[Archive

    Full Text Available 1D0GD-2RJLA 1D0G 2RJL D A PQRVAAHITGTRGEKALGRKINSWESSRSGHSFLS-NLH...LRNGELVIHEKGFYYIYSQTYFRFQEEIKENTKNDKQMVQYIYKYTS-YPDPILLMKSARNSCWSKDAEYGLYSIYQGGIFELKENDRIFVSVTNEHLIDM-DHEASFFGAFLVG GD...KPRAHLTVVRQTPTQFPALHWEHEL--GLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRG--------MKPDSITVVITKVTDS...YPEPTQLLMGTKSVS-EVG-SNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL- ...D0G D 1D0GD HSFLS-NLHLR

  20. Enhanced cardiac TBC1D10C expression lowers heart rate and enhances exercise capacity and survival

    Volland, Cornelia; Bremer, Sebastian; Hellenkamp, Kristian; Hartmann, Nico; Dybkova, Nataliya; Khadjeh, Sara; Kutschenko, Anna; Liebetanz, David; Wagner, Stefan; Unsöld, Bernhard; Didié, Michael; Toischer, Karl; Sossalla, Samuel; Hasenfuß, Gerd; Seidler, Tim

    2016-01-01

    TBC1D10C is a protein previously demonstrated to bind and inhibit Ras and Calcineurin. In cardiomyocytes, also CaMKII is inhibited and all three targeted enzymes are known to promote maladaptive cardiomyocyte hypertrophy. Here, in accordance with lack of Calcineurin inhibition in vivo, we did not observe a relevant anti-hypertrophic effect despite inhibition of Ras and CaMKII. However, cardiomyocyte-specific TBC1D10C overexpressing transgenic mice exhibited enhanced longevity. Ejection fraction and exercise capacity were enhanced in transgenic mice, but shortening of isolated cardiomyocytes was not increased. This suggests longevity resulted from enhanced cardiac performance but independent of cardiomyocyte contractile force. In further search for mechanisms, a transcriptome-wide analysis revealed expressional changes in several genes pertinent to control of heart rate (HR) including Hcn4, Scn10a, Sema3a and Cacna2d2. Indeed, telemetric holter recordings demonstrated slower atrial conduction and significantly lower HR. Pharmacological reduction of HR was previously demonstrated to enhance survival in mice. Thus, in addition to inhibition of stress signaling, TBC1D10C economizes generation of cardiac output via HR reduction, enhancing exercise capacity and survival. TBC1D10C may be a new target for HR reduction and longevity. PMID:27667030

  1. Cryptanalysis of a family of 1D unimodal maps

    Said, Mohamad Rushdan Md; Hina, Aliyu Danladi; Banerjee, Santo

    2017-03-01

    In this paper, we proposed a topologically conjugate map, equivalent to the well known logistic map. This constructed map is defined on the integer domain [0, 2 n ) with a view to be used as a random number generator (RNG) based on an integer domain as is the required in classical cryptography. The maps were found to have a one to one correspondence between points in their respective defining intervals defined on an n-bits precision. The dynamics of the proposed map similar with that of the logistic map, in terms of the Lyapunov exponents with the control parameter. This similarity between the curves indicates topological conjugacy between the maps. With a view to be applied in cryptography as a Pseudo-Random number generator (PRNG), the complexity of the constructed map as a source of randomness is determined using both the permutation entropy (PE) and the Lempel-Ziv (LZ-76) complexity measures, and the results are compared with numerical simulations.

  2. Human dendritic cells derived from embryonic stem cells stably modified with CD1d efficiently stimulate antitumor invariant natural killer T cell response.

    Zeng, Jieming; Wang, Shu

    2014-01-01

    Invariant natural killer T (iNKT) cells are a unique lymphocyte subpopulation that mediates antitumor activities upon activation. A current strategy to harness iNKT cells for cancer treatment is endogenous iNKT cell activation using patient-derived dendritic cells (DCs). However, the limited number and functional defects of patient DCs are still the major challenges for this therapeutic approach. In this study, we investigated whether human embryonic stem cells (hESCs) with an ectopically expressed CD1d gene could be exploited to address this issue. Using a lentivector carrying an optimized expression cassette, we generated stably modified hESC lines that consistently overexpressed CD1d. These modified hESC lines were able to differentiate into DCs as efficiently as the parental line. Most importantly, more than 50% of such derived DCs were CD1d+. These CD1d-overexpressing DCs were more efficient in inducing iNKT cell response than those without modification, and their ability was comparable to that of DCs generated from monocytes of healthy donors. The iNKT cells expanded by the CD1d-overexpressing DCs were functional, as demonstrated by their ability to lyse iNKT cell-sensitive glioma cells. Therefore, hESCs stably modified with the CD1d gene may serve as a convenient, unlimited, and competent DC source for iNKT cell-based cancer immunotherapy.

  3. Regional Seismograms: Attenuation and Scattering

    1992-03-06

    chosen because it can produce a full solution to the elastodynamic equation of motion, and unlike high frequency approximations (such as raytracing ...Lechniques such as raytracing are valid only when the size of the scatterer is large compared to a wavelength (e.g., ka > 10) (Cervenk, et al., 1982...crustal structure in southern Norway, Bull. Seismol. Soc. Am., 61, 457-471, 1971. Skolnik, M. I., Radar Handbook, McGraw-Hill Book Co., New York, 1970

  4. Automatic spikes detection in seismogram

    王海军; 靳平; 刘贵忠

    2003-01-01

    @@ Data processing for seismic network is very complex and fussy, because a lot of data is recorded in seismic network every day, which make it impossible to process these data all by manual work. Therefore, seismic data should be processed automatically to produce a initial results about events detection and location. Afterwards, these results are reviewed and modified by analyst. In automatic processing data quality checking is important. There are three main problem data thatexist in real seismic records, which include: spike, repeated data and dropouts. Spike is defined as isolated large amplitude point; the other two problem datahave the same features that amplitude of sample points are uniform in a interval. In data quality checking, the first step is to detect and statistic problem data in a data segment, if percent of problem data exceed a threshold, then the whole data segment is masked and not be processed in the later process.

  5. Analysis of the rotational structure in the high-resolution infrared spectra of trans-hexatriene-1,1-d2 and -cis-1-d1

    Craig, Norman C.; Fuson, Hannah A.; Tian, Hengfeng; Blake, Thomas A.

    2012-09-01

    Mixtures of trans-hexatriene-1,1-d2, -cis-1-d1, and -trans-1-d1 have been synthesized. Anharmonic frequencies and harmonic intensities were predicted with the B3LYP/cc-pVTZ model for the out-of-plane (a″) modes of the three isotopologues. Assignments are proposed for most of the a″ vibrational modes above 500 cm-1. Ground state (GS) rotational constants have been determined for the 1,1-d2 and cis-1-d1 species from the analysis of rotational structure of C-type bands in the high-resolution (0.0015 cm-1) infrared spectra in a mixture of the three isotopologues. The GS constants for the 1,1-d2 species are A0 = 0.8018850(6), B0 = 0.0418540(6), and C0 = 0.0397997(4) cm-1. The GS constants for the cis-1-d1 species are A0 = 0.809388(1), B0 = 0.043532(2), and C0 = 0.041320(1) cm-1. Small inertial defects confirm planarity for both species. These ground state rotational constants are intended for use in determining a semiexperimental equilibrium structure and evaluating the influence of chain length on π-electron delocalization in polyenes.

  6. Dynamics of the gas-liquid interfacial reaction of O(1D) with a liquid hydrocarbon.

    Waring, Carla; King, Kerry L; Costen, Matthew L; McKendrick, Kenneth G

    2011-06-30

    The dynamics of the gas-liquid interfacial reaction of the first electronically excited state of the oxygen atom, O((1)D), with the surface of a liquid hydrocarbon, squalane (C(30)H(62); 2,6,10,15,19,23-hexamethyltetracosane) has been studied experimentally. Translationally hot O((1)D) atoms were generated by 193 nm photolysis of a low pressure (nominally 1 mTorr) of N(2)O a short distance (mean = 6 mm) above a continually refreshed liquid squalane surface. Nascent OH (X(2)Π, v' = 0) reaction products were detected by laser-induced fluorescence (LIF) on the OH A(2)Σ(+)-X(2)Π (1,0) band at the same distance above the surface. The speed distribution of the recoiling OH was characterized by measuring the appearance profiles as a function of photolysis-probe delay for selected rotational levels, N'. The rotational (and, partially, fine-structure) state distributions were also measured by recording LIF excitation spectra at selected photolysis-probe delays. The OH v' = 0 rotational distribution is bimodal and can be empirically decomposed into near thermal (~300 K) and much hotter (~6000 K) Boltzmann-temperature components. There is a strong positive correlation between rotational excitation and translation energy. However, the colder rotational component still represents a significant fraction (~30%) of the fastest products, which have substantially superthermal speeds. We estimate an approximate upper limit of 3% for the quantum yield of OH per O((1)D) atom that collides with the surface. By comparison with established mechanisms for the corresponding reactions in the gas phase, we conclude that the rotationally and translationally hot products are formed via a nonstatistical insertion mechanism. The rotationally cold but translationally hot component is most likely produced by direct abstraction. Secondary collisions at the liquid surface of products of either of the previous two mechanisms are most likely responsible for the rotationally and translationally cold

  7. Structural and population-based evaluations of TBC1D1 p.Arg125Trp.

    Tom G Richardson

    Full Text Available Obesity is now a leading cause of preventable death in the industrialised world. Understanding its genetic influences can enhance insight into molecular pathogenesis and potential therapeutic targets. A non-synonymous polymorphism (rs35859249, p.Arg125Trp in the N-terminal TBC1D1 phosphotyrosine-binding (PTB domain has shown a replicated association with familial obesity in women. We investigated these findings in the Avon Longitudinal Study of Parents and Children (ALSPAC, a large European birth cohort of mothers and offspring, and by generating a predicted model of the structure of this domain. Structural prediction involved the use of three separate algorithms; Robetta, HHpred/MODELLER and I-TASSER. We used the transmission disequilibrium test (TDT to investigate familial association in the ALSPAC study cohort (N = 2,292 mother-offspring pairs. Linear regression models were used to examine the association of genotype with mean measurements of adiposity (Body Mass Index (BMI, waist circumference and Dual-energy X-ray absorptiometry (DXA assessed fat mass, and logistic regression was used to examine the association with odds of obesity. Modelling showed that the R125W mutation occurs in a location of the TBC1D1 PTB domain that is predicted to have a function in a putative protein:protein interaction. We did not detect an association between R125W and BMI (mean per allele difference 0.27 kg/m(2 (95% Confidence Interval: 0.00, 0.53 P = 0.05 or obesity (odds ratio 1.01 (95% Confidence Interval: 0.77, 1.31, P = 0.96 in offspring after adjusting for multiple comparisons. Furthermore, there was no evidence to suggest that there was familial association between R125W and obesity (χ(2 = 0.06, P = 0.80. Our analysis suggests that R125W in TBC1D1 plays a role in the binding of an effector protein, but we find no evidence that the R125W variant is related to mean BMI or odds of obesity in a general population sample.

  8. 1D multi-element CMUT arrays for ultrasound thermal therapy

    N'Djin, William Apoutou; Canney, Michael; Meynier, Cyril; Chavrier, Françoise; Lafon, Cyril; Nguyen-Dinh, An; Chapelon, Jean-Yves; Carpentier, Alexandre

    2017-03-01

    Interstitial therapeutic ultrasound devices are a promising technology for performing thermal ablation in a wide variety of organs. In this study, the use of Capacitive Micromachined Ultrasound Transducers (CMUTs) for interstitial heating applications was investigated. CMUTs exhibit potential advantages for use in therapeutic ultrasound applications in comparison to standard piezo ultrasound transducer technologies as they have good characteristics in terms of miniaturization (cell size: few dozens of microns), bandwidth (several MHz) and high electro-acoustic efficiency. Two designs of CMUT arrays were studied: (1) a 1D 128-element planar-CMUT array originally dedicated to abdominal ultrasound imaging purposes (5 MHz, element size: 0.3 × 8.0 mm2); (2) a 12-element linear-array, 32.4-mm long and 0.8-mm wide, developed specifically for minimally-invasive interstitial therapeutic applications (6 MHz, element size: 2.7 × 0.8 mm2). Simulations were performed to evaluate the ability to generate thermal lesions in soft tissues with: (1) 1 single linear array, (2) a combination of multiple linear arrays positioned on a cylindrical catheter. Experimental investigations performed with the CMUT imaging array showed the ability to generate surface acoustic intensities (Iac) up to 20 W.cm-2 and to generate intense centimetric thermal lesions in in-vitro turkey breast tissues. At 6 MHz, a single element was able to generate in water a maximum peak pressure of >0.5 MPa. In simulations, the ability to use various power levels and frequencies on independent elements, as well as combinations of multiple linear-arrays offered sufficient flexibility to achieve a wide variety of thermal ablation patterns in 3D. Simulated ablation volumes could be controlled to cover accurately non-symmetrical volumes of brain metastases. In conclusion, CMUT arrays show interesting characteristics, which may open new perspectives of spatial control for conformal interstitial thermal therapy with

  9. Acute exercise and physiological insulin induce distinct phosphorylation signatures on TBC1D1 and TBC1D4 in human skeletal muscle

    Treebak, Jonas Thue; Pehmøller, Christian; Kristensen, Jonas Møller

    2014-01-01

    We investigated the phosphorylation signatures of two Rab GTPase activating proteins TBC1D1 and TBC1D4 in human skeletal muscle in response to physical exercise and physiological insulin levels induced by a carbohydrate rich meal using a paired experimental design. Eight healthy male volunteers...... in response to physiological stimuli in human skeletal muscle and support the idea that Akt and AMPK are upstream kinases. TBC1D1 phosphorylation signatures were comparable between in vitro contracted mouse skeletal muscle and exercised human muscle, and we show that AMPK was regulating phosphorylation...... of these sites in mouse muscle. Contraction and exercise elicited a different phosphorylation pattern of TBC1D4 in mouse compared with human muscle, and although different circumstances in our experimental setup may contribute to this difference, the observation exemplifies that transferring findings between...

  10. 1D compressible flow with temperature dependent transport coefficients

    Jenssen, Helge Kristian

    2009-01-01

    We establish existence of global-in-time weak solutions to the one dimensional, compressible Navier-Stokes system for a viscous and heat conducting ideal polytropic gas (pressure $p=K\\theta/\\tau$, internal energy $e=c_v \\theta$), when the viscosity $\\mu$ is constant and the heat conductivity $\\kappa$ depends on the temperature $\\theta$ according to $\\kappa(\\theta) = \\bar \\kappa \\theta^\\beta$, with $0\\leq\\beta<{3/2}$. This choice of degenerate transport coefficients is motivated by the kinetic theory of gasses. Approximate solutions are generated by a semi-discrete finite element scheme. We first formulate sufficient conditions that guarantee convergence to a weak solution. The convergence proof relies on weak compactness and convexity, and it applies to the more general constitutive relations $\\mu(\\theta) = \\bar \\mu \\theta^\\alpha$, $\\kappa(\\theta) = \\bar \\kappa \\theta^\\beta$, with $\\alpha\\geq 0$, $0 \\leq \\beta < 2$ ($\\bar \\mu, \\bar \\kappa$ constants). We then verify the sufficient conditions in the case...

  11. Optical reflectance and omnidirectional bandgaps in Fibonacci quasicrystals type 1-D multilayer structures containing exponentially graded material

    Singh, Bipin K.; Thapa, Khem B.; Pandey, Praveen C.

    2013-06-01

    A theoretical study of optical reflectance and reflection bands of 1-D photonic quasi-crystals (Fibonacci type arrangement) composed of exponentially graded material is presented. The proposed structures consist of two different layers, one of them is of constant refractive index (L) and the other one is of exponentially graded refractive index (S) dielectric materials. Four different generations (2nd, 3rd, 4th and 5th) of the Fibonacci sequence for 10 periods in one dimension (1-D) are considered and compared in view of their optical reflectance and bandgaps for both TE and TM polarisations. Also, we proposed some heterostructures made by the combination of different Fibonacci generations and their periods to obtain suitable omnidirectional reflection band. We used the transfer matrix method (TMM) to obtain the reflectance, bandgaps and omnidirectional reflectional bandgaps (ODR) of such structures in near infrared spectrum (800-2200 nm) at different angles of incidence. We show that ODR exists in these types of structures. The number of ODRs and total bandgap depend on the Fibonacci generations. Extraordinary ODR bandgaps are obtained in the case of heterostructures formed by the combination of different generations of the Fibonacci sequence. The ODR for these structures is similar to the ODR of photonic crystals containing left-handed materials. This work would be useful to study the Fibonacci type photonic crystals having graded index materials and also it will open new window to design several photonic crystal devices like sensors, reflectors, etc. in the infrared region.

  12. Expression of CD1d protein in human testis showing normal and abnormal spermatogenesis.

    Adly, Mohamed A; Abdelwahed Hussein, Mahmoud-Rezk

    2011-05-01

    CD1d is a member of CD1 family of transmembrane glycoproteins, which represent antigen-presenting molecules. Immunofluorescent staining methods were utilized to examine expression pattern of CD1d in human testicular specimens. In testis showing normal spermatogenesis, a strong CD1d cytoplasmic expression was seen the Sertoli cells, spermatogonia, and Leydig cells. A moderate expression was observed in the spermatocytes. In testes showing maturation arrest, CD1d expression was strong in the Sertoli cells and weak in spermatogonia and spermatocytes compared to testis with normal spermatogenesis. In Sertoli cell only syndrome, CD1d expression was strong in the Sertoli and Leydig cells. This preliminary study displayed testicular infertility-related changes in CD1d expression. The ultrastructural changes associated with with normal and abnormal spermatogenesis are open for further investigations.

  13. TBC1D24 genotype-phenotype correlation: Epilepsies and other neurologic features

    Balestrini, S; Milh, M.; Castiglioni, C.; Lüthy, K.; Finelli, M. J.; Verstreken, P.; Cardon, A; Stražišar, B. G.; Holder, J. L.; Lesca, G; Mancardi, M. M.; Poulat, A. L.; Repetto, G. M.; Banka, S.; Bilo, L.

    2016-01-01

    Objective: To evaluate the phenotypic spectrum associated with mutations in TBC1D24. Methods: We acquired new clinical, EEG, and neuroimaging data of 11 previously unreported and 37 published patients. TBC1D24 mutations, identified through various sequencing methods, can be found online (http://lovd.nl/TBC1D24). Results: Forty-eight patients were included (28 men, 20 women, average age 21 years) from 30 independent families. Eighteen patients (38%) had myoclonic epilepsies. The other patients...

  14. Examination of 1D Solar Cell Model Limitations Using 3D SPICE Modeling: Preprint

    McMahon, W. E.; Olson, J. M.; Geisz, J. F.; Friedman, D. J.

    2012-06-01

    To examine the limitations of one-dimensional (1D) solar cell modeling, 3D SPICE-based modeling is used to examine in detail the validity of the 1D assumptions as a function of sheet resistance for a model cell. The internal voltages and current densities produced by this modeling give additional insight into the differences between the 1D and 3D models.

  15. Unambiguous metabolite identification in high-throughput metabolomics by hybrid 1D 1 H NMR/ESI MS 1 approach: Hybrid 1D 1 H NMR/ESI MS 1 metabolomics method

    Walker, Lawrence R. [Environmental Molecular Sciences Laboratory, Pacific Northwest National Laboratory, Richland WA 99354 USA; Hoyt, David W. [Environmental Molecular Sciences Laboratory, Pacific Northwest National Laboratory, Richland WA 99354 USA; Walker, S. Michael [Department of Ecology and Evolutionary Biology, University of Kansas, Lawrence KS 66045 USA; Ward, Joy K. [Department of Ecology and Evolutionary Biology, University of Kansas, Lawrence KS 66045 USA; Nicora, Carrie D. [Environmental Molecular Sciences Laboratory, Pacific Northwest National Laboratory, Richland WA 99354 USA; Bingol, Kerem [Environmental Molecular Sciences Laboratory, Pacific Northwest National Laboratory, Richland WA 99354 USA

    2016-09-16

    We present a novel approach to improve accuracy of metabolite identification by combining direct infusion ESI MS1 with 1D 1H NMR spectroscopy. The new approach first applies standard 1D 1H NMR metabolite identification protocol by matching the chemical shift, J-coupling and intensity information of experimental NMR signals against the NMR signals of standard metabolites in metabolomics library. This generates a list of candidate metabolites. The list contains false positive and ambiguous identifications. Next, we constrained the list with the chemical formulas derived from high-resolution direct infusion ESI MS1 spectrum of the same sample. Detection of the signals of a metabolite both in NMR and MS significantly improves the confidence of identification and eliminates false positive identification. 1D 1H NMR and direct infusion ESI MS1 spectra of a sample can be acquired in parallel in several minutes. This is highly beneficial for rapid and accurate screening of hundreds of samples in high-throughput metabolomics studies. In order to make this approach practical, we developed a software tool, which is integrated to Chenomx NMR Suite. The approach is demonstrated on a model mixture, tomato and Arabidopsis thaliana metabolite extracts, and human urine.

  16. Tunable Design of Structural Colors Produced by Pseudo-1D Photonic Crystals of Graphene Oxide.

    Tong, Liping; Qi, Wei; Wang, Mengfan; Huang, Renliang; Su, Rongxin; He, Zhimin

    2016-07-01

    It is broadly observed that graphene oxide (GO) films appear transparent with a thickness of about several nanometers, whereas they appear dark brown or almost black with thickness of more than 1 μm. The basic color mechanism of GO film on a sub-micrometer scale, however, is not well understood. This study reports on GO pseudo-1D photonic crystals (p1D-PhCs) exhibiting tunable structural colors in the visible wavelength range owing to its 1D Bragg nanostructures. Striking structural colors of GO p1D-PhCs could be tuned by simply changing either the volume or concentration of the aqueous GO dispersion during vacuum filtration. Moreover, the quantitative relationship between thickness and reflection wavelength of GO p1D-PhCs has been revealed, thereby providing a theoretical basis to rationally design structural colors of GO p1D-PhCs. The spectral response of GO p1D-PhCs to humidity is also obtained clearly showing the wavelength shift of GO p1D-PhCs at differently relative humidity values and thus encouraging the integration of structural color printing and the humidity-responsive property of GO p1D-PhCs to develop a visible and fast-responsive anti-counterfeiting label. The results pave the way for a variety of potential applications of GO in optics, structural color printing, sensing, and anti-counterfeiting.

  17. The Planar Sandwich and Other 1D Planar Heat Flow Test Problems in ExactPack

    Singleton, Jr., Robert [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-01-24

    This report documents the implementation of several related 1D heat flow problems in the verification package ExactPack [1]. In particular, the planar sandwich class defined in Ref. [2], as well as the classes PlanarSandwichHot, PlanarSandwichHalf, and other generalizations of the planar sandwich problem, are defined and documented here. A rather general treatment of 1D heat flow is presented, whose main results have been implemented in the class Rod1D. All planar sandwich classes are derived from the parent class Rod1D.

  18. Room-temperature synthesis of nanoporous 1D microrods of graphitic carbon nitride (g-C3N4) with highly enhanced photocatalytic activity and stability

    Pawar, Rajendra C.; Kang, Suhee; Park, Jung Hyun; Kim, Jong-Ho; Ahn, Sunghoon; Lee, Caroline S.

    2016-08-01

    A one-dimensional (1D) nanostructure having a porous network is an exceptional photocatalytic material to generate hydrogen (H2) and decontaminate wastewater using solar energy. In this report, we synthesized nanoporous 1D microrods of graphitic carbon nitride (g-C3N4) via a facile and template-free chemical approach at room temperature. The use of concentrated acids induced etching and lift-off because of strong oxidation and protonation. Compared with the bulk g-C3N4, the porous 1D microrod structure showed five times higher photocatalytic degradation performance toward methylene blue dye (MB) under visible light irradiation. The photocatalytic H2 evolution of the 1D nanostructure (34 μmol g-1) was almost 26 times higher than that of the bulk g-C3N4 structure (1.26 μmol g-1). Additionally, the photocurrent stability of this nanoporous 1D morphology over 24 h indicated remarkable photocorrosion resistance. The improved photocatalytic activities were attributed to prolonged carrier lifetime because of its quantum confinement effect, effective separation and transport of charge carriers, and increased number of active sites from interconnected nanopores throughout the microrods. The present 1D nanostructure would be highly suited for photocatalytic water purification as well as water splitting devices. Finally, this facile and room temperature strategy to fabricate the nanostructures is very cost-effective.

  19. Assembling carbon fiber–graphene–carbon fiber hetero-structures into 1D–2D–1D junction fillers and patterned structures for improved microwave absorption

    Li, Huimin; Liu, Lin; Li, Hai-Bing; Song, Wei-Li; Bian, Xing-Ming; Zhao, Quan-Liang; Chen, Mingji; Yuan, Xujin; Chen, Haosen; Fang, Daining

    2017-04-01

    Since carbon-based structures of various dimensions, including one-dimensional (1D) carbon nanotubes, two-dimensional (2D) graphene and three-dimensional (3D) carbon foams, have attracted significant attention as microwave absorption fillers, we present an exceptional hetero-junction filler with a 1D–2D–1D feature, achieved by manipulating 2D graphene into 1D carbon fibers in the fiber-extruding process under the electric field. The as-fabricated 1D–2D–1D structural fillers exhibited much-improved dielectric properties and promoted microwave absorption performance in their composites, which is linked to the establishment of enhanced polarization capability, the generation of increased electric loss pathway and the creation of more favorable electromagnetic energy consumption conditions. The results suggest that employing 2D graphene in the 1D–2D–1D nanostructures played the critical role in tuning the electromagnetic response ability, because of its intrinsic electric advantages and dimensional features. To broaden the effective absorption bandwidth, periodic pattern-absorbing structures were designed, which showed combined absorption advantages for various thicknesses. Our strategy for fabricating 1D–2D–1D structural fillers illuminates a universal approach for manipulating dimensions and structures in the nanotechnology.

  20. Fabrication of GaN/AlGaN 1D photonic crystals designed for nonlinear optical applications

    Stomeo, T; Tasco, V; Tarantini, I; Campa, A; De Vittorio, M; Passaseo, A; Braccini, M; Larciprete, M C; Sibilia, C; Bovino, F A

    2011-01-01

    In this paper we present a reliable process to fabricate GaN/AlGaN one dimensional photonic crystal (1D-PhC) microcavities with nonlinear optical properties. We used a heterostructure with a GaN layer embedded between two Distributed Bragg Reflectors consisting of AlGaN/GaN multilayers, on sapphire substrate, designed to generate a {\\lambda}= 800 nm frequency down-converted signal (\\chi^(2) effect) from an incident pump signal at {\\lambda}= 400 nm. The heterostructure was epitaxially grown by metal organic chemical vapour deposition (MOCVD) and integrates a properly designed 1D-PhC grating, which amplifies the signal by exploiting the double effect of cavity resonance and non linear GaN enhancement. The integrated 1D-PhC microcavity was fabricate combing a high resolution e-beam writing with a deep etching technique. For the pattern transfer we used ~ 170 nm layer Cr metal etch mask obtained by means of high quality lift-off technique based on the use of bi-layer resist (PMMA/MMA). At the same time, plasma co...

  1. 5β-Reduced steroids and human Δ(4)-3-ketosteroid 5β-reductase (AKR1D1).

    Chen, Mo; Penning, Trevor M

    2014-05-01

    5β-Reduced steroids are non-planar steroids that have a 90° bend in their structure to create an A/B cis-ring junction. This novel property is required for bile-acids to act as emulsifiers, but in addition 5β-reduced steroids have remarkable physiology and may act as potent tocolytic agents, endogenous cardiac glycosides, neurosteroids, and can act as ligands for orphan and membrane bound receptors. In humans there is only a single 5β-reductase gene AKR1D1, which encodes Δ(4)-3-ketosteroid-5β-reductase (AKR1D1). This enzyme is a member of the aldo-keto reductase superfamily, but possesses an altered catalytic tetrad, in which Glu120 replaces the conserved His residue. This predominant liver enzyme generates all 5β-dihydrosteroids in the C19-C27 steroid series. Mutations exist in the AKR1D1 gene, which result in loss of protein stability and are causative in bile-acid deficiency.

  2. A Novel 1D Hybrid Chaotic Map-Based Image Compression and Encryption Using Compressed Sensing and Fibonacci-Lucas Transform

    Tongfeng Zhang

    2016-01-01

    Full Text Available A one-dimensional (1D hybrid chaotic system is constructed by three different 1D chaotic maps in parallel-then-cascade fashion. The proposed chaotic map has larger key space and exhibits better uniform distribution property in some parametric range compared with existing 1D chaotic map. Meanwhile, with the combination of compressive sensing (CS and Fibonacci-Lucas transform (FLT, a novel image compression and encryption scheme is proposed with the advantages of the 1D hybrid chaotic map. The whole encryption procedure includes compression by compressed sensing (CS, scrambling with FLT, and diffusion after linear scaling. Bernoulli measurement matrix in CS is generated by the proposed 1D hybrid chaotic map due to its excellent uniform distribution. To enhance the security and complexity, transform kernel of FLT varies in each permutation round according to the generated chaotic sequences. Further, the key streams used in the diffusion process depend on the chaotic map as well as plain image, which could resist chosen plaintext attack (CPA. Experimental results and security analyses demonstrate the validity of our scheme in terms of high security and robustness against noise attack and cropping attack.

  3. Potent neutralizing anti-CD1d antibody reduces lung cytokine release in primate asthma model.

    Nambiar, Jonathan; Clarke, Adam W; Shim, Doris; Mabon, David; Tian, Chen; Windloch, Karolina; Buhmann, Chris; Corazon, Beau; Lindgren, Matilda; Pollard, Matthew; Domagala, Teresa; Poulton, Lynn; Doyle, Anthony G

    2015-01-01

    CD1d is a receptor on antigen-presenting cells involved in triggering cell populations, particularly natural killer T (NKT) cells, to release high levels of cytokines. NKT cells are implicated in asthma pathology and blockade of the CD1d/NKT cell pathway may have therapeutic potential. We developed a potent anti-human CD1d antibody (NIB.2) that possesses high affinity for human and cynomolgus macaque CD1d (KD ∼100 pM) and strong neutralizing activity in human primary cell-based assays (IC50 typically <100 pM). By epitope mapping experiments, we showed that NIB.2 binds to CD1d in close proximity to the interface of CD1d and the Type 1 NKT cell receptor β-chain. Together with data showing that NIB.2 inhibited stimulation via CD1d loaded with different glycolipids, this supports a mechanism whereby NIB.2 inhibits NKT cell activation by inhibiting Type 1 NKT cell receptor β-chain interactions with CD1d, independent of the lipid antigen in the CD1d antigen-binding cleft. The strong in vitro potency of NIB.2 was reflected in vivo in an Ascaris suum cynomolgus macaque asthma model. Compared with vehicle control, NIB.2 treatment significantly reduced bronchoalveolar lavage (BAL) levels of Ascaris-induced cytokines IL-5, IL-8 and IL-1 receptor antagonist, and significantly reduced baseline levels of GM-CSF, IL-6, IL-15, IL-12/23p40, MIP-1α, MIP-1β, and VEGF. At a cellular population level NIB.2 also reduced numbers of BAL lymphocytes and macrophages, and blood eosinophils and basophils. We demonstrate that anti-CD1d antibody blockade of the CD1d/NKT pathway modulates inflammatory parameters in vivo in a primate inflammation model, with therapeutic potential for diseases where the local cytokine milieu is critical.

  4. Mapping of the serotonin 5-HT{sub 1D{alpha}} autoreceptor gene (HTR1D) on chromosome 1 using a silent polymorphism in the coding region

    Ozaki, N.; Lappalainen, J.; Linnoila, M. [National Institute on Alcohol Abuse and Alcoholism, Rockville, MD (United States)] [and others

    1995-04-24

    Serotonin (5-HT){sub ID} receptors are 5-HT release-regulating autoreceptors in the human brain. Abnormalities in brain 5-HT function have been hypothesized in the pathophysiology of various psychiatric disorders, including obsessive-compulsive disorder, autism, mood disorders, eating disorders, impulsive violent behavior, and alcoholism. Thus, mutations occurring in 5-HT autoreceptors may cause or increase the vulnerability to any of these conditions. 5-HT{sub 1D{alpha}} and 5-HT{sub 1D{Beta}} subtypes have been previously localized to chromosomes 1p36.3-p34.3 and 6q13, respectively, using rodent-human hybrids and in situ localization. In this communication, we report the detection of a 5-HT{sub 1D{alpha}} receptor gene polymorphism by single strand conformation polymorphism (SSCP) analysis of the coding sequence. The polymorphism was used for fine scale linkage mapping of 5-HT{sub 1D{alpha}} on chromosome 1. This polymorphism should also be useful for linkage studies in populations and in families. Our analysis also demonstrates that functionally significant coding sequence variants of the 5-HT{sub 1D{alpha}} are probably not abundant either among alcoholics or in the general population. 14 refs., 1 fig., 1 tab.

  5. Analysis of Rotational Structure in the High-Resolution Infrared Spectra of the TRANS-HEXATRIENE-1,1-D2 and -CIS-1-D1 Species

    Craig, Norman C.; Fuson, Hannah A.; Tian, Hengfeng; Blake, Thomas A.

    2011-06-01

    Hexatriene-1,1-D2 with some admixture of the cis-1-D1 and trans-1-D1 species was synthesized by reaction of 2,4-pentadienal and (methyl-D3)-triphenylphosphonium iodide (Wittig reagent). The trans isomer was isolated by preparative gas chromatography, and the high-resolution (0.0015 Cm-1) infrared spectrum was recorded on a Bruker IFS 125HR instrument. The rotational structure in two C-type bands for the 1,1-D2 species was analyzed. For this species the bands at 902.043 and 721.864 Cm-1 yielded composite ground state rotational constants of A0 = 0.801882(1), B0 = 0.041850(2), and C0 = 0.039804(1) Cm-1. For the cis-1-D1 species the C-type band at 803.018 Cm-1 gave A0 = 0.809384(2), B0 = 0.043530(3), and C0 = 0.041321(2) Cm-1. By iodine-catalyzed isomerization, we have obtained some of the much less favored cis isomer and hope to obtain microwave spectra for its three deuterium-substituted species. The rotational constants reported here contribute to data needed for determining a semi-experimental structure for trans-hexatriene, which should show that the structural consequences of pi-electron delocalization increase with the chain length of polyenes.

  6. Multiple mobility edges in a 1D Aubry chain with Hubbard interaction in presence of electric field: Controlled electron transport

    Saha, Srilekha; Maiti, Santanu K.; Karmakar, S. N.

    2016-09-01

    Electronic behavior of a 1D Aubry chain with Hubbard interaction is critically analyzed in presence of electric field. Multiple energy bands are generated as a result of Hubbard correlation and Aubry potential, and, within these bands localized states are developed under the application of electric field. Within a tight-binding framework we compute electronic transmission probability and average density of states using Green's function approach where the interaction parameter is treated under Hartree-Fock mean field scheme. From our analysis we find that selective transmission can be obtained by tuning injecting electron energy, and thus, the present model can be utilized as a controlled switching device.

  7. Molecular cloning, sequence analysis and pharmacological properties of the porcine 5-HT(1D) receptor.

    P.L. Bhalla (Pankaj); H.S. Sharma (Hari); T. Wurch (Thierry); P.J. Pauwels (Petrus); P.R. Saxena (Pramod Ranjan)

    2000-01-01

    textabstractA cDNA encoding the full-length 5-HT(1D) receptor derived from porcine cerebral cortex was amplified, cloned and sequenced, using guinea-pig 5-HT(1D) receptor coding sequence oligonucleotide primers in reverse transcription-polymerase chain reaction (RT - PC

  8. 1D Grating structures designed by the time domain topology optimization

    Yang, Lirong; Lavrinenko, Andrei; Sigmund, Ole;

    2008-01-01

    We report on the time domain application of topology optimization to 1D photonic devices. The method is confirmed to converge to the global minimum when optimizing a Bragg grating structure.......We report on the time domain application of topology optimization to 1D photonic devices. The method is confirmed to converge to the global minimum when optimizing a Bragg grating structure....

  9. A rational route to SCM materials based on a 1-D cobalt selenocyanato coordination polymer.

    Boeckmann, Jan; Näther, Christian

    2011-07-07

    Thermal annealing of a discrete complex with terminal SeCN anions and monodentate coligands enforces the formation of a 1D cobalt selenocyanato coordination polymer that shows slow relaxation of the magnetization. Therefore, this approach offers a rational route to 1D materials that might show single chain magnetic behaviour.

  10. Data of evolutionary structure change: 1B99C-2AZ1D [Confc[Archive

    Full Text Available GSDS--VESAN >E --HHHHH> ATOM 316...>D 2AZ1D HGSDHEDEGANE >E HHH...pdbID>1B99 C 1B99C EELLT-EVKPN ...> - > ATOM 3319 CA GLU C 141 17.330 5.755...DChain>2AZ1D DELVDWDRDAS re>GG EEGGHcture

  11. Data of evolutionary structure change: 1D7EA-1OTAA [Confc[Archive

    Full Text Available 1D7EA-1OTAA 1D7E 1OTA A A ---VAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNI...ne>VAL CA 559 PHE CA 524 1OTA A 1OTAA KKALSGDSYWVF E EE...9981689453 7.820000171661377 tion> 0.8790000081062...1399 0.36500000953674316 -0.3330000042915344 -0.25200000405311584 -0.9089999794960022

  12. Data of evolutionary structure change: 1D5NC-1UNFX [Confc[Archive

    Full Text Available msd> 1.0891029834747314 EVID> 1 1UNF...1D5NC-1UNFX 1D5N 1UNF C X ----SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYV...NNANAALESL----PEFANLPVEELITKLDQLPADKKTVL---------RNNAGGHANHSLFWKGLKKGT--TLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGW...HH EVID> 0 TRP CA 380 1UNF X 1UNF

  13. Data of evolutionary structure change: 1D5ND-1UNFX [Confc[Archive

    Full Text Available 1.0915240049362183 EVID> 1 1UNF...1D5ND-1UNFX 1D5N 1UNF D X ----SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYV...NNANAALESL----PEFANLPVEELITKLDQLPADKKTVL---------RNNAGGHANHSLFWKGLKKGTT--LQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGW...H EVID> 0 TRP CA 379 1UNF X 1UNF

  14. Data of evolutionary structure change: 1D5IL-2GJJA [Confc[Archive

    Full Text Available 1D5IL-2GJJA 1D5I 2GJJ L A -DIKMTQSPSSMYASLGERVTITCKASQDIN------SY... 219 ALA CA 310 SER CA 336 2GJJ A 2GJJA PEVVKTGASVK 5.283660888671875 1 2GJJ... A 2GJJA RLEIK----RGEVQ

  15. Testing the Early Mars H2-CO2 Greenhouse Hypothesis with a 1-D Photochemical Model

    Batalha, Natasha; Ramirez, Ramses; Kasting, James

    2015-01-01

    A recent study by Ramirez et al. (2014) demonstrated that an atmosphere with 1.3-4 bar of CO2 and H2O, in addition to 5-20% H2, could have raised the mean annual and global surface temperature of early Mars above the freezing point of water. Such warm temperatures appear necessary to generate the rainfall (or snowfall) amounts required to carve the ancient martian valleys. Here, we use our best estimates for early martian outgassing rates, along with a 1-D photochemical model, to assess the conversion efficiency of CO, CH4, and H2S to CO2, SO2, and H2. Our outgassing estimates assume that Mars was actively recycling volatiles between its crust and interior, as Earth does today. H2 production from serpentinization and deposition of banded iron-formations is also considered. Under these assumptions, maintaining an H2 concentration of ~1-2% by volume is achievable, but reaching 5% H2 requires additional H2 sources or a slowing of the hydrogen escape rate below the diffusion limit. If the early martian atmosphere...

  16. Analysis of the interaction proteins of PIH1D1%与PIH1D1相互作用的蛋白分析

    章元; 张业

    2016-01-01

    目的 分析细胞中与PIH1D1相互作用的蛋白.方法 构建稳定表达FLAG-HA双标签标记的PIH1D1蛋白的HEK293T细胞株,利用FLAG-HA串联亲和纯化(TAP)双标签纯化实验,对目的条带进行质谱分析.结果 成功构建稳定表达FLAG-HA双标签标记的PIH1D1细胞株.通过质谱分析得到了PIH1D1相互作用的蛋白数据,包括细胞质内RNA PolⅡ组装复合物成员RPAP3、UXT、PFD2和PFD6等,凋亡复合物成员MONAD/WDR92等,钙调蛋白信号通路中的PIP和CALM1以及代谢通路中的PKM和LCN1等.结论 PIH1D1与细胞中RPAP3、UXT、PFD2、PFD6、MONAD/WDR92、PIP、CALM1、PKM和LCN1等相互作用,提示PIH1D1可能参与细胞中RNApol Ⅱ组装、细胞凋亡、钙调蛋白通路等多种生理过程.

  17. Alternative spliced CD1d transcripts in human bronchial epithelial cells.

    Kambez Hajipouran Benam

    Full Text Available CD1d is a MHC I like molecule which presents glycolipid to natural killer T (NKT cells, a group of cells with diverse but critical immune regulatory functions in the immune system. These cells are required for optimal defence against bacterial, viral, protozoan, and fungal infections, and control of immune-pathology and autoimmune diseases. CD1d is expressed on antigen presenting cells but also found on some non-haematopoietic cells. However, it has not been observed on bronchial epithelium, a site of active host defence in the lungs. Here, we identify for the first time, CD1D mRNA variants and CD1d protein expression on human bronchial epithelial cells, describe six alternatively spliced transcripts of this gene in these cells; and show that these variants are specific to epithelial cells. These findings provide the basis for investigations into a role for CD1d in lung mucosal immunity.

