WorldWideScience

Sample records for seed weight variation

  1. combining high seed number and weight to improve seed yield

    African Journals Online (AJOL)

    ACSS

    ABSTRACT. Increasing seed size and seed weight is an important trait for trade, yield component and adaptation of chickpea ... determining yield or quality, and the development of rapid and ..... C.G. 1981. Control of seed growth in soybeans.

  2. Crop physiological analysis of seed quality variation in common bean (Phaseolus vulgaris L.)

    NARCIS (Netherlands)

    Muasya, R.M.

    2001-01-01

    Keywords : Physiological maturity, harvest maturity, earliness, common bean, Phaseolus vulgaris L., morphological markers, variation, moisture content, dry weight, viability, vigour, electrical conductivity, tetrazolium, seed lot, seed

  3. All rights reserved Variation in Body Weight, Organ Weight and ...

    African Journals Online (AJOL)

    ADOWIE PERE

    Variation in Body Weight, Organ Weight and Haematological Parameters of Rats Fed ... ABSTRACT: Food insecurity is a major problem of the developing nations. ... Except for the values of haemoglobin and packed cell volume that were ...

  4. Seed predators exert selection on the subindividual variation of seed size.

    Science.gov (United States)

    Sobral, M; Guitián, J; Guitián, P; Larrinaga, A R

    2014-07-01

    Subindividual variation among repeated organs in plants constitutes an overlooked level of variation in phenotypic selection studies, despite being a major component of phenotypic variation. Animals that interact with plants could be selective agents on subindividual variation. This study examines selective pressures exerted during post-dispersal seed predation and germination on the subindividual variation of seed size in hawthorn (Crataegus monogyna). With a seed offering experiment and a germination test, we estimated phenotypic selection differentials for average and subindividual variation of seed size due to seed predation and germination. Seed size affects germination, growth rate and the probability of an individual seed of escaping predation. Longer seeds showed higher germination rates, but this did not result in significant selection on phenotypes of the maternal trees. On the other hand, seed predators avoided wider seeds, and by doing so exerted phenotypic selection on adult average and subindividual variation of seed size. The detected selection on subindividual variation suggests that the levels of phenotypic variation within individual plants may be, at least partly, the adaptive consequence of animal-mediated selection. © 2013 German Botanical Society and The Royal Botanical Society of the Netherlands.

  5. Variation of weigh and viability of seeds of Pinus tropicalis from different populations

    Directory of Open Access Journals (Sweden)

    Marta Bonilla Vichot

    2014-06-01

    Full Text Available Pinus tropicalis Morelet is endemic in the province of Pinar del Rio and Isla de la Juventud. In this paper the variation is evaluated in weight and viability of seeds from 4 seed areas of the province of Pinar del Rio, Cuba, which were harvested in July and stored for five months at room temperature until They were made to the corresponding analysis. Samples of each of the sources weretaken to determine the weight of 1000 seeds, as established methodology ISTA (1993. Viability was also determined from the tetrazolium Test. It was observed that the individual weight of the seeds of Pinus tropicalis has 0,0051g values to 0,050g, while the average weight of 1000 seeds shows variation by origin, showing the greatest weight to the seeds from the seed mass Ceja del Negro (orchard seedling genetically enhanced trees, which directly influences the quality of seeds. The viability was also superior in the origin of Ceja del Negro.

  6. Plasticity of seed weight compensates reductions in seed number of oilseed rape in response to shading at flowering

    NARCIS (Netherlands)

    Labra Fernandez, Marcelo; Struik, Paul C.; Evers, Jochem B.; Calderini, Daniel F.

    2017-01-01

    Understanding the response of the number of seeds and seed weight to the availability of assimilates is crucial for designing breeding strategies aimed to increase seed and oil yield in oilseed rape. This study aims to answer the questions: i) do seed number and seed weight in oilseed rape differ

  7. Seed maturation associated transcriptional programs and regulatory networks underlying genotypic difference in seed dormancy and size/weight in wheat (Triticum aestivum L.).

    Science.gov (United States)

    Yamasaki, Yuji; Gao, Feng; Jordan, Mark C; Ayele, Belay T

    2017-09-16

    Maturation forms one of the critical seed developmental phases and it is characterized mainly by programmed cell death, dormancy and desiccation, however, the transcriptional programs and regulatory networks underlying acquisition of dormancy and deposition of storage reserves during the maturation phase of seed development are poorly understood in wheat. The present study performed comparative spatiotemporal transcriptomic analysis of seed maturation in two wheat genotypes with contrasting seed weight/size and dormancy phenotype. The embryo and endosperm tissues of maturing seeds appeared to exhibit genotype-specific temporal shifts in gene expression profile that might contribute to the seed phenotypic variations. Functional annotations of gene clusters suggest that the two tissues exhibit distinct but genotypically overlapping molecular functions. Motif enrichment predicts genotypically distinct abscisic acid (ABA) and gibberellin (GA) regulated transcriptional networks contribute to the contrasting seed weight/size and dormancy phenotypes between the two genotypes. While other ABA responsive element (ABRE) motifs are enriched in both genotypes, the prevalence of G-box-like motif specifically in tissues of the dormant genotype suggests distinct ABA mediated transcriptional mechanisms control the establishment of dormancy during seed maturation. In agreement with this, the bZIP transcription factors that co-express with ABRE enriched embryonic genes differ with genotype. The enrichment of SITEIIATCYTC motif specifically in embryo clusters of maturing seeds irrespective of genotype predicts a tissue specific role for the respective TCP transcription factors with no or minimal contribution to the variations in seed dormancy. The results of this study advance our understanding of the seed maturation associated molecular mechanisms underlying variation in dormancy and weight/size in wheat seeds, which is a critical step towards the designing of molecular strategies

  8. Variation for seed phytosterols in sunflower germplasm

    Science.gov (United States)

    Sunflower (Helianthus annuus L.) seeds and oils are rich sources of phytosterols, which are important compounds for human nutrition. There is limited information on variability for seed phytosterols in sunflower germplasm. The objective of the present research was to evaluate kernel phytosterol cont...

  9. Variation in quantitative characters of faba bean after seed ...

    African Journals Online (AJOL)

    Variation in quantitative characters of faba bean after seed irradiation and associated molecular changes. Sonia Mejri, Yassine Mabrouk, Marie Voisin, Philippe Delavault, Philippe Simier, Mouldi Saidi, Omrane Belhadj ...

  10. Variation in physico-chemical properties of seed of selected ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-10-20

    Oct 20, 2008 ... Full Length Research Paper. Variation in ... Key words: Industrial crop, seed physicochemical content, Vigna unduiculata. ..... Cowpea genetics a review of the world literasture. ... Development of improved cowpea varieties.

  11. Seed coat color, weight and eye pattern inheritance in gamma-rays induced cowpea M2-mutant line

    Directory of Open Access Journals (Sweden)

    Reda M. Gaafar

    2016-06-01

    Full Text Available Gamma radiation is a very effective tool for inducing genetic variation in characters of many plants. Black seeds of M2 mutant were obtained after exposure of an Egyptian cowpea cultivar (Kaha 1 to a low dose of gamma rays. Segregation of seed coat color, weight of 100 seeds and seed eye pattern of the black seeds of this mutant line were further examined in this study. Four colors were observed for seed coat in the M3 plants ranging from cream to reddish brown and three eye patterns were distinguished from each other. SDS–PAGE of the seed storage proteins showed 18 protein bands; five of these bands disappeared in the seeds of M3 plants compared to M2 and M0 controls while other 5 protein bands were specifically observed in seeds of M3 plants. PCR analysis using twelve ISSR primers showed 47 polymorphic and 8 unique amplicons. The eight unique amplicons were characteristic of the cream coat color and brown wide eye pattern (M03-G10 while the polymorphic bands were shared by 6 coat-color groups. A PCR fragment of 850 bp was amplified, using primer HB-12, in M3-G04 which showed high-100 seed weight. These results demonstrated the mutagenic effects of gamma rays on seed coat color, weight of 100 seeds and eye pattern of cowpea M3 mutant plants.

  12. Analysis of interspecies physicochemical variation of grain legume seeds

    Science.gov (United States)

    Rybiński, Wojciech; Rusinek, Robert; Szot, Bogusław; Bocianowski, Jan; Starzycki, Michał

    2014-10-01

    The paper presents an attempt to assess the reaction of seeds to mechanical loads taking into account their geometry expressed as seed thickness and 1000 seed weight. The initial material comprised 33 genotypes of grain legume plants and included cultivars registered in the country and breeding lines that are subject to pre-registration trials. The analysis of variance revealed significant diversity of the cultivars and lines of the species studied in terms of each of the analysed trait. The highest weight of 1000 seeds were obtained for white lupine seeds and peas, the lowest for andean lupine seeds. The maximum deformation and energy were obtained for white lupine seeds, the lowest for pea seeds, the maximum force and module the lowest values were determined for narrow-leafed lupine and pea. The highest values of protein were obtained for andean and yellow lupine, a fat content for andean and white lupine. The fatty acid profile as much as 70% or more were linoleic and oleic acids. Against the background of all the species are distinguished by white lupine seeds with a high content of oleic acid and the lowest of linoleic acid, for yellow lupine were obtained the inverse ratio of the two acids.

  13. Weight loss in bamboo ( Bambusa vulgaris ) treated with neem seed ...

    African Journals Online (AJOL)

    Split-bamboo samples conditioned to 11.76% moisture content were converted to test specimens for Percentage Weight Loss (PWL) and treated with mechanically extracted neem seed oil at two different treatment temperature regimes by completely soaking a set in oil at ambient room temperature of 25 ± 2oC for 24 hours ...