  18. TU-EF-BRA-01: NMR and Proton Density MRI of the 1D Patient

    Wolbarst, A. [Univ Kentucky (United States)

    2015-06-15

    can be introduced with either of two approaches. In the first, one thinks (loosely) of the nuclei of hydrogen atoms as (rotating and charged and therefore) magnetic objects, whose spin-axes tend to align in a strong external magnetic field, much like a compass needle. As with the Bohr atom, this spin-up/spin-down picture is a highly abridged version of the full quantum mechanical treatment, but still it leads to some useful, legitimate pictures of the NMR process occurring within a voxel: When RF photons of the correct (Larmor) frequency elevate protons in a fixed magnetic field out of their lower-energy spin state into the upper, the NMR phenomenon is indicated by the detectable absorption of RF power. With the addition of a linear gradient field along a multi-voxel, one-dimensional patient/phantom, as well, we can determine the water content of each compartment – an example of a real MRI study, albeit in 1D. Part I concludes with a discussion of the net magnetization at position x, m0(x), under conditions of dynamic thermal equilibrium, which leads into: Part II. Net Voxel Magnetization, m(x,t); T1-MRI; The MRI Device (Lemen), investigates the biophysics of the form of proton spin relaxation process characterized by the time T1. It then moves on to the creation of an MR image that displays the spatial variation in the values of this clinically relevant parameter, again in 1D. Finally, the design and workings of a clinical MRI machine are sketched, in preparation for: Part III. ‘Classical’ NMR; FID Imaging in 1D via k-Space (Yanasak) presents the second standard approach to NMR and MRI, the classical model. It focuses on the time dependence of the net nuclear magnetization, m(x,t), the overall magnetic field generated by the cohort of protons in the voxel at position x. Quite remarkably, this nuclear net magnetization itself acts in a strong magnetic field like a gyroscope in a gravitational field. This tack is better for explaining Free Induction Decay (FID

  19. Tctex1d2 Is a Negative Regulator of GLUT4 Translocation and Glucose Uptake.

    Shimoda, Yoko; Okada, Shuichi; Yamada, Eijiro; Pessin, Jeffrey E; Yamada, Masanobu

    2015-10-01

    Tctex1d2 (Tctex1 domain containing 2) is an open reading frame that encodes for a functionally unknown protein that contains a Tctex1 domain found in dynein light chain family members. Examination of gene expression during adipogenesis demonstrated a marked increase in Tctex1d2 protein expression that was essentially undetectable in preadipocytes and markedly induced during 3T3-L1 adipocyte differentiation. Tctex1d2 overexpression significantly inhibited insulin-stimulated glucose transporter 4 (GLUT4) translocation and 2-deoxyglucose uptake. In contrast, Tctex1d2 knockdown significantly increased insulin-stimulated GLUT4 translocation and 2-deoxyglucose uptake. However, acute insulin stimulation (up to 30 min) in 3T3-L1 adipocytes with overexpression or knockdown of Tctex1d2 had no effect on Akt phosphorylation, a critical signal transduction target required for GLUT4 translocation. Although overexpression of Tctex1d2 had no significant effect on GLUT4 internalization, Tctex1d2 was found to associate with syntaxin 4 in an insulin-dependent manner and inhibit Doc2b binding to syntaxin 4. In addition, glucose-dependent insulinotropic polypeptide rescued the Tctex1d2 inhibition of insulin-stimulated GLUT4 translocation by suppressing the Tctex1d2-syntaxin 4 interaction and increasing Doc2b-Synatxin4 interactions. Taking these results together, we hypothesized that Tctex1d2 is a novel syntaxin 4 binding protein that functions as a negative regulator of GLUT4 plasma membrane translocation through inhibition of the Doc2b-syntaxin 4 interaction.

  20. Technical Note: Sensitivity of 1-D smoke plume rise models to the inclusion of environmental wind drag

    S. R. Freitas

    2010-01-01

    Full Text Available Vegetation fires emit hot gases and particles which are rapidly transported upward by the positive buoyancy generated by the combustion process. In general, the final vertical height that the smoke plumes reach is controlled by the thermodynamic stability of the atmospheric environment and the surface heat flux released by the fire. However, the presence of a strong horizontal wind can enhance the lateral entrainment and induce additional drag, particularly for small fires, impacting the smoke injection height. In this paper, we revisit the parameterization of the vertical transport of hot gases and particles emitted from vegetation fires, described in Freitas et al. (2007, to include the effects of environmental wind on transport and dilution of the smoke plume at its scale. This process is quantitatively represented by introducing an additional entrainment term to account for organized inflow of a mass of cooler and drier ambient air into the plume and its drag by momentum transfer. An extended set of equations including the horizontal motion of the plume and the additional increase of the plume radius is solved to simulate the time evolution of the plume rise and the smoke injection height. One-dimensional (1-D model results are presented for two deforestation fires in the Amazon basin with sizes of 10 and 50 ha under calm and windy atmospheric environments. The results are compared to corresponding simulations generated by the complex non-hydrostatic three-dimensional (3-D Active Tracer High resolution Atmospheric Model (ATHAM. We show that the 1-D model results compare well with the full 3-D simulations. The 1-D model may thus be used in field situations where extensive computing facilities are not available, especially under conditions for which several optional cases must be studied.

  1. Growth and Magnetic Characterization of 1D Permalloy Nanowires Using Self Developed Anodic Aluminium Oxide Templates.

    Singh, Ashutosh K; Mandal, Kalyan

    2016-01-01

    1D Permalloy refers to arrays of nanowires (NWs) made of an alloy of Ni and Fe with 80 and 20 at% composition respectively. In the present work 1 D Permalloy NWs arrays were fabricated into the pores of self engineered Anodic Aluminium Oxide (AAO) templates by a simple electrodeposition technique (EDT). By varying the anodization voltage and parameters of the electrolyte solutions we developed AAO templates with different average pore diameters (40 nm to 70 nm) and developed 1D Permalloy NWs within them. Structural characterization of AAO templates and 1D Permalloy NWs were performed by Transmission and Scanning Electron Microscopy (TEM and SEM respectively). X-ray diffraction (XRD) studies of 1D Permalloy NWs showed their fcc crystalline structure and the AAO template was found to be amorphous in nature. Magnetic studies showed the 1D Permalloy NWs arrays to have strong shape anisotropy, and the easy axis was found to be parallel to the NWs axis. We studied the angular dependence of magnetic properties of the NWs. Coercivity (Hc) and remanence (Mr/Ms) measured along the NWs axis were found to be higher than those measured in a direction perpendicular to the NWs axis. 1D Permalloy NWs developed in this work have the potential to be used in magnetic recording devices.

  2. On the Current Drive Capability of Low Dimensional Semiconductors: 1D versus 2D

    Zhu, Y.; Appenzeller, J.

    2015-10-01

    Low-dimensional electronic systems are at the heart of many scaling approaches currently pursuit for electronic applications. Here, we present a comparative study between an array of one-dimensional (1D) channels and its two-dimensional (2D) counterpart in terms of current drive capability. Our findings from analytical expressions derived in this article reveal that under certain conditions an array of 1D channels can outperform a 2D field-effect transistor because of the added degree of freedom to adjust the threshold voltage in an array of 1D devices.

  3. On the Current Drive Capability of Low Dimensional Semiconductors: 1D versus 2D.

    Zhu, Y; Appenzeller, J

    2015-12-01

    Low-dimensional electronic systems are at the heart of many scaling approaches currently pursuit for electronic applications. Here, we present a comparative study between an array of one-dimensional (1D) channels and its two-dimensional (2D) counterpart in terms of current drive capability. Our findings from analytical expressions derived in this article reveal that under certain conditions an array of 1D channels can outperform a 2D field-effect transistor because of the added degree of freedom to adjust the threshold voltage in an array of 1D devices.

  4. Spatial and frequency domain effects of defects in 1D photonic crystal

    Rudziński, A; Szczepański, P; 10.1007/s11082-007-9095-3

    2009-01-01

    The aim of this paper is to present the analysis of influence of defects in 1D photonic crystal (PC) on the density of states and simultaneously spontaneous emission, in both spatial and frequency domains. In our investigations we use an analytic model of 1D PC with defects. Our analysis reveals how presence of a defect causes a defect mode to appear. We show that a defect in 1D PC has local character, being negligible in regions of PC situated far from the defected elementary cell. We also analyze the effect of multiple defects, which lead to photonic band gap splitting.

  5. TCTEX1D2 mutations underlie Jeune asphyxiating thoracic dystrophy with impaired retrograde intraflagellar transport

    Schmidts, Miriam; Hou, Yuqing; Cortés, Claudio R.; Mans, Dorus A.; Huber, Celine; Boldt, Karsten; Patel, Mitali; van Reeuwijk, Jeroen; Plaza, Jean-Marc; van Beersum, Sylvia E. C.; Yap, Zhi Min; Letteboer, Stef J. F.; Taylor, S. Paige; Herridge, Warren; Johnson, Colin A.; Scambler, Peter J.; Ueffing, Marius; Kayserili, Hulya; Krakow, Deborah; King, Stephen M.; Beales, Philip L.; Al-Gazali, Lihadh; Wicking, Carol; Cormier-Daire, Valerie; Roepman, Ronald; Mitchison, Hannah M.; Witman, George B.; Al-Turki, Saeed; Anderson, Carl; Anney, Richard; Antony, Dinu; Asimit, Jennifer; Ayub, Mohammad; Barrett, Jeff; Barroso, Inês; Bentham, Jamie; Bhattacharya, Shoumo; Blackwood, Douglas; Bobrow, Martin; Bochukova, Elena; Bolton, Patrick; Boustred, Chris; Breen, Gerome; Brion, Marie-Jo; Brown, Andrew; Calissano, Mattia; Carss, Keren; Chatterjee, Krishna; Chen, Lu; Cirak, Sebhattin; Clapham, Peter; Clement, Gail; Coates, Guy; Collier, David; Cosgrove, Catherine; Cox, Tony; Craddock, Nick; Crooks, Lucy; Curran, Sarah; Daly, Allan; Danecek, Petr; Smith, George Davey; Day-Williams, Aaron; Day, Ian; Durbin, Richard; Edkins, Sarah; Ellis, Peter; Evans, David; Farooqi, I. Sadaf; Fatemifar, Ghazaleh; Fitzpatrick, David; Flicek, Paul; Floyd, Jamie; Foley, A. Reghan; Franklin, Chris; Futema, Marta; Gallagher, Louise; Gaunt, Tom; Geschwind, Daniel; Greenwood, Celia; Grozeva, Detelina; Guo, Xiaosen; Gurling, Hugh; Hart, Deborah; Hendricks, Audrey; Holmans, Peter; Huang, Jie; Humphries, Steve E.; Hurles, Matt; Hysi, Pirro; Jackson, David; Jamshidi, Yalda; Jewell, David; Chris, Joyce; Kaye, Jane; Keane, Thomas; Kemp, John; Kennedy, Karen; Kent, Alastair; Kolb-Kokocinski, Anja; Lachance, Genevieve; Langford, Cordelia; Lee, Irene; Li, Rui; Li, Yingrui; Ryan, Liu; Lönnqvist, Jouko; Lopes, Margarida; MacArthur, Daniel G.; Massimo, Mangino; Marchini, Jonathan; Maslen, John; McCarthy, Shane; McGuffin, Peter; McIntosh, Andrew; McKechanie, Andrew; McQuillin, Andrew; Memari, Yasin; Metrustry, Sarah; Min, Josine; Moayyeri, Alireza; Morris, James; Muddyman, Dawn; Muntoni, Francesco; Northstone, Kate; O'Donovan, Michael; O'Rahilly, Stephen; Onoufriadis, Alexandros; Oualkacha, Karim; Owen, Michael; Palotie, Aarno; Panoutsopoulou, Kalliope; Parker, Victoria; Parr, Jeremy; Paternoster, Lavinia; Paunio, Tiina; Payne, Felicity; Perry, John; Pietilainen, Olli; Plagnol, Vincent; Quail, Michael A.; Quaye, Lydia; Raymond, Lucy; Rehnström, Karola; Brent Richards, J.; Ring, Sue; Ritchie, Graham R S; Savage, David B.; Schoenmakers, Nadia; Semple, Robert K.; Serra, Eva; Shihab, Hashem; Shin, So-Youn; Skuse, David; Small, Kerrin; Smee, Carol; Soler, Artigas María; Soranzo, Nicole; Southam, Lorraine; Spector, Tim; St Pourcain, Beate; St. Clair, David; Stalker, Jim; Surdulescu, Gabriela; Suvisaari, Jaana; Tachmazidou, Ioanna; Tian, Jing; Timpson, Nic; Tobin, Martin; Valdes, Ana; van Kogelenberg, Margriet; Vijayarangakannan, Parthiban; Wain, Louise; Walter, Klaudia; Wang, Jun; Ward, Kirsten; Wheeler, Ellie; Whittall, Ros; Williams, Hywel; Williamson, Kathy; Wilson, Scott G.; Wong, Kim; Whyte, Tamieka; ChangJiang, Xu; Zeggini, Eleftheria; Zhang, Feng; Zheng, Hou-Feng

    2015-01-01

    The analysis of individuals with ciliary chondrodysplasias can shed light on sensitive mechanisms controlling ciliogenesis and cell signalling that are essential to embryonic development and survival. Here we identify TCTEX1D2 mutations causing Jeune asphyxiating thoracic dystrophy with partially penetrant inheritance. Loss of TCTEX1D2 impairs retrograde intraflagellar transport (IFT) in humans and the protist Chlamydomonas, accompanied by destabilization of the retrograde IFT dynein motor. We thus define TCTEX1D2 as an integral component of the evolutionarily conserved retrograde IFT machinery. In complex with several IFT dynein light chains, it is required for correct vertebrate skeletal formation but may be functionally redundant under certain conditions. PMID:26044572

  6. Global adjoint tomography: first-generation model

    Bozdağ, Ebru; Peter, Daniel; Lefebvre, Matthieu; Komatitsch, Dimitri; Tromp, Jeroen; Hill, Judith; Podhorszki, Norbert; Pugmire, David

    2016-12-01

    We present the first-generation global tomographic model constructed based on adjoint tomography, an iterative full-waveform inversion technique. Synthetic seismograms were calculated using GPU-accelerated spectral-element simulations of global seismic wave propagation, accommodating effects due to 3-D anelastic crust & mantle structure, topography & bathymetry, the ocean load, ellipticity, rotation, and self-gravitation. Fréchet derivatives were calculated in 3-D anelastic models based on an adjoint-state method. The simulations were performed on the Cray XK7 named `Titan', a computer with 18 688 GPU accelerators housed at Oak Ridge National Laboratory. The transversely isotropic global model is the result of 15 tomographic iterations, which systematically reduced differences between observed and simulated three-component seismograms. Our starting model combined 3-D mantle model S362ANI with 3-D crustal model Crust2.0. We simultaneously inverted for structure in the crust and mantle, thereby eliminating the need for widely used `crustal corrections'. We used data from 253 earthquakes in the magnitude range 5.8 ≤ Mw ≤ 7.0. We started inversions by combining ˜30 s body-wave data with ˜60 s surface-wave data. The shortest period of the surface waves was gradually decreased, and in the last three iterations we combined ˜17 s body waves with ˜45 s surface waves. We started using 180 min long seismograms after the 12th iteration and assimilated minor- and major-arc body and surface waves. The 15th iteration model features enhancements of well-known slabs, an enhanced image of the Samoa/Tahiti plume, as well as various other plumes and hotspots, such as Caroline, Galapagos, Yellowstone and Erebus. Furthermore, we see clear improvements in slab resolution along the Hellenic and Japan Arcs, as well as subduction along the East of Scotia Plate, which does not exist in the starting model. Point-spread function tests demonstrate that we are approaching the resolution

  7. Vorticity and Λ polarization in event-by-event (3+1)D viscous hydrodynamics

    Pang, Long-Gang; Fang, Ren-Hong; Petersen, Hannah; Wang, Qun; Wang, Xin-Nian

    2017-01-01

    We visualized the vortical fluid in fluctuating QGP using (3+1)D viscous hydrodynamics, computed the spin distribution and correlation of hyperons and estimated the polarization splitting between Λ and .

  8. Experimental Conditions: SE24_S1_M1_D1 [Metabolonote[Archive

    Full Text Available rometry with 13C‑Labeling for Chemical Assignment of Sulfur-Containing Metabolites ...SE24_S1_M1_D1 SE24 Combination of Liquid Chromatography-Fourier Transform Ion Cyclotron Resonance-Mass Spect

  9. The Rab-GTPase-activating protein TBC1D1 regulates skeletal muscle glucose metabolism

    Szekeres, Ferenc; Chadt, Alexandra; Tom, Robby Z

    2012-01-01

    The Rab-GTPase-activating protein TBC1D1 has emerged as a novel candidate involved in metabolic regulation. Our aim was to determine whether TBC1D1 is involved in insulin as well as energy-sensing signals controlling skeletal muscle metabolism. TBC1D1-deficient congenic B6.SJL-Nob1.10 (Nob1.10(SJL...... be explained partly by a 50% reduction in GLUT4 protein, since proximal signaling at the level of Akt, AMPK, and acetyl-CoA carboxylase (ACC) was unaltered. Paradoxically, in vivo insulin-stimulated 2-deoxyglucose uptake was increased in EDL and tibialis anterior muscle from TBC1D1-deficient mice......)) and wild-type littermates were studied. Glucose and insulin tolerance, glucose utilization, hepatic glucose production, and tissue-specific insulin-mediated glucose uptake were determined. The effect of insulin, AICAR, or contraction on glucose transport was studied in isolated skeletal muscle. Glucose...

  10. Derivative expansion and the induced Chern-Simons term in N=1, d=3 superspace

    Gama, F S; Petrov, A Yu

    2015-01-01

    In this paper we apply a supersymmetric generalization of the method of derivative expansion to compute the induced non-Abelian Chern-Simons term in $\\mathcal{N}=1$, $d=3$ superspace, for an arbitrary gauge group.

  11. Quasi-one dimensional (Q1D) nanostructures: Synthesis, integration and device application

    Chien, Chung-Jen

    Quasi-one-dimensional (Q1D) nanostructures such as nanotubes and nanowires have been widely regarded as the potential building blocks for nanoscale electronic, optoelectronic and sensing devices. In this work, the content can be divided into three categories: Nano-material synthesis and characterizations, alignment and integration, physical properties and application. The dissertation consists of seven chapters as following. Chapter 1 will give an introduction to low dimensional nano-materials. Chapter 2 explains the mechanism how Q1D nanostructure grows. Chapter 3 describes the methods how we horizontally and vertically align the Q1D nanostructure. Chapter 4 and 5 are the electrical and optical device characterization respectively. Chapter 6 demonstrates the integration of Q1D nanostructures and the device application. The last chapter will discuss the future work and conclusion of the thesis.

  12. Ruthenium and osmium complexes of hemilabile chiral monophosphinite ligands derived from 1D-pinitol or 1D-chiro-inositol as catalysts for asymmetric hydrogenation reactions.

    Slade, Angela T; Lensink, Cornelis; Falshaw, Andrew; Clark, George R; Wright, L James

    2014-12-07

    The monophosphinite ligands, 1D-1,2;5,6-di-O-cyclopentylidene-3-O-methyl-4-O-diphenylphosphino-chiro-inositol (D-P1), 1D-1,2;5,6-di-O-isopropylidene-3-O-methyl-4-O-diphenylphosphino-chiro-inositol (D-P2), 1D-1,2;5,6-di-O-cyclohexylidene-3-O-methyl-4-O-diphenylphosphino-chiro-inositol (D-P3), and 1D-1,2;5,6-di-O-cyclopentylidene-3-O-ethyl-4-O-diphenylphosphino-chiro-inositol (D-P4), can be conveniently prepared from the chiral natural products 1D-pinitol or 1D-chiro-inositol. On treatment of toluene solutions of RuCl2(PPh3)3 with two mole equivalents of the ligands D-PY (Y = 1-4) the complexes RuCl2(D-P1)2 (1), RuCl2(D-P2)2 (4), RuCl2(D-P3)2 (5), or RuCl2(D-P4)2 (6), respectively, are formed. Similarly, treatment of OsCl2(PPh3)3 with D-P1 gives OsCl2(D-P1)2 (7). The single crystal X-ray structure determination of 1 reveals that each D-P1 ligand coordinates to ruthenium through phosphorus and the oxygen atom of the methoxyl group. Treatment of 1 with excess LiBr or LiI results in metathesis of the chloride ligands and RuBr2(D-P1)2 (2) or RuI2(D-P1)2 (3), respectively, are formed. Exposure of a solution of 1 to carbon monoxide results in the very rapid formation of RuCl2(CO)2(D-P1)2 (8), thereby demonstrating the ease with which the oxygen donors are displaced from the metal and hence the hemilabile nature of the two bidentate D-P1 ligands in 1. Preliminary studies indicate that 1-7 act as catalysts for the asymmetric hydrogenation reactions of acetophenone and 3-quinuclidinone to give the corresponding alcohols in generally high conversions but low enantiomeric excesses.

  13. Overexpression of AtDREB1D transcription factor improves drought tolerance in soybean.

    Guttikonda, Satish K; Valliyodan, Babu; Neelakandan, Anjanasree K; Tran, Lam-Son Phan; Kumar, Rajesh; Quach, Truyen N; Voothuluru, Priyamvada; Gutierrez-Gonzalez, Juan J; Aldrich, Donavan L; Pallardy, Stephen G; Sharp, Robert E; Ho, Tuan-Hua David; Nguyen, Henry T

    2014-12-01

    Drought is one of the major abiotic stresses that affect productivity in soybean (Glycine max L.) Several genes induced by drought stress include functional genes and regulatory transcription factors. The Arabidopsis thaliana DREB1D transcription factor driven by the constitutive and ABA-inducible promoters was introduced into soybean through Agrobacterium tumefaciens-mediated gene transfer. Several transgenic lines were generated and molecular analysis was performed to confirm transgene integration. Transgenic plants with an ABA-inducible promoter showed a 1.5- to two-fold increase of transgene expression under severe stress conditions. Under well-watered conditions, transgenic plants with constitutive and ABA-inducible promoters showed reduced total leaf area and shoot biomass compared to non-transgenic plants. No significant differences in root length or root biomass were observed between transgenic and non-transgenic plants under non-stress conditions. When subjected to gradual water deficit, transgenic plants maintained higher relative water content because the transgenic lines used water more slowly as a result of reduced total leaf area. This caused them to wilt slower than non-transgenic plants. Transgenic plants showed differential drought tolerance responses with a significantly higher survival rate compared to non-transgenic plants when subjected to comparable severe water-deficit conditions. Moreover, the transgenic plants also showed improved drought tolerance by maintaining 17-24 % greater leaf cell membrane stability compared to non-transgenic plants. The results demonstrate the feasibility of engineering soybean for enhanced drought tolerance by expressing stress-responsive genes.

  14. The structure of nanocomposite 1D cationic conductor crystal@SWNT.

    Kiselev, N A; Kumskov, A S; Zakalyukin, R M; Vasiliev, A L; Chernisheva, M V; Eliseev, A A; Krestinin, A V; Freitag, B; Hutchison, J L

    2012-06-01

    Nanocomposites consisting of one-dimensional (1D) crystals of the cationic conductors CuI, CuBr and AgBr inside single-walled carbon nanotubes, mainly (n, 0), were obtained using the capillary technique. 1D crystal structure models were proposed based on the high resolution transmission electron microscopy performed on a FEI Titan 80-300 at 80 kV with aberration correction. According to the models and image simulations there are two modifications of 1D crystal: hexagonal close-packed bromine (iodine) anion sublattice (growth direction ) and 1D crystal cubic structure (growth direction ) compressed transversely to the nanotube (D(m) ∼1.33 nm) axis. Tentatively this kind of 1D crystal can be considered as monoclinic. One modification of the anion sublattice reversibly transforms into the other inside the nanotube, probably initiated by electron beam heating. As demonstrated by micrographs, copper or silver cations can occupy octahedral positions or are statistically distributed across two tetrahedral positions. A 1DAgBr@SWNT (18, 0; 19, 0) pseudoperiodic 'lattice distortion' is revealed resulting from convolution of the nanotube wall function image with 1D cubic crystal function image.

  15. HERMES Precision Results on g1p, g1d and g1n and the First Measurement of the Tensor Structure Function b1d

    Riedl, C; Akopov, Z; Amarian, M; Ammosov, V V; Andrus, A; Aschenauer, E C; Augustyniak, W; Avakian, R; Avetisian, A; Avetissian, E; Bailey, P; Baturin, V; Baumgarten, C; Beckmann, M; Belostotskii, S; Bernreuther, S; Bianchi, N; Blok, H P; Böttcher, Helmut B; Borisov, A; Bouwhuis, M; Brack, J; Brüll, A; Bryzgalov, V V; Capitani, G P; Chiang, H C; Ciullo, G; Contalbrigo, M; Dalpiaz, P F; De Leo, R; De Nardo, L; De Sanctis, E; Devitsin, E G; Di Nezza, P; Düren, M; Ehrenfried, M; Elalaoui-Moulay, A; Elbakian, G M; Ellinghaus, F; Elschenbroich, U; Ely, J; Fabbri, R; Fantoni, A; Feshchenko, A; Felawka, L; Fox, B; Franz, J; Frullani, S; Gärber, Y; Gapienko, G; Gapienko, V; Garibaldi, F; Garrow, K; Garutti, E; Gaskell, D; Gavrilov, G E; Karibian, V; Graw, G; Grebenyuk, O; Greeniaus, L G; Hafidi, K; Hartig, M; Hasch, D; Heesbeen, D; Henoch, M; Hertenberger, R; Hesselink, W H A; Hillenbrand, A; Hoek, M; Holler, Y; Hommez, B; Iarygin, G; Ivanilov, A; Izotov, A; Jackson, H E; Jgoun, A; Kaiser, R; Kinney, E; Kiselev, A; Königsmann, K C; Kopytin, M; Korotkov, V A; Kozlov, V; Krauss, B; Krivokhizhin, V G; Lagamba, L; Lapikas, L; Laziev, A; Lenisa, P; Liebing, P; Lindemann, T; Lipka, K; Lorenzon, W; Lü, J; Maiheu, B; Makins, N C R; Marianski, B; Marukyan, H O; Masoli, F; Mexner, V; Meyners, N; Miklukho, O; Miller, C A; Miyachi, Y; Muccifora, V; Nagaitsev, A; Nappi, E; Naryshkin, Yu; Nass, A; Negodaev, M A; Nowak, Wolf-Dieter; Oganessyan, K; Ohsuga, H; Orlandi, G; Pickert, N; Potashov, S Yu; Potterveld, D H; Raithel, M; Reggiani, D; Reimer, P E; Reischl, A; Reolon, A R; Rith, K; Airapetian, A; Rosner, G; Rostomyan, A; Rubacek, L; Ryckbosch, D; Salomatin, Yu I; Sanjiev, I; Savin, I; Scarlett, C; Schäfer, A; Schill, C; Schnell, G; Schüler, K P; Schwind, A; Seele, J; Seidl, R; Seitz, B; Shanidze, R G; Shearer, C; Shibata, T A; Shutov, V B; Simani, M C; Sinram, K; Stancari, M D; Statera, M; Steffens, E; Steijger, J J M; Stewart, J; Stösslein, U; Tait, P; Tanaka, H; Taroian, S P; Tchuiko, B; Terkulov, A R; Tkabladze, A V; Trzcinski, A; Tytgat, M; Vandenbroucke, A; Van der Nat, P B; van der Steenhoven, G; Vetterli, Martin C; Vikhrov, V; Vincter, M G; Visser, J; Vogel, C; Vogt, M; Volmer, J; Weiskopf, C; Wendland, J; Wilbert, J; Ybeles-Smit, G V; Yen, S; Zihlmann, B; Zohrabyan, H G; Zupranski, P; Riedl, Caroline

    2005-01-01

    Final HERMES results on the proton, deuteron and neutron structure function g1 are presented in the kinematic range 0.00211d are presented.

  16. Stable Interacting $(2 + 1)d$ Conformal Field Theories at the Boundary of a class of $(3 + 1)d$ Symmetry Protected Topological Phases

    Bi, Zhen; BenTov, Yoni; Xu, Cenke

    2016-01-01

    Motivated by recent studies of symmetry protected topological (SPT) phases, we explore the possible gapless quantum disordered phases in the $(2+1)d$ nonlinear sigma model defined on the Grassmannian manifold $\\frac{U(N)}{U(n)\\times U(N - n)}$ with a Wess-Zumino-Witten (WZW) term at level $k$, which is the effective low energy field theory of the boundary of certain $(3+1)d$ SPT states. With $k = 0$, this model has a well-controlled large-$N$ limit, $i.e.$ its renormalization group equations can be computed exactly with large-$N$. However, with the WZW term, the large-$N$ and large-$k$ limit alone is not sufficient for a reliable study of the nature of the quantum disordered phase. We demonstrate that at least for $n = 1$, through a combined large-$N$, large-$k$ and $3-\\epsilon$ generalization, a stable fixed point in the quantum disordered phase can be reliably located, which corresponds to a $(2+1)d$ strongly interacting conformal field theory. Extension of our method to $n > 1$ will also be discussed.

  17. Benchmarks and models for 1-D radiation transport in stochastic participating media

    Miller, D S

    2000-08-21

    Benchmark calculations for radiation transport coupled to a material temperature equation in a 1-D slab and 1-D spherical geometry binary random media are presented. The mixing statistics are taken to be homogeneous Markov statistics in the 1-D slab but only approximately Markov statistics in the 1-D sphere. The material chunk sizes are described by Poisson distribution functions. The material opacities are first taken to be constant and then allowed to vary as a strong function of material temperature. Benchmark values and variances for time evolution of the ensemble average of material temperature energy density and radiation transmission are computed via a Monte Carlo type method. These benchmarks are used as a basis for comparison with three other approximate methods of solution. One of these approximate methods is simple atomic mix. The second approximate model is an adaptation of what is commonly called the Levermore-Pomraning model and which is referred to here as the standard model. It is shown that recasting the temperature coupling as a type of effective scattering can be useful in formulating the third approximate model, an adaptation of a model due to Su and Pomraning which attempts to account for the effects of scattering in a stochastic context. This last adaptation shows consistent improvement over both the atomic mix and standard models when used in the 1-D slab geometry but shows limited improvement in the 1-D spherical geometry. Benchmark values are also computed for radiation transmission from the 1-D sphere without material heating present. This is to evaluate the performance of the standard model on this geometry--something which has never been done before. All of the various tests demonstrate the importance of stochastic structure on the solution. Also demonstrated are the range of usefulness and limitations of a simple atomic mix formulation.

  18. A predictive method of calculating the dosimetric effect of 1-D motion on narrow multileaf collimated segments.

    Kelly, A; Williams, M; Metcalfe, P

    2009-03-01

    This study aims to investigate the utility of 1-D convolution as a predictive method to quantify the effect of patient movement as a result of respiration on segmented dose distributions typically found in IMRT. This is for the restricted case of 1-D motion perpendicular to the beam direction. A modified respiratory motion phantom was coupled to a solid water phantom and used to measure the dose distribution of several narrow MLC segments. The measured data was compared to dose distribution calculated by the mathematical convolution of static profiles with a probability distribution function (PDF) generated for sinusoidal motion and power cosine motion. The MLC segments for an IMRT field were also studied. Additionally, the dosimetric effect of intra-fraction patient motion combined with that of inter-fraction setup error, modelled using a Gaussian PDF, was calculated. Set-up variation and respiratory motion can significantly degrade the dose distribution of narrow segments. Our results emphasise the need to maintain the smallest feasible amplitude of respiratory motion and minimise set-up uncertainties, particularly when narrow segments are used.

  19. Thermal characterization of large size lithium-ion pouch cell based on 1d electro-thermal model

    Vertiz, G.; Oyarbide, M.; Macicior, H.; Miguel, O.; Cantero, I.; Fernandez de Arroiabe, P.; Ulacia, I.

    2014-12-01

    Thermal management is one of the key factors to keep lithium-ion cells in optimum electrical performance, under safe working conditions and into a reasonably low ageing process. This issue is becoming particularly relevant due to the heterogeneous heat generation along the cell. Cell working temperature is determined by ambient temperature, heat generation and evacuation capacity. Therefore, thermal management is established by: i) the intrinsic thermal properties (heat capacity & thermal conductivity) and ii) the heat generation electro-thermal parameters (internal resistance, open circuit voltage & entropic factor). In this research, different methods - calculated and experimental - are used to characterize the main heat properties of a 14Ah -LiFePO4/graphite-commercial large sizes pouch cell. In order to evaluate the accuracy of methods, two comparisons were performed. First, Newman heat generation estimations were compared with experimental heat measurements. Secondly, empirical thermal cell behaviour was match with 1D electro-thermal model response. Finally, considering the results, the most adequate methodology to evaluate the key thermal parameters of a large size Lithium-ion pouch cell are proposed to be: i) pulse method for internal resistance, ii)heat loss method for entropic factor; and iii)experimental measurement (ARC calorimeter and C-177-97 standard method) for heat capacity and thermal conductivity.

  20. Comparing 1D, 2D and 3D models for predicting root water uptake at the plant scale

    de Willigen, Peter; van Dam, Jos; Heinen, Marius; Javaux, Mathieu

    2010-05-01

    Numerous modeling approaches exist to simulate soil water extraction by plant roots. They mainly differ in terms of dimensionality (from 1-D to 3-D) and in the degree of detail involved in the root geometry. One dimensional models consider 1-D root length density profiles and assume uniform horizontal soil water distribution and are very efficient regarding computation time. On the opposite, very detailed 3-D approaches, which consider explicitly the root architecture and the root water flow, may need more computation power and time. In between these two extreme cases, other approaches exist, which may be more accurate and less computationally demanding. Our objective is to compare different modeling approaches and check how their implicit or explicit simplifications or assumptions affect the root water uptake (RWU) predictions. Four models were subject to our comparison, all based on Richards equation. The first is a 1-D model solving Richards equation (SWAP) with the Feddes (1978) approach for RWU. The second one is also based on SWAP but with the root water uptake defined by a microscopic approach developed by de Jong van Lier (2008). The third one, FUSSIM, solves the Richards equation in 2-D based on a 2-D distribution of root length density (RLD). The fourth one is R-SWMS, a 3-D model simulating the water flow in the soil and in the roots, based on the complete root architecture description. A 45-day maize root was generated in 3-D and simplified in 2-D or 1-D RLD distributions. We simulated a constant uptake rate for 30 days with a 1-day rainfall at day 15 in three different soil types. We compared relative water uptake versus relative root length density profiles, and actual transpiration time series. On the one hand, the general trends of cumulative transpiration with time for the three soils were relatively similar for all models. On the other hand, some features like hydraulic lift are simulated by both FUSSIM and RSWMS models while other models do not

  1. VES/TEM 1D joint inversion by using Controlled Random Search (CRS) algorithm

    Bortolozo, Cassiano Antonio; Porsani, Jorge Luís; Santos, Fernando Acácio Monteiro dos; Almeida, Emerson Rodrigo

    2015-01-01

    Electrical (DC) and Transient Electromagnetic (TEM) soundings are used in a great number of environmental, hydrological, and mining exploration studies. Usually, data interpretation is accomplished by individual 1D models resulting often in ambiguous models. This fact can be explained by the way as the two different methodologies sample the medium beneath surface. Vertical Electrical Sounding (VES) is good in marking resistive structures, while Transient Electromagnetic sounding (TEM) is very sensitive to conductive structures. Another difference is VES is better to detect shallow structures, while TEM soundings can reach deeper layers. A Matlab program for 1D joint inversion of VES and TEM soundings was developed aiming at exploring the best of both methods. The program uses CRS - Controlled Random Search - algorithm for both single and 1D joint inversions. Usually inversion programs use Marquadt type algorithms but for electrical and electromagnetic methods, these algorithms may find a local minimum or not converge. Initially, the algorithm was tested with synthetic data, and then it was used to invert experimental data from two places in Paraná sedimentary basin (Bebedouro and Pirassununga cities), both located in São Paulo State, Brazil. Geoelectric model obtained from VES and TEM data 1D joint inversion is similar to the real geological condition, and ambiguities were minimized. Results with synthetic and real data show that 1D VES/TEM joint inversion better recovers simulated models and shows a great potential in geological studies, especially in hydrogeological studies.

  2. Noncoherent Spectral Optical CDMA System Using 1D Active Weight Two-Code Keying Codes

    Bih-Chyun Yeh

    2016-01-01

    Full Text Available We propose a new family of one-dimensional (1D active weight two-code keying (TCK in spectral amplitude coding (SAC optical code division multiple access (OCDMA networks. We use encoding and decoding transfer functions to operate the 1D active weight TCK. The proposed structure includes an optical line terminal (OLT and optical network units (ONUs to produce the encoding and decoding codes of the proposed OLT and ONUs, respectively. The proposed ONU uses the modified cross-correlation to remove interferences from other simultaneous users, that is, the multiuser interference (MUI. When the phase-induced intensity noise (PIIN is the most important noise, the modified cross-correlation suppresses the PIIN. In the numerical results, we find that the bit error rate (BER for the proposed system using the 1D active weight TCK codes outperforms that for two other systems using the 1D M-Seq codes and 1D balanced incomplete block design (BIBD codes. The effective source power for the proposed system can achieve −10 dBm, which has less power than that for the other systems.

  3. Deconvolution of Complex 1D NMR Spectra Using Objective Model Selection.

    Travis S Hughes

    Full Text Available Fluorine (19F NMR has emerged as a useful tool for characterization of slow dynamics in 19F-labeled proteins. One-dimensional (1D 19F NMR spectra of proteins can be broad, irregular and complex, due to exchange of probe nuclei between distinct electrostatic environments; and therefore cannot be deconvoluted and analyzed in an objective way using currently available software. We have developed a Python-based deconvolution program, decon1d, which uses Bayesian information criteria (BIC to objectively determine which model (number of peaks would most likely produce the experimentally obtained data. The method also allows for fitting of intermediate exchange spectra, which is not supported by current software in the absence of a specific kinetic model. In current methods, determination of the deconvolution model best supported by the data is done manually through comparison of residual error values, which can be time consuming and requires model selection by the user. In contrast, the BIC method used by decond1d provides a quantitative method for model comparison that penalizes for model complexity helping to prevent over-fitting of the data and allows identification of the most parsimonious model. The decon1d program is freely available as a downloadable Python script at the project website (https://github.com/hughests/decon1d/.

  4. Progressing from 1D to 2-3D near surface airborne electromagnetic mapping: Development of MAiSIE, a Multi-Sensor, Airborne Sea Ice Explorer

    Pfaffhuber, Andreas; Hendricks, Stefan; Kvistedal, Yme

    2012-01-01

    The polar oceans’ sea ice cover is an unconventional and challenging geophysical target to map. Current state of ractice helicopter-electromagnetic (HEM) ice thickness apping is limited to 1D interpretation due to common rocedures and systems that are mainly sensitive to layered tructures. We present a new generation Multi-sensor, irborne Sea Ice Explorer (MAiSIE) to overcome these imitations. As the actual sea ice structure is 3D and in parts heterogeneous, errors up to 50% are observe...

  5. Force on a slow moving impurity due to thermal and quantum fluctuations in a 1D Bose-Einstein condensate

    Roberts, David [Los Alamos National Laboratory; Sykes, Andrew [UNIV OF QUEENSLAND

    2009-01-01

    We study the drag force acting on an impurity moving through a 1D Bose-Einstein condensate in the presence of both quantum and thermal fluctuations. We are able to find exact analytical solutions of the partial differential equations to the level of the Bogoliubov approximation. At zero temperature, we find a nonzero force is exerted on the impurity at subcritical velocities, due to the scattering of quantum fluctuations. We make the following explicit assumptions: far from the impurity the system is in a quantum state given by that of a zero (or finite) temperature Bose-Einstein condensate, and the scattering process generates only causally related reflection/transmission. The results raise unanswered questions in the quantum dynamics associated with the formation of persistent currents.

  6. 3+1D Massless Weyl spinors from bosonic scalar-tensor duality

    Amoretti, Andrea; Caruso, Giacomo; Maggiore, Nicola; Magnoli, Nicodemo

    2013-01-01

    We consider the fermionization of a bosonic free theory characterized by the 3+1D scalar - tensor duality. This duality can be interpreted as the dimensional reduction, via a planar boundary, of the 4+1D topological BF theory. In this model, adopting the Sommerfield tomographic representation of quantized bosonic fields, we explicitly build a fermionic operator and its associated Klein factor such that it satisfies the correct anticommutation relations. Interestingly, we demonstrate that this operator satisfies the massless Dirac equation and that it can be identified with a 3+1D Weyl spinor. Finally, as an explicit example, we write the integrated charge density in terms of the tomographic transformed bosonic degrees of freedom.

  7. Periodic Properties of 1D FE Discrete Models in High Frequency Dynamics

    A. Żak

    2016-01-01

    Full Text Available Finite element discrete models of various engineering 1D structures may be considered as structures of certain periodic characteristics. The source of this periodicity comes from the discontinuity of stress/strain field between the elements. This behaviour remains unnoticeable, when low frequency dynamics of these structures is investigated. At high frequency regimes, however, its influence may be strong enough to dominate calculated structural responses distorting or even falsifying them completely. In this paper, certain computational aspects of structural periodicity of 1D FE discrete models are discussed by the authors. In this discussion, the authors focus their attention on an exemplary problem of 1D rod modelled according to the elementary theory.

  8. DEVELOPMENT OF COUPLED 1D-2D MATHEMATICAL MODELS FOR TIDAL RIVERS

    XU Zu-xin; YIN Hai-long

    2004-01-01

    Some coupled 1D-2D hydrodynamic and water quality models depicting tidal water bodies with complex topography were presented. For the coupled models, finite element method was used to solve the governing equations so as to study tidal rivers with complex topography. Since the 1D and 2D models were coupled, the principle of model coupling was proposed to account appropriately for the factors of water level, flow and pollutant flux and the related dynamical behavior was simulated. Specifically the models were used to probe quantitative pollution contribution of receiving water from neighboring Jiangsu and Zhejiang Provinces to the pollution in the Huangpu River passing through Shanghai City. Numerical examples indicated that the developed coupled 1D-2D models are applicable in tidal river network region of Shanghai.

  9. 3+1D Massless Weyl Spinors from Bosonic Scalar-Tensor Duality

    Andrea Amoretti

    2014-01-01

    Full Text Available We consider the fermionization of a bosonic-free theory characterized by the 3+1D scalar-tensor duality. This duality can be interpreted as the dimensional reduction, via a planar boundary, of the 4+1D topological BF theory. In this model, adopting the Sommerfield tomographic representation of quantized bosonic fields, we explicitly build a fermionic operator and its associated Klein factor such that it satisfies the correct anticommutation relations. Interestingly, we demonstrate that this operator satisfies the massless Dirac equation and that it can be identified with a 3+1D Weyl spinor. Finally, as an explicit example, we write the integrated charge density in terms of the tomographic transformed bosonic degrees of freedom.

  10. PC-1D installation manual and user's guide

    Basore, P.A.

    1991-05-01

    PC-1D is a software package for personal computers that uses finite-element analysis to solve the fully-coupled two-carrier semiconductor transport equations in one dimension. This program is particularly useful for analyzing the performance of optoelectronic devices such as solar cells, but can be applied to any bipolar device whose carrier flows are primarily one-dimensional. This User's Guide provides the information necessary to install PC-1D, define a problem for solution, solve the problem, and examine the results. Example problems are presented which illustrate these steps. The physical models and numerical methods utilized are presented in detail. This document supports version 3.1 of PC-1D, which incorporates faster numerical algorithms with better convergence properties than previous versions of the program. 51 refs., 17 figs., 5 tabs.