  14. Thousand-seed weight in the theory and practice

    Directory of Open Access Journals (Sweden)

    Mirić Mladen

    2007-01-01

    Full Text Available Out of approximately 100 seed traits, 20 are of the marketing importance, and 10-15, including the 1000-seed weight (TSW have been studied. There are many articles partially dealing with TSW in our literature related to the seed industry, but none of them is all-inclusive. Therefore, the aim of the present study was to determine: (1 a role, (2 factors of formation and (3 obtaining desirable TWS (DTWS. Germination, yield and trade depend on TWS, while TWS is interrelated with a dozen of other parameters, selection of sowing plates, determination of the amounts of seeds necessary for sowing (sowing rate and the depth of sowing, and can be an indicator of some other seed or crop traits. TSW depends on inheritance and conditions and is interrelated with sowing, drying and processing. Individual factors of TSW are numerous and classified into two groups each with two subgroups: a agro ecological (abiotic and biotic and b agro technological (cropping practices and processing. The species and variety, crop density and uniformity, irrigation regime and fertilization have the greatest impact on TSW, while the effects of soil tillage and weather conditions, except during pollination and maturing, are of less importance. Seed fractioning is crucial, but it is less performed in our country than world-wide. The desirable TSW (DTWS is a term designating higher-quality, more homogenous and greater yield of seed units in the whole process of the seed production. It is necessary to analyze DTWS for all varieties in order to determine DTWS that will provide the highest yield of viable and uniform seeds per hectare. Labor rationalization and productivity require obtaining DTWS as high as possible in the filed and maintaining it in processing. .

  15. A PP2C-1 Allele Underlying a Quantitative Trait Locus Enhances Soybean 100-Seed Weight

    Institute of Scientific and Technical Information of China (English)

    Xiang Lu; Yong-Cai Lai; Wei-Guang Du; Wei-Qun Man; Shou-Yi Chen; Jin-Song Zhang; Qing Xiong; Tong Cheng; Qing-Tian Li; Xin-Lei Liu; Ying-Dong Bi; Wei Li; Wan-Ke Zhang; Biao Ma

    2017-01-01

    Cultivated soybeans may lose some useful genetic loci during domestication.Introgression of genes from wild soybeans could broaden the genetic background and improve soybean agronomic traits.In this study,through whole-genome sequencing of a recombinant inbred line population derived from a cross between a wild soybean ZYD7 and a cultivated soybean HN44,and mapping of quantitative trait loci for seed weight,we discovered that a phosphatase 2C-1 (PP2C-1) allele from wild soybean ZYD7 contributes to the increase in seed weight/size.PP2C-1 may achieve this function by enhancing cell size of integument and activating a subset of seed trait-related genes.We found that PP2C-1 is associated with GmBZR1,a soybean ortholog of Arabidopsis BZR1,one of key transcription factors in brassinosteroid (BR) signaling,and facilitate accumulation of dephosphorylated GmBZR1.In contrast,the PP2C-2 allele with variations of a few amino acids at the N-terminus did not exhibit this function.Moreover,we showed that GmBZR1 could promote seed weight/size in transgenic plants.Through analysis of cultivated soybean accessions,we found that 40% of the examined accessions do not have the PP2C-1 allele,suggesting that these accessions can be improved by introduction of this allele.Taken together,our study identifies an elite allele PP2C-1,which can enhance seed weight and/or size in soybean,and pinpoints that manipulation of this allele by molecular-assisted breeding may increase production in soybean and other legumes/crops.

  16. Genetic variation of transgenerational plasticity of offspring germination in response to salinity stress and the seed transcriptome of Medicago truncatula.

    Science.gov (United States)

    Vu, Wendy T; Chang, Peter L; Moriuchi, Ken S; Friesen, Maren L

    2015-04-01

    demonstrate genetic variation in transgenerational plasticity within M. truncatula and show that parental exposure to salinity stress influences the expression of stored seed transcripts, seed weight, and germination behavior. Furthermore, we show that the parental environment influences gene expression to modulate biological pathways that are likely responsible for offspring germination responses to salinity stress.

  17. Sequence variations in the FAD2 gene in seeded pumpkins.

    Science.gov (United States)

    Ge, Y; Chang, Y; Xu, W L; Cui, C S; Qu, S P

    2015-12-21

    Seeded pumpkins are important economic crops; the seeds contain various unsaturated fatty acids, such as oleic acid and linoleic acid, which are crucial for human and animal nutrition. The fatty acid desaturase-2 (FAD2) gene encodes delta-12 desaturase, which converts oleic acid to linoleic acid. However, little is known about sequence variations in FAD2 in seeded pumpkins. Twenty-seven FAD2 clones from 27 accessions of Cucurbita moschata, Cucurbita maxima, Cucurbita pepo, and Cucurbita ficifolia were obtained (totally 1152 bp; a single gene without introns). More than 90% nucleotide identities were detected among the 27 FAD2 clones. Nucleotide substitution, rather than nucleotide insertion and deletion, led to sequence polymorphism in the 27 FAD2 clones. Furthermore, the 27 FAD2 selected clones all encoded the FAD2 enzyme (delta-12 desaturase) with amino acid sequence identities from 91.7 to 100% for 384 amino acids. The same main-function domain between 47 and 329 amino acids was identified. The four species clustered separately based on differences in the sequences that were identified using the unweighted pair group method with arithmetic mean. Geographic origin and species were found to be closely related to sequence variation in FAD2.

  18. Variation in Body Weight, Organ Weight and Haematological ...

    African Journals Online (AJOL)

    The rats fed raw kudzu and negative control diet showed negative mean weight changes(- 6.50g and -10.0g )while those fed with positive control and treated kudzu diet showed positive mean weight ... The result showed that the treated flour supported growth but had no definite effect on other parameters measured.

  19. Consequences of intraspecific seed-size variation in Sparganium emersum for dispersal by fish

    NARCIS (Netherlands)

    Pollux, B.J.A.; Ouborg, J.; Van Groenendael, J.M.; Klaassen, M.R.J.

    2007-01-01

    The potential for seed dispersal by fish (ichthyochory) is likely to vary within aquatic plant species, depending on intraspecific variation in phenotypic seed traits. 2. We studied the effect of seed size variation within the unbranched burreed (Sparganium emersum) on the potential for internal

  20. Seed dormancy and seed longevity: from genetic variation to gene identification

    NARCIS (Netherlands)

    Nguyen, T.P.

    2014-01-01

    Seed dormancy and seed longevity are the most important survival traits in the soil seed bank. Both traits are induced during seed maturation and evolved to assure seed survival during environmental conditions that cannot support the regular course of life. Seed dormancy is related to the timing of

  1. Interspecific variation in persistence of buried weed seeds follows trade-offs among physiological, chemical, and physical seed defenses.

    Science.gov (United States)

    Davis, Adam S; Fu, Xianhui; Schutte, Brian J; Berhow, Mark A; Dalling, James W

    2016-10-01

    Soil seedbanks drive infestations of annual weeds, yet weed management focuses largely on seedling mortality. As weed seedbanks increasingly become reservoirs of herbicide resistance, species-specific seedbank management approaches will be essential to weed control. However, the development of seedbank management strategies can only develop from an understanding of how seed traits affect persistence.We quantified interspecific trade-offs among physiological, chemical, and physical traits of weed seeds and their persistence in the soil seedbank in a common garden study. Seeds of 11 annual weed species were buried in Savoy, IL, from 2007 through 2012. Seedling recruitment was measured weekly and seed viability measured annually. Seed physiological (dormancy), chemical (phenolic compound diversity and concentration; invertebrate toxicity), and physical traits (seed coat mass, thickness, and rupture resistance) were measured.Seed half-life in the soil ( t 0.5 ) showed strong interspecific variation ( F 10,30  = 15, p  central role of seed dormancy in controlling seed persistence.A quantitative comparison between our results and other published work indicated that weed seed dormancy and seedbank persistence are linked across diverse environments and agroecosystems. Moreover, among seedbank-forming early successional plant species, relative investment in chemical and physical seed defense varies with seedbank persistence. Synthesis and applications . Strong covariance among weed seed traits and persistence in the soil seedbank indicates potential for seedbank management practices tailored to specific weed species. In particular, species with high t 0.5 values tend to invest less in chemical defenses. This makes them highly vulnerable to physical harvest weed seed control strategies, with small amounts of damage resulting in their full decay.

  2. Patterns of cross-continental variation in tree seed mass in the Canadian Boreal Forest.

    Directory of Open Access Journals (Sweden)

    Jushan Liu

    Full Text Available Seed mass is an adaptive trait affecting species distribution, population dynamics and community structure. In widely distributed species, variation in seed mass may reflect both genetic adaptation to local environments and adaptive phenotypic plasticity. Acknowledging the difficulty in separating these two aspects, we examined the causal relationships determining seed mass variation to better understand adaptability and/or plasticity of selected tree species to spatial/climatic variation. A total of 504, 481 and 454 seed collections of black spruce (Picea mariana (Mill. B.S.P., white spruce (Picea glauca (Moench Voss and jack pine (Pinus banksiana Lamb across the Canadian Boreal Forest, respectively, were selected. Correlation analyses were used to determine how seed mass vary with latitude, longitude, and altitude. Structural Equation Modeling was used to examine how geographic and climatic variables influence seed mass. Climatic factors explained a large portion of the variation in seed mass (34, 14 and 29%, for black spruce, white spruce and jack pine, respectively, indicating species-specific adaptation to long term climate conditions. Higher annual mean temperature and winter precipitation caused greater seed mass in black spruce, but annual precipitation was the controlling factor for white spruce. The combination of factors such as growing season temperature and evapotranspiration, temperature seasonality and annual precipitation together determined seed mass of jack pine. Overall, sites with higher winter temperatures were correlated with larger seeds. Thus, long-term climatic conditions, at least in part, determined spatial variation in seed mass. Black spruce and Jack pine, species with relatively more specific habitat requirements and less plasticity, had more variation in seed mass explained by climate than did the more plastic species white spruce. As traits such as seed mass are related to seedling growth and survival, they

  3. Evaluation of within-litter birth weight variation in piglets

    African Journals Online (AJOL)

    VaZindove

    2014-03-23

    Mar 23, 2014 ... rates. Large weight variation at birth also requires the use of more pens, ... defined as the distribution of individual weights within a litter, has not been ..... the economic values of selection responses from the component traits ...

  4. Changes in seed weight in response to different sources: sink ratio in oilseed rape

    Directory of Open Access Journals (Sweden)

    Francisco M Iglesias

    2014-06-01

    Full Text Available Little knowledge exists about the degree of source, sink and source: sink limitations on mean seed weight in oilseed rape (Brassica napus L.. The objective of this work was to analyze the nature and magnitude on seed weight response to assimilate availability during the effective seed-filling period in oilseed rape. Three Argentinean varieties, Eclipse, Impulse, and Master, were grown under field conditions, and at the beginning of the effective seed filling period, a broad range of source: sink manipulation combinations were produced. Source manipulations consisted of two incoming radiation (R level reductions: 0% (Rn and ~50% (Rs combined with three different sources: sink treatments were applied: C, control; PR, ~50% pod removal, and D, 100% defoliation. Rs significantly reduced yield (15% and MSW (12% with respect to Rn, without significant effects on the rest of the sub yield components. Source:sink manipulation treatments significantly affected all yield components. PR diminished yield by 29%, reducing ca. 40% seeds pl-1 by reductions pods pl-1 (41% with respect to Rn, whereas PR increased MSW by 19%, counterbalancing the reduction in seeds pl-1 and thereby in yield. When considering different seed positions along the main raceme, Rs reduced MSW by 12% independently of seed positions onto the raceme. On the contrary, PR increased MSW in average 17% with respect to C. Results reported here suggest that oilseed rape has source: sink co-limitation during the effective seed filling period, which is apparently higher than wheat and lower than maize.

  5. Seed trichome variation in Hibiscus section Furcaria in East Africa ...

    African Journals Online (AJOL)

    The micromorphology of the seed trichomes in Hibiscus section Furcaria in Tropical East Africa was surveyed. The structure of the trichomes was found to be unique for each species examined, where such trichomes are present. Seed trichomes of specimens of H. altissimus Horny from the Kenya and Tanzania coasts were ...

  6. Variation of germination of eggplant (Solanum melongena L.) seed during storage life

    OpenAIRE

    Ristić, Nevena; Todorović, Vesna; Adžić, Slađan; Zdravković, Jasmina

    2013-01-01

    Eggplant (Solanum melongena L.) seed is dormant, which means that the maximum germination is achieved after some time. The research was performed on one genotype (Domaci srednje dugi - DSD). The seed, studied for germination rate, originates from year 2007 and the germination variation was studied for period 2007 - 2011. Eggplant seed was dormant after yield in 2007, but the germination increased over the years. The trial was conducted at the standard germination test method, defined in the R...

  7. Annual variations in seed yield and implications for multiple use of crabwood

    Directory of Open Access Journals (Sweden)

    Helio Tonini

    2017-12-01

    Full Text Available The objective of this study was to evaluate the annual variation in seed yield of crabwood, and discuss implications for multiple use management of the species. Data were collected in a forest area in the southern of Roraima State in a permanent plot of 9 ha (300 m x 300 m with a natural population of crabwood. Seed production was monitored of 115 trees during four years. Seed yield varied among years. May to July was the period of bigger yield. Few trees (22.6% concentrated the bigger part of seeds yield (80.7% and the most productive trees had diameter at 1.30 m above ground level between 40 cm - 70 cm. Therefore we recommend 70 cm as minimum cutting diameter for wood exploitation. For sustainable crabwood seed management we recommend to restrict seed collection from the most productive trees and only during the period of maximum seed dispersal.

  8. Effects of seed traits variation on seedling performance of the invasive weed, Ambrosia artemisiifolia L.

    Science.gov (United States)

    Ortmans, William; Mahy, Grégory; Monty, Arnaud

    2016-02-01

    Seedling performance can determine the survival of a juvenile plant and impact adult plant performance. Understanding the factors that may impact seedling performance is thus critical, especially for annuals, opportunists or invasive plant species. Seedling performance can vary among mothers or populations in response to environmental conditions or under the influence of seed traits. However, very few studies have investigated seed traits variations and their consequences on seedling performance. Specifically, the following questions have been addressed by this work: 1) How the seed traits of the invasive Ambrosia artemisiifolia L. vary among mothers and populations, as well as along the latitude; 2) How do seed traits influence seedling performance; 3) Is the influence on seedlings temperature dependent. With seeds from nine Western Europe ruderal populations, seed traits that can influence seedling development were measured. The seeds were sown into growth chambers with warmer or colder temperature treatments. During seedling growth, performance-related traits were measured. A high variability in seed traits was highlighted. Variation was determined by the mother identity and population, but not latitude. Together, the temperature, population and the identity of the mother had an effect on seedling performance. Seed traits had a relative impact on seedling performance, but this did not appear to be temperature dependent. Seedling performance exhibited a strong plastic response to the temperature, was shaped by the identity of the mother and the population, and was influenced by a number of seed traits.

  9. VARIATIONS IN SEED TRAITS OF CASTOR (Ricinus communis ...

    African Journals Online (AJOL)

    The fatty acid composition of Malaysian castor seed oil reveals that ... ricinoleic acid content from India and Brazil castor bean oils were ... Standard cultural practices were applied to all plots. .... will influence the utilization of other nutrients by.

  10. Variation in Weed Seed Fate Fed to Different Holstein Cattle Groups.

    Directory of Open Access Journals (Sweden)

    Salman Rahimi

    Full Text Available Weed seeds may maintain their viability when passing through the digestive tract of cattle and can be therefore dispersed by animal movement or the application of manure. Whether different cattle types of the same species can cause differential weed seed fate is largely unknown to us particularly under non-grazed systems similar to Holstein-Friesian dairy farming. We investigated the effect on the seed survival of four weed species in the digestive tracts of four groups of Holstein cattle: lactating cows, feedlot male calves, dry cows and growing heifers. The weed species used were Cuscuta campestris, Polygonum aviculare, Rumex crispus and Sorghum halepense. Cattle excretion was sampled for recovery and viability of seeds at four 24 hourly intervals after seed intake. The highest seed recovery occurred two days after seed intake in all cattle groups. Averaged over weed species, dry and lactating cows had the lowest and highest seed recovery of 36.4% and 74.4% respectively. No significant differences were observed in seed recovery of the four weed species when their seeds were fed to dry cows. Based on a power model fitted to seed viability data, the estimated time to 50% viability loss after seed intake, over all cattle groups ranged from 65 h (R. crispus to 76 h (P. aviculare. Recovered seeds from the dung of feedlot male calves showed the highest mortality among cattle groups. Significant correlation was found between seed viability and ruminal pH (r = 0.86; P<0.05. This study shows that management programs aiming to minimize weed infestation caused by livestock should account for the variation amongst cattle groups in seed persistence. Our findings can be used as a guideline for evaluating the potential risk of the spread of weeds via the application of cattle manure.

  11. Variation in Weed Seed Fate Fed to Different Holstein Cattle Groups.

    Science.gov (United States)

    Rahimi, Salman; Mashhadi, Hamid Rahimian; Banadaky, Mehdi Dehghan; Mesgaran, Mohsen Beheshtian

    2016-01-01

    Weed seeds may maintain their viability when passing through the digestive tract of cattle and can be therefore dispersed by animal movement or the application of manure. Whether different cattle types of the same species can cause differential weed seed fate is largely unknown to us particularly under non-grazed systems similar to Holstein-Friesian dairy farming. We investigated the effect on the seed survival of four weed species in the digestive tracts of four groups of Holstein cattle: lactating cows, feedlot male calves, dry cows and growing heifers. The weed species used were Cuscuta campestris, Polygonum aviculare, Rumex crispus and Sorghum halepense. Cattle excretion was sampled for recovery and viability of seeds at four 24 hourly intervals after seed intake. The highest seed recovery occurred two days after seed intake in all cattle groups. Averaged over weed species, dry and lactating cows had the lowest and highest seed recovery of 36.4% and 74.4% respectively. No significant differences were observed in seed recovery of the four weed species when their seeds were fed to dry cows. Based on a power model fitted to seed viability data, the estimated time to 50% viability loss after seed intake, over all cattle groups ranged from 65 h (R. crispus) to 76 h (P. aviculare). Recovered seeds from the dung of feedlot male calves showed the highest mortality among cattle groups. Significant correlation was found between seed viability and ruminal pH (r = 0.86; Pweed infestation caused by livestock should account for the variation amongst cattle groups in seed persistence. Our findings can be used as a guideline for evaluating the potential risk of the spread of weeds via the application of cattle manure.