  11. An improved 1D area law for frustration-free systems

    Arad, Itai; Vazirani, Umesh

    2011-01-01

    We present a new proof for the 1D area law for frustration-free systems with a constant gap, which exponentially improves the entropy bound in Hastings' 1D area law, and which is tight to within a polynomial factor. For particles of dimension $d$, spectral gap $\\epsilon>0$ and interaction strength of at most $J$, our entropy bound is $S_{1D}\\le \\orderof{1}X^3\\log^8 X$ where $X\\EqDef(J\\log d)/\\epsilon$. Our proof is completely combinatorial, combining the detectability lemma with basic tools from approximation theory. Incorporating locality into the proof when applied to the 2D case gives an entanglement bound that is at the cusp of being non-trivial in the sense that any further improvement would yield a sub-volume law.

  12. Microstates of D1-D5(-P) black holes as interacting D-branes

    Morita, Takeshi

    2014-01-01

    In our previous study [1] (1311.6540), we figured out that the thermodynamics of the near extremal black $p$-branes can be explained as the collective motions of gravitationally interacting elementary $p$-branes (the $p$-soup proposal). We test this proposal in the near-extremal D1-D5 and D1-D5-P black holes and show that their thermodynamics also can be explained in a similar fashion, i.e. via the collective motions of the interacting elementary D1-branes and D5-branes (and waves). It may imply that the microscopic origins of these intersecting black branes and the black $p$-brane are explained in the unified picture. We also argue the relation between the $p$-soup proposal and the conformal field theory calculations of the D1-D5(-P) black holes in superstring theory.

  13. Microstates of D1-D5(-P) black holes, as interacting D-branes

    Morita, Takeshi; Shiba, Shotaro

    2015-07-01

    In our previous study (Morita et al., 2014 [1]), we figured out that the thermodynamics of the near extremal black p-branes can be explained as the collective motions of gravitationally interacting elementary p-branes (the p-soup proposal). We test this proposal in the near-extremal D1-D5 and D1-D5-P black holes and show that their thermodynamics also can be explained in a similar fashion, i.e. via the collective motions of the interacting elementary D1-branes and D5-branes (and waves). It may imply that the microscopic origins of these intersecting black branes and the black p-brane are explained in the unified picture. We also argue the relation between the p-soup proposal and the conformal field theory calculations of the D1-D5(-P) black holes in superstring theory.

  14. REAL-TIME FLOOD FORECASTING METHOD WITH 1-D UNSTEADY FLOW MODEL

    MU Jin-bin; ZHANG Xiao-feng

    2007-01-01

    A real-time forecasting method coupled with the 1-D unsteady flow model with the recursive least-square method was developed. The 1-D unsteady flow model was modified by using the time-variant parameter and revising it dynamically through introducing a variable weighted forgetting factor, such that the output of the model could be adjusted for the real time forecasting of floods. The application of the new real time forecasting model in the reach from Yichang to Luoshan of the Yangtze River was demonstrated. Computational result shows that the forecasting accuracy of the new model is much higher than that of the original 1-D unsteady flow model. The method developed is effective for flood forecasting, and can be used for practical operation in the flood forecasting.

  15. New multi-camera calibration algorithm based on 1D objects

    Zi-jian ZHAO; Yun-cai LIU

    2008-01-01

    A new calibration algorithm for multi-camera systems using 1D calibration objects is proposed. The algorithm integrates the rank-4 factorization with Zhang (2004)'s method. The intrinsic parameters as well as the extrinsic parameters are recovered by capturing with cameras the 1D object's rotations around a fixed point. The algorithm is based on factorization of the scaled measurement matrix, the projective depth of which is estimated in an analytical equation instead of a recursive form. For more than three points on a 1D object, the approach of our algorithm is to extend the scaled measurement matrix. The obtained parameters are finally refined through the maximum likelihood inference. Simulations and experiments with real images verify that the proposed technique achieves a good trade-off between the intrinsic and extrinsic camera parameters.

  16. A comparison of 1D and 2D LSTM architectures for the recognition of handwritten Arabic

    Yousefi, Mohammad Reza; Soheili, Mohammad Reza; Breuel, Thomas M.; Stricker, Didier

    2015-01-01

    In this paper, we present an Arabic handwriting recognition method based on recurrent neural network. We use the Long Short Term Memory (LSTM) architecture, that have proven successful in different printed and handwritten OCR tasks. Applications of LSTM for handwriting recognition employ the two-dimensional architecture to deal with the variations in both vertical and horizontal axis. However, we show that using a simple pre-processing step that normalizes the position and baseline of letters, we can make use of 1D LSTM, which is faster in learning and convergence, and yet achieve superior performance. In a series of experiments on IFN/ENIT database for Arabic handwriting recognition, we demonstrate that our proposed pipeline can outperform 2D LSTM networks. Furthermore, we provide comparisons with 1D LSTM networks trained with manually crafted features to show that the automatically learned features in a globally trained 1D LSTM network with our normalization step can even outperform such systems.

  17. Solution to 1-D consolidation of non-homogeneous soft clay

    XIE Kang-he; WEN Jie-bang; XIA Jian-zhong

    2005-01-01

    In this work, semi-analytical methods were used to solve the problem of 1-D consolidation of non-homogeneous soft clay with spatially varying coefficients of permeability and compressibility. The semi-analytical solution was programmed and then verified by comparison with the obtained analytical solution of a special case. Based on the results of some computations and comparisons with the 1-D homogeneous consolidation (by Terzaghi) and the 1-D non-linear consolidation theory (by Davis et al.)of soft clay, some diagrams were prepared and the relevant consolidation behavior of non-homogeneous soils is discussed. It was shown that the result obtained differs greatly from Terzaghi's theory and that of the non-linear consolidation theory when the coefficients of permeability and compressibility vary greatly.

  18. Transparent Conducting Electrodes based on 1D and 2D Ag Nanogratings for Organic Photovoltaics

    Zeng, Beibei; Bartoli, Filbert J

    2014-01-01

    The optical and electrical properties of optically-thin one-dimensional (1D) Ag nanogratings and two-dimensional (2D) Ag nanogrids are studied, and their use as transparent electrodes in organic photovoltaics are explored. A large broadband and polarization-insensitive optical absorption enhancement in the organic light-harvesting layers is theoretically and numerically demonstrated using either single-layer 2D Ag nanogrids or two perpendicular 1D Ag nanogratings, and is attributed to the excitation of surface plasmon resonances and plasmonic cavity modes. Total photon absorption enhancements of 150% and 200% are achieved for the optimized single-layer 2D Ag nanogrids and double (top and bottom) perpendicular 1D Ag nanogratings, respectively.

  19. Characterisation and improvement of j(O1D) filter radiometers

    Bohn, Birger; Heard, Dwayne E.; Mihalopoulos, Nikolaos; Plass-Dülmer, Christian; Schmitt, Rainer; Whalley, Lisa K.

    2016-07-01

    Atmospheric O3 → O(1D) photolysis frequencies j(O1D) are crucial parameters for atmospheric photochemistry because of their importance for primary OH formation. Filter radiometers have been used for many years for in situ field measurements of j(O1D). Typically the relationship between the output of the instruments and j(O1D) is non-linear because of changes in the shape of the solar spectrum dependent on solar zenith angles and total ozone columns. These non-linearities can be compensated for by a correction method based on laboratory measurements of the spectral sensitivity of the filter radiometer and simulated solar actinic flux density spectra. Although this correction is routinely applied, the results of a previous field comparison study of several filter radiometers revealed that some corrections were inadequate. In this work the spectral characterisations of seven instruments were revised, and the correction procedures were updated and harmonised considering recent recommendations of absorption cross sections and quantum yields of the photolysis process O3 → O(1D). Previous inconsistencies were largely removed using these procedures. In addition, optical interference filters were replaced to improve the spectral properties of the instruments. Successive determinations of spectral sensitivities and field comparisons of the modified instruments with a spectroradiometer reference confirmed the improved performance. Overall, filter radiometers remain a low-maintenance alternative of spectroradiometers for accurate measurements of j(O1D) provided their spectral properties are known and potential drifts in sensitivities are monitored by regular calibrations with standard lamps or reference instruments.

  20. Modelling turbulent vertical mixing sensitivity using a 1-D version of NEMO

    G. Reffray

    2014-08-01

    Full Text Available Through two numerical experiments, a 1-D vertical model called NEMO1D was used to investigate physical and numerical turbulent-mixing behaviour. The results show that all the turbulent closures tested (k + l from Blanke and Delecluse, 1993 and two equation models: Generic Lengh Scale closures from Umlauf and Burchard, 2003 are able to correctly reproduce the classical test of Kato and Phillips (1969 under favourable numerical conditions while some solutions may diverge depending on the degradation of the spatial and time discretization. The performances of turbulence models were then compared with data measured over a one-year period (mid-2010 to mid-2011 at the PAPA station, located in the North Pacific Ocean. The modelled temperature and salinity were in good agreement with the observations, with a maximum temperature error between −2 and 2 °C during the stratified period (June to October. However the results also depend on the numerical conditions. The vertical RMSE varied, for different turbulent closures, from 0.1 to 0.3 °C during the stratified period and from 0.03 to 0.15 °C during the homogeneous period. This 1-D configuration at the PAPA station (called PAPA1D is now available in NEMO as a reference configuration including the input files and atmospheric forcing set described in this paper. Thus, all the results described can be recovered by downloading and launching PAPA1D. The configuration is described on the NEMO site (http://www.nemo-ocean.eu/Using-NEMO/Configurations/C1D_PAPA. This package is a good starting point for further investigation of vertical processes.

  1. Column Testing and 1D Reactive Transport Modeling to Evaluate Uranium Plume Persistence Processes

    Johnson, Raymond H. [Navarro Research and Engineering, Inc.; Morrison, Stan [Navarro Research and Engineering, Inc.; Morris, Sarah [Navarro Research and Engineering, Inc.; Tigar, Aaron [Navarro Research and Engineering, Inc.; Dam, William [U.S. Department of Energy, Office of Legacy Management; Dayvault, Jalena [U.S. Department of Energy, Office of Legacy Management

    2016-04-26

    Motivation for Study: Natural flushing of contaminants at various U.S. Department of Energy Office of Legacy Management sites is not proceeding as quickly as predicted (plume persistence) Objectives: Help determine natural flushing rates using column tests. Use 1D reactive transport modeling to better understand the major processes that are creating plume persistence Approach: Core samples from under a former mill tailings area Tailings have been removed. Column leaching using lab-prepared water similar to nearby Gunnison River water. 1D reactive transport modeling to evaluate processes

  2. Synthesis and characterization of 1D iron(II) spin crossover coordination polymers with hysteresis.

    Bauer, Wolfgang; Lochenie, Charles; Weber, Birgit

    2014-02-07

    Purposeful ligand design was used for the synthesis of eight new 1D iron(II) spin crossover coordination polymers aiming for cooperative spin transitions with hysteresis. The results from magnetic measurements and X-ray structure analysis show that the combination of rigid linkers and a hydrogen bond network between the 1D chains is a promising tool to reach this goal. Five of the eight new samples show a cooperative spin transition with hysteresis with up to 43 K wide hysteresis loops.

  3. Statistics of Eigenfunctions in 1D Tight Binding Model: Distribution of Riccati Variable

    WANG Wen-Ge

    2001-01-01

    For energy eigenfunctions in 1D tight binding model, the distribution of ratios of the nearest components (Riccati variable), denoted by f(p), gives information on their fluctuation properties. The shape of f(p) is studied numerically for three versions of the 1D tight binding model. It is shown that when perturbation is strong the shape of f(p) is usually quite close to that of the Lorentzian distribution and in the case of weak perturbation the shape of the central part of f(p) is model-dependent while the shape of tails are still close to the Lorentzian form.``

  4. Dopamine D1-D2 receptor heteromer signaling pathway in the brain: emerging physiological relevance

    Hasbi Ahmed

    2011-06-01

    Full Text Available Abstract Dopamine is an important catecholamine neurotransmitter modulating many physiological functions, and is linked to psychopathology of many diseases such as schizophrenia and drug addiction. Dopamine D1 and D2 receptors are the most abundant dopaminergic receptors in the striatum, and although a clear segregation between the pathways expressing these two receptors has been reported in certain subregions, the presence of D1-D2 receptor heteromers within a unique subset of neurons, forming a novel signaling transducing functional entity has been shown. Recently, significant progress has been made in elucidating the signaling pathways activated by the D1-D2 receptor heteromer and their potential physiological relevance.

  5. Using the D1D5 CFT to Understand Black Holes

    Avery, Steven

    2010-01-01

    In this dissertation, we review work presented in arXiv:0906.2015, arXiv:0907.1663, arXiv:1002.3132, arXiv:1003.2746, and arXiv:1007.2202 on the D1D5 system. We begin with some motivational material for black holes in string theory. In Chapter 2, we review the D1D5 system, including the gravity and CFT descriptions. In Chapter 3, we show how to perturbatively relax the decoupling limit in a general AdS-CFT setting. This allows one to compute the emission out of the AdS/CFT into the asymptotic...

  6. Opto-digital image encryption by using Baker mapping and 1-D fractional Fourier transform

    Liu, Zhengjun; Li, She; Liu, Wei; Liu, Shutian

    2013-03-01

    We present an optical encryption method based on the Baker mapping in one-dimensional fractional Fourier transform (1D FrFT) domains. A thin cylinder lens is controlled by computer for implementing 1D FrFT at horizontal direction or vertical direction. The Baker mapping is introduced to scramble the amplitude distribution of complex function. The amplitude and phase of the output of encryption system are regarded as encrypted image and key. Numerical simulation has been performed for testing the validity of this encryption scheme.

  7. File list: Oth.ALL.10.Nr1d2.AllCell [Chip-atlas[Archive

    Full Text Available Oth.ALL.10.Nr1d2.AllCell mm9 TFs and others Nr1d2 All cell types SRX109462,SRX12817...4,SRX128175 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.ALL.10.Nr1d2.AllCell.bed ...

  8. File list: Oth.ALL.05.Nr1d1.AllCell [Chip-atlas[Archive

    Full Text Available Oth.ALL.05.Nr1d1.AllCell mm9 TFs and others Nr1d1 All cell types SRX997755,SRX12817...758,SRX994726,SRX100297,SRX1304810,SRX1304809 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.ALL.05.Nr1d1.AllCell.bed ...

  9. File list: Oth.ALL.20.Nr1d1.AllCell [Chip-atlas[Archive

    Full Text Available Oth.ALL.20.Nr1d1.AllCell mm9 TFs and others Nr1d1 All cell types SRX997762,SRX10946...4810,SRX997755,SRX994726,SRX1304809,SRX997756 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.ALL.20.Nr1d1.AllCell.bed ...

  10. File list: Oth.ALL.50.Nr1d2.AllCell [Chip-atlas[Archive

    Full Text Available Oth.ALL.50.Nr1d2.AllCell mm9 TFs and others Nr1d2 All cell types SRX109462,SRX12817...4,SRX128175 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.ALL.50.Nr1d2.AllCell.bed ...

  11. File list: Oth.ALL.20.Nr1d2.AllCell [Chip-atlas[Archive

    Full Text Available Oth.ALL.20.Nr1d2.AllCell mm9 TFs and others Nr1d2 All cell types SRX109462,SRX12817...4,SRX128175 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.ALL.20.Nr1d2.AllCell.bed ...

  12. Simulation of engine cooling with coupled 1D and 3D flow computation; Simulation der Motorkuehlung mit Hilfe gekoppelter 1D- und 3D-Stroemungsberechnung

    Grafenberger, P.; Klinner, P.; Nefischer, P. [BMW Motoren GmbH, Steyr (Austria); Klingebiel, F. [AMSTRAL Engineering fuer Stroemungsmechanik GmbH, Idstein (Germany)

    2000-04-01

    Shorting the development time for new engines and vehicles is leading to the increasing use of computational design and simulation methods in the automotive industry. For several years now, both one-dimensional and three-dimensional flow computation have been used successfully in the development of cooling systems. However, the fact that less hardware is used in the early development stages makes new demands on the quality and quantity of these simulation results. BMW's diesel development division has been able to improve the quality of the results and to reduce the processing time by improving the model quality and by coupling existing 1D and 3D computational fluid dynamic programmes. (orig.) [German] Die Verkuerzung der Entwicklungszeit neuer Motoren und Automobile fuehrt zu einem verstaerkten Einsatz von rechnergestuetzten Konstruktions- und Simulationsmethoden in der Fahrzeugindustrie. Sowohl eindimensionale als auch dreidimensionale Stroemungsberechnungen werden seit Jahren erfolgreich bei der Entwicklung von Kuehlsystemen eingesetzt. Der Entfall von Hardware-Baugruppen in der fruehen Entwicklungsphase stellt jedoch neue Anforderungen an die Qualitaet und Quantitaet dieser Simulationsergebnisse. Durch Verbesserung der Modellqualitaet und durch Kopplung vorhandener 1D- und 3D-Stroemungsberechnungsprogramme konnten in der Dieselmotorenentwicklung von BMW die Qualitaet der Ergebnisse und die Bearbeitungsgeschwindigkeit deutlich gesteigert werden. (orig.)

  13. Dynamics of the 1D Heisenberg model and optical absorption of spinons in cuprate antiferromagnetic chains

    Lorenzana, J.; Eder, R.

    1996-01-01

    Published in: Phys. Rev. B 55 (1997) 3358-3361 Citing articles (CrossRef) citations recorded in [Science Citation Index] Abstract: We use numerical and analytical results to construct a simple ansatz for the energy dynamical correlation function of the 1D antiferromagnetic Heisenberg model. This is

  14. Fresnel Lenses fabricated by femtosecond laser micromachining on Polymer 1D Photonic Crystal

    Guduru Surya S.K.

    2013-11-01

    Full Text Available We report the fabrication of micro Fresnel lenses by femtosecond laser surface ablation on polymer 1D photonic crystals. This device is designed to focus the transmitted wavelength of the photonic crystal and filter the wavelengths corresponding to the photonic band gap region. Integration of such devices in a wavelength selective light harvesting and filtering microchip can be achieved.

  15. Data of evolutionary structure change: 1D5IH-3FZUH [Confc[Archive

    Full Text Available ntryIDChain> CKATG--YTFSS >EEEE -- GGG> 3FZU H 3FZUH CAASGFRFTFNN ...>EEEE GGGure> ATOM 1790 CA CYS H 22 34.95...SW >EEEE ---- > ATOM 2413 CA ALA...pdbChain> 1D5IH ARGHSYYFYDGDYW >EE

  16. Classical solution to 1D viscous polytropic perfect fluids with constant diffusion coefficients and vacuum

    Liang, Zhilei; Wu, Shanqiu

    2017-02-01

    This paper deals with the initial boundary value problem for one-dimensional (1D) viscous, compressible and heat conducting fluids. We establish the global existence and uniqueness of classical solutions, with large data and possible vacuum at initial time. Our approach is based on the Calderón-Zygmund decomposition technique and allows that the viscosity and heat conductivity are both constant.

  17. Experimental Conditions: SE19_S2_M1_D1 [Metabolonote[Archive

    Full Text Available SE19_S2_M1_D1 SE19 Grobal triacylglycerol analysis in mouse liver and white adipose... tissue (WAT) by high resolution LC/ESI-QTOF MS/MS SE19_S2 Mouse white adipose tissue (WAT) SE19_S2_M1 20 ug

  18. Plasma as a tool for growth of 1D and 2D nanomaterials and their conversions

    Cvelbar, Uros

    2015-09-01

    The growth of 1D and 2D nanostructures in low pressure oxygen plasma is presented with the special stress on metal-oxide nanowires and their deterministic growth mechanisms. Since the resulting nanostructures not always have required properties for applications their modifications are required. Therefore their conversions into different oxides or sulphites/nitrides are required with either molecules, atoms, electrons or photons.

  19. (3+1)D Anomalous Twisted Gauge Theories with Global Symmetry

    Ye, Peng

    2016-01-01

    In (3+1)D twisted gauge theories, global symmetry may be imposed on topological currents $\\star\\frac{1}{2\\pi}db^I$ in a hydrodynamical way ($I=1,2,\\cdots$, $\\{b^I\\}$ is a set of Kalb-Ramond gauge fields). This methodology has been applied before in the Chern-Simons theory of fractional quantum Hall liquids. We find that, in some twisted gauge theories (with discrete Abelian gauge group $G_g$), implementing a global symmetry (denoted by $G_s$) is always inconsistent. There are two consequences. First, the symmetry-enriched topological order (SET) of the ground state is anomalous, which cannot exist in (3+1)D system alone. It can exist as a boundary of 4+1D topological phases. Second, if $G_s$ is fully gauged, the resulting new gauge theory has gauge anomaly. A (4+1)D topological phase is required to cancel this anomaly. We elaborate this phenomenon via a concrete example.

  20. GLOBAL EXISTENCE AND ASYMPTOTIC BEHAVIOR OF THE SOLUTION TO 1-D ENERGY TRANSPORT MODEL FOR SEMICONDUCTORS

    黎勇; 陈丽

    2002-01-01

    In this paper, we study the asymptotic behavior of global smooth solution to the initial boundary problem for the 1-D energy transport model in semiconductor science. We prove that the smooth solution of the problem converges to a stationary solution exponentially fast as t - ∞ when the initial data is a small perturbation of the stationary solution.

  1. On time-reversal anomaly of 2+1d topological phases

    Tachikawa, Yuji

    2016-01-01

    We describe a method to find the anomaly of the time-reversal symmetry of 2+1d topological quantum field theories, by computing the fractional anomalous momentum on the cross-cap background. This allows us, for example, to identify the parameter $\

  2. Probing the dispersion properties of 1D nanophotonic waveguides with far-field Fourier optics

    Le Thomas, N.; Jágerská, J.; Houdré, R.;

    2008-01-01

    We present an advanced Fourier space imaging technique to probe guided light in nanophotonic structures with an effective numerical aperture of 2.5. This superresolution technique allows us to successfully investigate the dispersive properties of 1D nanowaveguides such as photonic crystal W1 wave...

  3. CAMK1D amplification implicated in epithelial-mesenchymal transition in basal-like breast cancer.

    Bergamaschi, Anna; Kim, Young H; Kwei, Kevin A; La Choi, Yoon; Bocanegra, Melanie; Langerød, Anita; Han, Wonshik; Noh, Dong-Young; Huntsman, David G; Jeffrey, Stefanie S; Børresen-Dale, Anne-Lise; Pollack, Jonathan R

    2008-12-01

    Breast cancer exhibits clinical and molecular heterogeneity, where expression profiling studies have identified five major molecular subtypes. The basal-like subtype, expressing basal epithelial markers and negative for estrogen receptor (ER), progesterone receptor (PR) and HER2, is associated with higher overall levels of DNA copy number alteration (CNA), specific CNAs (like gain on chromosome 10p), and poor prognosis. Discovering the molecular genetic basis of tumor subtypes may provide new opportunities for therapy. To identify the driver oncogene on 10p associated with basal-like tumors, we analyzed genomic profiles of 172 breast carcinomas. The smallest shared region of gain spanned just seven genes at 10p13, including calcium/calmodulin-dependent protein kinase ID (CAMK1D), functioning in intracellular signaling but not previously linked to cancer. By microarray, CAMK1D was overexpressed when amplified, and by immunohistochemistry exhibited elevated expression in invasive carcinomas compared to carcinoma in situ. Engineered overexpression of CAMK1D in non-tumorigenic breast epithelial cells led to increased cell proliferation, and molecular and phenotypic alterations indicative of epithelial-mesenchymal transition (EMT), including loss of cell-cell adhesions and increased cell migration and invasion. Our findings identify CAMK1D as a novel amplified oncogene linked to EMT in breast cancer, and as a potential therapeutic target with particular relevance to clinically unfavorable basal-like tumors.

  4. Build up An Operational Flood Simulation from Existing 1D Channel Flow Works

    Chang, Che-Hao; Hsu, Chih-Tsung; Wu, Shiang-Jen; Lien, Ho-Cheng; Shen, Jhih-Cyuan; Chung, Ming-Ko

    2016-04-01

    Several 2D flood simulations will be developed for urban area in recent years in Taiwan. Original ideas focus on the static flood maps produced by the 2D flood simulation with respect to design events, which could be useful no matter for planning or disaster awareness. However, an extra bonus is expected to see if we can reuse the 2D flood simulation framework for operational use or not. Such a project goal inspire us to setup a standard operation procedure before any progress from existing 1D channel flow works. 3 key issues are taken into account in the SOP: 1. High Resolution Terrain: A 1m resolution digital terrain model (DTM) is considered as a reference. The Channels and structures should be setup in 1D channel flow works if we can identify under such high resolution. One should examine the existing 1D channel flow works consistent with the DTM or not. 2. Meteo Stations Referenced: Real time precipitation would be send to referenced location in RR models during an operational forecast. Existing 1D channels flow works are usually specifically for design events which are not necessarily equipped with such references. 3. Time Consuming: A full scale 2D flood simulation needs a lot of computation resources. A solution should be derived within practical time limits. Under the above consideration, some impacts and procedures will be analyzed and developed to setup the SOP for further model modification.

  5. A South American Prehistoric Mitogenome: Context, Continuity, and the Origin of Haplogroup C1d

    Sans, Mónica; Figueiro, Gonzalo; Hughes, Cris E.; Lindo, John; Hidalgo, Pedro C.; Malhi, Ripan S.

    2015-01-01

    Based on mitochondrial DNA (mtDNA), it has been estimated that at least 15 founder haplogroups peopled the Americas. Subhaplogroup C1d3 was defined based on the mitogenome of a living individual from Uruguay that carried a lineage previously identified in hypervariable region I sequences from ancient and modern Uruguayan individuals. When complete mitogenomes were studied, additional substitutions were found in the coding region of the mitochondrial genome. Using a complete ancient mitogenome and three modern mitogenomes, we aim to clarify the ancestral state of subhaplogroup C1d3 and to better understand the peopling of the region of the Río de la Plata basin, as well as of the builders of the mounds from which the ancient individuals were recovered. The ancient mitogenome, belonging to a female dated to 1,610±46 years before present, was identical to the mitogenome of one of the modern individuals. All individuals share the mutations defining subhaplogroup C1d3. We estimated an age of 8,974 (5,748–12,261) years for the most recent common ancestor of C1d3, in agreement with the initial peopling of the geographic region. No individuals belonging to the defined lineage were found outside of Uruguay, which raises questions regarding the mobility of the prehistoric inhabitants of the country. Moreover, the present study shows the continuity of Native lineages over at least 6,000 years. PMID:26509686

  6. Solvent-free porous framework resulted from 3D entanglement of 1D zigzag coordination polymer

    Kole, Goutam Kumar Umar

    2010-01-01

    A solvent-free porous metal organic framework is constructed by the 3D entanglement of 1D zigzag coordination polymeric chains. The role of solvents and the effect of reaction conditions on such unique entanglement are addressed. © 2010 The Royal Society of Chemistry and the Centre National de la Recherche Scientifique.

  7. Data of evolutionary structure change: 1BU1D-1OOTA [Confc[Archive

    Full Text Available 1BU1D-1OOTA 1BU1 1OOT D A -IIVVALYDYEAIHHEDLSFQKGDQMVVLEESGE---WW...14> 1OOT A 1OOTA...tryChain> -21.645000457763672 -6.38100004196167 51.89799880981445 ...76022339 -0.7429999709129333 -0.09000000357627869 tion> 1.78559505939483641OOT A 1OOTA WTGRV--NGREG

  8. Nonlinear Control of Absorption in Graphene-based 1D Photonic Crystal

    Vincenti, M A; Grande, M; D'Orazio, A; Scalora, M

    2013-01-01

    Perfect, narrow-band absorption is achieved in an asymmetric 1D photonic crystal with a monolayer graphene defect. Thanks to the large third order nonlinearity of graphene and field localization in the defect layer we demonstrate the possibility to achieve controllable, saturable absorption for the pump frequency.

  9. CD1d-restricted peripheral T cell lymphoma in mice and humans

    Bachy, Emmanuel; Urb, Mirjam; Chandra, Shilpi; Robinot, Rémy; Bricard, Gabriel; de Bernard, Simon; Traverse-Glehen, Alexandra; Gazzo, Sophie; Blond, Olivier; Khurana, Archana; Baseggio, Lucile; Heavican, Tayla; Ffrench, Martine; Crispatzu, Giuliano; Mondière, Paul; Schrader, Alexandra; Taillardet, Morgan; Thaunat, Olivier; Martin, Nadine; Dalle, Stéphane; Le Garff-Tavernier, Magali; Salles, Gilles; Lachuer, Joel; Hermine, Olivier; Asnafi, Vahid; Roussel, Mikael; Lamy, Thierry; Herling, Marco; Iqbal, Javeed; Buffat, Laurent; Marche, Patrice N.; Gaulard, Philippe; Kronenberg, Mitchell; Defrance, Thierry

    2016-01-01

    Peripheral T cell lymphomas (PTCLs) are a heterogeneous entity of neoplasms with poor prognosis, lack of effective therapies, and a largely unknown pathophysiology. Identifying the mechanism of lymphomagenesis and cell-of-origin from which PTCLs arise is crucial for the development of efficient treatment strategies. In addition to the well-described thymic lymphomas, we found that p53-deficient mice also developed mature PTCLs that did not originate from conventional T cells but from CD1d-restricted NKT cells. PTCLs showed phenotypic features of activated NKT cells, such as PD-1 up-regulation and loss of NK1.1 expression. Injections of heat-killed Streptococcus pneumonia, known to express glycolipid antigens activating NKT cells, increased the incidence of these PTCLs, whereas Escherichia coli injection did not. Gene expression profile analyses indicated a significant down-regulation of genes in the TCR signaling pathway in PTCL, a common feature of chronically activated T cells. Targeting TCR signaling pathway in lymphoma cells, either with cyclosporine A or anti-CD1d blocking antibody, prolonged mice survival. Importantly, we identified human CD1d-restricted lymphoma cells within Vδ1 TCR-expressing PTCL. These results define a new subtype of PTCL and pave the way for the development of blocking anti-CD1d antibody for therapeutic purposes in humans. PMID:27069116

  10. Toward Structural Correctness: Aquatolide and the Importance of 1D Proton NMR FID Archiving.

    Pauli, Guido F; Niemitz, Matthias; Bisson, Jonathan; Lodewyk, Michael W; Soldi, Cristian; Shaw, Jared T; Tantillo, Dean J; Saya, Jordy M; Vos, Klaas; Kleinnijenhuis, Roel A; Hiemstra, Henk; Chen, Shao-Nong; McAlpine, James B; Lankin, David C; Friesen, J Brent

    2016-02-05

    The revision of the structure of the sesquiterpene aquatolide from a bicyclo[2.2.0]hexane to a bicyclo[2.1.1]hexane structure using compelling NMR data, X-ray crystallography, and the recent confirmation via full synthesis exemplify that the achievement of "structural correctness" depends on the completeness of the experimental evidence. Archived FIDs and newly acquired aquatolide spectra demonstrate that archiving and rigorous interpretation of 1D (1)H NMR data may enhance the reproducibility of (bio)chemical research and curb the growing trend of structural misassignments. Despite being the most accessible NMR experiment, 1D (1)H spectra encode a wealth of information about bonds and molecular geometry that may be fully mined by (1)H iterative full spin analysis (HiFSA). Fully characterized 1D (1)H spectra are unideterminant for a given structure. The corresponding FIDs may be readily submitted with publications and collected in databases. Proton NMR spectra are indispensable for structural characterization even in conjunction with 2D data. Quantum interaction and linkage tables (QuILTs) are introduced for a more intuitive visualization of 1D J-coupling relationships, NOESY correlations, and heteronuclear experiments. Overall, this study represents a significant contribution to best practices in NMR-based structural analysis and dereplication.

  11. Models of Late-Type Disk Galaxies: 1-D Versus 2-D

    Mineikis, Tadas

    2015-01-01

    We investigate the effects of stochasticity on the observed galaxy parameters by comparing our stochastic star formation two-dimensional (2-D) galaxy evolution models with the commonly used one-dimensional (1-D) models with smooth star formation. The 2-D stochastic models predict high variability of the star formation rate and the surface photometric parameters across the galactic disks and in time.

  12. Correlation versus surface effects in photoemission of quasi-1D organic conductors

    Claessen, R.; Schwingenschlogl, U.; Sing, M.;

    2002-01-01

    The absence of spectral weight at the Fermi level in photoemission spectra of quasi-1D organic conductors has been interpreted as possible evidence for an unusual many-body state. We demonstrate that great care must be exercised to draw this conclusion exclusively on the basis of a pseudogap...

  13. Phase structure of (2+1)d strongly coupled lattice gauge theories

    Strouthos, C G

    2003-01-01

    We study the chiral phase transition in (2+1)d strongly coupled U(N) lattice gauge theories with staggered fermions. We show with high precision simulations performed directly in the chiral limit that these models undergo a Berezinski-Kosterlitz-Thouless (BKT) transition. We also show that this universality class is unaffected even in the large N limit.

  14. Influence of lipid rafts on CD1d presentation by dendritic cells

    Peng, Wei; Martaresche, Cecile; Escande-Beillard, Nathalie;

    2011-01-01

    Our main objective was to analyze the role of lipid rafts in the activation of Valpha-14(-) and Valpha-14(+) T hybridomas by dendritic cells. We showed that activation of Valpha-14(+) hybridomas by dendritic cells or other CD1d-expressing cells was altered by disruption of lipid rafts...

  15. Stabilization and shape control of a 1D piezoelectric Timoshenko beam

    Voss, T.; Scherpen, J. M. A.

    2011-01-01

    In this paper we show how to perform stabilization and shape control for a finite dimensional model that recasts the dynamics of an inflatable space reflector in port-Hamiltonian (pH) form. We show how to derive a decentralized passivity-based controller which can be used to stabilize a 1D piezoelec

  16. A new EEG measure using the 1D cluster variation method

    Maren, Alianna J.; Szu, Harold H.

    2015-05-01

    A new information measure, drawing on the 1-D Cluster Variation Method (CVM), describes local pattern distributions (nearest-neighbor and next-nearest neighbor) in a binary 1-D vector in terms of a single interaction enthalpy parameter h for the specific case where the fractions of elements in each of two states are the same (x1=x2=0.5). An example application of this method would be for EEG interpretation in Brain-Computer Interfaces (BCIs), especially in the frontier of invariant biometrics based on distinctive and invariant individual responses to stimuli containing an image of a person with whom there is a strong affiliative response (e.g., to a person's grandmother). This measure is obtained by mapping EEG observed configuration variables (z1, z2, z3 for next-nearest neighbor triplets) to h using the analytic function giving h in terms of these variables at equilibrium. This mapping results in a small phase space region of resulting h values, which characterizes local pattern distributions in the source data. The 1-D vector with equal fractions of units in each of the two states can be obtained using the method for transforming natural images into a binarized equi-probability ensemble (Saremi & Sejnowski, 2014; Stephens et al., 2013). An intrinsically 2-D data configuration can be mapped to 1-D using the 1-D Peano-Hilbert space-filling curve, which has demonstrated a 20 dB lower baseline using the method compared with other approaches (cf. SPIE ICA etc. by Hsu & Szu, 2014). This CVM-based method has multiple potential applications; one near-term one is optimizing classification of the EEG signals from a COTS 1-D BCI baseball hat. This can result in a convenient 3-D lab-tethered EEG, configured in a 1-D CVM equiprobable binary vector, and potentially useful for Smartphone wireless display. Longer-range applications include interpreting neural assembly activations via high-density implanted soft, cellular-scale electrodes.

  17. Role of α1D -adrenoceptors in vascular wall hypertrophy during angiotensin II-induced hypertension.

    Gallardo-Ortíz, I A; Rodríguez-Hernández, S N; López-Guerrero, J J; Del Valle-Mondragón, L; López-Sánchez, P; Touyz, R M; Villalobos-Molina, R

    2015-09-01

    The in vivo effect of continuous angiotensin II (Ang II) infusion on arterial blood pressure, vascular hypertrophy and α1 -adrenoceptors (α1 -ARs) expression was explored. Alzet(®) minipumps filled with Ang II (200 ng kg(-1)  min(-1) ) were subcutaneously implanted in male Wistar rats (3 months-old). Groups of rats were also treated with losartan, an AT1 R antagonist, or with BMY 7378, a selective α1D -AR antagonist. Blood pressure was measured by tail-cuff; after 2 or 4 weeks of treatment, vessels were isolated for functional and structural analyses. Angiotensin II increased systolic blood pressure. Phenylephrine-induced contraction in aorta was greater (40% higher) in Ang II-treated rats than in the controls, and similar effect occurred with KCl 80 mm. Responses in tail arteries were not significantly different among the different groups. Angiotensin II decreased α1D -ARs without modifying the other α1 -ARs and induced an increase in media thickness (hypertrophy) in aorta, while no structural change occurred in tail artery. Losartan prevented and reversed hypertension and hypertrophy, while BMY 7378 prevented and reversed the aorta's hypertrophic response, without preventing or reversing hypertension. Findings indicate that Ang II-induced aortic hypertrophic response involves Ang II-AT1 Rs and α1D -ARs. Angiotensin II-induced α1D -AR-mediated vascular remodeling occurs independently of hypertension. Findings identify a α1D -AR-mediated process whereby Ang II influences aortic hypertrophy independently of blood pressure elevation.

  18. Improvement of the 2D/1D Method in MPACT Using the Sub-Plane Scheme

    Graham, Aaron M [ORNL; Collins, Benjamin S [ORNL; Downar, Thomas [University of Michigan

    2017-01-01

    Oak Ridge National Laboratory and the University of Michigan are jointly developing the MPACTcode to be the primary neutron transport code for the Virtual Environment for Reactor Applications (VERA). To solve the transport equation, MPACT uses the 2D/1D method, which decomposes the problem into a stack of 2D planes that are then coupled with a 1D axial calculation. MPACT uses the Method of Characteristics for the 2D transport calculations and P3 for the 1D axial calculations, then accelerates the solution using the 3D Coarse mesh Finite Dierence (CMFD) method. Increasing the number of 2D MOC planes will increase the accuracy of the alculation, but will increase the computational burden of the calculations and can cause slow convergence or instability. To prevent these problems while maintaining accuracy, the sub-plane scheme has been implemented in MPACT. This method sub-divides the MOC planes into sub-planes, refining the 1D P3 and 3D CMFD calculations without increasing the number of 2D MOC planes. To test the sub-plane scheme, three of the VERA Progression Problems were selected: Problem 3, a single assembly problem; Problem 4, a 3x3 assembly problem with control rods and pyrex burnable poisons; and Problem 5, a quarter core problem. These three problems demonstrated that the sub-plane scheme can accurately produce intra-plane axial flux profiles that preserve the accuracy of the fine mesh solution. The eigenvalue dierences are negligibly small, and dierences in 3D power distributions are less than 0.1% for realistic axial meshes. Furthermore, the convergence behavior with the sub-plane scheme compares favorably with the conventional 2D/1D method, and the computational expense is decreased for all calculations due to the reduction in expensive MOC calculations.

  19. 1D Ladder-like Chain and 1D Channeled 3D Supramolecular Architectures Based on Benzophenone-2,4'-dicarboxylic Acid

    YANG Xiao-Gang; LI Dong-Sheng; FU Feng; WU Ya-Pan; WANG Ji-Jiang; WANG Yao-Yu

    2008-01-01

    The hydrothermal reactions of AgNO3, 2,2'-bipyridyl, and benzophenone-2,4'-dicarboxylic acid gave rise to two benzophenone-2,4'-dicarboxylic acid). The two compounds are extended by hydrogen bonds in two different apbonding between H2L ligands and water molecules, then extended to a 3D supramolecular architecture. Compound 2 possesses 3D supramolecular architecture containing 1D open channels, which are driven due to the strong H-bonding interactions occurring between the HL anions and water molecules; interestingly, [Ag(bpy)2]+ cations vestigated, the emission maxima for 2 exhibits red-shift compared with that of free ligand and 1 due to chelating effect of the 2,2'-bipyridine ligand to the silver ion and the presence of aromatic π-packing.

  20. Molecular, physicochemical and rheological characteristics of introgressive Triticale/Triticum monococcum ssp. monococcum lines with wheat 1D/1A chromosome substitution.

    Salmanowicz, Bolesław P; Langner, Monika; Wiśniewska, Halina; Apolinarska, Barbara; Kwiatek, Michał; Błaszczyk, Lidia

    2013-07-26

    Three sets of hexaploid introgressive triticale lines, with Triticum monococcum ssp. monococcum (cultivated einkorn wheat) genes and a bread wheat chromosome 1D substituted for chromosome 1A, and one set of secondary triticale lines were evaluated for grain and flour physicochemical and dough rheological characteristics in two generations (F7 and F8). Genomic in situ hybridization (GISH) and fluorescence in situ hybridization (FISH) confirmed the 1D/1A chromosome substitution. The presence or absence of einkorn high-molecular-weight (HMW) glutenin subunits and the wheat Glu-D1d locus encoding the 5 + 10 subunits was assessed by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE), capillary zone electrophoresis, and allele-specific molecular markers. Significant differences were found among physicochemical properties (with the exception of the Hagberg falling number) of all introgressive Triticale/T. monococcum lines and the secondary triticale lines. The wheat 1D/1A chromosome substitution also affected these properties. The results showed that in all introgressive triticale lines, the protein and gluten content, Zeleny sedimentation value, and water absorption capacity, were increased. The rheological parameters estimated using micro-farinograph, reomixer, and Kieffer dough extensibility systems also showed an appreciable increase in dough-mixing properties, maximum resistance to extension (Rmax), and dough extensibility. Introgressive Triticale/T. monococcum lines with 5 + 10 subunits have particularly favorable rheological parameters. The results obtained in this study suggest that the cultivated einkorn genome Am, in the context of hexaploid secondary triticale lines and with a wheat 1D/1A substitution, has the potential to improve gluten polymer interactions and be a valuable genetic resource for triticale quality improvement.

  1. Molecular, Physicochemical and Rheological Characteristics of Introgressive Triticale/Triticum monococcum ssp. monococcum Lines with Wheat 1D/1A Chromosome Substitution

    Lidia Błaszczyk

    2013-07-01

    Full Text Available Three sets of hexaploid introgressive triticale lines, with Triticum monococcum ssp. monococcum (cultivated einkorn wheat genes and a bread wheat chromosome 1D substituted for chromosome 1A, and one set of secondary triticale lines were evaluated for grain and flour physicochemical and dough rheological characteristics in two generations (F7 and F8. Genomic in situ hybridization (GISH and fluorescence in situ hybridization (FISH confirmed the 1D/1A chromosome substitution. The presence or absence of einkorn high-molecular-weight (HMW glutenin subunits and the wheat Glu-D1d locus encoding the 5 + 10 subunits was assessed by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE, capillary zone electrophoresis, and allele-specific molecular markers. Significant differences were found among physicochemical properties (with the exception of the Hagberg falling number of all introgressive Triticale/T. monococcum lines and the secondary triticale lines. The wheat 1D/1A chromosome substitution also affected these properties. The results showed that in all introgressive triticale lines, the protein and gluten content, Zeleny sedimentation value, and water absorption capacity, were increased. The rheological parameters estimated using micro-farinograph, reomixer, and Kieffer dough extensibility systems also showed an appreciable increase in dough-mixing properties, maximum resistance to extension (Rmax, and dough extensibility. Introgressive Triticale/T. monococcum lines with 5 + 10 subunits have particularly favorable rheological parameters. The results obtained in this study suggest that the cultivated einkorn genome Am, in the context of hexaploid secondary triticale lines and with a wheat 1D/1A substitution, has the potential to improve gluten polymer interactions and be a valuable genetic resource for triticale quality improvement.