  12. Effects of environmental variation during seed production on seed dormancy and germination.

    Science.gov (United States)

    Penfield, Steven; MacGregor, Dana R

    2017-02-01

    The environment during seed production has major impacts on the behaviour of progeny seeds. It can be shown that for annual plants temperature perception over the whole life history of the mother can affect the germination rate of progeny, and instances have been documented where these affects cross whole generations. Here we discuss the current state of knowledge of signal transduction pathways controlling environmental responses during seed production, focusing both on events that take place in the mother plant and those that occur directly as a result of environmental responses in the developing zygote. We show that seed production environment effects are complex, involving overlapping gene networks active independently in fruit, seed coat, and zygotic tissues that can be deconstructed using careful physiology alongside molecular and genetic experiments. © The Author 2016. Published by Oxford University Press on behalf of the Society for Experimental Biology. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  13. Seed crop size variation in the dominant South American conifer Araucaria angustifolia

    Science.gov (United States)

    Souza, Alexandre F.; Uarte de Matos, Daniele; Forgiarini, Cristiane; Martinez, Jaime

    2010-01-01

    Temporal variation in seed crop size of the long-lived pioneer conifer Araucaria angustifolia was studied in subtropical South America. We evaluated the expectations that: 1) A. angustifolia presents highly variable seed production (mast seeding behavior); 2) A. angustifolia has endogenous cycles of reproduction of two or three years; 3) There is a tendency for a high seed production year to be followed by an unusually low production year; 4) populations show synchrony in seed production at a geographical scale; 5) seed crop size is influenced by distinct climatic factors occurring during "key" reproductive stages and 6) as an expression of plant productivity, seed crop size should depend on integrated resource availability during the reproductive cycle. We obtained data from two distinct sources: 1) seed harvesting records from a private forest (14 years), and 2) commercial data from 22 municipalities in the Rio Grande do Sul State. Expectations 1, 2, 3 and 5 were not met, while expectations 4 and 6 were supported by the data. A. angustifolia showed environmentally triggered, continuous, moderately fluctuating, and regionally synchronous reproduction. Seed set seems to track variations in resource abundance as well as respond continuously to improved opportunities for successful regeneration.

  14. A major and stable QTL associated with seed weight in soybean across multiple environments and genetic backgrounds.

    Science.gov (United States)

    Kato, Shin; Sayama, Takashi; Fujii, Kenichiro; Yumoto, Setsuzo; Kono, Yuhi; Hwang, Tae-Young; Kikuchi, Akio; Takada, Yoshitake; Tanaka, Yu; Shiraiwa, Tatsuhiko; Ishimoto, Masao

    2014-06-01

    We detected a QTL for single seed weight in soybean that was stable across multiple environments and genetic backgrounds with the use of two recombinant inbred line populations. Single seed weight (SSW) in soybean is a key determinant of both seed yield and the quality of soy food products, and it exhibits wide variation. SSW is under genetic control, but the molecular mechanisms of such control remain unclear. We have now investigated quantitative trait loci (QTLs) for SSW in soybean and have identified such a QTL that is stable across multiple environments and genetic backgrounds. Two populations of 225 and 250 recombinant inbred lines were developed from crosses between Japanese and US cultivars of soybean that differ in SSW by a factor of ~2, and these populations were grown in at least three different environments. A whole-genome panel comprising 304 simple sequence repeat (SSR) loci was applied to mapping in each population. We identified 15 significant QTLs for SSW dispersed among 11 chromosomes in the two populations. One QTL located between Sat_284 and Sat_292 on chromosome 17 was detected (3.6 soybean.

  15. Low molecular weight squash trypsin inhibitors from Sechium edule seeds.

    Science.gov (United States)

    Laure, Hélen J; Faça, Vítor M; Izumi, Clarice; Padovan, Júlio C; Greene, Lewis J

    2006-02-01

    Nine chromatographic components containing trypsin inhibitor activity were isolated from Sechium edule seeds by acetone fractionation, gel filtration, affinity chromatography and RP-HPLC in an overall yield of 46% of activity and 0.05% of protein. The components obtained with highest yield of total activity and highest specific activity were sequenced by Edman degradation and their molecular masses determined by mass spectrometry. The inhibitors contained 31, 32 and 27 residues per molecule and their sequences were: SETI-IIa, EDRKCPKILMRCKRDSDCLAKCTCQESGYCG; SETI-IIb, EEDRKCPKILMRCKRDSDCLAKCTCQESGYCG and SETI-V, CPRILMKCKLDTDCFPTCTCRPSGFCG. SETI-IIa and SETI-IIb, which differed by an amino-terminal E in the IIb form, were not separable under the conditions employed. The sequences are consistent with consensus sequences obtained from 37 other inhibitors: CPriI1meCk_DSDCla_C_C_G_CG, where capital letters are invariant amino acid residues and lower case letters are the most preserved in this position. SETI-II and SETI-V form complexes with trypsin with a 1:1 stoichiometry and have dissociation constants of 5.4x10(-11)M and 1.1x10(-9)M, respectively.

  16. Genetic variation for drought resistance in small red seeded ...

    African Journals Online (AJOL)

    Common bean (Phaseolus vulgaris L.) productivity is low in major growing regions of Ethiopia mainly due to drought, caused by low and erratic rainfall. A field experiment was carried out at Gofa in Southern Ethiopia, to assess genetic variability for drought resistance in forty-nine small red seeded common bean genotypes ...

  17. Seed morphology and variation in the genus Pachycereus (Cactaceae).

    Science.gov (United States)

    Arias, Salvador; Terrazas, Teresa

    2004-08-01

    Seeds of 13 Pachycereus species and two Stenocereus species that have been suggested as closely related were examined with the scanning electron microscope. Quantitative features were evaluated using multivariate analysis in order to identify characters that distinguish them. Several species groups were recognized on the basis of 16 qualitative characters. All species studied are keeled. Stenocereus aragonii and S. eichlamii share with most Pachycereus species large size, glossy appearance, and a flat relief on periclinal cells in the lateral region. Pachycereus gatesii and P. schottii are unique in having the smallest seeds and a deeply impressed hilum-micropylar region. P. hollianus does not exhibit micro-relief on periclinal walls in the lateral region, and P. fulviceps has no expanded testa border. Multivariate analysis showed that four characters, length, breadth, hilum-micropylar region length, and angle, made the greatest contribution to distinguishing among species groups. More than 80% of P. fulviceps, P. hollianus, P. tepamo, P. weberi, and S. eichlamii seeds could be classified correctly using four seed features and the percentage was even higher using just two or three features for P. gatesii, P. grandis, P. militaris, P. pringlei, and P. schottii. Testa appearance, testa cell-pattern, and position relative to the rim of the hilum-micropylar region were found to be potentially informative and should be combined with other sources of data in future phylogenetic analyses.

  18. Quantitative Genetics Identifies Cryptic Genetic Variation Involved in the Paternal Regulation of Seed Development.

    Directory of Open Access Journals (Sweden)

    Nuno D Pires

    2016-01-01

    Full Text Available Embryonic development requires a correct balancing of maternal and paternal genetic information. This balance is mediated by genomic imprinting, an epigenetic mechanism that leads to parent-of-origin-dependent gene expression. The parental conflict (or kinship theory proposes that imprinting can evolve due to a conflict between maternal and paternal alleles over resource allocation during seed development. One assumption of this theory is that paternal alleles can regulate seed growth; however, paternal effects on seed size are often very low or non-existent. We demonstrate that there is a pool of cryptic genetic variation in the paternal control of Arabidopsis thaliana seed development. Such cryptic variation can be exposed in seeds that maternally inherit a medea mutation, suggesting that MEA acts as a maternal buffer of paternal effects. Genetic mapping using recombinant inbred lines, and a novel method for the mapping of parent-of-origin effects using whole-genome sequencing of segregant bulks, indicate that there are at least six loci with small, paternal effects on seed development. Together, our analyses reveal the existence of a pool of hidden genetic variation on the paternal control of seed development that is likely shaped by parental conflict.

  19. Natural variation and QTL analysis for cationic mineral content in seeds of Arabidopsis thaliana.

    NARCIS (Netherlands)

    Vreugdenhil, D.; Aarts, M.G.M.; Koornneef, M.; Nelissen, H.J.M.; Ernst, W.H.O.

    2004-01-01

    Naturally occurring genetic variation for contents of cationic minerals in seeds of Arabidopsis thaliana was studied by screening a series of accessions (ecotypes) for Ca, Fe, K, Mg, Mn, Na, Zn, and for total contents of P. Variation was observed for all minerals and correlations between contents of

  20. Variations in seed traits of castor ( Ricinus communis ) accessions ...

    African Journals Online (AJOL)

    The physicochemical analysis showed that castor seed and oil had saponification value of 182.9 mg/g, moisture content of 4.4%, acid value of 3.085 mg/g, viscosity of 110.41 cP, pH of 6.11, iodine value of 8.46 mg/g, specific gravity of 0.962 and refractive index of 1.477˚C. The proximate analysis showed that moisture ...

  1. Natural variation for seed longevity and seed dormancy are negatively correlated in Arabidopsis

    NARCIS (Netherlands)

    Nguyen, T.P.; Keizer, L.C.P.; Eeuwijk, van F.; Smeekens, S.C.M.; Bentsink, L.

    2012-01-01

    Dormancy is a state of metabolic arrest that facilitates the survival of organisms during environmental conditions incompatible with their regular course of life. Many organisms have deep dormant stages to promote an extended life span (increased longevity). In contrast, plants have seed dormancy

  2. Using soil seed banks to assess temporal patterns of genetic variation in invasive plant populations

    OpenAIRE

    Fennell, Mark; Gallagher, Tommy; Vintro, Luis Leon; Osborne, Bruce

    2014-01-01

    Most research on the genetics of invasive plant species has focused on analyzing spatial differences among existing populations. Using a long-established Gunnera tinctoria population from Ireland, we evaluated the potential of using plants derived from seeds associated with different soil layers to track genetic variation through time. This species and site were chosen because (1) G. tinctoria produces a large and persistent seed bank; (2) it has been present in this locality, Sraheens, for ∼...

  3. Characterization and quantitation of low and high molecular weight phenolic compounds in apple seeds.

    Science.gov (United States)

    Fromm, Matthias; Bayha, Sandra; Carle, Reinhold; Kammerer, Dietmar R

    2012-02-08

    The phenolic constituents of seeds of 12 different apple cultivars were fractionated by sequential extraction with aqueous acetone (30:70, v/v) and ethyl acetate after hexane extraction of the lipids. Low molecular weight phenolic compounds were individually quantitated by RP-HPLC-DAD. The contents of extractable and nonextractable procyanidins were determined by applying RP-HPLC following thiolysis and n-butanol/HCl hydrolysis, respectively. As expected, the results revealed marked differences of the ethyl acetate extracts, aqueous acetone extracts, and insoluble residues with regard to contents and mean degrees of polymerization of procyanidins. Total phenolic contents in the defatted apple seed residues ranged between 18.4 and 99.8 mg/g. Phloridzin was the most abundant phenolic compound, representing 79-92% of monomeric polyphenols. Yields of phenolic compounds significantly differed among the cultivars under study, with seeds of cider apples generally being richer in phloridzin and catechins than seeds of dessert apple cultivars. This is the first study presenting comprehensive data on the contents of phenolic compounds in apple seeds comprising extractable and nonextractable procyanidins. Furthermore, the present work points out a strategy for the sustainable and complete exploitation of apple seeds as valuable agro-industrial byproducts, in particular as a rich source of phloridzin and antioxidant flavanols.

  4. Classification of viable and non-viable spinach (Spinacia oleracea L.) seeds by single seed near infrared spectroscopy and extended canonical variates analysis

    DEFF Research Database (Denmark)

    Olesen, Merete Halkjær; Shetty, Nisha; Gislum, René

    2011-01-01

    ). Assigning the difference of scatter corrected absorbance spectra from aged and non-aged seeds also lead to CH2, CH3 and HC=CH structures, which are some of the functional groups in lipids. In the ECVA plot, there was a clear difference between seeds with and without a pericarp. Evaluating the spectra...... studies. Spinach (Spinacia oleracea L.) is the major crop in vegetable seed production in Denmark and two seed lots with viability percentages of 90% and 97% were chosen for examination by single seed NIR spectroscopy. Lipids play a major role in both ageing and germination. During accelerated ageing......, lipid peroxidation leads to deterioration of cell membranes and contributes in that way to reducing seed viability of the seed sample. These biochemical changes may be the reason for a clear grouping between aged and non-aged seeds when performing the extended canonical variates analysis (ECVA...

  5. Temporal patterns of genetic variation across a 9-year-old aerial seed bank of the shrub Banksia hookeriana (Proteaceae).

    Science.gov (United States)

    Barrett, Luke G; He, Tianhua; Lamont, Byron B; Krauss, Siegfried L

    2005-11-01

    The pattern of accumulation of genetic variation over time in seed banks is poorly understood. We examined the genetic structure of the aerial seed bank of Banksia hookeriana within a single 15-year-old population in fire-prone southwestern Australia, and compared genetic variation between adults and each year of a 9-year-old seed bank using amplified fragment length polymorphism (AFLP). B. hookeriana is well suited to the study of seed bank dynamics due to the canopy storage of its seeds, and because each annual crop can be identified. A total of 304 seeds from nine crop years and five maternal plants were genotyped, along with 113 plants from the adult population. Genetic variation, as assessed by the proportion of polymorphic markers (P(p)) and Shannon's index (I), increased slightly within the seed bank over time, while gene diversity (H(j)), did not change. P(p), I, and H(j) all indicated that genetic variation within the seed bank quickly approached the maximal level detected. Analysis of molecular variance revealed that less than 4% of variation could be accounted for by variation among seeds produced in different years, whereas there was greater differentiation among maternal plants (12.7%), and among individual seeds produced by different maternal plants (83.4%). With increasing population age, offspring generated each year were slightly more outbred, as indicated by an increase in the mean number of nonmaternal markers per offspring. There were no significant differences for H(j) or I between adults and the seed bank. Viability of seeds decreased with age, such that the viability of 9-year-old seeds was half that of 2-year-old seeds. These results suggest that variable fire frequencies have only limited potential to influence the amount of genetic variation stored within the seed bank of B. hookeriana.

  6. Variation in the protein profiles in the gamma-irradiated chick pea (Cicer arietinum L.) seeds

    International Nuclear Information System (INIS)

    Farook, S.A.F.; Nizam, Jafar

    1978-01-01

    Water soluble seed proteins from the control as well as gamma ray treated material from the M 2 generation of Chick pea (Cicer arietinum L.) were separated by disc electrophoresis using 7.5 percent poly acrylamide gels. Average Rf values and percentage of similarity values were calculated. The comparisons of number and Rf values of protein bands were made to elucidate the differences in the treated material. Differences obtained in the seed protein profiles of the treated material suggest the presence of the qualitative variation in the proteins. Attempts were made to correlate the variation in the protein bands with the morphological changes in the mutants. (author)

  7. Experiments on Growth and Variation of Spaceship Loaded Plant Seeds

    Energy Technology Data Exchange (ETDEWEB)

    Kang, S. Y.; Lee, G. J.; Kim, D. S.; Kim, J. B.

    2008-08-15

    This educational experiment was designed (1)to obtain the basic information on the effects of the space environments on plant growth and mutagenesis, (2)to evaluate plant germination and seedling growth under the effect of microgravity and light conditions and (3)to improve a child's scientific mind through the real-time observations of a seedling growth for two plants conducted both in space and on earth. This project was implemented?as one of the missions in the Korean Astronaut Program. Seeds of eleven plant species (rice, soybean, rape, radish, hot pepper, perilla, arabidopsis, orchids, dandelion, hibiscus, cosmos) was vacuum-sealed in aluminium bags. Those seeds was loaded in the 'Progress' spaceship in Feb. 2008, traveled in the 'Progress', placed in the Russian Sector-International Space Station (RS-ISS), and then was brought by the Korean astronaut from the RS-ISS, and handed over to us at Korea Atomic Energy Research Institute(KAERI). The germination rate, plant growth and mutation type/frequency of the returned plants are under testing in the lab and field in KAERI now. The first Korean astronaut, Dr. So-Yeon Yi, who had returned to earth on April 19, 2008 after successfully completing her scientific mission for 12 days in Space, performed the experiment of plant germination and seedling growth in the International Space Station (ISS), and a similarly designed experiment kit was distributed to conduct the experiment by student and adult volunteers in Korea at the same time. The experiment was to observe the effects of microgravity and light on a seedling growth for soybean and radish. We designed a growth kit that was an all-in-one package consisting of seeds (12 seeds in each chamber) and rock wool as a growing medium filled in four polycarbonate growing chambers in a light proof textile bag or carton paper. The bottom of the chamber was filled with a tightly-fitted rock wool which can hold water and provide moisture during a

  8. Experiments on Growth and Variation of Spaceship Loaded Plant Seeds

    International Nuclear Information System (INIS)

    Kang, S. Y.; Lee, G. J.; Kim, D. S.; Kim, J. B.

    2008-08-01

    This educational experiment was designed (1)to obtain the basic information on the effects of the space environments on plant growth and mutagenesis, (2)to evaluate plant germination and seedling growth under the effect of microgravity and light conditions and (3)to improve a child's scientific mind through the real-time observations of a seedling growth for two plants conducted both in space and on earth. This project was implemented?as one of the missions in the Korean Astronaut Program. Seeds of eleven plant species (rice, soybean, rape, radish, hot pepper, perilla, arabidopsis, orchids, dandelion, hibiscus, cosmos) was vacuum-sealed in aluminium bags. Those seeds was loaded in the 'Progress' spaceship in Feb. 2008, traveled in the 'Progress', placed in the Russian Sector-International Space Station (RS-ISS), and then was brought by the Korean astronaut from the RS-ISS, and handed over to us at Korea Atomic Energy Research Institute(KAERI). The germination rate, plant growth and mutation type/frequency of the returned plants are under testing in the lab and field in KAERI now. The first Korean astronaut, Dr. So-Yeon Yi, who had returned to earth on April 19, 2008 after successfully completing her scientific mission for 12 days in Space, performed the experiment of plant germination and seedling growth in the International Space Station (ISS), and a similarly designed experiment kit was distributed to conduct the experiment by student and adult volunteers in Korea at the same time. The experiment was to observe the effects of microgravity and light on a seedling growth for soybean and radish. We designed a growth kit that was an all-in-one package consisting of seeds (12 seeds in each chamber) and rock wool as a growing medium filled in four polycarbonate growing chambers in a light proof textile bag or carton paper. The bottom of the chamber was filled with a tightly-fitted rock wool which can hold water and provide moisture during a seedling growth. The

  9. [Variation of muscle mass and weight in critical patient].