  2. Targeting PPM1D by lentivirus-mediated RNA interference inhibits the tumorigenicity of bladder cancer cells

    W. Wang

    2014-12-01

    Full Text Available Protein phosphatase magnesium/manganese-dependent 1D (PPM1D is a p53-induced phosphatase that functions as a negative regulator of stress response pathways and has oncogenic properties. However, the functional role of PPM1D in bladder cancer (BC remains largely unknown. In the present study, lentivirus vectors carrying small hairpin RNA (shRNA targeting PPM1D were used to explore the effects of PPM1D knockdown on BC cell proliferation and tumorigenesis. shRNA-mediated knockdown of PPM1D significantly inhibited cell growth and colony forming ability in the BC cell lines 5637 and T24. Flow cytometric analysis showed that PPM1D silencing increased the proportion of cells in the G0/G1 phase. Downregulation of PPM1D also inhibited 5637 cell tumorigenicity in nude mice. The results of the present study suggest that PPM1D plays a potentially important role in BC tumorigenicity, and lentivirus-mediated delivery of shRNA against PPM1D might be a promising therapeutic strategy for the treatment of BC.

  3. Targeting PPM1D by lentivirus-mediated RNA interference inhibits the tumorigenicity of bladder cancer cells

    Wang, W. [Institute of Urology, Huashan Hospital, Fudan University, Shanghai (China); Department of the Intensive Care Unit, Huashan Hospital, Fudan University, Shanghai (China); Zhu, H. [Department of the Intensive Care Unit, Huashan Hospital, Fudan University, Shanghai (China); Zhang, H.; Zhang, L. [Department of Urology, Huashan Hospital, Fudan University, Shanghai (China); Ding, Q.; Jiang, H. [Institute of Urology, Huashan Hospital, Fudan University, Shanghai (China); Department of Urology, Huashan Hospital, Fudan University, Shanghai (China)

    2014-09-23

    Protein phosphatase magnesium/manganese-dependent 1D (PPM1D) is a p53-induced phosphatase that functions as a negative regulator of stress response pathways and has oncogenic properties. However, the functional role of PPM1D in bladder cancer (BC) remains largely unknown. In the present study, lentivirus vectors carrying small hairpin RNA (shRNA) targeting PPM1D were used to explore the effects of PPM1D knockdown on BC cell proliferation and tumorigenesis. shRNA-mediated knockdown of PPM1D significantly inhibited cell growth and colony forming ability in the BC cell lines 5637 and T24. Flow cytometric analysis showed that PPM1D silencing increased the proportion of cells in the G0/G1 phase. Downregulation of PPM1D also inhibited 5637 cell tumorigenicity in nude mice. The results of the present study suggest that PPM1D plays a potentially important role in BC tumorigenicity, and lentivirus-mediated delivery of shRNA against PPM1D might be a promising therapeutic strategy for the treatment of BC.

  4. Head and Tail Deformations, Torsional Coriolis Coupling, and E(1d)-E(2d) Vibrational Mixing in Ethane-Like Molecules.

    Lattanzi; di Lauro C

    1999-12-01

    The mechanism of torsional Coriolis interaction of E(1d) and E(2d) vibrational modes in ethane-like molecules is investigated, and it is shown that this coupling can drastically affect the torsional splitting in the degenerate vibrational states. A basic point of our treatment is that the sets of coordinates of head and tail which combine with the + sign to generate E(1d) normal coordinates are in general different from those which combine with the - sign to generate E(2d) normal coordinates. It is shown that the zeta(gamma) torsional Coriolis coefficients calculated by the usual methods of normal mode analysis are related to the vibrational angular momenta within head and tail referred to the internal rotor axis systems. With knowledge of the L and L(-1) matrices it is possible to transform these coefficients for reference to the molecule-fixed frame. It is peculiar that torsional Coriolis matrix elements occur between E(1d) and E(2d) vibrational components with the same x or y orientation in the molecule-fixed frame. The matrix elements of the torsional Coriolis operator and other operators responsible for the end-to-end coupling are determined, and a method for calculating vibration-torsion energies, and then torsional splittings, in degenerate vibrational states is outlined. Detailed calculations require a global model, involving all the degenerate vibrational basis states in a complex mechanism of interactions, but it is shown that useful information can be obtained by means of simplified models. Our semiempirical rule that degenerate vibrational states with a large negative value of the diagonal vibration-rotation Coriolis coefficient are likely to deviate much from the behavior of E(1d) or E(2d) vibrational states, with a sensible decrease of the torsional splittings, is confirmed. Copyright 1999 Academic Press.

  5. Bifurcations of families of 1D-tori in 4D symplectic maps.

    Onken, Franziska; Lange, Steffen; Ketzmerick, Roland; Bäcker, Arnd

    2016-06-01

    The regular structures of a generic 4d symplectic map with a mixed phase space are organized by one-parameter families of elliptic 1d-tori. Such families show prominent bends, gaps, and new branches. We explain these features in terms of bifurcations of the families when crossing a resonance. For these bifurcations, no external parameter has to be varied. Instead, the longitudinal frequency, which varies along the family, plays the role of the bifurcation parameter. As an example, we study two coupled standard maps by visualizing the elliptic and hyperbolic 1d-tori in a 3d phase-space slice, local 2d projections, and frequency space. The observed bifurcations are consistent with the analytical predictions previously obtained for quasi-periodically forced oscillators. Moreover, the new families emerging from such a bifurcation form the skeleton of the corresponding resonance channel.

  6. Magnetic Anticrossing of 1D Subbands in Coupled Ballistic Double Quantum Wires

    BLOUNT,MARK A.; MOON,JEONG-SUN; SIMMONS,JERRY A.; LYO,SUNGKWUN K.; WENDT,JOEL R.; RENO,JOHN L.

    2000-07-13

    We study the low-temperature in-plane magnetoconductance of vertically coupled double quantum wires. Using a novel flip-chip technique, the wires are defined by two pairs of mutually aligned split gates on opposite sides of a s 1 micron thick AlGaAs/GaAs double quantum well heterostructure. We observe quantized conductance steps due to each quantum well and demonstrate independent control of each ID wire. A broad dip in the magnetoconductance at -6 T is observed when a magnetic field is applied perpendicular to both the current and growth directions. This conductance dip is observed only when 1D subbands are populated in both the top and bottom constrictions. This data is consistent with a counting model whereby the number of subbands crossing the Fermi level changes with field due to the formation of an anticrossing in each pair of 1D subbands.

  7. A 1D (radial) Plasma Jet Propagation Study for the Plasma Liner Experiment (PLX)

    Thompson, J. R.; Bogatu, I. N.; Galkin, S. A.; Kim, J. S.; Welch, D. R.; Thoma, C.; Golovkin, I.; Macfarlane, J. J.; Case, A.; Messer, S. J.; Witherspoon, F. D.; Cassibry, J. T.; Awe, T. J.; Hsu, S. C.

    2011-10-01

    The Plasma Liner Experiment will explore the formation of imploding spherical ``plasma liners'' that reach peak pressures of 0.1 Mbar upon stagnation. The liners will be formed through the merging of dense, high velocity plasma jets (n ~1017 cm-3, T ~3 eV, v ~50 km/s) in a spherically convergent geometry. The focus of this 1D (radial) study is argon plasma jet evolution during propagation from the rail gun source to the jet merging radius. The study utilizes the Large Scale Plasma (LSP) PIC code with atomic physics included through the use of a non-Local Thermal Equilibrium (NLTE) Equation of State (EOS) table. We will present scenarios for expected 1D (radial) plasma jet evolution, from upon exiting the PLX rail gun to reaching the jet merging radius. The importance of radiation cooling early in the simulation is highlighted. Work supported by US DOE grant DE-FG02-05ER54835.

  8. Bifurcations of families of 1D-tori in 4D symplectic maps

    Onken, Franziska; Lange, Steffen; Ketzmerick, Roland; Bäcker, Arnd

    2016-06-01

    The regular structures of a generic 4d symplectic map with a mixed phase space are organized by one-parameter families of elliptic 1d-tori. Such families show prominent bends, gaps, and new branches. We explain these features in terms of bifurcations of the families when crossing a resonance. For these bifurcations, no external parameter has to be varied. Instead, the longitudinal frequency, which varies along the family, plays the role of the bifurcation parameter. As an example, we study two coupled standard maps by visualizing the elliptic and hyperbolic 1d-tori in a 3d phase-space slice, local 2d projections, and frequency space. The observed bifurcations are consistent with the analytical predictions previously obtained for quasi-periodically forced oscillators. Moreover, the new families emerging from such a bifurcation form the skeleton of the corresponding resonance channel.

  9. Effect of the deformation operator in the D1D5 CFT

    Carson, Zaq; Mathur, Samir D; Turton, David

    2014-01-01

    The D1D5 CFT gives a holographic dual description of a near-extremal black hole in string theory. The interaction in this theory is given by a marginal deformation operator, which is composed of supercharges acting on a twist operator. The twist operator links together different copies of a free CFT. We study the effect of this deformation operator when it links together CFT copies with winding numbers M and N to produce a copy with winding M+N, populated with excitations of a particular form. We compute the effect of the deformation operator in the full supersymmetric theory, firstly on a Ramond-Ramond ground state and secondly on states with an initial bosonic or fermionic excitation. Our results generalize recent work which studied only the bosonic sector of the CFT. Our findings are a step towards understanding thermalization in the D1D5 CFT, which is related to black hole formation and evaporation in the bulk.

  10. Analytical investigations of the magnetotelluric directionality estimation in 1-D anisotropic layered media

    Okazaki, T.; Oshiman, N.; Yoshimura, R.

    2016-11-01

    Inferring geoelectric dimensionality (1D, 2D or 3D) and directionality (strike directions) from the impedance tensor is a basic procedure in magnetotelluric data processing. Given that electrical anisotropy is increasingly recognized in observations, it is valuable to understand the imprint of anisotropy in these analyses. In this paper, we analytically investigate the estimation of strike directions based on rotational invariants in 1D anisotropic layered media. We first show that if anisotropy axes are identical in all anisotropic layers, the estimated strike coincides with that direction. We then derive an analytical formula of the strike angle at long periods for general anisotropic layers with an isotropic basement. This formula shows a clear physical interpretation that the strike angle points where the conductance integrated along depth takes a maximum value.

  11. 1-D seismic velocity model and hypocenter relocation using double difference method around West Papua region

    Sabtaji, Agung; Nugraha, Andri Dian

    2015-04-01

    West Papua region has fairly high of seismicity activities due to tectonic setting and many inland faults. In addition, the region has a unique and complex tectonic conditions and this situation lead to high potency of seismic hazard in the region. The precise earthquake hypocenter location is very important, which could provide high quality of earthquake parameter information and the subsurface structure in this region to the society. We conducted 1-D P-wave velocity using earthquake data catalog from BMKG for April, 2009 up to March, 2014 around West Papua region. The obtained 1-D seismic velocity then was used as input for improving hypocenter location using double-difference method. The relocated hypocenter location shows fairly clearly the pattern of intraslab earthquake beneath New Guinea Trench (NGT). The relocated hypocenters related to the inland fault are also observed more focus in location around the fault.

  12. Verification and comparison of four numerical schemes for a 1D viscoelastic blood flow model.

    Wang, Xiaofei; Fullana, Jose-Maria; Lagrée, Pierre-Yves

    2015-01-01

    A reliable and fast numerical scheme is crucial for the 1D simulation of blood flow in compliant vessels. In this paper, a 1D blood flow model is incorporated with a Kelvin-Voigt viscoelastic arterial wall. This leads to a nonlinear hyperbolic-parabolic system, which is then solved with four numerical schemes, namely: MacCormack, Taylor-Galerkin, monotonic upwind scheme for conservation law and local discontinuous Galerkin. The numerical schemes are tested on a single vessel, a simple bifurcation and a network with 55 arteries. The numerical solutions are checked favorably against analytical, semi-analytical solutions or clinical observations. Among the numerical schemes, comparisons are made in four important aspects: accuracy, ability to capture shock-like phenomena, computational speed and implementation complexity. The suitable conditions for the application of each scheme are discussed.

  13. ZnO 1-D nanostructures: Low temperature synthesis and characterizations

    Apurba Dev; S Chaudhuri; B N Dev

    2008-06-01

    ZnO is one of the most important semiconductors having a wide variety of applications in photonic, field emission and sensing devices. In addition, it exhibits a wide variety of morphologies in the nano regime that can be grown by tuning the growth habit of the ZnO crystal. Among various nanostructures, oriented 1-D nanoforms are particularly important for applications such as UV laser, sensors, UV LED, field emission displays, piezoelectric nanogenerator etc. We have developed a soft chemical approach to fabricate well-aligned arrays of various 1-D nanoforms like nanonails, nanowires and nanorods. The microstructural and photoluminescence properties of all the structures were investigated and tuned by varying the synthesis parameters. Field emission study from the aligned nanorod arrays exhibited high current density and a low turn-on field. These arrays also exhibited very strong UV emission and week defect emission. These structures can be utilized to fabricate efficient UV LEDs.

  14. Controlling Interface States in 1D Photonic Crystals by tuning Bulk Geometric Phases

    Gao, Wensheng; Chen, Baojie; Pun, Edwin Y B; Chan, C T; Tam, Wing Yim

    2016-01-01

    Interface states in photonic crystals usually require defects or surface/interface decorations. We show here that one can control interface states in 1D photonic crystals through the engineering of geometrical phase such that interface states can be guaranteed in even or odd, or in all photonic bandgaps. We verify experimentally the designed interface states in 1D multilayered photonic crystals fabricated by electron beam vapor deposition. We also obtain the geometrical phases by measuring the reflection phases at the bandgaps of the PCs and achieve good agreement with the theory. Our approach could provide a platform for the design of using interface states in photonic crystals for nonlinear optic, sensing, and lasing applications

  15. FPGA Implementation of Efficient VLSI Architecture for Fixed Point 1-D DWT Using Lifting Scheme

    Durga Sowjanya

    2012-09-01

    Full Text Available In this paper, a scheme for the design of area efficient and high speed pipeline VLSI architecture for the computation of fixed point 1-d discrete wavelet transform using lifting scheme is proposed. The main focus of the scheme is to reduce the number and period of clock cycles and efficient area with little or no overhead on hardware resources. The fixed point representation requires less hardware resources compared with floating point representation. The pipelining architecture speeds up the clock rate of DWT and reduced bit precision reduces the area required for implementation. The architecture has been coded in verilog HDL on Xilinx platform and the target FPGA device used is Virtex-II Pro family, XC2VP7-7board. The proposed scheme requires the least computing time for fixed point 1-D DWT and achieves theless area for implementation, compared with other architectures. So this architecture is realizable for real time processing of DWT computation applications.

  16. Localized self-heating in large arrays of 1D nanostructures

    Monereo, O.; Illera, S.; Varea, A.; Schmidt, M.; Sauerwald, T.; Schütze, A.; Cirera, A.; Prades, J. D.

    2016-02-01

    One dimensional (1D) nanostructures offer a promising path towards highly efficient heating and temperature control in integrated microsystems. The so called self-heating effect can be used to modulate the response of solid state gas sensor devices. In this work, efficient self-heating was found to occur at random networks of nanostructured systems with similar power requirements to highly ordered systems (e.g. individual nanowires, where their thermal efficiency was attributed to the small dimensions of the objects). Infrared thermography and Raman spectroscopy were used to map the temperature profiles of films based on random arrangements of carbon nanofibers during self-heating. Both the techniques demonstrate consistently that heating concentrates in small regions, the here-called ``hot-spots''. On correlating dynamic temperature mapping with electrical measurements, we also observed that these minute hot-spots rule the resistance values observed macroscopically. A physical model of a random network of 1D resistors helped us to explain this observation. The model shows that, for a given random arrangement of 1D nanowires, current spreading through the network ends up defining a set of spots that dominate both the electrical resistance and power dissipation. Such highly localized heating explains the high power savings observed in larger nanostructured systems. This understanding opens a path to design highly efficient self-heating systems, based on random or pseudo-random distributions of 1D nanostructures.One dimensional (1D) nanostructures offer a promising path towards highly efficient heating and temperature control in integrated microsystems. The so called self-heating effect can be used to modulate the response of solid state gas sensor devices. In this work, efficient self-heating was found to occur at random networks of nanostructured systems with similar power requirements to highly ordered systems (e.g. individual nanowires, where their thermal

  17. Quantitative Multiscale Analysis using Different Wavelets in 1D Voice Signal and 2D Image

    Shakhakarmi, Niraj

    2012-01-01

    Mutiscale analysis represents multiresolution scrutiny of a signal to improve its signal quality. Multiresolution analysis of 1D voice signal and 2D image is conducted using DCT, FFT and different wavelets such as Haar, Deubachies, Morlet, Cauchy, Shannon, Biorthogonal, Symmlet and Coiflet deploying the cascaded filter banks based decomposition and reconstruction. The outstanding quantitative analysis of the specified wavelets is done to investigate the signal quality, mean square error, entropy and peak-to-peak SNR at multiscale stage-4 for both 1D voice signal and 2D image. In addition, the 2D image compression performance is significantly found 93.00% in DB-4, 93.68% in bior-4.4, 93.18% in Sym-4 and 92.20% in Coif-2 during the multiscale analysis.

  18. Static sign language recognition using 1D descriptors and neural networks

    Solís, José F.; Toxqui, Carina; Padilla, Alfonso; Santiago, César

    2012-10-01

    A frame work for static sign language recognition using descriptors which represents 2D images in 1D data and artificial neural networks is presented in this work. The 1D descriptors were computed by two methods, first one consists in a correlation rotational operator.1 and second is based on contour analysis of hand shape. One of the main problems in sign language recognition is segmentation; most of papers report a special color in gloves or background for hand shape analysis. In order to avoid the use of gloves or special clothing, a thermal imaging camera was used to capture images. Static signs were picked up from 1 to 9 digits of American Sign Language, a multilayer perceptron reached 100% recognition with cross-validation.

  19. Revisiting the D1/D5 system or bubbling in AdS{sub 3}

    Boni, Matteo [Dipartimento di Fisica dell' Universita di Milano (Italy); INFN, Sezione di Milano, Via Celoria 16, I-20133 Milan (Italy); Silva, Pedro J. [INFN, Sezione di Milano, Via Celoria 16, I-20133 Milan (Italy); Institut de Fisica d' Altes Energies (IFAE), Edf. Cn, Universitat Autonoma de Barcelona (UAB), E-08193 Bellaterra, Barcelona (Spain)

    2005-10-15

    In this article we study the relation between the bubbling construction and the Mathur's microscopic solutions for the D1/D5 system. We have found that the regular near horizon D1/D5 system (after appropriated constraints are imposed) contains all the bubbling regular solutions. Then, we show that the features of this system are rather different from the bubbling in AdS{sub 5} x S{sup 5}, since the perimeter and not the area plays a key role. After setting the main dictionary between the two approaches, we investigate on extensions to non-regular solutions like conical defects and/or naked singular solutions. In particular, among the latter metrics, closed time-like curves are found together with a chronology protection mechanism enforced by the AdS/CFT duality.

  20. Riemann-Hadamard method for solving a (2+1)-D problem for degenerate hyperbolic equation

    Nikolov, Aleksey; Popivanov, Nedyu

    2015-11-01

    We consider a (2+1)-D boundary value problem for degenerate hyperbolic equation, which is closely connected with transonic fluid dynamics. This problem was introduced by Protter in 1954 as a multi-dimensional analogue of the Darboux problem in the plain, which is known to be well-posed. However the (2+1)-D problem is overdetermined with infinitely many conditions necessary for its classical solvability and there exist generalized solutions of this problem with strong singularities. Last years we study the exact asymptotic behavior of such singular solutions. We offer a Riemann-Hadamard method for solving the problem instead of the used until now method of successive approximations for solving an equivalent integral equation. As result, we obtain a more convenient representation of the singular solutions giving more precise results in our investigation.

  1. Numerical Methods and Comparisons for 1D and Quasi 2D Streamer Propagation Models

    Huang, Mengmin; Guan, Huizhe; Zeng, Rong

    2016-01-01

    In this work, we propose four different strategies to simulate the one-dimensional (1D) and quasi two-dimensional (2D) model for streamer propagation. Each strategy involves of one numerical method for solving Poisson's equation and another method for solving continuity equations in the models, and a total variation diminishing three-stage Runge-Kutta method in temporal discretization. The numerical methods for Poisson's equation include finite volume method, discontinuous Galerkin methods, mixed finite element method and least-squared finite element method. The numerical method for continuity equations is chosen from the family of discontinuous Galerkin methods. The accuracy tests and comparisons show that all of these four strategies are suitable and competitive in streamer simulations from the aspects of accuracy and efficiency. By applying any strategy in real simulations, we can study the dynamics of streamer propagations and influences due to the change of parameters in both of 1D and quasi 2D models. T...

  2. Membranes having aligned 1-D nanoparticles in a matrix layer for improved fluid separation

    Revanur, Ravindra; Lulevich, Valentin; Roh, Il Juhn; Klare, Jennifer E.; Kim, Sangil; Noy, Aleksandr; Bakajin, Olgica

    2015-12-22

    Membranes for fluid separation are disclosed. These membranes have a matrix layer sandwiched between an active layer and a porous support layer. The matrix layer includes 1-D nanoparticles that are vertically aligned in a porous polymer matrix, and which substantially extend through the matrix layer. The active layer provides species-specific transport, while the support layer provides mechanical support. A matrix layer of this type has favorable surface morphology for forming the active layer. Furthermore, the pores that form in the matrix layer tend to be smaller and more evenly distributed as a result of the presence of aligned 1-D nanoparticles. Improved performance of separation membranes of this type is attributed to these effects.

  3. 1-D seismic velocity model and hypocenter relocation using double difference method around West Papua region

    Sabtaji, Agung, E-mail: sabtaji.agung@gmail.com, E-mail: agung.sabtaji@bmkg.go.id [Study Program of Earth Sciences, Faculty of Earth Sciencies and Technology, Institute of Technology Bandung, Bandung 40132 (Indonesia); Indonesia’s Agency for Meteorological, Climatological and Geophysics Region V, Jayapura 1572 (Indonesia); Nugraha, Andri Dian, E-mail: nugraha@gf.itb.ac.id [Global Geophysics Research Group, Faculty of Mining and Petroleum Engineering, Institute of Technology Bandung, Bandung 40132 (Indonesia)

    2015-04-24

    West Papua region has fairly high of seismicity activities due to tectonic setting and many inland faults. In addition, the region has a unique and complex tectonic conditions and this situation lead to high potency of seismic hazard in the region. The precise earthquake hypocenter location is very important, which could provide high quality of earthquake parameter information and the subsurface structure in this region to the society. We conducted 1-D P-wave velocity using earthquake data catalog from BMKG for April, 2009 up to March, 2014 around West Papua region. The obtained 1-D seismic velocity then was used as input for improving hypocenter location using double-difference method. The relocated hypocenter location shows fairly clearly the pattern of intraslab earthquake beneath New Guinea Trench (NGT). The relocated hypocenters related to the inland fault are also observed more focus in location around the fault.

  4. Complex Langevin Dynamics in 1+1d QCD at Non-Zero Densities

    Schmalzbauer, Sebastian

    2016-01-01

    We present our results obtained from gauge cooled complex Langevin simulations in 1+1d QCD at non-zero densities in the strong coupling regime with unrooted staggered fermions. For small quark masses there are regions of the chemical potential where this method fails to reproduce correct results. In these parameter ranges we studied the effect of different gauge cooling schemes on the distributions of the fermion determinant as well as of observables.

  5. Scotogenic $Z_2$ or $U(1)_D$ Model of Neutrino Mass with $\\Delta(27)$ Symmetry

    Ma, Ernest

    2014-01-01

    The scotogenic model of radiative neutrino mass with $Z_2$ or $U(1)_D$ dark matter is shown to accommodate $\\Delta(27)$ symmetry naturally. The resulting neutrino mass matrix is identical to either of two forms, one proposed in 2006, the other in 2008. These two structures are studied in the context of present neutrino data, with predictions of $CP$ violation and neutrinoless double beta decay.

  6. Mentor Graphics在京发布1D-3D CFD解决方案

    杜莹

    2012-01-01

    7月10日,Mentor Graphics1D-3D CFD解决方案战略发布会在北京举行。作为领先的电子设计自动化技术和MCAE技术的领导厂商,Mentor Graphics Mechanical Analysis部门总经理Erich Buergel分享了最新的产品解决方案。

  7. Two Qubits Entanglement Dynamics in 1D Heisenberg Chain with Intrinsic Decoherence

    SHAO Bin; ZHANG Li-li; ZOU Jian

    2006-01-01

    To reveal how the decoherence modifies the time evolution of the entanglement of quantum system,the intrinsic decoherence approach and the entanglement of formation are used, and the time evolution of entanglement for two-qubit 1D quantum Heisenberg model in an external uniform magnetic field is derived. It is shown that the external magnetic field can strengthen the effects of the intrinsic decoherence on the entanglement of the system.

  8. 1D-Var temperature retrievals from microwave radiometer and convective scale model

    Pauline Martinet

    2015-12-01

    Full Text Available This paper studies the potential of ground-based microwave radiometers (MWR for providing accurate temperature retrievals by combining convective scale numerical models and brightness temperatures (BTs. A one-dimensional variational (1D-Var retrieval technique has been tested to optimally combine MWR and 3-h forecasts from the French convective scale model AROME. A microwave profiler HATPRO (Humidity and Temperature PROfiler was operated during 6 months at the meteorological station of Bordeaux (Météo France. MWR BTs were monitored against simulations from the Atmospheric Radiative Transfer Simulator 2 radiative transfer model. An overall good agreement was found between observations and simulations for opaque V-band channels but large errors were observed for channels the most affected by liquid water and water vapour emissions (51.26 and 52.28 GHz. 1D-Var temperature retrievals are performed in clear-sky and cloudy conditions using a screening procedure based on cloud base height retrieval from ceilometer observations, infrared radiometer temperature and liquid water path derived from the MWR observations. The 1D-Var retrievals were found to improve the AROME forecasts up to 2 km with a maximum gain of approximately 50 % in root-mean-square-errors (RMSE below 500 m. They were also found to outperform neural network retrievals. A static bias correction was proposed to account for systematic instrumental errors. This correction was found to have a negligible impact on the 1D-Var retrievals. The use of low elevation angles improves the retrievals up to 12 % in RMSE in cloudy-sky in the first layers. The present implementation achieved a RMSE with respect to radiosondes within 1 K in clear-sky and 1.3 K in cloudy-sky conditions for temperature.

  9. E1DS: catalytic site prediction based on 1D signatures of concurrent conservation

    2008-01-01

    Large-scale automatic annotation of protein sequences remains challenging in postgenomics era. E1DS is designed for annotating enzyme sequences based on a repository of 1D signatures. The employed sequence signatures are derived using a novel pattern mining approach that discovers long motifs consisted of several sequential blocks (conserved segments). Each of the sequential blocks is considerably conserved among the protein members of an EC group. Moreover, a signature includes at least thre...

  10. EXTENSION OF THE 1D FOUR-GROUP ANALYTIC NODAL METHOD TO FULL MULTIGROUP

    B. D. Ganapol; D. W. Nigg

    2008-09-01

    In the mid 80’s, a four-group/two-region, entirely analytical 1D nodal benchmark appeared. It was readily acknowledged that this special case was as far as one could go in terms of group number and still achieve an analytical solution. In this work, we show that by decomposing the solution to the multigroup diffusion equation into homogeneous and particular solutions, extension to any number of groups is a relatively straightforward exercise using the mathematics of linear algebra.

  11. Finite difference approximation of control via the potential in a 1-D Schrodinger equation

    K. Kime

    2000-04-01

    Full Text Available We consider the problem of steering given initial data to given terminal data via a time-dependent potential, the control, in a 1-D Schrodinger equation. We determine a condition for existence of a transferring potential within our approximation. Using Maple, we give equations for the control and also examples in which the potential is restricted to be centralized and to be a step potential.

  12. Transfer Matrix Approach to 1d Random Band Matrices: Density of States

    Shcherbina, Mariya; Shcherbina, Tatyana

    2016-09-01

    We study the special case of n× n 1D Gaussian Hermitian random band matrices, when the covariance of the elements is determined by the matrix J=(-W^2triangle +1)^{-1}. Assuming that n≥ CW log W≫ 1, we prove that the averaged density of states coincides with the Wigner semicircle law up to the correction of order W^{-1}.

  13. Experimental Conditions: SE37_S19_M1_D1 [Metabolonote[Archive

    Full Text Available opes SE37_S19 PSEUDO: Unlabeled and labeled Medicago samples for flavonoid annotation using ShiftedIonsFinde...03_M1) and for a blank sample (S16_M1 to S16_M3) are used. Import file name is unlabeling SE37_DS5 Flavonoid like peak search by ShiftedIonsFinder ... ...SE37_S19_M1_D1 SE37 Medicago truncatula shoot metabolite analysis using stable isot

  14. Modelling Hydrology of a Single Bioretention System with HYDRUS-1D

    Yingying Meng; Huixiao Wang; Jiangang Chen; Shuhan Zhang

    2014-01-01

    A study was carried out on the effectiveness of bioretention systems to abate stormwater using computer simulation. The hydrologic performance was simulated for two bioretention cells using HYDRUS-1D, and the simulation results were verified by field data of nearly four years. Using the validated model, the optimization of design parameters of rainfall return period, filter media depth and type, and surface area was discussed. And the annual hydrologic performance of bioretention systems was ...

  15. Time-dependent delta-interactions for 1D Schr\\"odinger Hamiltonians

    Hmidi, Taoufik; Nier, Francis

    2009-01-01

    The non autonomous Cauchy problem for time dependent 1D point interactions is considered. The regularity assumptions for the coupling parameter are accurately analyzed and show that the general results for non autonomous linear evolution equations in Banach spaces are far from being optimal. In the mean time, this article shows an unexpected application of paraproduct techniques, initiated by J.M. Bony for nonlinear partial differential equations, to a classical linear problem.

  16. Towards an Automatic Parking System using Bio-Inspired 1-D Optical Flow Sensors

    2015-01-01

    International audience; Although several (semi-) automatic parking systems have been presented throughout the years [1]–[12], car manufacturers are still looking for low-cost sensors providing redundant information about the obstacles around the vehicle, as well as efficient methods of processing this information, in the hope of achieving a very high level of robustness. We therefore investigated how Local Motion Sensors (LMSs) [13], [14], comprising only of a few pixels giving 1-D optical fl...

  17. A Fulling-Kuchment theorem for the 1D harmonic oscillator

    Guillemin, Victor

    2011-01-01

    We prove that there exists a pair of "non-isospectral" 1D semiclassical Schr\\"odinger operators whose spectra agree modulo h^\\infty. In particular, all their semiclassical trace invariants are the same. Our proof is based on an idea of Fulling-Kuchment and Hadamard's variational formula applied to suitable perturbations of the harmonic oscillator. Keywords: Inverse spectral problems, semiclassical Schr\\"odinger operators, trace invariants, Hadamard's variational formula, harmonic oscillator, Penrose mushroom, Sturm-Liouville theory.

  18. Controlled Growth and Field-emission Application of 1D ZnS Nanostructures

    X.S.Fang; Y.Bando; D.Golberg

    2007-01-01

    1 Results One-dimensional (1D) nanostructures have recently stimulated great interest due to their potential value for understanding fundamental physical concepts and for applications in constructing nanoscale electric and optoelectronic devices since the discovery of carbon nanotubes[1]. ZnS is one of the first semiconductors discovered and probably one of the most important materials in the electronics industry with a wide range of applications[2]. Controllable growth of nanostructures is a crucial is...

  19. Development of a hybrid deterministic/stochastic method for 1D nuclear reactor kinetics

    Terlizzi, Stefano; Dulla, Sandra; Ravetto, Piero [Politecnico di Torino, Corso Duca degli Abruzzi, 24 10129, Torino (Italy); Rahnema, Farzad, E-mail: farzad@gatech.edu [Nuclear & Radiological Engineering and Medical Physics Programs, Georgia Institute of Technology, 770 State Street NW, Atlanta, Ga, 30332-0745 (United States); Nuclear & Radiological Engineering and Medical Physics Programs, Georgia Institute of Technology, 770 State Street NW, Atlanta, Ga, 30332-0745 (United States); Zhang, Dingkang [Nuclear & Radiological Engineering and Medical Physics Programs, Georgia Institute of Technology, 770 State Street NW, Atlanta, Ga, 30332-0745 (United States)

    2015-12-31

    A new method has been implemented for solving the time-dependent neutron transport equation efficiently and accurately. This is accomplished by coupling the hybrid stochastic-deterministic steady-state coarse-mesh radiation transport (COMET) method [1,2] with the new predictor-corrector quasi-static method (PCQM) developed at Politecnico di Torino [3]. In this paper, the coupled method is implemented and tested in 1D slab geometry.

  20. Development of a hybrid deterministic/stochastic method for 1D nuclear reactor kinetics

    Terlizzi, Stefano; Rahnema, Farzad; Zhang, Dingkang; Dulla, Sandra; Ravetto, Piero

    2015-12-01

    A new method has been implemented for solving the time-dependent neutron transport equation efficiently and accurately. This is accomplished by coupling the hybrid stochastic-deterministic steady-state coarse-mesh radiation transport (COMET) method [1,2] with the new predictor-corrector quasi-static method (PCQM) developed at Politecnico di Torino [3]. In this paper, the coupled method is implemented and tested in 1D slab geometry.

  1. Insulin stimulation regulates AS160 and TBC1D1 phosphorylation sites in human skeletal muscle

    Middelbeek, R J W; Chambers, M A; Tantiwong, P

    2013-01-01

    Individuals with obesity and type 2 diabetes (T2D) are typically insulin resistant, exhibiting impaired skeletal muscle glucose uptake. Animal and cell culture experiments have shown that site-specific phosphorylation of the Rab-GTPase-activating proteins AS160 and TBC1D1 is critical for GLUT4 tr...... translocation facilitating glucose uptake, but their regulation in human skeletal muscle is not well understood....

  2. Piezo-semiconductive quasi-1D nanodevices with or without anti-symmetry.

    Araneo, Rodolfo; Lovat, Giampiero; Burghignoli, Paolo; Falconi, Christian

    2012-09-04

    The piezopotential in floating, homogeneous, quasi-1D piezo-semiconductive nanostructures under axial stress is an anti-symmetric (i.e., odd) function of force. Here, after introducing piezo-nano-devices with floating electrodes for maximum piezo-potential, we show that breaking the anti-symmetric nature of the piezopotential-force relation, for instance by using conical nanowires, can lead to better nanogenerators, piezotronic and piezophototronic devices.

  3. Enzyme-catalysed synthesis of galactosylated 1D- and 1L-chiro-inositol, 1D-pinitol, myo-inositol and selected derivatives using the beta-galactosidase from the thermophile Thermoanaerobacter sp. strain TP6-B1.

    Hart, Joanne B; Kröger, Lars; Falshaw, Andrew; Falshaw, Ruth; Farkas, Erzsébet; Thiem, Joachim; Win, Anna L

    2004-08-02

    The products from the enzymatic beta-D-galactopyranosylation of 1D-chiro-inositol, 1D-pinitol, 1D-3-O-allyl-4-O-methyl-chiro-inositol, 1D-3,4-di-O-methyl-chiro-inositol, 1L-chiro-inositol and myo-inositol in combined yields ranging from 46% to 64% have been obtained using the beta-galactosidase isolated from an anaerobic extreme thermophile, Thermoanaerobacter sp. strain TP6-B1 and p-nitrophenyl beta-D-galactopyranoside as the donor. Analysis of the products from these reactions reveals information about the acceptor preferences of the enzyme.

  4. Secure information embedding into 1D biomedical signals based on SPIHT.

    Rubio, Oscar J; Alesanco, Alvaro; García, José

    2013-08-01

    This paper proposes an encoding system for 1D biomedical signals that allows embedding metadata and provides security and privacy. The design is based on the analysis of requirements for secure and efficient storage, transmission and access to medical tests in e-health environment. This approach uses the 1D SPIHT algorithm to compress 1D biomedical signals with clinical quality, metadata embedding in the compressed domain to avoid extra distortion, digital signature to implement security and attribute-level encryption to support Role-Based Access Control. The implementation has been extensively tested using standard electrocardiogram and electroencephalogram databases (MIT-BIH Arrhythmia, MIT-BIH Compression and SCCN-EEG), demonstrating high embedding capacity (e.g. 3 KB in resting ECGs, 200 KB in stress tests, 30 MB in ambulatory ECGs), short delays (2-3.3s in real-time transmission) and compression of the signal (by ≃3 in real-time transmission, by ≃5 in offline operation) despite of the embedding of security elements and metadata to enable e-health services.

  5. Study of 1D stranged-charm meson family using HQET

    Gupta, Pallavi

    2015-01-01

    Recently LHCb predicted spin 1 and spin 3 states D* s1(2860) and D* s3(2860) which are studied through their strong decays, and are assigned to fit the 13D1and 13D3 states in the charm spectroscopy. In this paper,using the heavy quark effective theory, we state that assigning D*s1(2860) as the mixing of 13D1 - 23S1 states, is rather a better justification to its observed experimental values than a pure state. We study its decay modes variation with hadronic coupling constant gxh and the mixing angle . We appoint spin 3 state D* s3(2860) as the missing 1D 3- JP state, and also study its decay channel behavior with coupling constant gyh. To appreciate the above results, we check the variation of decay modes for their spin partners states i.e. 1D2 and 1D'2 with their masses and strong coupling constant i.e. gxh and gyh. Our calculation using HQET approach give mixing angle between the 13D1 - 23S1 state for D* s1(2860) to lie in the range (-1.6 radians < theta < -1.2 radians). Our calculation for coupling c...

  6. A two-layer $\\alpha\\omega$ dynamo model, and its implications for 1-D dynamos

    Roald, C B

    1999-01-01

    I will discuss an attempt at representing an interface dynamo in a simplified, essentially 1D framework. The operation of the dynamo is broken up into two 1D layers, one containing the $\\alpha$ effect and the other containing the $\\omega$ effect, and these two layers are allowed to communicate with each other by the simplest possible representation of diffusion, an analogue of Newton's law of cooling. Dynamical back-reaction of the magnetic field on them with diagrams I computed for a comparable purely 1D model. The bifurcation structure shows remarkable similarity, but a couple of subtle changes imply dramatically different physical behaviour for the model. In particular, the solar-like dynamo mode found in the 1-layer model is not stable in the 2-layer version; instead there is an (apparent) homoclinic bifurcation and a sequence of periodic, quasiperiodic, and chaotic modes. I argue that the fragility of these models makes them effectively useless as predictors or interpreters of more complex dynamos.

  7. A SPLIT-CHARACTERISTIC FINITE ELEMENT MODEL FOR 1-D UNSTEADY FLOWS

    ZHOU Yi-lin; TANG Hong-wu; LIU Xiao-hua

    2007-01-01

    An efficient and accurate solution algorithm was proposed for 1-D unsteady flow problems widely existing in hydraulic engineering. Based on the split-characteristic finite element method, the numerical model with the Saint-Venant equations of 1-D unsteady flows was established. The assembled finite element equations were solved with the tri-diagonal matrix algorithm. In the semi-implicit and explicit scheme, the critical time step of the method was dependent on the space step and flow velocity, not on the wave celerity. The method was used to eliminate the restriction due to the wave celerity for the computational analysis of unsteady open-channel flows. The model was verified by the experimental data and theoretical solution and also applied to the simulation of the flow in practical river networks. It shows that the numerical method has high efficiency and accuracy and can be used to simulate 1-D steady flows, and unsteady flows with shock waves or flood waves. Compared with other numerical methods, the algorithm of this method is simpler with higher accuracy, less dissipation, higher computation efficiency and less computer storage.

  8. Coupled 1D-2D hydrodynamic inundation model for sewer overflow: Influence of modeling parameters

    Adeniyi Ganiyu Adeogun

    2015-10-01

    Full Text Available This paper presents outcome of our investigation on the influence of modeling parameters on 1D-2D hydrodynamic inundation model for sewer overflow, developed through coupling of an existing 1D sewer network model (SWMM and 2D inundation model (BREZO. The 1D-2D hydrodynamic model was developed for the purpose of examining flood incidence due to surcharged water on overland surface. The investigation was carried out by performing sensitivity analysis on the developed model. For the sensitivity analysis, modeling parameters, such as mesh resolution Digital Elevation Model (DEM resolution and roughness were considered. The outcome of the study shows the model is sensitive to changes in these parameters. The performance of the model is significantly influenced, by the Manning's friction value, the DEM resolution and the area of the triangular mesh. Also, changes in the aforementioned modeling parameters influence the Flood characteristics, such as the inundation extent, the flow depth and the velocity across the model domain.

  9. An experimental and theoretical investigation of the C(1D) + D2 reaction

    Hickson, Kevin M

    2016-01-01

    In a previous joint experimental and theoretical study of the barrierless chemical reaction C(1D) + H2 at low temperatures (300-50 K) [K. M. Hickson, J.-C. Loison, H. Guo, Y. V. Suleimanov, J. Phys. Chem. Lett., 2015, 6, 4194.], excellent agreement was found between experimental thermal rate constants and theoretical estimates based on ring polymer molecular dynamics (RPMD) over the two lowest singlet potential energy surfaces (PESs). Here, we extend this work to one of its deuterated counterparts, C(1D) + D2, over the same temperature range. Experimental and RPMD results are in very good agreement when contributions from both PESs to this chemical reaction are included in the RPMD simulations. The deviation between experiment and the RPMD calculations does not exceed 25 % and both results exhibit a slight negative temperature dependence. The first excited 1A" PES plays a more important role than the ground 1A' PES as the temperature is decreased, similar to our previous studies of the C(1D) + H2 reaction but...

  10. A study on cooling efficiency using 1-d analysis code suitable for cooling system of thermoforming

    Li, Zhen Zhe; Heo, Kwang Su; Xuan, Dong Ji; Seol, Seoung Yun [Chonnam National University, Gwangju (Korea, Republic of)

    2009-03-15

    Thermoforming is one of the most versatile and economical processes available for polymer products, but cycle time and production cost must be continuously reduced in order to improve the competitive power of products. In this study, water spray cooling was simulated to apply to a cooling system instead of compressed air cooling in order to shorten the cycle time and reduce the cost of compressed air used in the cooling process. At first, cooling time using compressed air was predicted in order to check the state of mass production. In the following step, the ratio of removed energy by air cooling or water spray cooling among the total removed energy was found by using 1-D analysis code of the cooling system under the condition of checking the possibility of conversion from 2-D to 1-D problem. The analysis results using water spray cooling show that cycle time can be reduced because of high cooling efficiency of water spray, and cost of production caused by using compressed air can be reduced by decreasing the amount of the used compressed air. The 1-D analysis code can be widely used in the design of a thermoforming cooling system, and parameters of the thermoforming process can be modified based on the recommended data suitable for a cooling system of thermoforming

  11. Low band gap frequencies and multiplexing properties in 1D and 2D mass spring structures

    Aly, Arafa H.; Mehaney, Ahmed

    2016-11-01

    This study reports on the propagation of elastic waves in 1D and 2D mass spring structures. An analytical and computation model is presented for the 1D and 2D mass spring systems with different examples. An enhancement in the band gap values was obtained by modeling the structures to obtain low frequency band gaps at small dimensions. Additionally, the evolution of the band gap as a function of mass value is discussed. Special attention is devoted to the local resonance property in frequency ranges within the gaps in the band structure for the corresponding infinite periodic lattice in the 1D and 2D mass spring system. A linear defect formed of a row of specific masses produces an elastic waveguide that transmits at the narrow pass band frequency. The frequency of the waveguides can be selected by adjusting the mass and stiffness coefficients of the materials constituting the waveguide. Moreover, we pay more attention to analyze the wave multiplexer and DE-multiplexer in the 2D mass spring system. We show that two of these tunable waveguides with alternating materials can be employed to filter and separate specific frequencies from a broad band input signal. The presented simulation data is validated through comparison with the published research, and can be extended in the development of resonators and MEMS verification.

  12. Quantitative 3D electromagnetic field determination of 1D nanostructures from single projection

    Phatak, C.; Knoop, L. de; Houdellier, F.; Gatel, C.; Hÿtch, M. J.; Masseboeuf, A.

    2016-05-01

    One-dimensional (1D) nanostructures have been regarded as the most promising building blocks for nanoelectronics and nanocomposite material systems as well as for alternative energy applications. Although they result in confinement of a material, their properties and interactions with other nanostructures are still very much three-dimensional (3D) in nature. In this work, we present a novel method for quantitative determination of the 3D electromagnetic fields in and around 1D nanostructures using a single electron wave phase image, thereby eliminating the cumbersome acquisition of tomographic data. Using symmetry arguments, we have reconstructed the 3D magnetic field of a nickel nanowire as well as the 3D electric field around a carbon nanotube field emitter, from one single projection. The accuracy of quantitative values determined here is shown to be a better fit to the physics at play than the value obtained by conventional analysis. Moreover the 3D reconstructions can then directly be visualized and used in the design of functional 3D architectures built using 1D nanostructures.

  13. Influence of Underhood Flow on Engine Cooling Using 1-D And 3-D Approach

    Bolehovský Ondřej

    2015-12-01

    Full Text Available This work deals with numerical simulation of complete cooling system of internal combustion engine (GT-SUITE, which also involves the simulation of flow in underhood using the computationally undemanding simulation. A detailed model of the internal combustion engine is extended to a cooling circuit model which is then coupled to a simplified underhood model which is created with the help of GT-COOL application as a 3-D model and afterwards transferred to a 1-D form. The approaches, one using 1-D solution of arrangement of the heat exchangers and the other 3-D approach using the underhood model, were investigated in two steady states corresponding to various vehicle speeds and engine load. These simulations have shown the inappropriateness of 1-D approach when solving the flow in the heat exchangers in the underhood and helped to explore a relatively undemanding method of flow simulation in the underhood, which enables to detect the interaction between the models of the cooling system and the internal combustion engine and the issue of arrangement of the heat exchangers in the underhood.

  14. Subplane-based Control Rod Decusping Techniques for the 2D/1D Method in MPACT

    Graham, Aaron M [ORNL; Collins, Benjamin S [ORNL; Downar, Thomas [University of Michigan

    2017-01-01

    The MPACT transport code is being jointly developed by Oak Ridge National Laboratory and the University of Michigan to serve as the primary neutron transport code for the Virtual Environment for Reactor Applications Core Simulator. MPACT uses the 2D/1D method to solve the transport equation by decomposing the reactor model into a stack of 2D planes. A fine mesh flux distribution is calculated in each 2D plane using the Method of Characteristics (MOC), then the planes are coupled axially through a 1D NEM-P$_3$ calculation. This iterative calculation is then accelerated using the Coarse Mesh Finite Difference method. One problem that arises frequently when using the 2D/1D method is that of control rod cusping. This occurs when the tip of a control rod falls between the boundaries of an MOC plane, requiring that the rodded and unrodded regions be axially homogenized for the 2D MOC calculations. Performing a volume homogenization does not properly preserve the reaction rates, causing an error known as cusping. The most straightforward way of resolving this problem is by refining the axial mesh, but this can significantly increase the computational expense of the calculation. The other way of resolving the partially inserted rod is through the use of a decusping method. This paper presents new decusping methods implemented in MPACT that can dynamically correct the rod cusping behavior for a variety of problems.

  15. Neutronic analysis of the 1D and 1E banks reflux detection system

    Blanchard, A.

    1999-12-21

    Two H Canyon neutron monitoring systems for early detection of postulated abnormal reflux conditions in the Second Uranium Cycle 1E and 1D Mixer-Settle Banks have been designed and built. Monte Carlo neutron transport simulations using the general purpose, general geometry, n-particle MCNP code have been performed to model expected response of the monitoring systems to varying conditions.The confirmatory studies documented herein conclude that the 1E and 1D neutron monitoring systems are able to achieve adequate neutron count rates for various neutron source and detector configurations, thereby eliminating excessive integration count time. Neutron count rate sensitivity studies are also performed. Conversely, the transport studies concluded that the neutron count rates are statistically insensitive to nitric acid content in the aqueous region and to the transition region length. These studies conclude that the 1E and 1D neutron monitoring systems are able to predict the postulated reflux conditions for all examined perturbations in the neutron source and detector configurations. In the cases examined, the relative change in the neutron count rates due to postulated transitions from normal {sup 235}U concentration levels to reflux levels remain satisfactory detectable.

  16. Measuring the Speed of Sound in a 1D Fermi Gas

    Fry, Jacob; Revelle, Melissa; Hulet, Randall

    2016-05-01

    We report measurements of the speed of sound in a two-spin component, 1D gas of fermionic lithium. The 1D system is an array of one-dimensional tubes created by a 2D optical lattice. By increasing the lattice depth, the tunneling between tubes is sufficiently small to make each an independent 1D system. To measure the speed of sound, we create a density notch at the center of the atom cloud using a sheet of light tuned far from resonance. The dipole force felt by both spin states will be equivalent, so this notch can be thought of as a charge excitation. Once this beam is turned off, the notch propagates to the edge of the atomic cloud with a velocity that depends on the strength of interatomic interactions. We control interactions using a magnetically tuned Feshbach resonance, allowing us to measure the speed of sound over a wide range of interaction. This method may be used to extract the Luttinger parameter vs. interaction strength. Supported by an ARO MURI Grant, NSF, and The Welch Foundation.

  17. Surface defect inspection of TFT-LCD panels based on 1D Fourier method

    Zhang, Teng-da; Lu, Rong-sheng

    2016-01-01

    Flat panel displays have been used in a wide range of electronic devices. The defects on their surfaces are an important factor affecting the product quality. Automated optical inspection (AOI) method is an important and effective means to perform the surface defection inspection. In this paper, a kind of defect extraction algorithm based on one dimensional (1D) Fourier theory for the surface defect extraction with periodic texture background is introduced. In the algorithm, the scanned surface images are firstly transformed from time domain to frequency domain by 1D Fourier transform. The periodic texture background on the surface is then removed by using filtering methods in the frequency domain. Then, a dual-threshold statistical control method is applied to separate the defects from the surface background. Traditional 1D Fourier transform scheme for detecting ordinary defects is very effective; however, the method is not where the defect direction is close to horizontal in periodic texture background. In order to tackle the problem, a mean threshold method based on faultless image is put forward. It firstly calculates the upper and lower control limits of the every reconstructed line scanned image with faultless and then computes the averages of the upper and lower limits. The averages then act as the constant double thresholds to extract the defects. The experimental results of different defects show that the method developed in the paper is very effective for TFT-LCD panel surface defect inspection even in the circumstance that the defect directions are close to horizontal.

  18. Interview: glycolipid antigen presentation by CD1d and the therapeutic potential of NKT cell activation.

    Kronenberg, Mitchell

    2007-01-01

    Natural Killer T cells (NKT) are critical determinants of the immune response to cancer, regulation of autioimmune disease, clearance of infectious agents, and the development of artheriosclerotic plaques. In this interview, Mitch Kronenberg discusses his laboratory's efforts to understand the mechanism through which NKT cells are activated by glycolipid antigens. Central to these studies is CD1d--the antigen presenting molecule that presents glycolipids to NKT cells. The advent of CD1d tetramer technology, a technique developed by the Kronenberg lab, is critical for the sorting and identification of subsets of specific glycolipid-reactive T cells. Mitch explains how glycolipid agonists are being used as therapeutic agents to activate NKT cells in cancer patients and how CD1d tetramers can be used to assess the state of the NKT cell population in vivo following glycolipid agonist therapy. Current status of ongoing clinical trials using these agonists are discussed as well as Mitch's prediction for areas in the field of immunology that will have emerging importance in the near future.

  19. Determination of cellular lipids bound to human CD1d molecules.

    Daryl Cox

    Full Text Available CD1 molecules are glycoproteins that present lipid antigens at the cell surface for immunological recognition by specialized populations of T lymphocytes. Prior experimental data suggest a wide variety of lipid species can bind to CD1 molecules, but little is known about the characteristics of cellular ligands that are selected for presentation. Here we have molecularly characterized lipids bound to the human CD1d isoform. Ligands were eluted from secreted CD1d molecules and separated by normal phase HPLC, then characterized by mass spectroscopy. A total of 177 lipid species were molecularly identified, comprising glycerophospholipids and sphingolipids. The glycerophospholipids included common diacylglycerol species, reduced forms known as plasmalogens, lyso-phospholipids (monoacyl species, and cardiolipins (tetraacyl species. The sphingolipids included sphingomyelins and glycosylated forms, such as the ganglioside GM3. These results demonstrate that human CD1d molecules bind a surprising diversity of lipid structures within the secretory pathway, including compounds that have been reported to play roles in cancer, autoimmune diseases, lipid signaling, and cell death.

  20. Numerical Modeling of Imploding Plasma liners Using the 1D Radiation-Hydrodynamics Code HELIOS

    Davis, J. S.; Hanna, D. S.; Awe, T. J.; Hsu, S. C.; Stanic, M.; Cassibry, J. T.; Macfarlane, J. J.

    2010-11-01

    The Plasma Liner Experiment (PLX) is attempting to form imploding plasma liners to reach 0.1 Mbar upon stagnation, via 30--60 spherically convergent plasma jets. PLX is partly motivated by the desire to develop a standoff driver for magneto-inertial fusion. The liner density, atomic makeup, and implosion velocity will help determine the maximum pressure that can be achieved. This work focuses on exploring the effects of atomic physics and radiation on the 1D liner implosion and stagnation dynamics. For this reason, we are using Prism Computational Science's 1D Lagrangian rad-hydro code HELIOS, which has both equation of state (EOS) table-lookup and detailed configuration accounting (DCA) atomic physics modeling. By comparing a series of PLX-relevant cases proceeding from ideal gas, to EOS tables, to DCA treatments, we aim to identify how and when atomic physics effects are important for determining the peak achievable stagnation pressures. In addition, we present verification test results as well as brief comparisons to results obtained with RAVEN (1D radiation-MHD) and SPHC (smoothed particle hydrodynamics).

  1. Soil salt leaching under different irrigation regimes:HYDRUS-1D modelling and analysis

    WenZhi ZENG; Chi XU; JingWei WU; JieSheng HUANG

    2014-01-01

    Field irrigation experiments were conducted in the Hetao Irrigation District of Inner Mongolia, China, to study the effects of irrigation regimes on salt leaching in the soil profile. The data were used to calibrate and validate the HYDRUS-1D model. The results demonstrated that the model can accurately simulate the water and salt dy-namics in the soil profile. The HYDRUS-1D model was then used to simulate 15 distinct irrigation scenarios. The results of the simulation indicated that irrigation amount did not have a significant effect on soil water storage but that increases in irrigation amount could accelerate salt leaching. However, when the irrigation amount was larger than 20 cm, the acceleration was not obvious. Compared with irrigating only once, intermittent irrigation had a better effect on increasing soil water storage and salt leaching, but excessive irrigation times and intervals did not improve salt leaching. In addition, we found that the irrigation regime of 20 cm, irrigated twice at 1-d intervals, might signifi-cantly increase salt leaching in the plough layer and decrease the risks of deep seepage and groundwater con-tamination.

  2. Implementation and validation of a 1D fluid model for collapsible channels.

    Anderson, Peter; Fels, Sidney; Green, Sheldon

    2013-11-01

    A 1D fluid model is implemented for the purpose of fluid-structure interaction (FSI) simulations in complex and completely collapsible geometries, particularly targeting the case of obstructive sleep apnea (OSA). The fluid mechanics are solved separately from any solid mechanics, making possible the use of a highly complex and/or black-box solver for the solid mechanics. The fluid model is temporally discretized with a second-order scheme and spatially discretized with an asymmetrical fourth-order scheme that is robust in highly uneven geometries. A completely collapsing and reopening geometry is handled smoothly using a modified area function. The numerical implementation is tested with two driven-geometry cases: (1) an inviscid analytical solution and (2) a completely closing geometry with viscous flow. Three-dimensional fluid simulations in static geometries are performed to examine the assumptions of the 1D model, and with a well-defined pressure-recovery constant the 1D model agrees well with 3D models. The model is very fast computationally, is robust, and is recommended for OSA simulations where the bulk flow pressure is primarily of interest.

  3. Position error in profiles retrieved from MIPAS observations with a 1-D algorithm

    M. Carlotti

    2012-09-01

    Full Text Available The information load (IL analysis, first introduced for the two-dimensional approach (Carlotti and Magnani, 2009, is applied to the inversion of MIPAS observations operated with a 1-dimensional (1-D retrieval algorithm. The IL distribution of MIPAS spectra is shown to be often asymmetrical with respect to the tangent points of the observations and permits to identify the preferential latitude where the profiles retrieved with a 1-D algorithm should be geo-located. Therefore a position error is made when the tangent points of the observations are used to assign the geo-location of the retrieved profile. We assess the amplitude of the position error for some of the MIPAS main targets and we show that the IL analysis can also be used as a tool for the selection of observations that, when analyzed, minimize the position error of the retrieved profile. When the temperature (T profiles are used for the retrieval of volume mixing ratio (VMR of atmospheric constituents, the T position error (of the order of 1.5 degrees of latitude induces a VMR error that is directly connected with the horizontal T gradients. Temperature profiles can be externally-provided or determined in a previous step of the retrieval process. In the first case, the IL analysis shows that a meaningful fraction (often exceeding 50% of the VMR error deriving from the 1-D approximation is to be attributed to the mismatch between the position assigned to the external T profile and the positions where T is required by the analyzed observations. In the second case the retrieved T values suffer by an error of 1.5–2 K due to neglecting the horizontal variability of T; however the error induced on VMRs is of minor entity because of the generally small mismatch between the IL distribution of the observations analyzed to retrieve T and those analyzed to retrieve the VMR target. An estimate of the contribution of the

  4. Hydrothermally processed 1D hydroxyapatite: Mechanism of formation and biocompatibility studies.

    Stojanović, Zoran S; Ignjatović, Nenad; Wu, Victoria; Žunič, Vojka; Veselinović, Ljiljana; Škapin, Srečo; Miljković, Miroslav; Uskoković, Vuk; Uskoković, Dragan

    2016-11-01

    Recent developments in bone tissue engineering have led to an increased interest in one-dimensional (1D) hydroxyapatite (HA) nano- and micro-structures such as wires, ribbons and tubes. They have been proposed for use as cell substrates, reinforcing phases in composites and carriers for biologically active substances. Here we demonstrate the synthesis of 1D HA structures using an optimized, urea-assisted, high-yield hydrothermal batch process. The one-pot process, yielding HA structures composed of bundles of ribbons and wires, was typified by the simultaneous occurrence of a multitude of intermediate reactions, failing to meet the uniformity criteria over particle morphology and size. To overcome these issues, the preparation procedure was divided to two stages: dicalcium phosphate platelets synthesized in the first step were used as a precursor for the synthesis of 1D HA in the second stage. Despite the elongated particle morphologies, both the precursor and the final product exhibited excellent biocompatibility and caused no reduction of viability when tested against osteoblastic MC3T3-E1 cells in 2D culture up to the concentration of 2.6mg/cm(2). X-ray powder diffraction combined with a range of electron microscopies and laser diffraction analyses was used to elucidate the formation mechanism and the microstructure of the final particles. The two-step synthesis involved a more direct transformation of DCP to 1D HA with the average diameter of 37nm and the aspect ratio exceeding 100:1. The comparison of crystalline domain sizes along different crystallographic directions showed no signs of significant anisotropy, while indicating that individual nanowires are ordered in bundles in the b crystallographic direction of the P63/m space group of HA. Intermediate processes, e.g., dehydration of dicalcium phosphate, are critical for the formation of 1D HA alongside other key aspects of this phase transformation, it must be investigated in more detail in the continuous

  5. MAST-1D, a Model to Route Sediment and Tracers in Channel-Floodplain Complexes

    Viparelli, E.; Lauer, J. W.; Belmont, P.

    2014-12-01

    Sediment exchange between the channel and floodplain can occur via meander migration, overbank deposition or erosion, and channel widening or narrowing. Depending on channel and floodplain history, floodplains can act either as sources or sinks of bed material and/or wash load. The Morphodynamics And Sediment Tracers in 1D program (MAST-1D) is a numerical model built to describe grain size specific transport of sediment and tracers and the long-term - i.e. decadal and longer - evolution of channel floodplain complexes. MAST-1D differs from other 1D numerical models because it allows for 1) uneven exchange of sediment and tracers between the river channel and the floodplain, 2) temporal changes in channel geometry, bed elevation and floodplain thickness, which result in changes in the channel hydraulic capacity, and 3) temporal changes of size distribution and tracer content in the floodplain, in the load and in the underlying substrate. Under conditions of constant base level, water and sediment supply, the main assumptions in the model result in the system evolving asymptotically toward a steady state wherein channel bed erosion is balanced by channel bed deposition. When at this condition, the amount of sediment deposited on the floodplain through point bar deposition and overbank sedimentation is balanced by the erosion of sediment from the floodplain through lateral migration. However, imbalances in floodplain storage can persist for many years even when the channel bed elevation and size distribution are near steady state. The MAST-1D program is applied to study the long term response of a sand bed river, an 80 km long reach of the Minnesota River between Mankato and Jordan, Minnesota, to changes in flow regime and the sediment load due to the development of intensive agriculture in the watershed. The simulations are performed in successive phases, the model is first set up so that under the best estimates available for pre-agriculture conditions, channel

  6. HLA class II susceptibility pattern for type 1 diabetes (T1D) in an Iranian population.

    Kiani, J; Hajilooi, M; Furst, D; Rezaei, H; Shahryari-Hesami, S; Kowsarifard, S; Zamani, A; Solgi, G

    2015-08-01

    This study aimed to determine the HLA-DRB1/HLA-DQB1 susceptibility and protection pattern for type 1 diabetes (T1D) in a population from Hamadan, north-west of Iran. A total of 133 patients with T1D were tested for HLA-DRB1 and HLA-DQB1 alleles using PCR-SSP compared to 100 ethnic-matched healthy controls. Alleles and haplotypes frequencies were compared between both groups. The most susceptible alleles for disease were HLA-DRB1*03:01, DRB1*04:02, DQB1*02:01 and DQB1*03:02, and protective alleles were HLA-DRB1*07:01, *11:01, *13:01, *14:01 and DRB1*15 and HLA-DQB1*06:01, *06:02 and *06:03. Haplotype analysis revealed that patients with T1D had higher frequencies of DRB1*03:01-DQB1*02:01 (OR = 4.86, P < 10(-7) ) and DRB1*04:02-DQB1*03:02 (OR = 9.93, P < 10(-7) ) and lower frequencies of DRB1*07:01-DQB1*02:01 (P = 0.0005), DRB1*11:01-DQB1*03:01 (P = 0.001), DRB1*13:01-DQB1*06:03 (P = 0.002) and DRB1*15-DQB1*06:01 (P = 0.001) haplotypes compared to healthy controls. Heterozygote combination of both susceptible haplotypes (DR3/DR4) confers the highest risk for T1D (RR = 18.80, P = 4 × 10(-5) ). Additionally, patients with homozygote diplotype, DR3/DR3 and DR4/DR4, showed a similar risk with less extent to heterozygote combination (P = 0.0004 and P = 0.01, respectively). Our findings not only confirm earlier reports from Iranians but also are in line with Caucasians and partly with Asians and some African patients with T1D. Remarkable differences were the identification of DRB1*04:01-DQB1*03:02, DRB1*07:01-DQB1*03:03 and DRB1*16-DQB1*05:02 as neutral and DRB1*13:01-DQB1*06:03 as the most protective haplotypes in this study.

  7. File list: Oth.Liv.05.Nr1d1.AllCell [Chip-atlas[Archive

    Full Text Available Oth.Liv.05.Nr1d1.AllCell mm9 TFs and others Nr1d1 Liver SRX128176,SRX997762,SRX9977...63,SRX997761,SRX997760,SRX997765,SRX997764,SRX109461,SRX100296,SRX994725,SRX994726,SRX100297 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.Liv.05.Nr1d1.AllCell.bed ...

  8. Altered Expression Profile of Renal α1D-Adrenergic Receptor in Diabetes and Its Modulation by PPAR Agonists

    Xueying Zhao

    2014-01-01

    Full Text Available Alpha1D-adrenergic receptor (α1D-AR plays important roles in regulating physiological and pathological responses mediated by catecholamines, particularly in the cardiovascular and urinary systems. The present study was designed to investigate the expression profile of α1D-AR in the diabetic kidneys and its modulation by activation of peroxisome proliferator-activated receptors (PPARs. 12-week-old Zucker lean (ZL and Zucker diabetic fatty (ZD rats were treated with fenofibrate or rosiglitazone for 8–10 weeks. Gene microarray, real-time PCR, and confocal immunofluorescence microscopy were performed to assess mRNA and protein expression of α1D-AR in rat kidney tissue. Using microarray, we found that α1D-AR gene was dramatically upregulated in 22-week-old ZD rats compared to ZL controls. Quantitative PCR analysis verified a 16-fold increase in α1D-AR mRNA in renal cortex from ZD animals compared to normal controls. Chronic treatment with fenofibrate or rosiglitazone reduced renal cortical α1D-AR gene. Immunofluorescence staining confirmed that α1D-AR protein was induced in the glomeruli and tubules of diabetic rats. Moreover, dual immunostaining for α1D-AR and kidney injury molecule-1 indicated that α1D-AR was expressed in dedifferentiated proximal tubules of diabetic Zucker rats. Taken together, our results show that α1D-AR expression is upregulated in the diabetic kidneys. PPAR activation suppressed renal expression of α1D-AR in diabetic nephropathy.

  9. What causes the large extensions of red-supergiant atmospheres? Comparisons of interferometric observations with 1-D hydrostatic, 3-D convection, and 1-D pulsating model atmospheres

    Arroyo-Torres, B; Chiavassa, A; Scholz, M; Freytag, B; Marcaide, J M; Hauschildt, P H; Wood, P R; Abellan, F J

    2015-01-01

    We present the atmospheric structure and the fundamental parameters of three red supergiants, increasing the sample of RSGs observed by near-infrared spectro-interferometry. Additionally, we test possible mechanisms that may explain the large observed atmospheric extensions of RSGs. We carried out spectro-interferometric observations of 3 RSGs in the near-infrared K-band with the VLTI/AMBER instrument at medium spectral resolution. To comprehend the extended atmospheres, we compared our observational results to predictions by available hydrostatic PHOENIX, available 3-D convection, and new 1-D self-excited pulsation models of RSGs. Our near-infrared flux spectra are well reproduced by the PHOENIX model atmospheres. The continuum visibility values are consistent with a limb-darkened disk as predicted by the PHOENIX models, allowing us to determine the angular diameter and the fundamental parameters of our sources. Nonetheless, in the case of V602 Car and HD 95686, the PHOENIX model visibilities do not predict ...

  10. Computational Study and Analysis of Structural Imperfections in 1D and 2D Photonic Crystals

    Maskaly, Karlene Rosera [Massachusetts Inst. of Technology (MIT), Cambridge, MA (United States)

    2005-06-01

    Dielectric reflectors that are periodic in one or two dimensions, also known as 1D and 2D photonic crystals, have been widely studied for many potential applications due to the presence of wavelength-tunable photonic bandgaps. However, the unique optical behavior of photonic crystals is based on theoretical models of perfect analogues. Little is known about the practical effects of dielectric imperfections on their technologically useful optical properties. In order to address this issue, a finite-difference time-domain (FDTD) code is employed to study the effect of three specific dielectric imperfections in 1D and 2D photonic crystals. The first imperfection investigated is dielectric interfacial roughness in quarter-wave tuned 1D photonic crystals at normal incidence. This study reveals that the reflectivity of some roughened photonic crystal configurations can change up to 50% at the center of the bandgap for RMS roughness values around 20% of the characteristic periodicity of the crystal. However, this reflectivity change can be mitigated by increasing the index contrast and/or the number of bilayers in the crystal. In order to explain these results, the homogenization approximation, which is usually applied to single rough surfaces, is applied to the quarter-wave stacks. The results of the homogenization approximation match the FDTD results extremely well, suggesting that the main role of the roughness features is to grade the refractive index profile of the interfaces in the photonic crystal rather than diffusely scatter the incoming light. This result also implies that the amount of incoherent reflection from the roughened quarterwave stacks is extremely small. This is confirmed through direct extraction of the amount of incoherent power from the FDTD calculations. Further FDTD studies are done on the entire normal incidence bandgap of roughened 1D photonic crystals. These results reveal a narrowing and red-shifting of the normal incidence bandgap with

  11. Design and initial 1D radiography tests of the FANTOM mobile fast-neutron radiography and tomography system

    Andersson, P.; Valldor-Blücher, J.; Andersson Sundén, E.; Sjöstrand, H.; Jacobsson-Svärd, S.

    2014-08-01

    The FANTOM system is a tabletop sized fast-neutron radiography and tomography system newly developed at the Applied Nuclear Physics Division of Uppsala University. The main purpose of the system is to provide time-averaged steam-and-water distribution measurement capability inside the metallic structures of two-phase test loops for light water reactor thermal-hydraulic studies using a portable fusion neutron generator. The FANTOM system provides a set of 1D neutron transmission data, which may be inserted into tomographic reconstruction algorithms to achieve a 2D mapping of the steam-and-water distribution. In this paper, the selected design of FANTOM is described and motivated. The detector concept is based on plastic scintillator elements, separated for spatial resolution. Analysis of pulse heights on an event-to-event basis is used for energy discrimination. Although the concept allows for close stacking of a large number of detector elements, this demonstrator is equipped with only three elements in the detector and one additional element for monitoring the yield from the neutron generator. The first measured projections on test objects of known configurations are presented. These were collected using a Sodern Genie 16 neutron generator with an isotropic yield of about 1E8 neutrons per second, and allowed for characterization of the instrument's capabilities. At an energy threshold of 10 MeV, the detector offered a count rate of about 500 cps per detector element. The performance in terms of spatial resolution was validated by fitting a Gaussian Line Spread Function to the experimental data, a procedure that revealed a spatial unsharpness in good agreement with the predicted FWHM of 0.5 mm.

  12. 1D zigzag chain and 0D monomer Cd(II)/Zn(II) compounds based on flexible phenylenediacetic ligand: Synthesis, crystal structures and fluorescent properties

    Yang, Fang; Ren, Yixia; Li, Dongsheng; Fu, Feng; Qi, Guangcai; Wang, Yaoyu

    2008-12-01

    Three novel Cd(II)/Zn(II) compounds, [Cd 2(poda) 2(phen) 3(H 2O)] n· nEtOH·3 nH 2O (1), [Zn(poda) 2(bpy)(H 2O)] n(2) and [Zn(Hpoda) 2(bpy)] (3) (H 2poda = 1,2-phenylenediacetic acid, phen = 1,10-phenanthroline, bpy = 2,2'-bipyridyl), have been synthesized and characterized by IR, TG, fluorescent spectrum and single-crystal X-ray diffraction techniques. In 1, poda 2- anions link the adjacent Cd(II) centers to generate a 1D zigzag chain. Furthermore, an unprecedented four-footed "8-shaped" mixed water-ethanol (H 2O) 6(C 2H 5OH) 2 cluster connects four double chains based on 1D zigzag chain into 3D supramolecular architecture. By bis(chelate-monodentate) fashion of poda 2- ligand, compound 2 exhibits 1D zigzag chains, which forming a dense zipper-like 2D structure via strong π-π stacking interactions. Differed from 1 and 2, compound 3 has a mononuclear motif, and displays a 3D 6-connected α-Po net hydrogen-bonded topology. The structure-related solid-state fluorescence spectra of compounds 1 and 2 have been determined.

  13. Nested 1D-2D approach for urban surface flood modeling

    Murla, Damian; Willems, Patrick

    2015-04-01

    Floods in urban areas as a consequence of sewer capacity exceedance receive increased attention because of trends in urbanization (increased population density and impermeability of the surface) and climate change. Despite the strong recent developments in numerical modeling of water systems, urban surface flood modeling is still a major challenge. Whereas very advanced and accurate flood modeling systems are in place and operation by many river authorities in support of flood management along rivers, this is not yet the case in urban water management. Reasons include the small scale of the urban inundation processes, the need to have very high resolution topographical information available, and the huge computational demands. Urban drainage related inundation modeling requires a 1D full hydrodynamic model of the sewer network to be coupled with a 2D surface flood model. To reduce the computational times, 0D (flood cones), 1D/quasi-2D surface flood modeling approaches have been developed and applied in some case studies. In this research, a nested 1D/2D hydraulic model has been developed for an urban catchment at the city of Gent (Belgium), linking the underground sewer (minor system) with the overland surface (major system). For the overland surface flood modelling, comparison was made of 0D, 1D/quasi-2D and full 2D approaches. The approaches are advanced by considering nested 1D-2D approaches, including infiltration in the green city areas, and allowing the effects of surface storm water storage to be simulated. An optimal nested combination of three different mesh resolutions was identified; based on a compromise between precision and simulation time for further real-time flood forecasting, warning and control applications. Main streets as mesh zones together with buildings as void regions constitute one of these mesh resolution (3.75m2 - 15m2); they have been included since they channel most of the flood water from the manholes and they improve the accuracy of

  14. Design, synthesis and biological evaluation of bivalent ligands against A1-D1 receptor heteromers

    Jian SHEN; Lei ZHANG; Wan-ling SONG; Tao MENG; Xin WANG; Lin CHEN; Lin-yin FENG

    2013-01-01

    Aim:To design and synthesize bivalent ligands for adenosine A1-dopamine D1 receptor heteromers (A1-D1R),and evaluate their pharmacological activities.Methods:Bivalent ligands and their corresponding A1R monovalent ligands were designed and synthesized.The affinities of the bivalent ligands for A1R and D1R in rat brain membrane preparation were examined using radiolabeled binding assays.To demonstrate the formation of A1-D1R,fluorescence resonance energy transfer (FRET) was conducted in HEK293 cells transfected with D1-CFP and A1-YFP.Molecular modeling was used to analyze the possible mode of protein-protein and protein-ligand interactions.Results:Two bivalent ligands for A1R and D1R (20a,20b),as well as the corresponding A1R monovalent ligands (21a,21b) were synthesized.In radiolabeled binding assays,the bivalent ligands showed affinities for A1R 10-100 times higher than those of the corresponding monovalent ligands.In FRET experiments,the bivalent ligands significantly increased the heterodimerization of A1R and D1R compared with the corresponding monovalent ligands.A heterodimer model with the interface of helixes 3,4,5 of A1R and helixes 1,6,7 from D1R was established with molecular modeling.The distance between the two ligand binding sites in the heterodimer model was approximately 48.4 (A),which was shorter than the length of the bivalent ligands.Conclusion:This study demonstrates the existence of A1-D1R in situ and a simultaneous interaction of bivalent ligands with both the receptors.

  15. Nanoelectronic Modeling (NEMO): Moving from commercial grade 1-D simulation to prototype 3-D simulation

    Klimeck, Gerhard

    2001-03-01

    The quantum mechanical functionality of commercially pursued heterostructure devices such as resonant tunneling diodes (RTDs), quantum well infrared photodetectors, and quantum well lasers are enabled by material variations on an atomic scale. The creation of these heterostructure devices is realized in a vast design space of material compositions, layer thicknesses and doping profiles. The full experimental exploration of this design space is unfeasible and a reliable design tool is needed. The Nanoelectronic Modeling tool (NEMO) is one of the first commercial grade attempts for such a modeling tool. NEMO was developed as a general-purpose quantum mechanics-based 1-D device design and analysis tool from 1993-97 by the Central Research Laboratory of Texas Instruments (later Raytheon Systems). NEMO enables(R. Lake, G. Klimeck, R. C. Bowen, and D. Jovanovic, J. Appl. Phys. 81), 7845 (1997). the fundamentally sound inclusion of the required(G. Klimeck et al.), in the 1997 55th Annual Device Research Conference Digest, (IEEE, NJ, 1997), p. 92^,(R. C. Bowen et al.), J. Appl. Phys 81, 3207 (1997). physics: bandstructure, scattering, and charge self-consistency based on the non-equilibrium Green function approach. A new class of devices which require full 3-D quantum mechanics based models is starting to emerge: quantum dots, or in general semiconductor based deca-nano devices. We are currently building a 3-D modeling tool based on NEMO to include the important physics to understand electronic stated in such superscaled structures. This presentation will overview various facets of the NEMO 1-D tool such electron transport physics in RTDs, numerical technology, software engineering and graphical user interface. The lessons learned from that work are now entering the NEMO 3-D development and first results using the NEMO 3-D prototype will be shown. More information about the publically available NEMO 1-D executables can be found at http://hpc.jpl.nasa.gov/ PEP/gekco/nemo

  16. Natural Outbreak of BVDV-1d-Induced Mucosal Disease Lacking Intestinal Lesions.

    Bianchi, M V; Konradt, G; de Souza, S O; Bassuino, D M; Silveira, S; Mósena, A C S; Canal, C W; Pavarini, S P; Driemeier, D

    2017-03-01

    Bovine viral diarrhea virus (BVDV) belongs to the Pestivirus genus, which is further divided into subgenotypes (1a-1u and 2a-c). When persistent infection occurs, the calf will be immunotolerant to BVDV and possibly develop mucosal disease. This study describes an outbreak of BVDV-1d-induced mucosal disease lacking intestinal lesions. Eleven calves presented with anorexia, sialorrhea, lameness, recumbency, and death. Three calves were necropsied, showing ulceration of the interdigital skin and the oral and nasal mucosa; linear ulcers in the tongue, esophagus, and rumen; and rounded ulcers in the abomasum. Microscopically, mucosa and skin had superficial necrosis, with single-cell necrosis and vacuolation in epithelial cells, and severe parakeratosis. Immunohistochemistry (IHC) showed BVDV antigen in the cytoplasm of epithelial cells in skin and mucosa. All 11 dead calves were positive upon reverse transcription-polymerase chain reaction (RT-PCR) for the detection of Pestivirus along with another 11 live calves from the herd, which were positive again by RT-PCR and IHC after a 4-week interval. Sequencing of the 5' untranslated region and N-terminal protease showed that viruses from these 22 calves were homologous and of subgenotype BVDV-1d. Cytopathic BVDV was isolated from 8 of 11 dead calves, but only noncytopathic BVDV was isolated from the 11 live animals. The findings indicate that this was an outbreak of mucosal disease caused by BVDV-1d, with high morbidity, and lesions restricted to the upper alimentary system and skin and absent from intestine. Thus, the epidemiological and pathological features in this form of mucosal disease may be similar to vesicular diseases, including foot and mouth disease.

  17. 1-D and 2-D electrophoresis protein profiles of the scorpion venom from Brotheas amazonicus

    Higa, A.M.; Noronha, M.D.N. [Universidade do Estado do Amazonas (UEA), Manaus, AM (Brazil). Rede Proteomica do Amazonas (Proteam). Lab. de Genomica e Proteomica; Rocha-Oliveira, F.; Lopez-Lozano, J.L.L. [Universidade Federal do Amazonas (UFAM), Manaus, AM (Brazil). Pos-Graduacao em Biotecnologia

    2008-07-01

    Full text: Introduction: Scorpions venoms show specific neurotoxins to insect or mammals. These toxins are very important molecular tools to development of news drugs or bioinsecticides. Brotheas amazonicus scorpion is an endemic specie in Amazonian Rain Forest, but your venom do not show toxicity in humans. Information about biological specific activity on insect of this venom is not known yet. Objectives: Molecular protein toxins profiles of the venom from Brotheas amazonicus scorpion by 1-D and 2-D electrophoresis methods to detected toxins with potential biotech applications. Results: Several spots 'families' with {approx} 60, 70 and 80 kDa were detected in gel acidic region with pI {approx} 4,5 - 6 range, in the same region 1-D zimography showed proteolytic activity on gelatin and fibrinogen and proteolytic activity was inhibited by PMSF, suggesting scorpion serine proteinases. 50 kDa proteins were detected with pI {approx} 6,5 - 7 range. In 23 - 50 kDa gel acid region were observed some proteins. In 23 - 14 kDa gel acidic region were detected proteins with pI 4 - 7 range. 1-D Tris-tricine gel showed proteins with {approx} 7 kDa, suggesting scorpion neurotoxins. In gel basic region only 14 kDa proteins were observed with pI {approx} 9 - 10 range. Conclusion: Molecular profile of the scorpion venom from B. amazonicus showed proteins with high and low molecular masses, mainly with acidic pI. Proteolytic activity suggest serine proteinases with high molecular masses and 7 kDa proteins in B. amazonicus venom suggest scorpion neurotoxins. Purification and molecular characterization of these toxins are in course.

  18. Electrochemical cortisol immunosensors based on sonochemically synthesized zinc oxide 1D nanorods and 2D nanoflakes.

    Vabbina, Phani Kiran; Kaushik, Ajeet; Pokhrel, Nimesh; Bhansali, Shekhar; Pala, Nezih

    2015-01-15

    We report on label free, highly sensitive and selective electrochemical immunosensors based on one-dimensional 1D ZnO nanorods (ZnO-NRs) and two-dimensional 2D ZnO nanoflakes (ZnO-NFs) which were synthesized on Au-coated substrates using simple one step sonochemical approach. Selective detection of cortisol using cyclic voltammetry (CV) is achieved by immobilizing anti-cortisol antibody (Anti-C(ab)) on the ZnO nanostructures (NSs). 1D ZnO-NRs and 2D ZnO-NFs provide unique sensing advantages over bulk materials. While 1D-NSs boast a high surface area to volume ratio, 2D-NSs with large area in polarized (0001) plane and high surface charge density could promote higher Anti-C(ab) loading and thus better sensing performance. Beside large surface area, ZnO-NSs also exhibit higher chemical stability, high catalytic activity, and biocompatibility. TEM studies showed that both ZnO-NSs are single crystalline oriented in (0001) plane. The measured sensing parameters are in the physiological range with a sensitivity of 11.86 µA/M exhibited by ZnO-NRs and 7.74 µA/M by ZnO-NFs with the lowest detection limit of 1 pM which is 100 times better than conventional enzyme-linked immunosorbant immunoassay (ELISA). ZnO-NSs based cortisol immunosensors were tested on human saliva samples and the performance were validated with conventional (ELISA) method which exhibits a remarkable correlation. The developed sensors can be integrated with microfluidic system and miniaturized potentiostat for point-of-care cortisol detection and such developed protocol can be used in personalized health monitoring/diagnostic.

  19. Membranes from nanoporous 1D and 2D materials: A review of opportunities, developments, and challenges

    Kim, Wun-gwi

    2013-12-01

    Membranes utilizing nanoporous one-dimensional (1D) and two-dimensional (2D) materials are emerging as attractive candidates for applications in molecular separations and related areas. Such nanotubular and nanolayered materials include carbon nanotubes, metal oxide nanotubes, layered zeolites, porous layered oxides, layered aluminophosphates, and porous graphenes. By virtue of their unique shape, size, and structure, they possess transport properties that are advantageous for membrane and thin film applications. These materials also have very different chemistry from more conventional porous 3D materials, due to the existence of a large, chemically active, external surface area. This feature also necessitates the development of innovative strategies to process these materials into membranes and thin films with high performance. This work provides the first comprehensive review of this emerging area. We first discuss approaches for the synthesis and structural characterization of nanoporous 1D and 2D materials. Thereafter, we elucidate different approaches for fabrication of membranes and thin films from these materials, either as multiphase (composite/hybrid) or single-phase membranes. The influence of surface chemistry and processing techniques on the membrane morphology is highlighted. We then discuss the applications of such membranes in areas relating to molecular transport and separation, e.g. gas and liquid-phase separations, water purification, and ion-conducting membranes. The review concludes with a discussion of the present outlook and some of the key scientific challenges to be addressed on the path to industrially applicable membranes containing nanoporous 1D and 2D materials. © 2013 Elsevier Ltd.

  20. Secretion of IFN-γ but Not IL-17 by CD1d-Restricted NKT Cells Enhances Rejection of Skin Grafts Expressing Epithelial Cell-Derived Antigen

    Mattarollo, Stephen R; Yong, Michelle; Tan, Lieven; Frazer, Ian H; Leggatt, Graham R

    2010-01-01

    NKT cells are key regulators of autoimmunity, tumor immune surveillance, and the immune response to pathogens. The role of NKT cells in regulating adaptive immunity to cutaneous Ags is largely unknown. This study explores the role of CD1d-restricted NKT cells in cross-priming of CD8 effector T cells to OVA expressed in epithelial keratinocytes (K5mOVA transgenic mouse). In a skin grafting model, we show that NKT cells enhance the rejection of K5mOVA skin grafts by promoting generation of OVA-...

  1. TCTEX1D2 mutations underlie Jeune asphyxiating thoracic dystrophy with impaired retrograde intraflagellar transport

    Schmidts, M.; Hou, Y.; Cortés, CR; Mans, DA; HUBER, C; Boldt, K.; Patel, M.; Van Reeuwijk, J; Plaza, JM; Van Beersum, SEC; Yap, ZM; Letteboer, SJF; Taylor, SP; Herridge, W.; Johnson, CA

    2015-01-01

    ARTICLE Received 1 Oct 2014 | Accepted 31 Mar 2015 | Published 5 June 2015 TCTEX1D2 mutations underlie Jeune asphyxiating thoracic dystrophy with impaired retrograde intraflagellar transport Miriam Schmidts1,2,3,4,*, Yuqing Hou5,*, Claudio R. Corte´s6, Dorus A. Mans2,3, Celine Huber7, Karsten Boldt8, Mitali Patel1, Jeroen van Reeuwijk2,3, Jean-Marc Plaza9, Sylvia E.C. van Beersum2,3, Zhi Min Yap1, Stef J.F. Letteboer2,3, S Paige Taylor10, Warren Herridge11, Colin A. Johns...