    Science.gov (United States)

    Valls-Matarín, J; del Cotillo-Fuente, M; Grané-Mascarell, N; Quintana, S

    2015-01-01

    Quantify the muscle mass and body weight variation in critically ill patients and to identify associated factors. A descriptive follow-up study. Data for demographic variables, body weight, fluid balance, daily kilocalories, the amount of sedation and muscle relaxants received and motor physiotherapy applied were collected. Three consecutive measurements were performed in the brachial biceps and quadriceps rectus by using ultrasound, upon admission and every 5 days until discharge. 68 patients were included. Average age was of 73.5 [57-78,5] years. The median length of stay was 9.5 [5.5 -15] days. The median 16 (SD=5.7) daily kilocalories per kg/weight, 91.2% received sedation, 44.1% received muscle relaxants and 20% received physiotherapy. The patients presented a muscle wasting of 4.9 (SD=3.9)mm, p <.001 in the brachial biceps and 5.6 (SD=4.8)mm, p <.001 in the quadriceps rectus. Regression analysis selected the length of stay and the muscle relaxants are the most influential variables in the brachial biceps muscle wasting (R2=0.4), and length of stay as the most influential in the quadriceps rectus muscle wasting (R2=0.3). Patient's mean body weight on admission was of 81.1 (SD=15)kg and 81.2 (SD=14.2)kg on discharge, p=.95. The critically ill patient presents a significant muscle waste related with the length of stay and the treatment received with muscle relaxants. Patients are being discharged with a similar body weight to which they were admitted but with a significant reduction of muscle mass. Copyright © 2014 Elsevier España, S.L.U. y SEEIUC. All rights reserved.

  10. Seed Bank Variation under Contrasting Site Quality Conditions in Mixed Oak Forests of Southeastern Ohio, USA

    International Nuclear Information System (INIS)

    Small, Ch.J.; McCarthy, B.C.

    2010-01-01

    Seed bank composition was sampled in 192-2.5 m 2 quadrats, established in six regenerating clearcut (∼7 years) and six second-growth ((∼125 years) mixed-oak forest stands in southeastern Ohio. Seed bank and aboveground composition diverged markedly (Sorensen's coefficient <10%), emphasizing the importance of fast-growing, early-successional germinants to early ecosystem recovery. Seed richness was significantly (ρ<.01) higher in clearcut stands, suggesting declining richness with stand age. Richness estimations 28%-60% higher than observed values demonstrated high seed bank heterogeneity, emphasizing the need for intensive sampling to assess temperate forest seed bank variation. Site quality (topographic aspect) strongly influenced seed bank composition, with greater importance of early-successional trees, thicket-forming shrubs, and nonnative species on mesic sites. Thus, forest seed banks are likely to play an important, site-dependent role in shaping competitive environments for commercially important timber species after harvesting and soil disturbance and have the potential for marked influence on post harvest forest development.

  11. Seed Bank Variation under Contrasting Site Quality Conditions in Mixed Oak Forests of Southeastern Ohio, USA

    Directory of Open Access Journals (Sweden)

    Christine J. Small

    2010-01-01

    Full Text Available Seed bank composition was sampled in 192–2.5 m2 quadrats, established in six regenerating clearcut (∼7 years and six second-growth (∼125 years mixed-oak forest stands in southeastern Ohio. Seed bank and aboveground composition diverged markedly (Sørensen's coefficient <10%, emphasizing the importance of fast-growing, early-successional germinants to early ecosystem recovery. Seed richness was significantly (P<.01 higher in clearcut stands, suggesting declining richness with stand age. Richness estimations 28%–60% higher than observed values demonstrated high seed bank heterogeneity, emphasizing the need for intensive sampling to assess temperate forest seed bank variation. Site quality (topographic aspect strongly influenced seed bank composition, with greater importance of early-successional trees, thicket-forming shrubs, and nonnative species on mesic sites. Thus, forest seed banks are likely to play an important, site-dependent role in shaping competitive environments for commercially important timber species after harvesting and soil disturbance and have the potential for marked influence on postharvest forest development.

  12. Use of linear discriminant function analysis in seed morphotype ...

    African Journals Online (AJOL)

    Variation in seed morphology of the Lima bean in 31 accessions was studied. Data were collected on 100-seed weight, seed length and seed width. The differences among the accessions were significant, based on the three seed characteristics. K-means cluster analysis grouped the 31 accessions into four distinct groups, ...

  13. Analysis of natural allelic variation at seed dormancy loci of Arabidopsis thaliana

    NARCIS (Netherlands)

    Alonso-Blanco, C.; Bentsink, L.; Hanhart, C.J.; Vries, de M.H.C.; Koornneef, M.

    2003-01-01

    Arabidopsis accessions differ largely in their seed dormancy behavior. To understand the genetic basis of this intraspecific variation we analyzed two accessions: the laboratory strain Landsberg erecta (Ler) with low dormancy and the strong-dormancy accession Cape Verde Islands (Cvi). We used a

  14. Ecological, historical and evolutionary determinants of modularity in weighted seed-dispersal networks

    DEFF Research Database (Denmark)

    Schleuning, Matthias; Ingmann, Lili; Strauß, Rouven

    2014-01-01

    Modularity is a recurrent and important property of bipartite ecological networks. Although well-resolved ecological networks describe interaction frequencies between species pairs, modularity of bipartite networks has been analysed only on the basis of binary presence-absence data. We employ a new...... algorithm to detect modularity in weighted bipartite networks in a global analysis of avian seed-dispersal networks. We define roles of species, such as connector values, for weighted and binary networks and associate them with avian species traits and phylogeny. The weighted, but not binary, analysis...... identified a positive relationship between climatic seasonality and modularity, whereas past climate stability and phylogenetic signal were only weakly related to modularity. Connector values were associated with foraging behaviour and were phylogenetically conserved. The weighted modularity analysis...

  15. Maximum weight of greenhouse effect to global temperature variation

    International Nuclear Information System (INIS)

    Sun, Xian; Jiang, Chuangye

    2007-01-01

    Full text: The global average temperature has risen by 0.74 0 C since the late 19th century. Many studies have concluded that the observed warming in the last 50 years may be attributed to increasing concentrations of anthropogenic greenhouse gases. But some scientists have a different point of view. Global climate change is affected not only by anthropogenic activities, but also constraints in climate system natural factors. How much is the influencing weight of C02's greenhouse effects to the global temperature variation? Does global climate continue warming or decreasing in the next 20 years? They are two hot spots in global climate change. The multi-timescales analysis method - Empirical mode decomposition (EMD) is used to diagnose global annual mean air temperature dataset for land surface provided by IPCC and atmospheric content of C02 provided by the Carbon Dioxide Information Analysis Center (CDIAC) during 1881-2002. The results show that: Global temperature variation contains quasi-periodic oscillations on four timescales (3 yr, 6 yr, 20 yr and 60 yr, respectively) and a century-scale warming trend. The variance contribution of IMF1-IMF4 and trend is 17.55%, 11.34%, 6.77%, 24.15% and 40.19%, respectively. The trend and quasi-60 yr oscillation of temperature variation are the most prominent; C02's greenhouse effect on global temperature variation is mainly century-scale trend. The contribution of C02 concentration to global temperature variability is not more than 40.19%, whereas 59.81% contribution to global temperature variation is non-greenhouse effect. Therefore, it is necessary to re-study the dominant factors that induce the global climate change; It has been noticed that on the periods of 20 yr and 60 yr oscillation, the global temperature is beginning to decreased in the next 20 years. If the present C02 concentration is maintained, the greenhouse effect will be too small to countercheck the natural variation in global climate cooling in the next 20

  16. Variations in Cooking time with Some physico-chemical properties of stored pea dry seeds

    International Nuclear Information System (INIS)

    Ahmed, H. S.

    2006-01-01

    Cooking time is one of the most important aspects of food quality. Correlation of cooking time with certain quality attributes of stored pea dry seeds were investigated to verify previous findings in faba bean concerning the relationship between cooking time and these characters. Moreover, the study aimed at finding out indices for selection of early cooking pea types. Accordingly, the time when 50% of pea dry seeds considered cooked was determined for six pea genotypes grown at shambat in the season 1999/2000. This parameter revealed significant variance and wide range of variability (84.33-115.33 min) indicating various degrees of seed hardness. Similarly, marked differences in 100-seed weight, test a, cotyledon, moisture, ash and potassium content were recorded due to genotypes. Cooking time showed significant positive correlations (r = 0.892,<0.0001 and r = 0.504, P< 0.0310) with seed weight and cotyledon percentage, respectively, and significant negative correlations (r = - 0.907, P< 0.0001 and r = - 0.505, P=0.0313) with ash and test a percentages, respectively. (Author)

  17. Seed metabolomic study reveals significant metabolite variations and correlations among different soybean cultivars.

    Science.gov (United States)

    Lin, Hong; Rao, Jun; Shi, Jianxin; Hu, Chaoyang; Cheng, Fang; Wilson, Zoe A; Zhang, Dabing; Quan, Sheng

    2014-09-01

    Soybean [Glycine max (L.) Merr.] is one of the world's major crops, and soybean seeds are a rich and important resource for proteins and oils. While "omics" studies, such as genomics, transcriptomics, and proteomics, have been widely applied in soybean molecular research, fewer metabolomic studies have been conducted for large-scale detection of low molecular weight metabolites, especially in soybean seeds. In this study, we investigated the seed metabolomes of 29 common soybean cultivars through combined gas chromatography-mass spectrometry and ultra-performance liquid chromatography-tandem mass spectrometry. One hundred sixty-nine named metabolites were identified and subsequently used to construct a metabolic network of mature soybean seed. Among the 169 detected metabolites, 104 were found to be significantly variable in their levels across tested cultivars. Metabolite markers that could be used to distinguish genetically related soybean cultivars were also identified, and metabolite-metabolite correlation analysis revealed some significant associations within the same or among different metabolite groups. Findings from this work may potentially provide the basis for further studies on both soybean seed metabolism and metabolic engineering to improve soybean seed quality and yield. © 2014 Institute of Botany, Chinese Academy of Sciences.