  2. Hair on non-extremal D1-D5 bound states

    Roy, Pratik; Virmani, Amitabh

    2016-01-01

    We consider a truncation of type IIB supergravity on four-torus where in addition to the Ramond-Ramond 2-form field, the Ramond-Ramond axion (w) and the NS-NS 2-form field (B) are also retained. In the (w, B) sector we construct a linearised perturbation carrying only left moving momentum on two-charge non-extremal D1-D5 geometries of Jejjala, Madden, Ross and Titchener. The perturbation is found to be smooth everywhere and normalizable. It is constructed by matching to leading order solutions of the perturbation equations in the inner and outer regions of the geometry.

  3. Design for manufacturability from 1D to 4D for 90-22 nm technology nodes

    Balasinski, Artur

    2013-01-01

    This book explains integrated circuit design for manufacturability (DfM) at the product level (packaging, applications) and applies engineering DfM principles to the latest standards of product development at 22 nm technology nodes.  It is a valuable guide for layout designers, packaging engineers and quality engineers, covering DfM development from 1D to 4D, involving IC design flow setup, best practices, links to manufacturing and product definition, for process technologies down to 22 nm node, and product families including memories, logic, system-on-chip and system-in-package.

  4. Synthesis, Characterization, and Application of 1-D Cerium Oxide Nanomaterials: A Review

    Kuen-Song Lin

    2010-09-01

    Full Text Available The present work provides a comprehensive overview of the recent progress of research work toward developing new one dimensional (1-D ceria (CeO2 nanomaterials. The review has been classified into three parts: the preparation procedures with identification of the existing different dimensional ceria nanomaterials, the formation mechanisms, and an analysis of their applications. From literature survey, it is inaugurated that the fundamental structures of the ceria nanomaterials constructively dominate their properties and applications. In addition, this work will also provide a perspective on the future technical trends for the development of different dimensional CeO2 nanomaterials.

  5. Numerical Simulation of Carbon Nanotubes/GaAs Hybrid PV Devices with AMPS-1D

    Georgi Xosrovashvili

    2014-01-01

    Full Text Available The performance and characteristics of a hybrid heterojunction single-walled carbon nanotube and GaAs solar cell are modelled and numerically simulated using AMPS-1D device simulation tool. The device physics and performance with different junction parameters are analysed. The results suggest that the open-circuit voltage changes very slightly by changing the electron affinity, acceptor and donor density while the other electrical parameters reach an optimum value. Increasing the concentration of a discrete defect density in the absorber layer decreases the electrical parameters. The current-voltage characteristics, quantum efficiency, band gap, and thickness variation of the photovoltaic response will be quantitatively considered.

  6. Investigation of associations between NR1D1, RORA and RORB genes and bipolar disorder.

    Yin-Chieh Lai

    Full Text Available Several genes that are involved in the regulation of circadian rhythms are implicated in the susceptibility to bipolar disorder (BD. The current study aimed to investigate the relationships between genetic variants in NR1D1 RORA, and RORB genes and BD in the Han Chinese population. We conducted a case-control genetic association study with two samples of BD patients and healthy controls. Sample I consisted of 280 BD patients and 200 controls. Sample II consisted of 448 BD patients and 1770 healthy controls. 27 single nucleotide polymorphisms in the NR1D1, RORA, and RORB genes were genotyped using GoldenGate VeraCode assays in sample I, and 492 markers in the three genes were genotyped using Affymetrix Genome-Wide CHB Array in sample II. Single marker and gene-based association analyses were performed using PLINK. A combined p-value for the joining effects of all markers within a gene was calculated using the rank truncated product method. Multifactor dimensionality reduction (MDR method was also applied to test gene-gene interactions in sample I. All markers were in Hardy-Weinberg equilibrium (P>0.001. In sample I, the associations with BD were observed for rs4774388 in RORA (OR = 1.53, empirical p-value, P = 0.024, and rs1327836 in RORB (OR = 1.75, P = 0.003. In Sample II, there were 45 SNPs showed associations with BD, and the most significant marker in RORA was rs11639084 (OR = 0.69, P = 0.002, and in RORB was rs17611535 (OR = 3.15, P = 0.027. A combined p-value of 1.6×10-6, 0.7, and 1.0 was obtained for RORA, RORB and NR1D1, respectively, indicting a strong association for RORA with the risk of developing BD. A four way interaction was found among markers in NR1D1, RORA, and RORB with the testing accuracy 53.25% and a cross-validation consistency of 8 out of 10. In sample II, 45 markers had empirical p-values less than 0.05. The most significant markers in RORA and RORB genes were rs11639084 (OR = 0.69, P = 0.002, and rs17611535 (OR = 3

  7. Simulation of Tunnel Junction in Cascade Solar Cell (GaAs/Ge Using AMPS-1D

    Benmoussa Dennai

    2014-11-01

    Full Text Available The development of the tunnel junction interconnect was key the first two-terminal monolithic, multi-junction solar cell development. This paper describes simulation for the tunnel junction (GaAs between top cell (GaAs and bottom cell (Ge. This solar cell cascade was simulated when using one dimensional simulation program called analysis of microelectronic and photonic structures (AMPS-1D. In the simulation, the thickness of the tunnel junction layer was varied from 10 to 50 nm. By varying thickness of tunnel junction layer the simulated device performance was demonstrate in the form of current-voltage(I-V characteristics and quantum efficiency (QE.

  8. Peculiarities of propagation of acoustic excitations through an imperfect 1D-superlattice

    Rumyantsev, V.V.; Fedorov, S.A. [Galkin Institute for Physics and Engineering of National Academy of Sciences of Ukraine, 83114 Donetsk (Ukraine); Gumennyk, K.V., E-mail: gumennyk@depm.fti.ac.donetsk.ua [Galkin Institute for Physics and Engineering of National Academy of Sciences of Ukraine, 83114 Donetsk (Ukraine)

    2012-09-15

    Virtual crystal approximation is adapted to address peculiarities of propagation of acoustic waves through a 1D 'sandwich' superstructure consisting of alternating layers of two types randomly substituted by foreign layers of the third type. Same-parity layers are of the same width and constitute a sublattice. Dependence of the lowest forbidden acoustic zone width of the described structure on concentrations of impurity layers in the two sublattices is numerically evaluated for longitudinal and transverse excitations. Values of substitute concentrations making the structure completely transparent prove to be independent of the relative widths of the 1st and 2nd type layers.

  9. Thermal impedance at the interface of contacting bodies: 1-D examples solved by semi-derivatives

    Hristov Jordan

    2012-01-01

    Full Text Available Simple 1-D semi-infinite heat conduction problems enable to demonstrate the potential of the fractional calculus in determination of transient thermal impedances of two bodies with different initial temperatures contacting at the interface ( x = 0 at t = 0 . The approach is purely analytic and uses only semi-derivatives (half-time and semi-integrals in the Riemann-Liouville sense. The example solved clearly reveals that the fractional calculus is more effective in calculation the thermal resistances than the entire domain solutions.

  10. Momentum-carrying waves on D1-D5 microstate geometries

    Mathur, Samir D

    2012-01-01

    If one attempts to add momentum-carrying waves to a black string then the solution develops a singularity at the horizon; this is a manifestation of the 'no hair theorem' for black objects. However individual microstates of a black string do not have a horizon, and so the above theorem does not apply. We construct a perturbation that adds momentum to a family of microstates of the extremal D1-D5 string. This perturbation is analogous to the 'singleton' mode localized at the boundary of AdS; to leading order it is pure gauge in the AdS interior of the geometry.

  11. Momentum-carrying waves on D1-D5 microstate geometries

    Mathur, Samir D., E-mail: mathur@mps.ohio-state.edu [Department of Physics, Ohio State University, Columbus, OH 43210 (United States); Turton, David, E-mail: turton.7@osu.edu [Department of Physics, Ohio State University, Columbus, OH 43210 (United States)

    2012-09-21

    If one attempts to add momentum-carrying waves to a black string then the solution develops a singularity at the horizon; this is a manifestation of the 'no hair theorem' for black objects. However individual microstates of a black string do not have a horizon, and so the above theorem does not apply. We construct a perturbation that adds momentum to a family of microstates of the extremal D1-D5 string. This perturbation is analogous to the 'singleton' mode localized at the boundary of AdS; to leading order it is pure gauge in the AdS interior of the geometry.

  12. Analysis on characteristics of 1-D apodized and chirped photonic crystals containing negative refractive materials

    TONG Kai; CUI Wei-wei; XU Xiao-hui; LI Zhi-quan

    2008-01-01

    Using transfer matrix method, the optical transmission properties of 1-D photonic crystals composed partially of negativerefraction media are analyzed. The transmission spectra of periodic photonic crystal, chirped photonic crystal and apodizedphotonic crystal are numerically simulated respectively. By contrast with optical transmission properties of ordinary photo-nic crystals made of positive refraction media, the transmission spectra of apodized photonic crystal become unregular, theBragg flat-headed area recurs but the peak of transmission does not change significantly. Futhermore, the band gap rangeof chirped photonic crystal diminishes gradually.

  13. Maximizing 1D “like” implosion performance for inertial confinement fusion science

    Kline, John L. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-07-15

    While the march towards achieving indirectly driven inertial confinement fusion at the NIF has made great progress, the experiments show that multi-dimensional effects still dominate the implosion performance. Low mode implosion symmetry and hydrodynamic instabilities seed by capsule mounting features appear to be two key limiting factors for implosion performance. One reason these factors have a large impact on the performance of ICF implosions is the high convergence required to achieve high fusion gains. To tackle these problems, a predictable implosion platform is needed meaning experiments must trade-off high gain for performance. To this end, LANL has adopted three main approaches to develop a 1D implosion platform where 1D means high yield over 1D clean calculations. Taking advantage of the properties of beryllium capsules, a high adiabat, low convergence platform is being developed. The higher drive efficiency for beryllium enables larger case-to-capsule ratios to improve symmetry at the expense of drive. Smaller capsules with a high adiabat drive are expected to reduce the convergence and thus increase predictability. The second approach is liquid fuel layers using wetted foam targets. With liquid fuel layers, the initial mass in the hot spot can be controlled via the target fielding temperature which changes the liquid vapor pressure. Varying the initial hot spot mass via the vapor pressure controls the implosion convergence and minimizes the need to vaporize the dense fuel layer during the implosion to achieve ignition relevant hot spot densities. The last method is double shell targets. Unlike hot spot ignition, double shells ignite volumetrically. The inner shell houses the DT fuel and the convergence of this cavity is relatively small compared to hot spot ignition. Radiation trapping and the longer confinement times relax the conditions required to ignite the fuel. Key challenges for double shell targets are coupling the momentum of the outer shell to

  14. Adiabatic evolution of 1D shape resonances: an artificial interface conditions approach

    Faraj, Ali; Nier, Francis

    2010-01-01

    Artificial interface conditions parametrized by a complex number $\\theta_{0}$ are introduced for 1D-Schr{\\"o}dinger operators. When this complex parameter equals the parameter $\\theta\\in i\\R$ of the complex deformation which unveils the shape resonances, the Hamiltonian becomes dissipative. This makes possible an adiabatic theory for the time evolution of resonant states for arbitrarily large time scales. The effect of the artificial interface conditions on the important stationary quantities involved in quantum transport models is also checked to be as small as wanted, in the polynomial scale $(h^N)_{N\\in \\N}$ as $h\\to 0$, according to $\\theta_{0}$.

  15. Analytical solution to the Riemann problem of 1D elastodynamics with general constitutive laws

    Berjamin, H; Chiavassa, G; Favrie, N

    2016-01-01

    Under the hypothesis of small deformations, the equations of 1D elastodynamics write as a 2 x 2 hyperbolic system of conservation laws. Here, we study the Riemann problem for convex and nonconvex constitutive laws. In the convex case, the solution can include shock waves or rarefaction waves. In the nonconvex case, compound waves must also be considered. In both convex and nonconvex cases, a new existence criterion for the initial velocity jump is obtained. Also, admissibility regions are determined. Lastly, analytical solutions are completely detailed for various constitutive laws (hyperbola, tanh and polynomial), and reference test cases are proposed.

  16. Complex-Temperature Phase Diagrams of 1D Spin Models with Next-Nearest-Neighbor Couplings

    1997-01-01

    We study the dependence of complex-temperature phase diagrams on details of the Hamiltonian, focusing on the effect of non-nearest-neighbor spin-spin couplings. For this purpose, we consider a simple exactly solvable model, the 1D Ising model with nearest-neighbor (NN) and next-to-nearest-neighbor (NNN) couplings. We work out the exact phase diagrams for various values of $J_{nnn}/J_{nn}$ and compare these with the case of pure nearest-neighbor (NN) couplings. We also give some similar result...

  17. Combined Excitatory and Inhibitory Coupling in a 1-D Array of Belousov-Zhabotinsky Droplets

    2014-01-01

    the maximum concentration of ClO2 in the droplets as B50 mM. To observe the concentration of ClO2 in the microfluidic drops, we place a 400 nm...surably rapid. In the 30 seconds that it takes to load the capillary with droplets , remove it from the microfluidic chip and place it in the microscope for...Combined excitatory and inhibitory coupling in a 1-D array of Belousov–Zhabotinsky droplets Ning Li,†a Jorge Delgado,†bc Hector O. González-Ochoa,ad

  18. Comparison between the 1D deconvolution and the ETM scatter correction techniques in PET

    Trebossen, R.; Bendrien, B.; Frouin, V. [CEA-Service Hospitalier F. Joliot, Orsay (France)] [and others

    1994-05-01

    Scatter corrections usually degrade the Signal-to-Noise Ratio (SNR) while they improve image quantification. Dual energy corrections provide scatter corrected images with a poor SNR due to the use of two sinograms having low statistics. We have evaluated the SNR on 20 cm uniform cylinder images, acquired on an ECAT 953B/31 with septa in the field-of-view, corrected for scatter using the 1D deconvolution method and an energy based correction developed at Orsay. The latter, referenced as the Estimation of True Method, uses a High Energy Window (HEW) with 550 and 850 keV settings to estimate the true component registered in the Classical Energy Window (CEW) with 250 and 850 keV settings. A sinogram of scattered events is formed from this noisy estimate of the trues. It is filtered and then subtracted from the CEW sinogram to provide a scatter free sinogram. Nine Regions of Interest (ROI) of 18mm diameter have been drawn on a 110 mm diameter circle and reported on 11 direct slices (96 million events each in the CEW and 8 million in the HEW). The SNR has been defined as the ratio of the mean over the standard deviation of all ROI values. With the 1D deconvolution the SNR is 38.0, close to that obtained without scatter correction (39.1) It is lower with the ETM depending on the filter used: with a rectangular window of 9 bins by 15 angles it is 29;.8 (26.9 with a 5 by 5 window) while with a 2D Gaussian filter (7 bins by 13 angles variances) it is 30.8. This value is higher than 22.1 measured on the HEW image. The ETM with adequate filtering allows scatter correction with a SNR acceptable compared with that measured with the 1D deconvolution. Yet the ETM has a clear advantage over the 1D deconvolution in case of asymetrical source distributions in non homogeneous media and in case of off-plane scattering as has been tested on various phantom measurements.

  19. Partial Internal Control Recovery on 1-D Klein-Gordon Systems

    Iwan Pranoto

    2010-03-01

    Full Text Available In this exposition, a technique to recover internal control on a distributed parameter system is reported. The system is described by 1-D Klein-Gordon partial differential equation with a time-varying parameter. We would like to recover the internal control applied to the system if we know some limited information about the output. We use a method called sentinel method to recover the internal control. It involves some construction of a linear functional, and we show that this construction relates closely to the exact controllability problem.

  20. Simulations of Edge Effect in 1D Spin Crossover Compounds by Atom-Phonon Coupling Model

    Linares, J.; Chiruta, D.; Jureschi, C. M.; Alayli, Y.; Turcu, C. O.; Dahoo, P. R.

    2016-08-01

    We used the atom-phonon coupling model to explain and illustrate the behaviour of a linear nano-chain of molecules. The analysis of the system's behaviour was performed using Free Energy method, and by applying Monte Carlo Metropolis (MCM) method which take into account the phonon contribution. In particular we tested both the MCM algorithm and the dynamic-matrix method and we expose how the thermal behaviour of a 1D spin crossover system varies as a function of different factors. Furthermore we blocked the edge atoms of the chain in its high spin state to study the effect on the system's behaviour.

  1. Hair on non-extremal D1-D5 bound states

    Roy, Pratik; Srivastava, Yogesh K.; Virmani, Amitabh

    2016-09-01

    We consider a truncation of type IIB supergravity on four-torus where in addition to the Ramond-Ramond 2-form field, the Ramond-Ramond axion ( w) and the NS-NS 2-form field ( B) are also retained. In the ( w, B) sector we construct a linearised perturbation carrying only left moving momentum on two-charge non-extremal D1-D5 geometries of Jejjala, Madden, Ross and Titchener. The perturbation is found to be smooth everywhere and normalisable. It is constructed by matching to leading order solutions of the perturbation equations in the inner and outer regions of the geometry.

  2. Pharmacological evidence that 5-HT1D activation induces renal vasodilation by NO pathway in rats.

    García-Pedraza, José-Ángel; García, Mónica; Martín, María-Luisa; Morán, Asunción

    2015-06-01

    5-HT is a powerful vasoconstrictor substance in renal vasculature (mainly by 5-HT₂ activation). Nevertheless, 5-HT is notable for its dual cardiovascular effects, producing both vasodilator and vasoconstrictor actions. This study aimed to investigate whether, behind the predominant serotonergic vasoconstrictor action, THE 5-HT system may exert renal vasodilator actions, and, if so, characterize the 5-HT receptors and possible indirect pathways. Renal perfusion pressure (PP), systemic blood pressure (SBP) and heart rate (HR) measurement in in situ autoperfused rat kidney was determined in phenylephrine infused rats. Intra arterial (i.a.) bolus administration of 5-HT (0.00000125-0.1 μg/kg) decreased renal PP in the presence of a phenylephrine continuous infusion (phenylephrine-infusion group), without modifying SBP or HR. These vasodilator responses were potentiated by 5-HT₂ antagonism (ritanserin, 1 mg/kg i.v.), whereas the responses were abolished by 5-HT₁ /₇ antagonist (methiothepin, 100 μg/kg i.v.) or 5-HT1D antagonist (LY310762, 1 mg/kg i.v.). The i.a. administration (0.00000125 to 0.1 μg/kg) of 5-CT or L-694,247 (5-HT1D agonist) mimicked 5-HT vasodilator effect, while other agonists (1-PBG, α-methyl-5-HT, AS-19 (5-HT₇), 8-OH-DPAT (5-HT1A) or CGS-12066B (5-HT1B)) did not alter baseline haemodynamic variables. L-694,247 vasodilation was abolished by i.v. bolus of antagonists LY310762 (5-HT1D, 1 mg/kg) or L-NAME (nitric oxide, 10 mg/kg), but not by i.v. bolus of indomethacin (cyclooxygenase, 2 mg/kg) or glibenclamide (ATP-dependent K(+) channel, 20 mg/kg). These outcomes suggest that 5-HT1D activation produces a vasodilator effect in the in situ autoperfused kidney of phenylephrine-infusion rats mediated by the NO pathway.

  3. Results and limits in the 1-D analytical modeling for the asymmetric DG SOI MOSFET

    O. Cobianu; M. Glesner

    2008-01-01

    This paper presents the results and the limits of 1-D analytical modeling of electrostatic potential in the low-doped p type silicon body of the asymmetric n-channel DG SOI MOSFET, where the contribution to the asymmetry comes only from p- and n-type doping of polysilicon used as the gate electrodes. Solving Poisson's equation with boundary conditions based on the continuity of normal electrical displacement at interfaces and the presence of a minimum electrostatic potential by using the...

  4. Variational Formulation of 1-D Unsteady Compressible Flow in a Deforming Tube

    Gaolian Liu; Yi Tao; Yingxue Liu

    2003-01-01

    The variational principles for 1-D unsteady compressible flow in a deforming tube derived in a previous paper are improved essentially by reconstructing the initial/final-integral terms according to a new method suggested in a recent paper. As a result, the inherent shortcoming of variational principles of being unable to admit physically rational initial/final-value conditions in initial/boundary-value problems is successfully eliminated. Thus, a new theoretical basis for the time-space finite-element analysis is provided.

  5. Anion-dependent construction of a series of fluorescent coordination polymers based on 1D zinc∩4,4‧-bis(imidazol-1-yl)-biphenyl substrates

    Zou, Kang-Yu; Zou, Qian; Han, Tong; Liu, Yi-Chen; Wang, Jun-Jie; Zhang, Xue; Li, Zuo-Xi

    2016-03-01

    In this work, the rod-like ligand 4,4‧-bis(imidazol-1-yl)-biphenyl (bibp) has been utilized as a building block to carry out counterion effects on the structural diversities of coordination polymers. A series of new zinc complexes, [Zn(trans-bibp)Cl2]∞ (1), [Zn(trans-bibp)Br2]∞ (2), {[Zn(cis-bibp)(Ac)2]·(H2O)}∞ (3), [Zn(trans-bibp)SO4]∞ (4), {[Zn2(cis-bibp)2(ipa)2]·(H2O)}∞ (5, H2ipa=isophthalic acid) and {[Zn(trans-bibp)(cis-bibp)]·(ClO4)2(CHCl3)2(CH3OH)}∞ (6) have been successfully synthesized. Complexes 1 and 2 are iso-structural, which show a 1D W-type chain [Zn(trans-bibp)]∞. Complex 3 exhibits a 2D wave-like layer formed by the hydrogen bond among the 1D linear chain [Zn(cis-bibp)]∞. Complex 4 displays a 2D fish-bone lattice, which is generated from connecting the 1D W-type chain [Zn(trans-bibp)]∞ by the μ2-SO42- . Complex 5 presents an interesting 2D-3D 65·8 architecture, including two 1D chains [Zn(ipa)]∞ and [Zn(cis-bibp)]∞. Complex 6 demonstrates a 2D wave-like layer [Zn(trans-bibp)(cis-bibp)]∞. The structural diversities among 1-6 have been carefully discussed, and the role of counterion in the self-assembly of coordination polymer have also been well documented from the coordination affinity and bridging mode. Furthermore, the solid-state fluorescence properties of 1-6 at room temperature have been studied.

  6. Potential role of TBC1D4 in enhanced post-exercise insulin action in human skeletal muscle

    Treebak, Jonas Thue; Frøsig, Christian; Pehmøller, Christian

    2009-01-01

    insulin stimulation. CONCLUSION/INTERPRETATION: We provide evidence for site-specific phosphorylation of TBC1D4 in human skeletal muscle in response to physiological hyperinsulinaemia. The data support the idea that TBC1D4 is a nexus for insulin- and exercise-responsive signals that may mediate increased...... insulin action after exercise....

  7. Optimization of quasi-normal eigenvalues for 1-D wave equations in inhomogeneous media; description of optimal structures

    Karabash, Illya M

    2011-01-01

    The paper is devoted to optimization of quasi-normal eigenvalues of a spectral problem associated with a 1-D wave equation in an inhomogeneous medium. The wave equation is equipped with a radiation boundary condition, and so the set of quasi-normal eigenvalues lies in $\\C_+$. The problem is to design for a given $\\alpha \\in \\R$ the structure of the inhomogeneous medium such that it generates a quasi-normal eigenvalue on the line $\\alpha + \\i \\R$ with a minimal possible imaginary part. We consider the problem for three admissible families of structures. Two of these families have a natural mechanical interpretation as classes of Krein strings with total mass and static moment constraints. For these two classes we find optimal quasi-normal eigenvalues explicitly. The third class of admissible structures is connected with the problem of optimal design for photonic crystals. For this class, the paper gives a wider statement of the optimization problem, proves existence of optimal structures, and study their prope...

  8. A 2D/1D coupling neutron transport method based on the matrix MOC and NEM methods

    Zhang, H.; Zheng, Y.; Wu, H.; Cao, L. [School of Nuclear Science and Technology, Xi' an Jiaotong University, No. 28, Xianning West Road, Xi' an, Shaanxi 710049 (China)

    2013-07-01

    A new 2D/1D coupling method based on the matrix MOC method (MMOC) and nodal expansion method (NEM) is proposed for solving the three-dimensional heterogeneous neutron transport problem. The MMOC method, used for radial two-dimensional calculation, constructs a response matrix between source and flux with only one sweep and then solves the linear system by using the restarted GMRES algorithm instead of the traditional trajectory sweeping process during within-group iteration for angular flux update. Long characteristics are generated by using the customization of commercial software AutoCAD. A one-dimensional diffusion calculation is carried out in the axial direction by employing the NEM method. The 2D and ID solutions are coupled through the transverse leakage items. The 3D CMFD method is used to ensure the global neutron balance and adjust the different convergence properties of the radial and axial solvers. A computational code is developed based on these theories. Two benchmarks are calculated to verify the coupling method and the code. It is observed that the corresponding numerical results agree well with references, which indicates that the new method is capable of solving the 3D heterogeneous neutron transport problem directly. (authors)

  9. A study of optical reflectance and localization modes of 1-D Fibonacci photonic quasicrystals using different graded dielectric materials

    Singh, Bipin K.; Pandey, Praveen C.

    2014-06-01

    In this paper, we present an analytical study on the reflection properties of light through one-dimensional (1-D) quasi-periodic multilayer structures. The considered structures are as follows: F7, F8, F9, (F2)10, (F3)10 and some combinations such as: [(F2)10 (F7) (F2)10], [(F2)10 (F8) (F2)10], [(F3)10 (F7) (F3)10], [(F3)10 (F8) (F3)10], [(F2)10(F3)10], [(F2)10 (F7) (F3)10] and [(F2)10 (F8) (F3)10], where (Fj)n represents n period of the Fibonacci sequence of jth generation. These multilayer structures are considered of two types of layers. One type of layer is considered of graded material like normal, linear or exponential graded material, and the second type of layer is considered of constant refractive index material. Transfer matrix method is utilized to calculate the reflection spectra and localization modes of such structures in the frequency range 150-450 THz. This work would provide the basis of understanding of the effect of graded materials on the reflection and localization modes in Fibonacci photonic quasicrystal structures and obtained spectra can be used in the recognition of grading of materials. The considered heterostructures provide the broad reflection band and some localization modes in the calculated region.

  10. Identification of regions critical for the integrity of the TSC1-TSC2-TBC1D7 complex.

    Arthur Jorge Santiago Lima

    Full Text Available The TSC1-TSC2-TBC1D7 complex is an important negative regulator of the mechanistic target of rapamycin complex 1 that controls cell growth in response to environmental cues. Inactivating TSC1 and TSC2 mutations cause tuberous sclerosis complex (TSC, an autosomal dominant disorder characterised by the occurrence of benign tumours in various organs and tissues, notably the brain, skin and kidneys. TBC1D7 mutations have not been reported in TSC patients but homozygous inactivation of TBC1D7 causes megaencephaly and intellectual disability. Here, using an exon-specific deletion strategy, we demonstrate that some regions of TSC1 are not necessary for the core function of the TSC1-TSC2 complex. Furthermore, we show that the TBC1D7 binding site is encoded by TSC1 exon 22 and identify amino acid residues involved in the TSC1-TBC1D7 interaction.

  11. Performance studies on high pressure 1-D position sensitive neutron detectors

    S S Desai; A M Shaikh

    2008-11-01

    The powder diffractometer and Hi-Q diffractometer at Dhruva reactor make use of five identical 1-D position sensitive detectors (PSDs) to scan scattering angles in the range 3° to 140°. In order to improve the overall throughput of these spectrometers, it is planned to install a bank of 15 high-efficiency and high-resolution PSDs arranged in three layers with five PSDs in each layer. With each high pressure PSD (3He 10 bar + Kr 2 bar) showing the efficiency gain of 1.8 at 1.2 Å, detector bank is expected to show overall gain of 5.5 times the present detection efficiency and reduction in data collection time by equivalent factor. The 1-D PSDs are developed in batches of five, and are characterized so that all PSDs operate at uniform parameters such as position resolution, uniformity of efficiency and linearity of response. Position spectrum indicates the differential position resolution to be ∼ 1 mm and integral position resolution to be 3–4 mm. Broadening of position spectrum at the extreme end of sensitive length of PSD is analysed using fine shift of the beam. Dependence of position resolution and dynamic range of output pulse on the input impedance of pre-amplifier is also presented.

  12. Superdescendants of the D1D5 CFT and their dual 3-charge geometries

    Giusto, Stefano [Dipartimento di Fisica ed Astronomia “Galileo Galilei”, Università di Padova,Via Marzolo 8, 35131 Padova (Italy); I.N.F.N. Sezione di Padova,Via Marzolo 8, 35131 Padova (Italy); Russo, Rodolfo [Centre for Research in String Theory, School of Physics and Astronomy,Queen Mary University of London, Mile End Road, London, E1 4NS (United Kingdom); Laboratoire de Physique Théorique de L’Ecole Normale Supérieure,24 rue Lhomond, 75231 Paris cedex (France)

    2014-03-03

    We describe how to obtain the gravity duals of semiclassical states in the D1-D5 CFT that are superdescendants of a class of RR ground states. On the gravity side, the configurations we construct are regular and asymptotically reproduce the 3-charge D1-D5-P black hole compactified on S{sup 1}×T{sup 4}. The geometries depend trivially on the T{sup 4} directions but non-trivially on the remaining 6D space. In the decoupling limit, they reduce to asymptotically AdS{sub 3}×S{sup 3}×T{sup 4} spaces that are dual to CFT states obtained by acting with (exponentials of) the operators of the superconformal algebra. As explicit examples, we generalise the solution first constructed in arXiv:1306.1745 and discuss another class of states that have a more complicated dual geometry. By using the free orbifold description of the CFT we calculate the average values for momentum and the angular momenta of these configurations. Finally we compare the CFT results with those obtained in the bulk from the asymptotically M{sup 1,4}×S{sup 1}×T{sup 4} region.

  13. Design method for a laser line beam shaper of a general 1D angular power distribution

    Oved, E.; Oved, A.

    2016-05-01

    Laser line is a beam of laser, spanned in one direction using a beam shaper to form a fan of light. This illumination tool is important in laser aided machine vision, 3D scanners, and remote sensing. For some applications the laser line should have a specific angular power distribution. If the distribution is nonsymmetrical, the beam shaper is required to be nonsymmetrical freeform, and its design process using optical design software is time consuming due to the long optimization process which usually converges to some local minimum. In this paper we introduce a new design method of a single element refractive beam shaper of any predefined general 1D angular power distribution. The method makes use of a notion of "prism space", a geometrical representation of all double refraction prisms, and any 1D beam shaper can be described by a continuous curve in this space. It is shown that infinitely many different designs are possible for any given power distribution, and it is explained how an optimal design is selected among them, based on criteria such as high transmission, low surface slopes, robustness to manufacturing errors etc. The method is non-parametric and hence does not require initial guess of a functional form, and the resultant optical surfaces are described by a sequence of points, rather than by an analytic function.

  14. Reciprocating Compressor 1D Thermofluid Dynamic Simulation: Problems and Comparison with Experimental Data

    A. Gimelli

    2012-01-01

    Full Text Available The authors here extend a 0D-1D thermofluid dynamic simulation approach to describe the phenomena internal to the volumetric machines, reproducing pressure waves’ propagation in the ducts. This paper reports the first analysis of these phenomena in a reciprocating compressor. The first part presents a detailed experimental analysis of an open-type reciprocating compressor equipped with internal sensors. The second part describes a 0D-1D thermofluid dynamic simulation of the compressor. Comparison of computed and measured values of discharge mass flow rate shows a good agreement between results for compression ratio <5. Then, to improve the model fitting at higher pressures, a new scheme has been developed to predict the blow-by through the ring pack volumes. This model is based on a series of volumes and links which simulate the rings’ motions inside the grooves, while the ring dynamics are imposed using data from the literature about blow-by in internal combustion engines. The validation is obtained comparing experimental and computing data of the two cylinder engine blowby. After the validation, a new comparison of mass flow rate on the compressor shows a better fitting of the curves at higher compression ratio.

  15. A Review of Swarm-Based 1D/2D Signal Processing

    Horia Mihail Teodorescu

    2012-10-01

    Full Text Available While swarming behavior, widely encountered in nature, has recently sparked numerous models and interest in domains as optimization, data clustering, and control, their application to signal processing remains sporadic. In this paper I provide a unitary treatment and a review of former results obtained in signal filtering and enhancement using swarms. General equations are presented for these procedures and stability issues are considered, with examples. The paper overviews several swarming model I introduced in previous papers and provides new evidence of the applicability of these models in signal processing. In all the models for 1D signal processing, the key idea is that the swarm hunts a prey that impersonates the filtered signal. In the 2D models, the signal (image represents the “landscape” over which the swarm moves at a distance, while the swarm interacts with the signal (landscape. I provide and discuss details of the underlying theory of the models for processing time-domain signals and images. While this paper partly follows and summarizes previous papers, it nevertheless includes supplementary theoretical and algorithmic considerations and new results for both 1D and 2D signal processing. Although following either biological models or physical models in swarm algorithms is not generally accepted for technical applications, we prefer to emphasize the analogies established by our biomimetic approach with these two groups of models.

  16. Bogoliubov coefficients for the twist operator in the D1D5 CFT

    Carson, Zaq, E-mail: carson.231@osu.edu; Mathur, Samir D., E-mail: mathur.16@osu.edu; Turton, David, E-mail: turton.7@osu.edu

    2014-12-15

    The D1D5 CFT is a holographic dual of a near-extremal black hole in string theory. The interaction in this theory involves a twist operator which joins together different copies of a free CFT. Given a large number of D1 and D5 branes, the effective length of the circle on which the CFT lives is very large. We develop a technique to study the effect of the twist operator in the limit where the wavelengths of excitations are short compared to this effective length, which we call the ‘continuum limit’. The method uses Bogoliubov coefficients to compute the effect of the twist operator in this limit. For bosonic fields, we use the method to reproduce recent results describing the effect of the twist operator when it links together CFT copies with windings M and N, producing a copy of winding M+N. We also comment on possible generalizations of our results. The methods developed here may help in understanding the twist interaction at higher orders. This in turn should provide insight into the thermalization process in the D1D5 CFT, which gives a holographic description of black hole formation.

  17. Hypocenter determination using simulated annealing, updated 1D seismic velocity model and focal mechanism analysis

    Akbar, Akhmad Fanani; Nugraha, Andri Dian; Sule, Rachmat; Juanda, Aditya Abdurrahman

    2013-09-01

    Hypocenter determination of micro-earthquakes of Mount "X-1" geothermal field has been conducted using simulated annealing and guided error search method using a 1D seismic velocity model. In order to speed up the hypocenter determination process a three-circle intersection method has been used to guide the simulated annealing and guided error search process. We used P and S arrival time's microseismic data. In the simulated annealing and guided error search processes, the minimum travel time from a source to a receiver has been calculated by employing ray tracing with shooting method. The resulting hypocenters from the above process occurred at depths of 3-4 km below mean sea level. These hypocenter distributions are correlated with previous study which was concluded that the most active microseismic area in which the site of many fractures and also vertical circulation place. Later on, resulting hypocenters location was used as input to determine 1-D seismic velocity using joint hypocenter determination method. The results of VELEST indicate show low Vp/Vs ratio value at depths of 3-4 km. Our interpretation is this anomaly may be related to a rock layer which is saturated by vapor (gas or steam). Another feature is high Vp/Vs ratio value at depths of 1-3 km that may related to a rock layer which is saturated by fluid or partial melting. We also analyze the focal mechanism of microseismic using ISOLA method to determine the source characteristic of this event.

  18. A world-line framework for 1D Topological Conformal sigma-models

    Baulieu, L; Toppan, F

    2015-01-01

    We use world-line methods for pseudo-supersymmetry to construct $sl(2|1)$-invariant actions for the $(2,2,0)$ chiral and ($1,2,1)$ real supermultiplets of the twisted $D$-module representations of the $sl(2|1)$ superalgebra. The derived one-dimensional topological conformal $\\sigma$-models are invariant under nilpotent operators. The actions are constructed for both parabolic and hyperbolic/trigonometric realizations (with extra potential terms in the latter case). The scaling dimension $\\lambda$ of the supermultiplets defines a coupling constant, $2\\lambda+1$, the free theories being recovered at $\\lambda=-\\frac{1}{2}$. We also present, generalizing previous works, the $D$-module representations of one-dimensional superconformal algebras induced by ${\\cal N}=(p,q)$ pseudo-supersymmetry acting on $(k,n,n-k)$ supermultiplets. Besides $sl(2|1)$, we obtain the superalgebras $A(1,1)$, $D(2,1;\\alpha)$, $D(3,1)$, $D(4,1)$, $A(2,1)$ from $(p,q)= (1,1), (2,2), (3,3), (4,4), (5,1)$, at given $k,n$ and critical values ...

  19. Thermodynamics of Large N Gauge Theories with Chemical Potentials in a 1/D Expansion

    Morita, Takeshi

    2010-01-01

    In order to understand thermodynamical properties of N D-branes with chemical potentials associated with R-symmetry charges, we study a one dimensional large N gauge theory (bosonic BFSS type model) as a first step. This model is obtained through a dimensional reduction of a 1+D dimensional SU(N) Yang-Mills theory and we use a 1/D expansion to investigate the phase structure. We find three phases in the \\mu-T plane. We also show that all the adjoint scalars condense at large D and obtain a mass dynamically. This dynamical mass protects our model from the usual perturbative instability of massless scalars in a non-zero chemical potential. We find that the system is at least meta-stable for arbitrary large values of the chemical potentials in D \\to \\infty limit. We also explore the existence of similar condensation in higher dimensional gauge theories in a high temperature limit. In 2 and 3 dimensions, the condensation always happens as in one dimensional case. On the other hand, if the dimension is higher than...

  20. Thermodynamics of large N gauge theories with chemical potentials in a 1/ D expansion

    Morita, Takeshi

    2010-08-01

    In order to understand thermodynamical properties of N D-branes with chemical potentials associated with R-symmetry charges, we study a one dimensional large N gauge theory (bosonic BFSS type model) as a first step. This model is obtained through a dimensional reduction of a 1 + D dimensional SU( N) Yang-Mills theory and we use a 1 /D expansion to investigate the phase structure. We find three phases in the μ - T plane. We also show that all the adjoint scalars condense at large D and obtain a mass dynamically. This dynamical mass protects our model from the usual perturbative instability of massless scalars in a non-zero chemical potential. We find that the system is at least meta-stable for arbitrary large values of the chemical potentials in D → ∞ limit. We also explore the existence of similar condensation in higher dimensional gauge theories in a high temperature limit. In 2 and 3 dimensions, the condensation always happens as in one dimensional case. On the other hand, if the dimension is higher than 4, there is a critical chemical potential and the condensation happens only if the chemical potentials are below it.

  1. 1-D air-snowpack modeling of atmospheric nitrous acid at South Pole during ANTCI 2003

    Wei Liao

    2008-05-01

    Full Text Available A 1-D air-snowpack model of HONO has been developed and constrained by observed chemistry and meteorology data. The 1-D model includes molecular diffusion and mechanical dispersion, windpumping in snow, gas phase to quasi-liquid layer phase HONO transfer and quasi-liquid layer nitrate and interstitial air HONO photolysis. Photolysis of nitrate is important as a dominant HONO source inside the snowpack, however, the observed HONO emission from the snowpack was triggered mainly by the equilibrium between quasi liquid layer nitrite and firn air HONO deep down the snow surface (i.e. 30 cm below snow surface. The high concentration of HONO in the firn air is subsequently transported above the snowpack by diffusion and windpumping. The model uncertainties come mainly from lack of measurements and the interpretation of the QLL properties based on the bulk snow measurements. One critical factor is the ionic strength of QLL nitrite, which is estimated here by the bulk snow pH, nitrite concentration, and QLL to bulk snow volume ratio.

  2. 1-D Air-snowpack modeling of atmospheric nitrous acid at South Pole during ANTCI 2003

    W. Liao

    2008-12-01

    Full Text Available A 1-D air-snowpack model of HONO has been developed and constrained by observed chemistry and meteorology data. The 1-D model includes molecular diffusion and mechanical dispersion, windpumping in snow, gas phase to quasi-liquid layer phase HONO transfer and quasi-liquid layer nitrate and interstitial air HONO photolysis. Photolysis of nitrate is important as a dominant HONO source inside the snowpack, however, the observed HONO emission from the snowpack was triggered mainly by the equilibrium between quasi liquid layer nitrite and firn air HONO deep down the snow surface (i.e. 30 cm below snow surface. The high concentration of HONO in the firn air is subsequently transported above the snowpack by diffusion and windpumping. The model uncertainties come mainly from lack of measurements and the interpretation of the QLL properties based on the bulk snow measurements. One critical factor is the ionic strength of QLL nitrite, which is estimated here by the bulk snow pH, nitrite concentration, and QLL to bulk snow volume ratio.

  3. 1-D Systolic Arrays Design of LMS Adaptive (FIR Digital Filtering

    Ali H. Mahdi

    2010-01-01

    Full Text Available This paper extends the 1-D systolic array approach with a method of systematic linear design of systolic algorithms. Past methods for mapping the Least-Mean-Square (LMS Adaptive Finite-Impulse-Response (FIR filter onto parallel and pipelined architectures either introduce delays in the coefficients updates or have excessive hardware requirements. In this article, we describe an efficient 1-D systolic array for the LMS adaptive FIR filter that produces the same output and error signals as produced by the standard LMS adaptive filter architecture with single assignment form of processor functions.The proposed systolic architectures that are designed operate on a block-by-block basis and makes use of the flexibility in the design, which takes the inner product step (convolution sum of the tap weight vector and the tap input vector in the design consideration. It enables us to extract more than one algorithm for the same problem. The input and output data flow sequentially and continuously into and out of the systolic arrays at the system clock rates, during each clock period, processing element of the same type operates in parallel. The most computationally demanding among them performs only two consecutive multiplications and two additions/subtractions per clock period, thereby allowing a very high throughput and very fast block signal processing to be achieved at the expense of a delay of L samples between the input and output and 100% utilization, L being the block size.

  4. Unveiling the Role of CNTs on the Phase Formation of 1D Ferroelectrics

    Mahajan, Amit

    2015-05-21

    Carbon nanotubes (CNTs) have the potential to act as templates or bottom electrodes for three dimension (3D) capacitor arrays, which utilise one dimension (1D) ferroelectric nanostructures to increase memory size and density. However, growing a ferroelectric on the surface of CNTs is non-trivial. Here, we demonstrate that multi-walled (MW) CNTs decrease the time and temperature for formation of lead zirconium titanate Pb(Zr1-xTix)O3 (PZT) by ~100 ºC commensurate with a decrease in activation energy from 68±15 kJ/mol to 27±2 kJ/mol. As a consequence, monophasic PZT was obtained at 575 ºC for MWCNTs/PZT whereas for pure PZT traces of pyrochlore were still present at 650 ºC, where PZT phase formed due to homogeneous nucleation. The piezoelectric nature of MWCNT/PZT synthesised at 500 ºC for 1 h was proved. Although further work is required to prove the concept of 3D capacitor arrays, our result suggests that it is feasible to utilise MWCNTs as templates/electrodes for the formation of 1D PZT nano ferroelectrics.

  5. Effect of copper doping on the crystal structure and morphology of 1D nanostructured manganese oxides.

    Lee, Sun Hee; Park, Dae Hoon; Hwang, Seong-Ju; Choy, Jin-Ho

    2007-11-01

    We have tried to control the aspect ratio and physicochemical properties of 1D nanostructured manganese oxides through copper doping. Copper-doped manganese oxide nanostructures have been synthesized by one-pot hydrothermal treatment for the mixed solution of permanganate anions and copper cations. According to powder X-ray diffraction and electron microscopic analyses, all the present materials commonly crystallize with alpha-MnO2-type structure but their aspect ratio decreases significantly with increasing the content of copper. Such a variation of crystallite dimension is attributable to the limitation of crystal growth by the incorporation of copper ions. X-ray absorption spectroscopic studies at Mn K- and Cu K-edges clearly demonstrate that the average oxidation state of manganese ions is increased by the substitution of divalent copper ions. Electrochemical measurements reveal the improvement of the electrode performance of nanostructured manganate upon copper doping, which can be interpreted as a result of the decrease of aspect ratio and the increase of Mn valence state. From the present experimental findings, it becomes certain that the present Cu doping method can provide an effective way of controlling the crystal dimension and electrochemical property of 1D nanostructured manganese oxide.

  6. Simulation of hetero-junction silicon solar cells with AMPS-1D

    Hernandez-Como, Norberto; Morales-Acevedo, Arturo [Centro de Investigacion y de Estudios Avanzados del IPN, Electrical Engineering Department, Avenida IPN No. 2508, 07360 Mexico, D. F. (Mexico)

    2010-01-15

    Mono- and poly-crystalline silicon solar cell modules currently represent between 80% and 90% of the PV world market. The reasons are the stability, robustness and reliability of this kind of solar cells as compared to those of emerging technologies. Then, in the mid-term, silicon solar cells will continue playing an important role for their massive terrestrial application. One important approach is the development of silicon solar cells processed at low temperatures (less than 300 C) by depositing amorphous silicon layers with the purpose of passivating the silicon surface, and avoiding the degradation suffered by silicon when processed at temperatures above 800 C. This kind of solar cells is known as HIT cells (hetero-junction with an intrinsic thin amorphous layer) and are already produced commercially (Sanyo Ltd.), reaching efficiencies above 20%. In this work, HIT solar cells are simulated by means of AMPS-1D, which is a program developed at Pennsylvania State University. We shall discuss the modifications required by AMPS-1D for simulating this kind of structures since this program explicitly does not take into account interfaces with high interfacial density of states as occurs at amorphous-crystalline silicon hetero-junctions. (author)

  7. Interfaces Supporting Surface Gap Soliton Ground States in the 1D Nonlinear Schroedinger Equation

    Dohnal, Tomas; Plum, Michael; Reichel, Wolfgang

    2012-01-01

    We consider the problem of verifying the existence of $H^1$ ground states of the 1D nonlinear Schr\\"odinger equation for an interface of two periodic structures: $$-u" +V(x)u -\\lambda u = \\Gamma(x) |u|^{p-1}u \\ {on} \\R$$ with $V(x) = V_1(x), \\Gamma(x)=\\Gamma_1(x)$ for $x\\geq 0$ and $V(x) = V_2(x), \\Gamma(x)=\\Gamma_2(x)$ for $x1$. The article [T. Dohnal, M. Plum and W. Reichel, "Surface Gap Soliton Ground States for the Nonlinear Schr\\"odinger Equation," \\textit{Comm. Math. Phys.} \\textbf{308}, 511-542 (2011)] provides in the 1D case an existence criterion in the form of an integral inequality involving the linear potentials $V_{1},V_2$ and the Bloch waves of the operators $-\\tfrac{d^2}{dx^2}+V_{1,2}-\\lambda$. We choose here the classes of piecewise constant and piecewise linear potentials $V_{1,2}$ and check this criterion for a set of parameter values. In the piecewise constant case the Bloch waves are calculated explicitly and in the piecewise linear case verified enclosures of the Bloch waves are computed ...

  8. Quasi-1D physics in metal-organic frameworks: MIL-47(V from first principles

    Danny E. P. Vanpoucke

    2014-10-01

    Full Text Available The geometric and electronic structure of the MIL-47(V metal-organic framework (MOF is investigated by using ab initio density functional theory (DFT calculations. Special focus is placed on the relation between the spin configuration and the properties of the MOF. The ground state is found to be antiferromagnetic, with an equilibrium volume of 1554.70 Å3. The transition pressure of the pressure-induced large-pore-to-narrow-pore phase transition is calculated to be 82 MPa and 124 MPa for systems with ferromagnetic and antiferromagnetic chains, respectively. For a mixed system, the transition pressure is found to be a weighted average of the ferromagnetic and antiferromagnetic transition pressures. Mapping DFT energies onto a simple-spin Hamiltonian shows both the intra- and inter-chain coupling to be antiferromagnetic, with the latter coupling constant being two orders of magnitude smaller than the former, suggesting the MIL-47(V to present quasi-1D behavior. The electronic structure of the different spin configurations is investigated and it shows that the band gap position varies strongly with the spin configuration. The valence and conduction bands show a clear V d-character. In addition, these bands are flat in directions orthogonal to VO6 chains, while showing dispersion along the the direction of the VO6 chains, similar as for other quasi-1D materials.

  9. CD1d expression and invariant NKT cell responses in herpesvirus infections

    Rusung eTan

    2015-06-01

    Full Text Available Invariant natural killer T (iNKT cells are a highly conserved subset of unconventional T lymphocytes that express a canonical, semi-invariant T cell receptor (TCR and surface markers shared with the natural killer cell lineage. iNKT cells recognize exogenous and endogenous glycolipid antigens restricted by non-polymorphic CD1d molecules, and are highly responsive to the prototypical agonist, α-galactosylceramide. Upon activation, iNKT cells rapidly coordinate signaling between innate and adaptive immune cells through the secretion of proinflammatory cytokines, leading to the maturation of antigen-presenting cells and expansion of antigen-specific CD4+ and CD8+ T cells. Because of their potent immunoregulatory properties, iNKT cells have been extensively studied and are known to play a pivotal role in mediating immune responses against microbial pathogens including viruses. Here, we review evidence that herpesviruses manipulate CD1d expression to escape iNKT cell surveillance and establish lifelong latency in humans. Collectively, published findings suggest that iNKT cells play critical roles in anti-herpesvirus immune responses and could be harnessed therapeutically to limit viral infection and viral-associated disease.

  10. Statistical investigation and thermal properties for a 1-D impact system with dissipation

    Díaz I, Gabriel, E-mail: gabriel.diaz.iturry@gmail.com; Livorati, André L.P., E-mail: livorati@rc.unesp.br; Leonel, Edson D., E-mail: edleonel@rc.unesp.br

    2016-05-06

    Highlights: • The dynamics of a 1-D dissipative impact system is studied. • Statistical properties for the average velocity, root mean square velocity and its deviation are characterized. • A thermodynamics formalism is developed as function of the statistical variable. • The formalism shows itself to be robust, and we can predict numerical values without doing numerical simulations. - Abstract: The behavior of the average velocity, its deviation and average squared velocity are characterized using three techniques for a 1-D dissipative impact system. The system – a particle, or an ensemble of non-interacting particles, moving in a constant gravitation field and colliding with a varying platform – is described by a nonlinear mapping. The average squared velocity allows to describe the temperature for an ensemble of particles as a function of the parameters using: (i) straightforward numerical simulations; (ii) analytically from the dynamical equations; (iii) using the probability distribution function. Comparing analytical and numerical results for the three techniques, one can check the robustness of the developed formalism, where we are able to estimate numerical values for the statistical variables, without doing extensive numerical simulations. Also, extension to other dynamical systems is immediate, including time dependent billiards.

  11. Eighth-Order Compact Finite Difference Scheme for 1D Heat Conduction Equation

    Asma Yosaf

    2016-01-01

    Full Text Available The purpose of this paper is to develop a high-order compact finite difference method for solving one-dimensional (1D heat conduction equation with Dirichlet and Neumann boundary conditions, respectively. A parameter is used for the direct implementation of Dirichlet and Neumann boundary conditions. The introduced parameter adjusts the position of the neighboring nodes very next to the boundary. In the case of Dirichlet boundary condition, we developed eighth-order compact finite difference method for the entire domain and fourth-order accurate proposal is presented for the Neumann boundary conditions. In the case of Dirichlet boundary conditions, the introduced parameter behaves like a free parameter and could take any value from its defined domain but for the Neumann boundary condition we obtained a particular value of the parameter. In both proposed compact finite difference methods, the order of accuracy is the same for all nodes. The time discretization is performed by using Crank-Nicholson finite difference method. The unconditional convergence of the proposed methods is presented. Finally, a set of 1D heat conduction equations is solved to show the validity and accuracy of our proposed methods.

  12. Developing a 1D ``like'' performance basecamp for beryllium capsule implosions

    Kline, John; Yi, Austin; Loomis, Eric; Simakov, Andrei; Kyrala, George; Wilson, Doub; Dewald, Eddie; Ralph, Joe; Strozzi, David

    2016-10-01

    Experiments with Beryllium capsules in high density gas filled targets showed little difference in performance with respect to CH or HDC capsules. The hypothesis for the lack of performance difference is attributed to poor control of symmetry based on work by Clark et al. Going forward, the goal is to develop a target design that enables better comparisons between the performance of Be capsules and other ablators, as well as with simulations. To develop a platform in which Be capsules maximize performance with respect to 1D calculations, we have increased the case-to-capsule ratio and reduced the hohlraum drive. The stability properties of beryllium are expected to be accentuated at lower radiation temperature drives compared with other ablators. Experiments have been carried out with case-to-capasule ratio of 3.1 and 4.3. Results from these experiments are being used to develop an optimized case-to-capsule ratio to achieve controllable symmetric implosions with maximum 1D like performance. This presentation will focus on how results of the experiments are used to design the next series of optimized experiments..

  13. A world-line framework for 1D topological conformal σ-models

    Baulieu, L.; Holanda, N. L.; Toppan, F.

    2015-11-01

    We use world-line methods for pseudo-supersymmetry to construct sl(2|1)-invariant actions for the (2, 2, 0) chiral and (1, 2, 1) real supermultiplets of the twisted D-module representations of the sl(2|1) superalgebra. The derived one-dimensional topological conformal σ-models are invariant under nilpotent operators. The actions are constructed for both parabolic and hyperbolic/trigonometric realizations (with extra potential terms in the latter case). The scaling dimension λ of the supermultiplets defines a coupling constant, 2λ + 1, the free theories being recovered at λ = - /1 2 . We also present, generalizing previous works, the D-module representations of one-dimensional superconformal algebras induced by N = ( p , q ) pseudo-supersymmetry acting on (k, n, n - k) supermultiplets. Besides sl(2|1), we obtain the superalgebras A(1, 1), D(2, 1; α), D(3, 1), D(4, 1), A(2, 1) from (p, q) = (1, 1), (2, 2), (3, 3), (4, 4), (5, 1), at given k, n and critical values of λ.

  14. Crystal Structures of Human TBC1D1 and TBC1D4 (AS160) RabGTPase-activating Protein (RabGAP) Domains Reveal Critical Elements for GLUT4 Translocation

    S Park; W Jin; S Shoelson

    2011-12-31

    We have solved the x-ray crystal structures of the RabGAP domains of human TBC1D1 and human TBC1D4 (AS160), at 2.2 and 3.5 {angstrom} resolution, respectively. Like the yeast Gyp1p RabGAP domain, whose structure was solved previously in complex with mouse Rab33B, the human TBC1D1 and TBC1D4 domains both have 16 {alpha}-helices and no {beta}-sheet elements. We expected the yeast Gyp1p RabGAP/mouse Rab33B structure to predict the corresponding interfaces between cognate mammalian RabGAPs and Rabs, but found that residues were poorly conserved. We further tested the relevance of this model by Ala-scanning mutagenesis, but only one of five substitutions within the inferred binding site of the TBC1D1 RabGAP significantly perturbed catalytic efficiency. In addition, substitution of TBC1D1 residues with corresponding residues from Gyp1p did not enhance catalytic efficiency. We hypothesized that biologically relevant RabGAP/Rab partners utilize additional contacts not described in the yeast Gyp1p/mouse Rab33B structure, which we predicted using our two new human TBC1D1 and TBC1D4 structures. Ala substitution of TBC1D1 Met{sup 930}, corresponding to a residue outside of the Gyp1p/Rab33B contact, substantially reduced catalytic activity. GLUT4 translocation assays confirmed the biological relevance of our findings. Substitutions with lowest RabGAP activity, including catalytically dead RK and Met{sup 930} and Leu{sup 1019} predicted to perturb Rab binding, confirmed that biological activity requires contacts between cognate RabGAPs and Rabs beyond those in the yeast Gyp1p RabGAP/mouse Rab33B structure.

  15. 1D coordination polymers with polychalcogenides as linkers between metal atoms

    Kysliak, Oleksandr; Beck, Johannes, E-mail: j.beck@uni-bonn.de

    2013-07-15

    The reactions of zinc metal with elemental selenium and selenium/sulfur mixtures in liquid ammonia or methylamine under solvothermal conditions in closed glass ampoules at 50 °C lead within some days specifically to [Zn(NH{sub 3}){sub 2}Se{sub 4}]{sub n} (1), [Zn(MeNH{sub 2}){sub 2}Se{sub 4}]{sub n} (2), [Zn(NH{sub 3}){sub 2}Se{sub 2.23}S{sub 1.77}]{sub n} (3). From MnCl{sub 2}, Rb{sub 2}Se and excess Se in n-butylamine [Mn({sup n}BuNH{sub 2}){sub 4}Se{sub 6}]{sub n} (4) is obtained after prolonged reaction time at ambient temperature. The compounds are sensitive towards air and loss of NH{sub 3} or the amine ligands. The crystal structures were determined by single crystal diffraction at low temperatures. As a common structural feature, all compounds represent 1D coordination polymers with polychalcogenide chains as linkers between the metal atoms and consist of infinite [M–Ch{sub m}–]{sub n} chains (M=Zn, Mn; Ch{sub m}=Se{sub 4}, (S/Se){sub 4}, Se{sub 6}). The Zn central atoms in 1–3 have tetrahedral coordination with two amine ligands, the Mn atoms in 4 have octahedral coordination with four amine ligands and cis position of the two Se atoms. Raman spectra of 1–3 show the stretching mode vibrations of the Ch{sub 4} groups. The observation of S–S, S–Se, and Se–Se vibration bands in the spectrum of 3 indicates the presence of mixed S/Se polyanions. An optical band gap of 1.86(5) eV was determined for 2 by diffuse reflectance spectroscopy. - Graphical abstract: The reaction of Zn and Se in liquid methylamine yields dark red [Zn(NH{sub 2}CH{sub 3})Se{sub 4}], a 1D coordination polymer consisting of helical Zn–Se{sub 4}–Zn– chains. - Highlights: • A series of 1D coordination polymers consisting of metal amine complexes concatenated by polychalcogenide ions is presented. • Syntheses were performed as solvothermal reactions in liquid ammonia, liquid methylamine and n-butylamine. • Crystal structures are dominated by helices [M–Ch{sub m

  16. Higher-order local and non-local correlations for 1D strongly interacting Bose gas

    Nandani, EJKP; Römer, Rudolf A.; Tan, Shina; Guan, Xi-Wen

    2016-05-01

    The correlation function is an important quantity in the physics of ultracold quantum gases because it provides information about the quantum many-body wave function beyond the simple density profile. In this paper we first study the M-body local correlation functions, g M , of the one-dimensional (1D) strongly repulsive Bose gas within the Lieb-Liniger model using the analytical method proposed by Gangardt and Shlyapnikov (2003 Phys. Rev. Lett. 90 010401; 2003 New J. Phys. 5 79). In the strong repulsion regime the 1D Bose gas at low temperatures is equivalent to a gas of ideal particles obeying the non-mutual generalized exclusion statistics with a statistical parameter α =1-2/γ , i.e. the quasimomenta of N strongly interacting bosons map to the momenta of N free fermions via {k}i≈ α {k}iF with i=1,\\ldots ,N. Here γ is the dimensionless interaction strength within the Lieb-Liniger model. We rigorously prove that such a statistical parameter α solely determines the sub-leading order contribution to the M-body local correlation function of the gas at strong but finite interaction strengths. We explicitly calculate the correlation functions g M in terms of γ and α at zero, low, and intermediate temperatures. For M = 2 and 3 our results reproduce the known expressions for g 2 and g 3 with sub-leading terms (see for instance (Vadim et al 2006 Phys. Rev. A 73 051604(R); Kormos et al 2009 Phys. Rev. Lett. 103 210404; Wang et al 2013 Phys. Rev. A 87 043634). We also express the leading order of the short distance non-local correlation functions x}1)\\cdots {{{\\Psi }}}\\dagger ({x}M){{\\Psi }}({y}M)\\cdots {{\\Psi }}({y}1)> of the strongly repulsive Bose gas in terms of the wave function of M bosons at zero collision energy and zero total momentum. Here {{\\Psi }}(x) is the boson annihilation operator. These general formulas of the higher-order local and non-local correlation functions of the 1D Bose gas provide new insights into the many-body physics.

  17. Retinoic acid regulates CD1d gene expression at the transcriptional level in human and rodent monocytic cells.

    Chen, Qiuyan; Ross, A Catharine

    2007-04-01

    CD1d belongs to a group of nonclassical antigen-presenting molecules that present glycolipid antigens and thereby activate natural killer T (NKT) cells, a subset of bifunctional T cells. Little is known so far regarding the expression and physiologic regulation of CD1d. Here we show that all-trans-retinoic acid (RA), the active metabolite of vitamin A, rapidly (1 hr after treatment) increases CD1d mRNA in human and rodent monocytic cells at a physiologic dose (10 nM). The induction is RA specific and RA receptor (RAR) dependent-RA and an RARalpha agonist, Am580, both had a pronounced positive effect, whereas the addition of RARalpha antagonist partially blocked the increase in CD1d mRNA induced by RA and Am580. The induction was also completely blocked by the presence of actinomycin D. A putative RA-response element was identified in the distal 5' flanking region of the CD1d gene, which binds nuclear retinoid receptors and was responsive to RA in both gel mobility shift assay and transient transfection assay in THP-1 cells. These results further confirmed the transcriptional regulation of RA in CD1d gene expression. Moreover, RA significantly increased alpha-galactosylceramide-induced spleen cell proliferation. These studies together provide evidence for a previously unknown mechanism of CD1d gene expression regulation by RA and suggest that RA is a significant modulator of NKT cell activation.

  18. POLARISATION OF THE S - PHASE OF SEISMOGRAMS

    R. STONELEY

    1951-06-01

    Full Text Available In earthquakes recorded at moderate distances it lias been ohservedthat S phase appears first as SII, folloived some 10 to 14 seconds laterby SV. The object of tliis paper is to try to decide ichether doublérefraction is likely to be the explanation of tliis jìlwnomenon.A simpie model to consider ivould be a « transversely isotropie »material, symmetrical about the radiai direction. Formulae for thevelocities of SII and SV waves are available; tliese velocities dependon the angle that the ray makes ivi t li the norma!. It is unlikely thatthe Eartli could be as markedly anisotropie as the minerai beryl, whichis transversely isotropie; aceordingly, this material, of ivhich the fi veclastic constants are knoivn is taken as an extreme example, andthe velocities of SH and SV for different angles of incidence are« scaled down » so as to match the velocity of distortional ivaves ingranite. It is then possible to calcitiate the difference in the timo takenby ivaves from one point of the surface of the Earth to anotlier pointon the surface according as the S wave in the surface layer is of SHor SV type.

  19. Initial Stage of the Microwave Ionization Wave Within a 1D Model

    Semenov, V. E.; Rakova, E. I.; Glyavin, M. Yu.; Nusinovich, G. S.

    2016-05-01

    The dynamics of the microwave breakdown in a gas is simulated numerically within a simple 1D model which takes into account such processes as the impact ionization of gas molecules, the attachment of electrons to neutral molecules, and plasma diffusion. Calculations are carried out for different spatial distributions of seed electrons with account for reflection of the incident electromagnetic wave from the plasma. The results reveal considerable dependence of the ionization wave evolution on the relation between the field frequency and gas pressure, as well as on the existence of extended rarefied halo of seed electrons. At relatively low gas pressures (or high field frequencies), the breakdown process is accompanied by the stationary ionization wave moving towards the incident electromagnetic wave. In the case of a high gas pressure (or a relatively low field frequency), the peculiarities of the breakdown are associated with the formation of repetitive jumps of the ionization front.

  20. Detecting Arctic snow and ice cover with FY-1D global data

    2007-01-01

    Chinese meteorological satellite FY-1D can obtain global data from four spectral channels which include visible channel (0.58-0.68 μm) and infrared channels (0.84-0.89 μm, 10.3-11.3 μm, 11.5-12.5 μm). 2366 snow and ice samples, 2024 cloud samples, 1602 land samples and 1648 water samples were selected randomly from Arctic imageries. Land and water can be detected by spectral features. Snow-ice and cloud can be classified by textural features. The classifier is Bayes classifier. By synthesizing five d ays classifying result of Arctic snow and ice cover area, complete Arctic snow and ice cover area can be obtained. The result agrees with NOAA/NESDIS IMS products up to 70%.

  1. Fluid friction and wall viscosity of the 1D blood flow model

    Wang, Xiao-Fei; Matsukawa, Mami; Ghigo, Arthur; Lagrée, Pierre-Yves; Fullana, Jose-Maria

    2015-01-01

    We study the behavior of the pulse waves of water into a flexible tube for application to blood flow simulations. In pulse waves both fluid friction and wall viscosity are damping factors, and difficult to evaluate separately. In this paper, the coefficients of fluid friction and wall viscosity are estimated by fitting a nonlinear 1D flow model to experimental data. In the experimental setup, a distensible tube is connected to a piston pump at one end and closed at another end. The pressure and wall displacements are measured simultaneously. A good agreement between model predictions and experiments was achieved. For amplitude decrease, the effect of wall viscosity on the pulse wave has been shown as important as that of fluid viscosity.

  2. Quantum phase transition of light in a 1-D photon-hopping-controllable resonator array

    Wu, Chun-Wang; Deng, Zhi-Jiao; Dai, Hong-Yi; Chen, Ping-Xing; Li, Cheng-Zu

    2011-01-01

    We give a concrete experimental scheme for engineering the insulator-superfluid transition of light in a one-dimensional (1-D) array of coupled superconducting stripline resonators. In our proposed architecture, the on-site interaction and the photon hopping rate can be tuned independently by adjusting the transition frequencies of the charge qubits inside the resonators and at the resonator junctions, respectively, which permits us to systematically study the quantum phase transition of light in a complete parameter space. By combining the techniques of photon-number-dependent qubit transition and fast read-out of the qubit state using a separate low-Q resonator mode, the statistical property of the excitations in each resonator can be obtained with a high efficiency. An analysis of the various decoherence sources and disorders shows that our scheme can serve as a guide to coming experiments involving a small number of coupled resonators.

  3. Surface-modified Wannier-Stark states in a 1D optical lattice

    Maury, A; Gorza, M -P; Lambrecht, A; Guérout, R

    2016-01-01

    We study the energy spectrum of atoms trapped in a vertical 1D optical lattice in close proximity to a reflective surface. We propose an effective model to describe the interaction between the atoms and the surface at any distance. Our model includes the long-range Casimir-Polder potential together with a short-range Lennard-Jones potential, which are considered non-perturbatively with respect to the optical lattice potential. We find an intricate energy spectrum which contains a pair of loosely-bound states localized close to the surface in addition to a surface-modified Wannier-Stark ladder at long distances. Atomic interferometry involving those loosely-bound atom-surface states is proposed to probe the adsorption dynamics of atoms on mirrors.

  4. Facile hydrothermal route to the controlled synthesis of -Fe2O3 1-D nanostructures

    Lixia Yang; Ying Liang; Hou Chen; Lingyan Kong; Wei Jiang

    2008-12-01

    Single-crystalline -Fe2O3 1-D nanostructures can be obtained via a facile one-step hydrothermal synthetic route. It was found that the introduction of SnCl4 played a key role in determining the composition and morphology of -Fe2O3. The addition of SnCl4 favours the formation of Fe2O3 rather than FeOOH, and the morphology can be tuned from nanorod to double-shuttle as the increase of SnCl4 concentration. The products were characterized by X-ray powder diffraction (XRD), transmission electron microscopy (TEM) and selectedarea electron diffraction (SAED). This simple method does not need any seed, catalyst, or template, thus is promising for large-scale and low-cost production.

  5. Pressure Sensor via Optical Detection Based on a 1D Spin Transition Coordination Polymer

    Cătălin M. Jureschi

    2015-01-01

    Full Text Available We have investigated the suitability of using the 1D spin crossover coordination polymer [Fe(4-(2’-hydroxyethyl-1,2,4-triazole3]I2∙H2O, known to crossover around room temperature, as a pressure sensor via optical detection using various contact pressures up to 250 MPa. A dramatic persistent colour change is observed. The experimental data, obtained by calorimetric and Mössbauer measurements, have been used for a theoretical analysis, in the framework of the Ising-like model, of the thermal and pressure induced spin state switching. The pressure (P-temperature (T phase diagram calculated for this compound has been used to obtain the P-T bistability region.

  6. Wavelength modulated SERS hot spot distribution in 1D nanostructures on metal film

    Wang, Lili; Zeng, Xiping; Liu, Ting; Zhang, Xuemei; Wei, Hua; Huang, Yingzhou; Liu, Anping; Wang, Shuxia; Wen, Weijia

    2016-10-01

    Surface plasmons confining strong electromagnetic fields near metal surfaces, well-known as hot spots, provide an extremely efficient platform for surface-enhanced Raman scattering (SERS). In this work, SERS spectra of probing molecules in a silver particle-wire 1D nanostructure on a thin gold film are investigated. The Raman features of SERS spectra collected at the particle-wire joints exhibit an obvious wavelength dependence phenomenon. This result is confirmed electromagnetic field simulation, revealing that hot spot distribution is sensitively influenced by the wavelength of incident light at the joints. Further studies indicate this wavelength dependence of hot spot distribution is immune to influence from the geometric shape of the particle or the angle between wire and particle, which improves fabrication tolerance. This technology may have promising applications in surface plasmon related fields, such as ultrasensors, solar energy and selective surface catalysis.

  7. Analysis of silicon solar cell degradation in space using PC-1D

    Moreno, E.G. (IMEC, Leuven (Belgium) DEE (UPC), Barcelona (Spain)); Demesmaeker, E.; Ghannam, M.; Nijs, J. (DEE (UPC), Barcelona (Spain))

    1992-04-01

    This work presents a computation method to evaluate the life expectance of cells in space. The effects of the radiation environment are taken into account as a reduction of carrier lifetime. This reduction is calculated for each particle type as a function of the incident energy and the traveled depth inside the cell. Afterwards the calculated lifetimes are supplied to the PC-1D in order to obtain the electrical characteristics of the cell. The method allows one to calculate the equivalent damage relative to 1 MeV electrons of the different particles in the space environment. But its main feature lies in the direct calculation of the cell degradation by adding the contribution to lifetime reduction of each particle type. Results on efficiency degradation versus time in a circular orbit of 4630 km and 90deg inclination are shown for different cover glass thicknesses. (orig.).

  8. Correlations of the upper branch of 1D harmonically trapped two-component fermi gases.

    Gharashi, Seyed Ebrahim; Blume, D

    2013-07-26

    We present highly accurate energy spectra and eigenfunctions of small 1D harmonically trapped two-component Fermi gases with interspecies δ-function interactions, and analyze the correlations of the so-called upper branch (i.e., the branch that describes a repulsive Fermi gas consisting of atoms but no molecules) for positive and negative coupling constants. Changes of the two-body correlations as a function of the interspecies coupling strength reflect the competition of the interspecies interaction and the effective repulsion due to the Pauli exclusion principle, and are interpreted as a few-body analog of a transition from a nonmagnetic to a magnetic phase. Moreover, we show that the eigenstate ψadia of the infinitely strongly interacting system with |n1+n2|>2 and |n1-n2|Fermi-Fermi mapping function to the eigenfunction of the noninteracting single-component Fermi gas.

  9. Staggered grid leap-frog scheme for the (2+1)D Dirac equation

    Hammer, René

    2013-01-01

    A numerical scheme utilizing a grid which is staggered in both space and time is proposed for the numerical solution of the (2+1)D Dirac equation in presence of an external electromagnetic potential. It preserves the linear dispersion relation of the free Weyl equation for wave vectors aligned with the grid and facilitates the implementation of open (absorbing) boundary conditions via an imaginary potential term. This explicit scheme has second order accuracy in space and time. A functional for the norm is derived and shown to be conserved. Stability conditions are derived. Several numerical examples, ranging from generic to specific to textured topological insulator surfaces, demonstrate the properties of the scheme which can handle general electromagnetic potential landscapes.

  10. Statistics of scattered photons from a driven three-level emitter in 1D open space

    Roy, Dibyendu [Los Alamos National Lab. (LANL), Los Alamos, NM (United States). Theoretical Div. and Center for Nonlinear Studies; Bondyopadhaya, Nilanjan [Visva-Bharati University, Santiniketan (India). Integrated Science Education and Research Centre

    2014-01-07

    We derive the statistics of scattered photons from a Λ- or ladder-type three-level emitter (3LE) embedded in a 1D open waveguide. The weak probe photons in the waveguide are coupled to one of the two allowed transitions of the 3LE, and the other transition is driven by a control beam. This system shows electromagnetically induced transparency (EIT) which is accompanied with the Autler-Townes splitting (ATS) at a strong driving by the control beam, and some of these effects have been observed recently. We show that the nature of second-order coherence of the transmitted probe photons near two-photon resonance changes from bunching to antibunching to constant as strength of the control beam is ramped up from zero to a higher value where the ATS appears.

  11. REAL-TIME FLOOD FORECASTING MODELING OF 1D UNSTEADY CHANNEL FLOW AND KALMAN FILTER

    2001-01-01

    The model of 1D unsteady channel flow combined with the Kalmanfilter for real-time channel flood forecasting was attempted in this study. The suitable upstream and downstream boundary conditions were suggested. The system equation was given by the linearization of the finitedifference equations of the mass conservation and momentum equations as well as the boundary conditions. In the Kalman filter updating model, because the number of measurement variable is less then that of state-space variables, the measurement error covariance matrix could be estimated in real time through the innovation sequence, and the system error covariance matrix needs to be estimated preliminarily. A real example of flood forecasting in the Huaihe River was given to explain how the method works. The results show that the model is reasonable and effective.

  12. Holographic description of non-supersymmetric orbifolded D1-D5-P solutions

    Chakrabarty, Bidisha; Virmani, Amitabh

    2015-01-01

    Non-supersymmetric black hole microstates are of great interest in the context of the black hole information paradox. We identify the holographic description of the general class of non-supersymmetric orbifolded D1-D5-P supergravity solutions found by Jejjala, Madden, Ross and Titchener. This class includes both completely smooth solutions and solutions with conical defects, and in the near-decoupling limit these solutions describe degrees of freedom in the cap region. The CFT description involves a general class of states obtained by fractional spectral flow in both left-moving and right-moving sectors, generalizing previous work which studied special cases in this class. We compute the massless scalar emission spectrum and emission rates in both gravity and CFT and find perfect agreement, thereby providing strong evidence for our proposed identification. We also investigate the physics of ergoregion emission as pair creation for these orbifolded solutions. Our results represent the largest class of non-supe...

  13. Optical properties in 1D photonic crystal structure using Si/C60 multilayers

    Chen Jing; Tang Jiyu; Han Peide; Chen Junfang

    2009-01-01

    The feasibility of using Si/C60 mulfilayer films as one-dimensional(1D)photonie band gap crystals was investigated by theoretical calculations using a transfer matrix method(TMM).The response has been studied both within and out of the periodic plane of Si/C60 multilayers.It is found that Si/C60 multilayer films show incomplete photonic band gap(PBG)behavior in the visible frequency range.The fabricated Si/C60 multilayers with two pairs of 70 am C60 and 30 nm Si layers exhibit a PBG at central wavelength of about 600 nm.and the highest reflectivity call reach 99%.As a consequence,this photonic crystal may be important for fabricating a photonic crystal with an incomplete band gap in the visible frequency range.

  14. A 1D Optomechanical crystal with a complete phononic band gap

    Gomis-Bresco, J; Oudich, M; El-Jallal, S; Griol, A; Puerto, D; Chavez, E; Pennec, Y; Djafari-Rouhani, B; Alzina, F; Martínez, A; Torres, C M Sotomayor

    2014-01-01

    Recent years have witnessed the boom of cavity optomechanics, which exploits the confinement and coupling of optical waves and mechanical vibrations at the nanoscale. Amongst the different physical implementations,optomechanical (OM) crystals built on semiconductor slabs are particularly interesting since they enable the integration and manipulation of multiple OM elements in a single chip and provide GHz phonons suitable for coherent phonon manipulation. Different demonstrations of coupling of infrared photons and GHz phonons in cavities created by inserting defects on OM crystals have been performed. However, the considered structures do not show a complete phononic bandgap at the frequencies of interest, which in principle should allow longer dephasing time, since acoustic leakage is minimized. In this work we demonstrate the excitation of acoustic modes in a 1D OM crystal properly designed to display a full phononic bandgap for acoustic modes at about 4 GHz. The confined phonons have an OM coupling rangin...

  15. Fep1d: a script for the analysis of reaction coordinates.

    Banushkina, Polina V; Krivov, Sergei V

    2015-05-05

    The dynamics of complex systems with many degrees of freedom can be analyzed by projecting it onto one or few coordinates (collective variables). The dynamics is often described then as diffusion on a free energy landscape associated with the coordinates. Fep1d is a script for the analysis of such one-dimensional coordinates. The script allows one to construct conventional and cut-based free energy profiles, to assess the optimality of a reaction coordinate, to inspect whether the dynamics projected on the coordinate is diffusive, to transform (rescale) the reaction coordinate to more convenient ones, and to compute such quantities as the mean first passage time, the transition path times, the coordinate dependent diffusion coefficient, and so forth. Here, we describe the implemented functionality together with the underlying theoretical framework.

  16. Smooth non-extremal D1-D5-P solutions as charged gravitational instantons

    Chakrabarty, Bidisha; Virmani, Amitabh

    2016-01-01

    We present an alternative and more direct construction of the non-supersymmetric D1-D5-P supergravity solutions found by Jejjala, Madden, Ross and Titchener. We show that these solutions --- with all three charges and both rotations turned on --- can be viewed as a charged version of the Myers-Perry instanton. We present an inverse scattering construction of the Myers-Perry instanton metric in Euclidean five-dimensional gravity. The angular momentum bounds in this construction turn out to be precisely the ones necessary for the smooth microstate geometries. We add charges on the Myers-Perry instanton using appropriate SO(4,4) hidden symmetry transformations. The full construction can be viewed as an extension and simplification of a previous work by Katsimpouri, Kleinschmidt and Virmani.

  17. Application of OpenMP to Wireline Triaxial Induction Logging in 1D Layered Anisotropic Medium

    Zhijuan Zhang

    2012-01-01

    Full Text Available Efficient and accurate forward modeling of logging tool responses is essential for data inversion in the log data interpretation in both real time and postprocessing. With the aggressive advancement of various high-performance computing techniques and computer hardware technology, it is possible to significantly improve the efficiency of the forward modeling. In this paper, we apply OpenMP to parallelize the simulation of triaxial induction logging tools in 1D multilayered anisotropic formation. The parallel process is explained in detail and numerical examples are presented to demonstrate the effect of the parallel programming. Comparison of the original code and the parallel code shows that the latter is much faster without loss of accuracy, which is very promising for future real-time inversion.

  18. A 1-D modelling of streaming potential dependence on water content during drainage experiment in sand

    Allègre, Vincent; Ackerer, Philippe; Jouniaux, Laurence; Sailhac, Pascal; 10.1111/j.1365-246X.2012.05371.x

    2012-01-01

    The understanding of electrokinetics for unsaturated conditions is crucial for numerous of geophysical data interpretation. Nevertheless, the behaviour of the streaming potential coefficient C as a function of the water saturation Sw is still discussed. We propose here to model both the Richards' equation for hydrodynamics and the Poisson's equation for electrical potential for unsaturated conditions using 1-D finite element method. The equations are first presented and the numerical scheme is then detailed for the Poisson's equation. Then, computed streaming potentials (SPs) are compared to recently published SP measurements carried out during drainage experiment in a sand column. We show that the apparent measurement of DV / DP for the dipoles can provide the SP coefficient in these conditions. Two tests have been performed using existing models for the SP coefficient and a third one using a new relation. The results show that existing models of unsaturated SP coefficients C(Sw) provide poor results in term...

  19. One-electron singular spectral features of the 1D Hubbard model at finite magnetic field

    Carmelo, J. M. P.; Čadež, T.

    2017-01-01

    The momentum, electronic density, spin density, and interaction dependences of the exponents that control the (k , ω)-plane singular features of the σ = ↑ , ↓ one-electron spectral functions of the 1D Hubbard model at finite magnetic field are studied. The usual half-filling concepts of one-electron lower Hubbard band and upper Hubbard band are defined in terms of the rotated electrons associated with the model Bethe-ansatz solution for all electronic density and spin density values and the whole finite repulsion range. Such rotated electrons are the link of the non-perturbative relation between the electrons and the pseudofermions. Our results further clarify the microscopic processes through which the pseudofermion dynamical theory accounts for the one-electron matrix elements between the ground state and excited energy eigenstates.

  20. Experimental demonstration of an efficient number diagnostic for long 1D ion chains

    Kamsap, Marius Romuald; Pedregosa-Gutierrez, J; Houssin, Marie; Knoop, Martina

    2016-01-01

    Very long, one-dimensional (1D) ion chains are the basis for many applications, in particular in quantum information processing and reliable diagnostics are needed to quantify them. To that purpose, we have experimentally validated Dubin's model for very long ion chains [Phys. Rev. Lett. 71, 2753 (1993)]. This diagnostic allows to precisely determine the number of trapped ion with an accuracy of almost 1\\% without counting them, by measuring the ion-ion distance of the innermost particles, as well as the trapping potential along the ion chain direction. In our experiment, based on a 155 ion chain, the central 30 ions are measured to be equidistant to better than 2\\%, and we can determine the total number of trapped ions with a 4.5\\% uncertainty, completely dominated by a conservative estimation of the experimental characterisation of the trap.

  1. Refractive index sensor based on a 1D photonic crystal in a microfluidic channel

    Rodrigues de Sousa Nunes, Pedro André; Mortensen, Asger; Kutter, Jörg Peter;

    2010-01-01

    A refractive index sensor has been fabricated in silicon oxynitride by standard UV lithography and dry etching processes. The refractive index sensor consists of a 1D photonic crystal (PhC) embedded in a microfluidic channel addressed by fiber-terminated planar waveguides. Experimental...... demonstrations performed with several ethanol solutions ranging from a purity of 96.00% (n = 1.36356) to 95.04% (n = 1.36377) yielded a sensitivity (Δλ/Δn) of 836 nm/RIU and a limit of detection (LOD) of 6 x 10-5 RIU, which is, however, still one order of magnitude higher than the theoretical lower limit...... of the limit of detection 1.3 x 10–6 RIU....

  2. Refractive Index Sensor Based on a 1D Photonic Crystal in a Microfluidic Channel

    Klaus B. Mogensen

    2010-03-01

    Full Text Available A refractive index sensor has been fabricated in silicon oxynitride by standard UV lithography and dry etching processes. The refractive index sensor consists of a 1D photonic crystal (PhC embedded in a microfluidic channel addressed by fiber-terminated planar waveguides. Experimental demonstrations performed with several ethanol solutions ranging from a purity of 96.00% (n = 1.36356 to 95.04% (n = 1.36377 yielded a sensitivity (Δλ/Δn of 836 nm/RIU and a limit of detection (LOD of 6 x 10-5 RIU, which is, however, still one order of magnitude higher than the theoretical lower limit of the limit of detection 1.3 x 10–6 RIU.

  3. Quantum simulation of 2D topological physics in a 1D array of optical cavities.

    Luo, Xi-Wang; Zhou, Xingxiang; Li, Chuan-Feng; Xu, Jin-Shi; Guo, Guang-Can; Zhou, Zheng-Wei

    2015-07-06

    Orbital angular momentum of light is a fundamental optical degree of freedom characterized by unlimited number of available angular momentum states. Although this unique property has proved invaluable in diverse recent studies ranging from optical communication to quantum information, it has not been considered useful or even relevant for simulating nontrivial physics problems such as topological phenomena. Contrary to this misconception, we demonstrate the incredible value of orbital angular momentum of light for quantum simulation by showing theoretically how it allows to study a variety of important 2D topological physics in a 1D array of optical cavities. This application for orbital angular momentum of light not only reduces required physical resources but also increases feasible scale of simulation, and thus makes it possible to investigate important topics such as edge-state transport and topological phase transition in a small simulator ready for immediate experimental exploration.

  4. Development and tests of x-ray multifoil optical system for 1D imaging (Conference Presentation)

    Pína, Ladislav; Hudec, René; Inneman, Adolf J.; Baca, Tomas; Blazek, M.; Platkevic, M.; Sieger, Ladislav; Doubravova, Daniela; McEntaffer, Randall L.; Schultz, Ted B.; Dániel, Vladimír.

    2016-09-01

    The proposed wide-field optical system has not been used yet. Described novel approach is based on the use of 1D "Lobster eye" optics in combination with Timepix X-ray detector in the energy range 3 - 40 keV. The proposed project includes theoretical study and a functional sample of the Timepix X-ray detector with multifoil wide-field X-ray "Lobster eye" optics. Using optics to focus X-rays on a detector is necessary in cases where the intensity of impinging X-ray radiation is below the sensitivity of the detector without optic. Generally this is the case of very low light phenomena, or e.g. monitoring astrophysical objects in space. Namely, such optical system could find applications in laboratory spectroscopy systems or in a rocket space experiment. Designed wide-field optical system combined with Timepix X-ray detector is described together with experimental results obtained during laboratory tests.