  18. Seed metabolomic study reveals significant metabolite variations and correlations among different soybean cultivars

    Institute of Scientific and Technical Information of China (English)

    Hong Lin; Jun Rao; Jianxin Shi; Chaoyang Hu; Fang Cheng; Zoe AWilson; Dabing Zhang; Sheng Quan

    2014-01-01

    Soybean [Glycine max (L.) Merr.] is one of the world’s major crops, and soybean seeds are a rich and important resource for proteins and oils. While “omics”studies, such as genomics, transcriptomics, and proteomics, have been widely applied in soybean molecular research, fewer metabolomic studies have been conducted for large-scale detection of low molecular weight metabolites, especial y in soybean seeds. In this study, we investigated the seed metabolomes of 29 common soybean cultivars through combined gas chromatography-mass spectrometry and ultra-performance liquid chromatography-tandem mass spectrometry. One hundred sixty-nine named metabolites were identified and subsequently used to construct a metabolic network of mature soybean seed. Among the 169 detected metabolites, 104 were found to be significantly variable in their levels across tested cultivars. Metabolite markers that could be used to distinguish genetical y related soybean cultivars were also identified, and metabolite-metabolite correlation analysis revealed some significant associations within the same or among different metabolite groups. Findings from this work may potentially provide the basis for further studies on both soybean seed metabolism and metabolic engineering to improve soybean seed quality and yield.

  19. Global biogeography of mating system variation in seed plants.

    Science.gov (United States)

    Moeller, David A; Briscoe Runquist, Ryan D; Moe, Annika M; Geber, Monica A; Goodwillie, Carol; Cheptou, Pierre-Olivier; Eckert, Christopher G; Elle, Elizabeth; Johnston, Mark O; Kalisz, Susan; Ree, Richard H; Sargent, Risa D; Vallejo-Marin, Mario; Winn, Alice A

    2017-03-01

    Latitudinal gradients in biotic interactions have been suggested as causes of global patterns of biodiversity and phenotypic variation. Plant biologists have long speculated that outcrossing mating systems are more common at low than high latitudes owing to a greater predictability of plant-pollinator interactions in the tropics; however, these ideas have not previously been tested. Here, we present the first global biogeographic analysis of plant mating systems based on 624 published studies from 492 taxa. We found a weak decline in outcrossing rate towards higher latitudes and among some biomes, but no biogeographic patterns in the frequency of self-incompatibility. Incorporating life history and growth form into biogeographic analyses reduced or eliminated the importance of latitude and biome in predicting outcrossing or self-incompatibility. Our results suggest that biogeographic patterns in mating system are more likely a reflection of the frequency of life forms across latitudes rather than the strength of plant-pollinator interactions. © 2017 John Wiley & Sons Ltd/CNRS.

  20. Coffee seeds isotopic composition as a potential proxy to evaluate Minas Gerais, Brazil seasonal variations during seed maturation

    Science.gov (United States)

    Rodrigues, Carla; Maia, Rodrigo; Brunner, Marion; Carvalho, Eduardo; Prohaska, Thomas; Máguas, Cristina

    2010-05-01

    Plant seeds incorporate the prevailing climate conditions and the physiological response to those conditions (Rodrigues et al., 2009; Rodrigues et al., submitted). During coffee seed maturation the biochemical compounds may either result from accumulated material in other organs such as leafs and/or from new synthesis. Accordingly, plant seeds develop in different stages along a particular part of the year, integrating the plant physiology and seasonal climatic conditions. Coffee bean is an extremely complex matrix, rich in many products derived from both primary and secondary metabolism during bean maturation. Other studies (De Castro and Marraccini, 2006) have revealed the importance of different coffee plant organs during coffee bean development as transfer tissues able to provide compounds (i.e. sugars, organic acids, etc) to the endosperm where several enzymatic activities and expressed genes have been reported. Moreover, it has been proved earlier on that green coffee bean is a particularly suitable case-study (Rodrigues et al., 2009; Rodrigues et al., submitted), not only due to the large southern hemispheric distribution but also because of this product high economic interest. The aim of our work was to evaluate the potential use of green coffee seeds as a proxy to seasonal climatic conditions during coffee bean maturation, through an array of isotopic composition determinations. We have determined carbon, nitrogen, oxygen and sulfur isotopic composition (by IRMS - Isotope Ratio Mass Spectrometry) as well as strontium isotope abundance (by MC-ICP-MS; Multicollector Inductively Coupled Plasma Mass Spectrometry), of green coffee beans harvested at different times at Minas Gerais, Brazil. The isotopic composition data were combined with air temperature and relative humidity data registered during the coffee bean developmental period, and with the parent rock strontium isotopic composition. Results indicate that coffee seeds indeed integrate the interactions

  1. Characteristics and bioactivities of different molecular weight polysaccharides from camellia seed cake.

    Science.gov (United States)

    Xu, Zhou; Li, Xu; Feng, Shiling; Liu, Jing; Zhou, Lijun; Yuan, Ming; Ding, Chunbang

    2016-10-01

    Four polysaccharides, namely COP-1, COP-2, COP-3 and COP-4, were ultrafiltrated from crud Camellia oleifera seed cake polysaccharides (COP-c), purified, and characterized, including the determination of antioxidant and antiproliferative activities. Their molecular weights were 7.9, 36, 83 and 225kDa, respectively. All COPs showed the similar FT-IR spectrums, but significant differentials in monosaccharide components. COP-2 exhibited the highest radical scavenging abilities. COP-1 has the strongest metal chelating capabilities. Although with higher molecular weight, COP-4 showed the poorest antioxidant abilities. These results suggested appreciate molecular weight COP possessed a better antioxidant activities. Additionally, all COPs had non-significant antiproliferative abilities in HaLa and HepG2 cells. Copyright © 2016 Elsevier B.V. All rights reserved.

  2. Differences in glycosyltransferase family 61 accompany variation in seed coat mucilage composition in Plantago spp.

    Science.gov (United States)

    Phan, Jana L.; Tucker, Matthew R.; Khor, Shi Fang; Shirley, Neil; Lahnstein, Jelle; Beahan, Cherie; Bacic, Antony; Burton, Rachel A.

    2016-01-01

    Xylans are the most abundant non-cellulosic polysaccharide found in plant cell walls. A diverse range of xylan structures influence tissue function during growth and development. Despite the abundance of xylans in nature, details of the genes and biochemical pathways controlling their biosynthesis are lacking. In this study we have utilized natural variation within the Plantago genus to examine variation in heteroxylan composition and structure in seed coat mucilage. Compositional assays were combined with analysis of the glycosyltransferase family 61 (GT61) family during seed coat development, with the aim of identifying GT61 sequences participating in xylan backbone substitution. The results reveal natural variation in heteroxylan content and structure, particularly in P. ovata and P. cunninghamii, species which show a similar amount of heteroxylan but different backbone substitution profiles. Analysis of the GT61 family identified specific sequences co-expressed with IRREGULAR XYLEM 10 genes, which encode putative xylan synthases, revealing a close temporal association between xylan synthesis and substitution. Moreover, in P. ovata, several abundant GT61 sequences appear to lack orthologues in P. cunninghamii. Our results indicate that natural variation in Plantago species can be exploited to reveal novel details of seed coat development and polysaccharide biosynthetic pathways. PMID:27856710

  3. Relationships Between Seed Weight, Germination Potential and Biochemical Reserves of Maritime Pine in Morocco: Elements for Tree Seedlings Improvement

    Science.gov (United States)

    Wahid, Nadya; Bounoua, Lahouari

    2011-01-01

    Selection of quality seeds in breeding programs can significantly improve seedling productivity. Germination and biochemical analyses on seeds from ten natural populations of maritime pine (Pinus pinaster Ait.) in Morocco reveals significant differences among populations in seed weight, germination characters and protein content in both dry seeds and megagametophytes. During germination, the mobilization of protein content in megagametophyte is significantly different among populations than sugar content. A strong positive correlation between the germination capacity and the protein content in both dry seeds and megagametophytes indicates that the best populations in term of germination capacity may also be the richest in protein content. The present study finds that seed weight is not a good indicator for quality seed selection, nor is it recommended to increase the degree of germinability. Our results suggest that the pine population in southern Morocco might have adapted to drought conditions as it is characterized by heavy seed weight and lower speed of protein content mobilization in megagametophyte compared to northern populations growing in temperate climate.