  5. Recursive Estimation of Gauss-Markov Random Fields Indexed over 1-D Space

    Vats, Divyanshu

    2009-01-01

    This paper presents optimal recursive estimators for vector valued Gauss-Markov random \\emph{fields} taking values in $\\R^M$ and indexed by (intervals of) $\\R$ or $\\Z$. These 1-D fields are often called reciprocal processes. They correspond to two point boundary value fields, i.e., they have boundary conditions given at the end points of the indexing interval. To obtain the recursive estimators, we derive two classes of recursive representations for reciprocal processes. The first class transforms the Gaussian reciprocal process into a Gauss-Markov \\emph{process}, from which we derive forward and backwards recursive representations. The second representation folds the index set and transforms the original \\emph{field} taking values in $\\R^M$ into a Markov \\emph{process} taking values in $\\R^{2M}$. The folding corresponds to recursing the reciprocal process from the boundary points and telescoping inwards. From these recursive representations, Kalman filters and recursive smoothers are promptly derived.

  6. Application of MSOR iteration with Newton scheme for solutions of 1D nonlinear porous medium equations

    Chew, J. V. L.; Sulaiman, J.

    2016-06-01

    This paper considers Newton-MSOR iterative method for solving 1D nonlinear porous medium equation (PME). The basic concept of proposed iterative method is derived from a combination of one step nonlinear iterative method which known as Newton method with Modified Successive Over Relaxation (MSOR) method. The reliability of Newton-MSOR to obtain approximate solution for several PME problems is compared with Newton-Gauss-Seidel (Newton-GS) and Newton-Successive Over Relaxation (Newton-SOR). In this paper, the formulation and implementation of these three iterative methods have also been presented. From four examples of PME problems, numerical results showed that Newton-MSOR method requires lesser number of iterations and computational time as compared with Newton-GS and Newton-SOR methods.

  7. Evolution of Matter Wave Interference of Bose-Condensed Gas in a 1D Optical Lattice

    XU Zhi-Jun; ZHANG Dong-Mei

    2007-01-01

    For a Bose-condensed gas in a combined potential consisting of an axially-symmetric harmonic magnetic trap and one-dimensional (1D) optical lattice, using the mean-field Gross-Pitaevskii (G-P) equation and the propagator method, we obtain the analytical result of the order parameter for matter wave interference at any time. The evolution of the interference pattern under a variation of the relative phase △φ between successive subcondensates trapped on an optical lattices is also studied. For △φ = π, the interference pattern is symmetric with two sharp peaks, which are symmetrically located on a straight line on both sides of a vacant central peak and moving apart from each other. This work is in agreement with available experimental results.

  8. 1D accretion discs around eccentric planets: observable near-infrared variability

    Dunhill, Alex

    2014-01-01

    I present the results of 1D models of circumplanetary discs around planets on eccentric orbits. I use a classical viscous heating model to calculate emission fluxes at the wavelengths targeted by the NIRCam instrument on JWST, and compare the variability of this signal with the published NIRCam sensitivity specifications. This variability is theoretically detectable by JWST for a sufficiently viscous disc ($\\alpha \\sim 10^{-2}$) around a sufficiently eccentric planet ($e \\sim 0.1-0.2$) and if the circumplanetary disc accretes material from its parent disc at a rate $\\dot{M} \\gtrsim 10^{-7}\\, \\mathrm{M}_{\\odot}\\,\\mathrm{yr}^{-1}$. I discuss the limitations of the models used, and the implications of the result for probing the effectiveness of disc interactions for growing a planet's orbital eccentricity.

  9. Optical properties in 1D photonic crystal structure using Si/C{sub 60} multilayers

    Chen Jing; Tang Jiyu; Chen Junfang [College of Physics and Telecommunication Engineering, South China Normal University, Guangzhou 510006 (China); Han Peide, E-mail: chenjing1002972@sina.co, E-mail: tangjy@scnu.edu.c [College of Materials Science and Engineering, Taiyuan University of Technology, Taiyuan 030024 (China)

    2009-04-15

    The feasibility of using Si/C{sub 60} multilayer films as one-dimensional (1D) photonic band gap crystals was investigated by theoretical calculations using a transfer matrix method (TMM). The response has been studied both within and out of the periodic plane of Si/C{sub 60} multilayers. It is found that Si/C{sub 60} multilayer films show incomplete photonic band gap (PBG) behavior in the visible frequency range. The fabricated Si/C{sub 60} multilayers with two pairs of 70 nm C{sub 60} and 30 nm Si layers exhibit a PBG at central wavelength of about 600 nm, and the highest reflectivity can reach 99%. As a consequence, this photonic crystal may be important for fabricating a photonic crystal with an incomplete band gap in the visible frequency range.

  10. Reticular synthesis of porous molecular 1D nanotubes and 3D networks

    Slater, A. G.; Little, M. A.; Pulido, A.; Chong, S. Y.; Holden, D.; Chen, L.; Morgan, C.; Wu, X.; Cheng, G.; Clowes, R.; Briggs, M. E.; Hasell, T.; Jelfs, K. E.; Day, G. M.; Cooper, A. I.

    2017-01-01

    Synthetic control over pore size and pore connectivity is the crowning achievement for porous metal-organic frameworks (MOFs). The same level of control has not been achieved for molecular crystals, which are not defined by strong, directional intermolecular coordination bonds. Hence, molecular crystallization is inherently less controllable than framework crystallization, and there are fewer examples of 'reticular synthesis', in which multiple building blocks can be assembled according to a common assembly motif. Here we apply a chiral recognition strategy to a new family of tubular covalent cages to create both 1D porous nanotubes and 3D diamondoid pillared porous networks. The diamondoid networks are analogous to MOFs prepared from tetrahedral metal nodes and linear ditopic organic linkers. The crystal structures can be rationalized by computational lattice-energy searches, which provide an in silico screening method to evaluate candidate molecular building blocks. These results are a blueprint for applying the 'node and strut' principles of reticular synthesis to molecular crystals.

  11. Ground state of the quasi-1D correlated electronic system BaVS{sub 3}

    Foury-Leylekian, Pascale, E-mail: pascale.foury@u-psud.fr [Laboratoire de Physique des Solides, UMR 8502, CNRS, Universite Paris-Sud, F- 91405, Orsay Cedex (France); Leininger, Philippe [Max-Planck-Insitut furFestkoerperforschung, Heisenbergstrasse 1, D-70569 Stuttgart (Germany); Ilakovac, Vita [LCP-MR, Universite Pierre et Marie Curie, UMR 7614, CNRS, F-75321 Paris, France and Universite Cergy-Pontoise, F-95031, Cergy-Pontoise (France); Joly, Yves [Institut Neel, CNRS-UJF, BP 166, F-38042 Grenoble Cedex 9 (France); Bernu, Sylvain; Fagot, Sebastien; Pouget, Jean-Paul [Laboratoire de Physique des Solides, UMR 8502, CNRS, Universite Paris-Sud, F- 91405, Orsay Cedex (France)

    2012-06-01

    In this paper we review the salient features of the different instabilities exhibited by the quasi-1D system BaVS{sub 3} and show that there is a subtle interplay between the different phases stabilized. The analysis of the Peierls instability shows that the mobile dz Superscript-Two electrons are more localized than calculated because of their strong correlation with the localized e(t{sub 2g}) electrons. The complex AF magnetic structure of BaVS{sub 3} incorporates the magnetization of the e(t{sub 2g}) electrons with the Peierls pairing of the dz Superscript-Two electrons into magnetic singlets. Finally, we propose that the zig-zag disorder remaining after an incomplete orthorhombic phase transition could change the sign of the magnetic coupling and thus help to stabilize the canted ferromagnetism observed in non stoichiometric BaVS{sub 3-{delta}} and Sr and Ba substituted compounds.

  12. Dendritic cell recognition using template matching based on one-dimensional (1D) Fourier descriptors (FD)

    Muhd Suberi, Anis Azwani; Wan Zakaria, Wan Nurshazwani; Tomari, Razali; Lau, Mei Xia

    2016-07-01

    Identification of Dendritic Cell (DC) particularly in the cancer microenvironment is a unique disclosure since fighting tumor from the harnessing immune system has been a novel treatment under investigation. Nowadays, the staining procedure in sorting DC can affect their viability. In this paper, a computer aided system is proposed for automatic classification of DC in peripheral blood mononuclear cell (PBMC) images. Initially, the images undergo a few steps in preprocessing to remove uneven illumination and artifacts around the cells. In segmentation, morphological operators and Canny edge are implemented to isolate the cell shapes and extract the contours. Following that, information from the contours are extracted based on Fourier descriptors, derived from one dimensional (1D) shape signatures. Eventually, cells are classified as DC by comparing template matching (TM) of established template and target images. The results show that the proposed scheme is reliable and effective to recognize DC.

  13. Mechanisms and Kinetics of Radical Reaction of O(1D,3P) + HCN System

    HUANG Yu-Cheng; DU Jin-Yan; JU Xue-Hai; YE Shi-Yong; ZHOU Tao

    2008-01-01

    The reaction of HCN with O(1D, 3P) radical has been investigated by density functional theory (DFT) and ab initio methods. The stationary points on the reaction paths(reactants, intermediates and products) were optimized at the (U)B3LYP/aug-cc-pVTZ level.Single-point calculations were performed at the (U)QCISD(T)/aug-cc-pVTZ level for the optimized structures and all the total energies were corrected by zero-point energy. It is shown that there exist three competing mechanisms of oxygen attacking nitrogen O→N, oxygen attacking carbon O→C and oxygen attacking hydrogen O→H. The rate constants were obtained via Eyring transition-state theory in the temperature range of 600~2000 K. The linear relationship between lnk and 1/T was presented. The results show that path 1 is the main reaction channel and the product of NCO + H is predominant.

  14. Fuerza de Casimir 1D en semiconductores excitónicos

    A. D. Hernández de la Luz; M. A. Rodríguez Moreno; J. Olvera Hernández; G. Hernández Cocoletzi

    2006-01-01

    Se presentan cálculos de la fuerza de Casimir unidimensional entre placas paralelas semiconductoras excitónicas no locales homogéneas y no homogéneas. Los efectos no locales se generan por las transiciones excitónicas An=1 y Bn=1 en CdS. La fuerza se calcula, en el caso homogéneo, como una función de los espesores de las placas d1 = d2 = d y del ancho de la región de vacío L entre ellas. Asimismo, para el caso inhomogéneo se consideran placas construidas por superredes semiinfinitas con celda...

  15. Catalyst-nanostructure interaction in the growth of 1-D ZnO nanostructures.

    Borchers, C; Müller, S; Stichtenoth, D; Schwen, D; Ronning, C

    2006-02-02

    Vapor-liquid-solid is a well-established process in catalyst guided growth of 1-D nanostructures, i.e., nanobelts and nanowires. The catalyst particle is generally believed to be in the liquid state during growth, and is the site for impinging molecules. The crystalline structure of the catalyst may not have any influence on the structure of the grown nanostructures. In this work, using Au guided growth of ZnO, we show that the interfaces between the catalyst droplet and the nanostructure grow in well-defined mutual crystallographic relationships. The nanostructure defines the crystallographic orientation of the solidifying Au droplet. Possible alloy, intermetallic, or eutectic phase formation during catalysis are elucidated with the help of a proposed ternary Au-Zn-O phase diagram.

  16. Computing 1-D atomic densities in macromolecular simulations: the Density Profile Tool for VMD

    Giorgino, Toni

    2013-01-01

    Molecular dynamics simulations have a prominent role in biophysics and drug discovery due to the atomistic information they provide on the structure, energetics and dynamics of biomolecules. Specialized software packages are required to analyze simulated trajectories, either interactively or via scripts, to derive quantities of interest and provide insight for further experiments. This paper presents the Density Profile Tool, a package that enhances the Visual Molecular Dynamics environment with the ability to interactively compute and visualize 1-D projections of various density functions of molecular models. We describe how the plugin is used to perform computations both via a graphical interface and programmatically. Results are presented for realistic examples, all-atom bilayer models, showing how mass and electron densities readily provide measurements such as membrane thickness, location of structural elements, and how they compare to X-ray diffraction experiments.

  17. Verification and comparison of four numerical schemes for a 1D viscoelastic blood flow model

    Wang, Xiaofei; Lagrée, Pierre-Yves

    2013-01-01

    In this paper, we present four numerical schemes for a 1D viscoelastic blood flow model. In the case with a small nonlinearity (small amplitude of wave), asymptotic analysis predicts several behaviours of the wave: propagation in a uniform tube, attenuation of the amplitude due to the skin friction, diffusion due to the viscosity of the wall, and reflection and transmission at a branching point. These predictions are compared very favorably with all of the numerical solutions. The schemes are also tested in case with a larger nonlinearity. Finally, we apply all of the schemes on a relatively realistic arterial system with 55 arteries. The schemes are compared in four aspects: the spatial and temporal convergence speed, the ability to capture shock phenomena, the computation speed and the complexity of the implementation. The suitable conditions for the application of the various schemes are discussed.

  18. Quantum propagation and confinement in 1D systems using the transfer-matrix method

    Pujol, Olivier; Carles, Robert; Pérez, José-Philippe

    2014-05-01

    The aim of this article is to provide some Matlab scripts to the teaching community in quantum physics. The scripts are based on the transfer-matrix formalism and offer a very efficient and versatile tool to solve problems of a physical object (electron, proton, neutron, etc) with one-dimensional (1D) stationary potential energy. Resonant tunnelling through a multiple-barrier or confinement in wells of various shapes is particularly analysed. The results are quantitatively discussed with semiconductor heterostructures, harmonic and anharmonic molecular vibrations, or neutrons in a gravity field. Scripts and other examples (hydrogen-like ions and transmission by a smooth variation of potential energy) are available freely at http://www-loa.univ-lille1.fr/˜pujol in three languages: English, French and Spanish.

  19. Efficient transparent thin dye solar cells based on highly porous 1D photonic crystals

    Colodrero, Silvia; Lopez-Lopez, Carmen; Miguez, Hernan [Instituto de Ciencia de Materiales de Sevilla (CSIC-US), Centro de Investigaciones Cientificas Isla de la Cartuja, C/Americo Vespucio 49, 41092 Sevilla (Spain); Forneli, Amparo; Pelleja, Laia [Institute of Chemical Research of Catalonia (ICIQ) Avda., Paisos Catalans 16, 43007 Tarragona (Spain); Palomares, Emilio [Institute of Chemical Research of Catalonia (ICIQ) Avda., Paisos Catalans 16, 43007 Tarragona (Spain); Institucio Catalana de Recerca i Estudis Avancats (ICREA), Avda. Lluis Companys 23, 08010 Barcelona (Spain)

    2012-03-21

    A working electrode design based on a highly porous 1D photonic crystal structure that opens the path towards high photocurrents in thin, transparent, dye-sensitized solar cells is presented. By enlarging the average pore size with respect to previous photonic crystal designs, the new working electrode not only increases the device photocurrent, as predicted by theoretical models, but also allows the observation of an unprecedented boost of the cell photovoltage, which can be attributed to structural modifications caused during the integration of the photonic crystal. These synergic effects yield conversion efficiencies of around 3.5% by using just 2 {mu}m thick electrodes, with enhancements between 100% and 150% with respect to reference cells of the same thickness. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  20. A Stochastic Wavelet Finite Element Method for 1D and 2D Structures Analysis

    Xingwu Zhang

    2014-01-01

    Full Text Available A stochastic finite element method based on B-spline wavelet on the interval (BSWI-SFEM is presented for static analysis of 1D and 2D structures in this paper. Instead of conventional polynomial interpolation, the scaling functions of BSWI are employed to construct the displacement field. By means of virtual work principle and BSWI, the wavelet finite elements of beam, plate, and plane rigid frame are obtained. Combining the Monte Carlo method and the constructed BSWI elements together, the BSWI-SFEM is formulated. The constructed BSWI-SFEM can deal with the problems of structural response uncertainty caused by the variability of the material properties, static load amplitudes, and so on. Taking the widely used Timoshenko beam, the Mindlin plate, and the plane rigid frame as examples, numerical results have demonstrated that the proposed method can give a higher accuracy and a better constringency than the conventional stochastic finite element methods.

  1. Quantum Diffusion on Molecular Tubes: Universal Scaling of the 1D to 2D Transition

    Chuang, Chern; Lee, Chee Kong; Moix, Jeremy M.; Knoester, Jasper; Cao, Jianshu

    2016-05-01

    The transport properties of disordered systems are known to depend critically on dimensionality. We study the diffusion coefficient of a quantum particle confined to a lattice on the surface of a tube, where it scales between the 1D and 2D limits. It is found that the scaling relation is universal and independent of the temperature, disorder, and noise parameters, and the essential order parameter is the ratio between the localization length in 2D and the circumference of the tube. Phenomenological and quantitative expressions for transport properties as functions of disorder and noise are obtained and applied to real systems: In the natural chlorosomes found in light-harvesting bacteria the exciton transfer dynamics is predicted to be in the 2D limit, whereas a family of synthetic molecular aggregates is found to be in the homogeneous limit and is independent of dimensionality.

  2. Magnetodielectric and Metalomagnetic 1D Photonic Crystals Homogenization: ε-μ Local Behavior

    J. I. Rodríguez Mora

    2016-01-01

    Full Text Available A theory for calculating the effective optic response of photonic crystals with metallic and magnetic inclusions is reported, for the case when the wavelength of the electromagnetic fields is much larger than the lattice constant. The theory is valid for any type of Bravais lattice and arbitrary form of inclusions in the unitary cell. An equations system is obtained for macroscopic magnetic field and magnetic induction components expanding microscopic electromagnetic fields in Bloch waves. Permittivity and permeability effective tensors are obtained comparing the equations system with an anisotropic nonlocal homogenous medium. In comparison with other homogenization theories, this work uses only two tensors: nonlocal permeability and permittivity. The proposal showed here is based on the use of permeability equations, which are exact and very simple. We present the explicit form of these tensors in the case of binary 1D photonic crystals.

  3. A 1-D evolutionary model for icy satellites, applied to Enceladus

    Prialnik, Uri Malamud Dina

    2015-01-01

    We develop a long-term 1-D evolution model for icy satellites that couples multiple processes: water migration and differentiation, geochemical reactions and silicate phase transitions, compaction by self-gravity, and ablation. The model further considers the following energy sources and sinks: tidal heating, radiogenic heating, geochemical energy released by serpentinization or absorbed by mineral dehydration, gravitational energy and insolation, and heat transport by conduction, convection, and advection. We apply the model to Enceladus, by guessing the initial conditions that would render a structure compatible with present-day observations, assuming the initial structure to have been homogeneous. Assuming the satellite has been losing water continually along its evolution, we postulate that it was formed as a more massive, more icy and more porous satellite, and gradually transformed into its present day state due to sustained long-term tidal heating. We consider several initial compositions and evolution...

  4. TAU: A 1D radiative transfer code for transmission spectroscopy of extrasolar planet atmospheres

    Hollis, M D J; Tinetti, G

    2013-01-01

    The TAU code is a 1D line-by-line radiative transfer code, which is generally applicable for modelling transmission spectra of close-in extrasolar planets. The inputs are the assumed pressure-temperature profile of the planetary atmosphere, the continuum absorption coefficients and the absorption cross-sections for the trace molecular absorbers present in the model, as well as the fundamental system parameters taken from the published literature. The program then calculates the optical path through the planetary atmosphere of the radiation from the host star, and quantifies the absorption due to the modelled composition in a transmission spectrum of transit depth as a function of wavelength. The code is written in C++, parallelised using OpenMP, and is available for public download and use from http://www.ucl.ac.uk/exoplanets/.

  5. Advanced Nodal P3/SP3 Axial Transport Solvers for the MPACT 2D/1D Scheme

    Stimpson, Shane G [ORNL; Collins, Benjamin S [ORNL

    2015-01-01

    As part of its initiative to provide multiphysics simulations of nuclear reactor cores, the Consortium for Advanced Simulation of Light Water Reactors (CASL) is developing the Virtual Environment for Reactor Applications Core Simulator (VERA-CS). The MPACT code, which is the primary neutron transport solver of VERA-CS, employs the two-dimensional/one-dimensional (2D/1D) method to solve 3-dimensional neutron transport problems and provide sub-pin-level resolution of the power distribution. While 2D method of characteristics is used to solve for the transport effects within each plane, 1D-nodal methods are used axially. There have been extensive studies of the 2D/1D method with a variety nodal methods, and the P3/SP3 solver has proved to be an effective method of providing higher-fidelity solutions while maintaining a low computational burden.The current implementation in MPACT wraps a one-node nodal expansion method (NEM) kernel for each moment, iterating between them and performing multiple sweeps to resolve flux distributions. However, it has been observed that this approach is more sensitive to convergence problems. This paper documents the theory and application two new nodal P3/SP3 approaches to be used within the 2D/1D method in MPACT. These two approaches aim to provide enhanced stability compared with the pre-existing one-node approach. Results from the HY-NEM-SP3 solver show that the accuracy is consistent with the one-node formulations and provides improved convergence for some problems; but the solver has issues with cases in thin planes. Although the 2N-SENM-SP3 solver is still under development, it is intended to resolve the issues with HY-NEM-SP3 but it will incur some additional computational burden by necessitating an additional 1D-CMFD-P3 solver to generate the second moment cell-averaged scalar flux.

  6. Cocaine inhibits dopamine D2 receptor signaling via sigma-1-D2 receptor heteromers.

    Gemma Navarro

    Full Text Available Under normal conditions the brain maintains a delicate balance between inputs of reward seeking controlled by neurons containing the D1-like family of dopamine receptors and inputs of aversion coming from neurons containing the D2-like family of dopamine receptors. Cocaine is able to subvert these balanced inputs by altering the cell signaling of these two pathways such that D1 reward seeking pathway dominates. Here, we provide an explanation at the cellular and biochemical level how cocaine may achieve this. Exploring the effect of cocaine on dopamine D2 receptors function, we present evidence of σ1 receptor molecular and functional interaction with dopamine D2 receptors. Using biophysical, biochemical, and cell biology approaches, we discovered that D2 receptors (the long isoform of the D2 receptor can complex with σ1 receptors, a result that is specific to D2 receptors, as D3 and D4 receptors did not form heteromers. We demonstrate that the σ1-D2 receptor heteromers consist of higher order oligomers, are found in mouse striatum and that cocaine, by binding to σ1 -D2 receptor heteromers, inhibits downstream signaling in both cultured cells and in mouse striatum. In contrast, in striatum from σ1 knockout animals these complexes are not found and this inhibition is not seen. Taken together, these data illuminate the mechanism by which the initial exposure to cocaine can inhibit signaling via D2 receptor containing neurons, destabilizing the delicate signaling balance influencing drug seeking that emanates from the D1 and D2 receptor containing neurons in the brain.

  7. Analytical solutions for some defect problems in 1D hexagonal and 2D octagonal quasicrystals

    Wang, X.; Pan, E.

    2008-05-01

    We study some typical defect problems in one-dimensional (1D) hexagonal and two-dimensional (2D) octagonal quasicrystals. The first part of this investigation addresses in detail a uniformly moving screw dislocation in a 1D hexagonal piezoelectric quasicrystal with point group 6mm. A general solution is derived in terms of two functions \\varphi_1, \\varphi_2, which satisfy wave equations, and another harmonic function \\varphi_3. Elementary expressions for the phonon and phason displacements, strains, stresses, electric potential, electric fields and electric displacements induced by the moving screw dislocation are then arrived at by employing the obtained general solution. The derived solution is verified by comparison with existing solutions. Also obtained in this part of the investigation is the total energy of the moving screw dislocation. The second part of this investigation is devoted to the study of the interaction of a straight dislocation with a semi-infinite crack in an octagonal quasicrystal. Here the crack penetrates through the solid along the period direction and the dislocation line is parallel to the period direction. We first derive a general solution in terms of four analytic functions for plane strain problem in octagonal quasicrystals by means of differential operator theory and the complex variable method. All the phonon and phason displacements and stresses can be expressed in terms of the four analytic functions. Then we derive the exact solution for a straight dislocation near a semi-infinite crack in an octagonal quasicrystal, and also present the phonon and phason stress intensity factors induced by the straight dislocation and remote loads.

  8. Analytical solutions for some defect problems in 1D hexagonal and 2D octagonal quasicrystals

    X Wang; E Pan

    2008-05-01

    We study some typical defect problems in one-dimensional (1D) hexagonal and two-dimensional (2D) octagonal quasicrystals. The first part of this investigation addresses in detail a uniformly moving screw dislocation in a 1D hexagonal piezoelectric quasicrystal with point group 6. A general solution is derived in terms of two functions 1, 2, which satisfy wave equations, and another harmonic function 3. Elementary expressions for the phonon and phason displacements, strains, stresses, electric potential, electric fields and electric displacements induced by the moving screw dislocation are then arrived at by employing the obtained general solution. The derived solution is verified by comparison with existing solutions. Also obtained in this part of the investigation is the total energy of the moving screw dislocation. The second part of this investigation is devoted to the study of the interaction of a straight dislocation with a semi-infinite crack in an octagonal quasicrystal. Here the crack penetrates through the solid along the period direction and the dislocation line is parallel to the period direction. We first derive a general solution in terms of four analytic functions for plane strain problem in octagonal quasicrystals by means of differential operator theory and the complex variable method. All the phonon and phason displacements and stresses can be expressed in terms of the four analytic functions. Then we derive the exact solution for a straight dislocation near a semi-infinite crack in an octagonal quasicrystal, and also present the phonon and phason stress intensity factors induced by the straight dislocation and remote loads.

  9. Community interactive webtool to retrieve Greenland glacier data for 1-D geometry

    Perrette, Mahé

    2015-04-01

    Marine-terminating, outlet glaciers are challenging to include in conventional Greenland-wide ice sheet models because of the large variation in scale between model grid size (typically 10 km) and outlet glacier width (typically 1-5km), making it a subgrid scale feature. A possible approach to tackle this problem is to use one-dimensional flowline models for the individual glaciers (e.g. Nick et al., 2013, Nature; Enderlin et al 2013a,b, The Cryosphere). Here we present a python- and javascript- based webtool to prepare data required to feed in or validate a flowline model. It is designed primarily to outline the glacier geometry and returns relevant data averaged over cross-sections. The tool currently allows to: visualize 2-D ice sheet data (zoom/pan), quickly switch between datasets (e.g. ice thickness, bedrock elevation, surface velocity) interpolated / transformed on a common grid. draw flowlines from user-input seeds on the map, calculated from a vector field of surface velocity, as an helpful guide for point 3 interactively draw glacier outline (side and middle lines) on top of the data mesh the outlined glacier domain in the horizontal plane extract relevant data into a 1-D longitudinal profile download the result as a netCDF file The project is hosted on github to encourage collaboration, under the open-source MIT Licence. The server-side is written in python (open-source) using the web-framework flask, and the client-side (javascript) makes use of the d3 library for interactive figures. For now it only works locally in a web browser (start server: "python runserver.py"). Data need to be downloaded separately from the original sources. See the README file in the project for information how to use it. Github projects: https://github.com/perrette/webglacier1d (main) https://github.com/perrette/dimarray (dependency)

  10. Nanoscale stabilization of zintl compounds: 1D ionic Li-P double helix confined inside a carbon nanotube.

    Ivanov, Alexander S; Kar, Tapas; Boldyrev, Alexander I

    2016-02-14

    One-dimensional (1D) ionic nanowires are extremely rare materials due to the difficulty in stabilizing 1D chains of ions under ambient conditions. We demonstrate here a theoretical prediction of a novel hybrid material, a nanotube encapsulated 1D ionic lithium monophosphide (LiP) chain, featuring a unique double-helix structure, which is very unusual in inorganic chemistry. This nanocomposite has been investigated with density functional theory, including molecular dynamics simulations and electronic structure calculations. We find that the formation of the LiP double-helical nanowire is facilitated by strong interactions between LiP and CNTs resulting in a charge transfer. This work suggests that nanostructured confinement may be used to stabilize other polyphosphide 1D chains, thus opening new ways to study the chemistry of zintl compounds at the nanoscale.

  11. Multiple tissue-specific isoforms of sulfatide activate CD1d-restricted type II NKT cells

    Blomqvist, Maria; Rhost, Sara; Teneberg, Susann;

    2009-01-01

    The glycosphingolipid sulfatide (SO(3)-3Galbeta1Cer) is a demonstrated ligand for a subset of CD1d-restricted NKT cells, which could regulate experimental autoimmune encephalomyelitis, a murine model for multiple sclerosis, as well as tumor immunity and experimental hepatitis. Native sulfatide...... is a mixture of sulfatide isoforms, i.e. sulfatide molecules with different long-chain bases and fatty acid chain lengths and saturation. Here, we demonstrate that sulfatide-specific CD1d-restricted murine NKT hybridomas recognized several different sulfatide isoforms. These included the physiologically...... isoforms by a CD1d-restricted NKT-cell clone, and suggest that sulfatide, a major component of the myelin sheet and pancreatic beta-cells, is one of several natural ligands for type II CD1d-restricted NKT cells....

  12. Effects of GWAS-associated genetic variants on lncRNAs within IBD and T1D candidate loci

    Mirza, Aashiq H; Kaur, Simranjeet; Brorsson, Caroline A;

    2014-01-01

    Long non-coding RNAs are a new class of non-coding RNAs that are at the crosshairs in many human diseases such as cancers, cardiovascular disorders, inflammatory and autoimmune disease like Inflammatory Bowel Disease (IBD) and Type 1 Diabetes (T1D). Nearly 90% of the phenotype-associated single......, we systemically identified all annotated IBD and T1D loci-associated lncRNAs, and mapped nominally significant GWAS/ImmunoChip SNPs for IBD and T1D within these lncRNAs. Additionally, we identified tissue-specific cis-eQTLs, and strong linkage disequilibrium (LD) signals associated with these SNPs....... We explored sequence and structure based attributes of these lncRNAs, and also predicted the structural effects of mapped SNPs within them. We also identified lncRNAs in IBD and T1D that are under recent positive selection. Our analysis identified putative lncRNA secondary structure-disruptive SNPs...

  13. Anti-TGF-β Antibody, 1D11, Ameliorates Glomerular Fibrosis in Mouse Models after the Onset of Proteinuria.

    Xiaoyan Liang

    Full Text Available Fibrosis is a final common pathway leading to loss of kidney function, in which the fibrogenic cytokine, transforming growth factor β (TGF-β, plays a central role. While previous studies showed that TGF-β antagonism by various means prevents fibrosis in mouse models, clinical approaches based on these findings remain elusive. 1D11 is a neutralizing antibody to all three isoforms of TGF-β. In both adriamycin (ADR-induced nephropathy and NEP25 podocyte ablation nephropathy, thrice-weekly intraperitoneal administration of 1D11 from the day of disease induction until the mice were sacrificed (day 14 for ADR and day 28 for NEP25, significantly reduced glomerular COL1A2 mRNA accumulation and histological changes. Consistent with our previous findings, proteinuria remained overt in the mice treated with 1D11, suggesting distinct mechanisms for proteinuria and fibrogenesis. Podocyte numbers determined by WT1 staining were significantly reduced in NEP25-model glomeruli as expected, while WT1-positive cells were preserved in mice receiving 1D11. Even when 1D11 was administered after the onset of proteinuria on day 3, 1D11 preserved WT1-positive cell numbers in glomeruli and significantly reduced glomerular scar score (2.5 ± 0.2 [control IgG] vs. 1.8 ± 0.2 [1D11], P < 0.05 and glomerular COL1A2 mRNA expression (19.3 ± 4.4 [control IgG] vs. 8.4 ± 2.4 [1D11] fold increase over the healthy control, P < 0.05. Transmission electron microscopy revealed loss of podocytes and denuded glomerular basement membrane in NEP25 mice with disease, whereas podocytes remained attached to the basement membrane, though effaced and swollen, in those receiving 1D11 from day 3. Together, these data suggest that TGF-β neutralization by 1D11 prevents glomerular fibrosis even when started after the onset of proteinuria. While overt proteinuria and podocyte effacement persist, 1D11 prevents total podocytes detachment, which might be a key event activating fibrogenic events

  14. 明导电子推出1D-3D CFD解决方案

    龚淑娟

    2012-01-01

    FloEFD与Flowmaster结合起来可以作为一个1D-3D CFD应用的最佳组合,帮助设计工程师更加快速地实现更完美的产品设计开发。除了FloEFD,其他3D CFD工具也可通过MCPPI接口转移到Flowmaster进行1D CFD分析。

  15. Impact of Nanosize on Supercapacitance: Study of 1D Nanorods and 2D Thin-Films of Nickel Oxide.

    Patil, Ranjit A; Chang, Cheng-Ping; Devan, Rupesh S; Liou, Yung; Ma, Yuan-Ron

    2016-04-20

    We synthesized unique one-dimensional (1D) nanorods and two-dimensional (2D) thin-films of NiO on indium-tin-oxide thin-films using a hot-filament metal-oxide vapor deposition technique. The 1D nanorods have an average width and length of ∼100 and ∼500 nm, respectively, and the densely packed 2D thin-films have an average thickness of ∼500 nm. The 1D nanorods perform as parallel units for charge storing. However, the 2D thin-films act as one single unit for charge storing. The 2D thin-films possess a high specific capacitance of ∼746 F/g compared to 1D nanorods (∼230 F/g) using galvanostatic charge-discharge measurements at a current density of 3 A/g. Because the 1D NiO nanorods provide more plentiful surface areas than those of the 2D thin-films, they are fully active at the first few cycles. However, the capacitance retention of the 1D nanorods decays faster than that of the 2D thin-films. Also, the 1D NiO nanorods suffer from instability due to the fast electrochemical dissolution and high nanocontact resistance. Electrochemical impedance spectroscopy verifies that the low dimensionality of the 1D NiO nanorods induces the unavoidable effects that lead them to have poor supercapacitive performances. On the other hand, the slow electrochemical dissolution and small contact resistance in the 2D NiO thin-films favor to achieve high specific capacitance and great stability.

  16. XMS and NG1dF: extreme multiplex spectrographs for wide-field multi-object spectroscopy

    Content, Robert; Barden, Sam; Becerril, Santiago; Boehm, Armin; Clark, Paul; Costillo, Pedro; Dubbeldam, C. Mark; Farrell, Tony; Glazebrook, Karl; Haynes, Roger; Meisenheimer, Klaus; Miziarski, Stan; Nikoloudakis, Nikolaos; Prada, Luis Francisco; Rohloff, Ralf-Rainer; Shanks, Tom; Sharples, Ray M.; Wagner, Karl

    2010-07-01

    Two feasibility studies for spectrographs that can deliver at least 4000 MOS slits over a 1° field at the prime focuses of the Anglo-Australian and Calar Alto Observatories have been completed. We describe the design and science case of the Calar Alto eXtreme Multiplex Spectrograph (XMS) for which an extended study, half way between feasibility study and phase-A, was made. The optical design is quite similar than in the AAO study for the Next Generation 1 degree Field (NG1dF) but the mechanical design of XMS is quite different and much more developed. In a single night, 25000 galaxy redshifts can be measured to z~0.7 and beyond for measuring the Baryon Acoustic Oscillation (BAO) scale and many other science goals. This may provide a low-cost alternative to WFMOS for example and other large fibre spectrographs. The design features four cloned spectrographs which gives a smaller total weight and length than a unique spectrograph to makes it placable at prime focus. The clones use a transparent design including a grism in which all optics are about the size or smaller than the clone rectangular subfield so that they can be tightly packed with little gaps between subfields. Only low cost glasses are used; the variations in chromatic aberrations between bands are compensated by changing a box containing the grism and two adjacent lenses. Three bands cover the 420nm to 920nm wavelength range at 10A resolution while another cover the Calcium triplet at 3A. An optional box does imaging. We however also studied different innovative methods for acquisition without imaging. A special mask changing mechanism was also designed to compensate for the lack of space around the focal plane. Conceptual designs for larger projects (AAT 2º field, CFHT, VISTA) have also been done.

  17. Dosimetric comparisons of carbon ion treatment plans for 1D and 2D ripple filters with variable thicknesses

    Printz Ringbæk, Toke; Weber, Uli; Santiago, Alina; Simeonov, Yuri; Fritz, Peter; Krämer, Michael; Wittig, Andrea; Bassler, Niels; Engenhart-Cabillic, Rita; Zink, Klemens

    2016-06-01

    A ripple filter (RiFi)—also called mini-ridge filter—is a passive energy modulator used in particle beam treatments that broadens the Bragg peak (BP) as a function of its maximum thickness. The number of different energies requested from the accelerator can thus be reduced, which significantly reduces the treatment time. A new second generation RiFi with 2D groove shapes was developed using rapid prototyping, which optimizes the beam-modulating material and enables RiFi thicknesses of up to 6 mm. Carbon ion treatment plans were calculated using the standard 1D 3 mm thick RiFi and the new 4 and 6 mm 2D RiFis for spherical planning target volumes (PTVs) in water, eight stage I non-small cell lung cancer cases, four skull base chordoma cases and three prostate cancer cases. TRiP98 was used for treatment planning with facility-specific base data calculated with the Monte Carlo code SHIELD-HIT12A. Dose-volume-histograms, spatial dose distributions and dosimetric indexes were used for plan evaluation. Plan homogeneity and conformity of thinner RiFis were slightly superior to thicker RiFis but satisfactory results were obtained for all RiFis investigated. For the 6 mm RiFi, fine structures in the dose distribution caused by the larger energy steps were observed at the PTV edges, in particular for superficial and/or very small PTVs but performances for all RiFis increased with penetration depth due to straggling and scattering effects. Plans with the new RiFi design yielded for the studied cases comparable dosimetric results to the standard RiFi while the 4 and 6 mm RiFis lowered the irradiation time by 25-30% and 45-49%, respectively.

  18. Dosimetric comparisons of carbon ion treatment plans for 1D and 2D ripple filters with variable thicknesses.

    Ringbæk, Toke Printz; Weber, Uli; Santiago, Alina; Simeonov, Yuri; Fritz, Peter; Krämer, Michael; Wittig, Andrea; Bassler, Niels; Engenhart-Cabillic, Rita; Zink, Klemens

    2016-06-01

    A ripple filter (RiFi)-also called mini-ridge filter-is a passive energy modulator used in particle beam treatments that broadens the Bragg peak (BP) as a function of its maximum thickness. The number of different energies requested from the accelerator can thus be reduced, which significantly reduces the treatment time. A new second generation RiFi with 2D groove shapes was developed using rapid prototyping, which optimizes the beam-modulating material and enables RiFi thicknesses of up to 6 mm. Carbon ion treatment plans were calculated using the standard 1D 3 mm thick RiFi and the new 4 and 6 mm 2D RiFis for spherical planning target volumes (PTVs) in water, eight stage I non-small cell lung cancer cases, four skull base chordoma cases and three prostate cancer cases. TRiP98 was used for treatment planning with facility-specific base data calculated with the Monte Carlo code SHIELD-HIT12A. Dose-volume-histograms, spatial dose distributions and dosimetric indexes were used for plan evaluation. Plan homogeneity and conformity of thinner RiFis were slightly superior to thicker RiFis but satisfactory results were obtained for all RiFis investigated. For the 6 mm RiFi, fine structures in the dose distribution caused by the larger energy steps were observed at the PTV edges, in particular for superficial and/or very small PTVs but performances for all RiFis increased with penetration depth due to straggling and scattering effects. Plans with the new RiFi design yielded for the studied cases comparable dosimetric results to the standard RiFi while the 4 and 6 mm RiFis lowered the irradiation time by 25-30% and 45-49%, respectively.

  19. 1d Numerical Simulation of A Swiss Debris Flow: Comparison of Flow Laws

    McArdell, B. W.; Graf, Ch.; Naef, D.; Rickenmann, D.

    Efforts to numerically model debris flows have been limited by a lack of appropriate numerical tools. Here we report on our efforts to systematically evaluate different flow laws using a numerical tool under development at our institute. The model, DFEM, is a finite element solution of the shallow water equations in one or two dimensions and is based on the FEMTOOL libraries from Rutschmann (1993). Debris flow constitu- tive relations or flow laws include turbulent (e.g. Manning, Chézy, Voellmy), laminar (Bingham, Newtonian laminar), and inertial formulations (dilatant/grain shearing) as well as combinations of flow laws when appropriate. The model is applied to a recent debris flow event from the Schipfenbach torrent, Switzerland (Hürlimann, submitted), where we maintain an automated debris flow observation station. Observations include flow depth measurements from ultrasonic depth measurement devices, reach-averaged velocities estimated from the travel time between ultrasonic gages and geophones, velocity and flow behavior from video cam- eras situated near the flow retention basin on the fan, and post-event field surveys. Preliminary results suggest that the flow of debris in the steep reaches of the torrent channel can be reasonably described by a simple turbulent flow law (e.g. Manning- Strickler or Chézy) with a large overall flow resistance, and that both the flow in the channel and the deposition on the fan can be satisfactorily simulated using the Voellmy fluid approach. The results using the Voellmy fluid approach are in agree- ment with results calculated from the AVAL-1D snow avalanche simulation code and input parameters for debris instead of snow, corroborating the implementation in the DFEM model. The AVAL-1D code is commercially available, providing another tool that may be used by workers in the natural hazards field for debris flow routing in torrent channels and on alluvial fans. References: Hürlimann, M., Rickenmann, D. and Graf, Ch., Field

  20. Optical bullets in (2+1)D photonic structures and their interaction with localized defects

    Dohnal, Tomas

    2005-11-01

    This dissertation studies light propagation in Kerr-nonlinear two dimensional waveguides with a Bragg resonant, periodic structure in the propagation direction. The model describing evolution of the electric field envelopes is the system of 2D Nonlinear Coupled Mode Equations (2D CME). The periodic structure induces a range of frequencies (frequency gap) in which linear waves do not propagate. It is shown that, similarly to the ID case of a fiber grating, the 2D nonlinear system supports localized solitary wave solutions, referred to as 2D gap solitons, which have frequencies inside the linear gap and can travel at, any speed smaller than or equal to the speed of light in the corresponding homogeneous medium. Such solutions are constructed numerically via Newton's iteration. Convergence is obtained only near the upper edge of the gap. Gap solitons with a nonzero velocity are constructed by numerically following a bifurcation curve parameterized by the velocity v. It is shown that gap solitons are saddle points of the corresponding Hamiltonian functional and that no (constrained) local minima of the Hamiltonian exist. The linear stability problem is formulated and reasons for the failure of the standard Hamiltonian PDE approach for determining linear stability are discussed. In the second part of the dissertation interaction of 2D gap solitons with localized defects is studied and trapping of slow enough 2D gap solitons is demonstrated. This study builds on [JOSA B 19, 1635 (2002)], where such trapping of 1D gap solitons is considered. Analogously to this 1D problem trapping in the 2D model is explained as a resonant energy transfer into one or more defect modes existent for the particular defect. For special localized defects exact linear modes are found explicitly via the separation of variables. Numerical computation of linear defect modes is used for more general defects. Corresponding nonlinear modes are then constructed via Newton's iteration by following a