  4. Variation of lipid and fatty acid compositions in Thai Perilla seeds grown at different locations

    Directory of Open Access Journals (Sweden)

    Maitree Suttajit

    2006-03-01

    Full Text Available Perilla or Nga-Kee-Mon (Perilla frutescens seed has long been known as a rich source of α-linolenic acid (18:3, n-3. It is widely cultivated throughout Thailand. However, there are no data on the variation of lipid and fatty acid compositions among crops from different regions. The aim of this study was to examine the compositions of lipids and fatty acids in Thai perilla seed grown at different locations. Two different perilla seeds were harvested from Maehongsorn and Chiang Mai districts, and one commercial perilla was purchased from local market. Seeds were ground, lipid was extracted with chloroform: methanol (2:1, v/v and its composition determined by Iatroscan (TLC/FID. Fatty acid composition was analyzed with GLC using standard methods. Lipid content was between 34-36% (w/w. Triacylglycerol was a predominant lipid in perilla seed (97% of total lipids, and a minor component was phytosterol (3% of total lipids. The ratio of saturates: monounsaturates: polyunsaturates was approximately 1: 1: 8. Most predominant fatty acid was α-linolenic acid (18:3, n-3 (55-60% of total fatty acid. Seeds from Maehongsorn district had the highest concentration of α-linolenic acid, and commercial perilla had the lowest (P<0.05. Other two predominant fatty acids were linoleic acid (18:2, n-6 (18-22% of total fatty acid and oleic acid (18:1 (11-13% of total fatty acid. The results showed that the compositions of lipids and fatty acids in Thai perilla seeds varied significantly among samples from different locations.

  5. Using soil seed banks to assess temporal patterns of genetic variation in invasive plant populations.

    Science.gov (United States)

    Fennell, Mark; Gallagher, Tommy; Vintro, Luis Leon; Osborne, Bruce

    2014-05-01

    Most research on the genetics of invasive plant species has focused on analyzing spatial differences among existing populations. Using a long-established Gunnera tinctoria population from Ireland, we evaluated the potential of using plants derived from seeds associated with different soil layers to track genetic variation through time. This species and site were chosen because (1) G. tinctoria produces a large and persistent seed bank; (2) it has been present in this locality, Sraheens, for ∼90 years; (3) the soil is largely undisturbed; and (4) the soil's age can be reliably determined radiometrically at different depths. Amplified fragment length polymorphic markers (AFLPs) were used to assess differences in the genetic structure of 75 individuals sampled from both the standing population and from four soil layers, which spanned 18 cm (estimated at ∼90 years based on (210)Pb and (137)Cs dating). While there are difficulties in interpreting such data, including accounting for the effects of selection, seed loss, and seed migration, a clear pattern of lower total allele counts, percentage polymorphic loci, and genetic diversity was observed in deeper soils. The greatest percentage increase in the measured genetic variables occurred prior to the shift from the lag to the exponential range expansion phases and may be of adaptive significance. These findings highlight that seed banks in areas with long-established invasive populations can contain valuable genetic information relating to invasion processes and as such, should not be overlooked.

  6. Interspecific variation of total seed protein in wild rice germplasm using SDS-Page

    International Nuclear Information System (INIS)

    Shah, S.M.A.; Hidayat-ur-Rahman; Abbasi, F.M.; Ashiq, M.; Rabbani, A.M.; Khan, I.A.; Shinwari, Z.K.; Shah, Z.

    2011-01-01

    Variation in seed protein of 14 wild rice species (Oryza spp.) along with cultivated rice species (O. sativa) was studied using sodium dodecyl sulphate polyacrylamide gel electrophoresis (SDS-PAGE) to assess genetic diversity in the rice germplasm. SDS bands were scored as present (1) or absent (0) for protein sample of each genotype. On the basis of cluster analysis, four clusters were identified at a similarity level of 0.85. O. nivara, O. rufipogon and O. sativa with AA genomes constituted the first cluster. The second cluster comprised O. punctata of BB genome and wild rice species of CC genome i.e., O. rhizomatis and O. officinalis. However, it also contained O. barthii and O. glumaepatula of AA genome. O. australiensis with EE genome, and O. latifolia, O. alta and O. grandiglumis having CCDD genomes comprised the third cluster. The fourth cluster consisted of wild rice species, O. brachyantha with EE genome along with two other wild rice species, O. longistaminata and O. meridionalis of AA genome. Overall, on the basis of total seed protein, the grouping pattern of rice genotypes was mostly compatible with their genome status. The results of the present work depicted considerable interspecific genetic variation in the investigated germplasm for total seed protein. Moreover, the results obtained in this study also suggest that analysis of seed protein can also provide a better understanding of genetic affinity of the germplasm. (author)

  7. Selecting sagebrush seed sources for restoration in a variable climate: ecophysiological variation among genotypes

    Science.gov (United States)

    Germino, Matthew J.

    2012-01-01

    Big sagebrush (Artemisia tridentata) communities dominate a large fraction of the United States and provide critical habitat for a number of wildlife species of concern. Loss of big sagebrush due to fire followed by poor restoration success continues to reduce ecological potential of this ecosystem type, particularly in the Great Basin. Choice of appropriate seed sources for restoration efforts is currently unguided due to knowledge gaps on genetic variation and local adaptation as they relate to a changing landscape. We are assessing ecophysiological responses of big sagebrush to climate variation, comparing plants that germinated from ~20 geographically distinct populations of each of the three subspecies of big sagebrush. Seedlings were previously planted into common gardens by US Forest Service collaborators Drs. B. Richardson and N. Shaw, (USFS Rocky Mountain Research Station, Provo, Utah and Boise, Idaho) as part of the Great Basin Native Plant Selection and Increase Project. Seed sources spanned all states in the conterminous Western United States. Germination, establishment, growth and ecophysiological responses are being linked to genomics and foliar palatability. New information is being produced to aid choice of appropriate seed sources by Bureau of Land Management and USFS field offices when they are planning seed acquisitions for emergency post-fire rehabilitation projects while considering climate variability and wildlife needs.

  8. Genetic variation of soybean agronomic characters induced by irradiation of seed

    International Nuclear Information System (INIS)

    He Zhihong; Wang Jinling

    1988-02-01

    Dry seeds of three soybean varieties were irradiated by 60 Co γ ray with dosage of 4.1C/kg. The varieties irradiated were Fengshou No. 10, Donghong 74-403 and Heinong No. 26, and nonirradiated seeds of the corresponding variety was used as a control. The following genetic parameters of the nine agronomic characters were estimated, including genotypic coefficient of variation, genotypic variance, broad sense heritanility and genetic advance expected through selection. Three types of plant in M 2 and M 3 were used for the estimation of these parameters which comprise semisterility (MS), fertility (MF) in M 1 and control (CK). The genetic advance expected through selection was compared with the actual effect of selection for date of maturity, seed weigh per plant and 100 seed wight. The pattern of the genetic variation in the early generations of the induced population was analysed. Problems of selection for main agronomic characters in the early generations, and significance of fertility of M 1 plants for mutation breeding were discussed

  9. Different effects of variation in Xanthium strumarium L. (Compositae) on two insect seed predators.

    Science.gov (United States)

    Hare, J Daniel; Futuyma, Douglas J

    1978-01-01

    To determine the relative importance of variation in several plant characters on susceptibility to herbivores, we examined patterns of seed predation by two monophagous insect species and patterns of variation in ten populations of the cocklebur, Xanthium strumarium. Multiple regression analysis disclosed that one seed predator was most influenced by plant chemical variation, the other was significantly influenced by both chemical and morphological variation, but variation in yet another character, general burr size, was most important in conferring resistance to both insects simultaneously. The plant populations differed most in this character. Although many of the plant characters were correlated with each other, those important in determining susceptibility to each insect species were uncorrelated and independent of those conferring resistance to both insects simultaneously.These results imply that ecological similar herbivores may be influenced by different aspects of plant variation, and that predictions of evolutionary responses of local plant populations to herbivory may require knowledge of the structure of local herbivore communities and the dynamics of their establishment.

  10. Variation in extracellular matrix genes is associated with weight regain after weight loss in a sex-specific manner

    DEFF Research Database (Denmark)

    Roumans, Nadia J T; Vink, Roel G; Gielen, Marij

    2015-01-01

    The extracellular matrix (ECM) of adipocytes is important for body weight regulation. Here, we investigated whether genetic variation in ECM-related genes is associated with weight regain among participants of the European DiOGenes study. Overweight and obese subjects (n = 469, 310 females, 159 m.......40-5.63). Concluding, variants of ECM genes are associated with weight regain after weight loss in a sex-specific manner....

  11. Do key dimensions of seed and seedling functional trait variation capture variation in recruitment probability?

    Science.gov (United States)

    1. Plant functional traits provide a mechanistic basis for understanding ecological variation among plant species and the implications of this variation for species distribution, community assembly and restoration. 2. The bulk of our functional trait understanding, however, is centered on traits rel...

  12. Body weight in relation to variation in body size of Oystercatchers Haematopus ostralegus

    NARCIS (Netherlands)

    Zwarts, L; Hulscher, JB; Koopman, K; Zegers, PM

    1996-01-01

    This paper analyses the relationships between body weight in the Oystercatcher and two measures of its body size, bill length and wing length. The weight variation between individuals due to differences in body size is nearly as large as the seasonal variation in body weight within individuals. Wing

  13. Genetic variation for seed yield and some of agro-morphological traits in faba bean (Vicia faba L. genotypes

    Directory of Open Access Journals (Sweden)

    Peyman SHARIFI

    2015-11-01

    Full Text Available  An investigation was carried out to select the most successful faba bean genotype(s and to estimate the heritability for seed yield and some of agro-morphological traits. The results of analysis of variance indicated that the studied genotypes differed significantly for all of the traits. For 100-seed weight, two north's of Iran landraces (G1 and G2 and two improved breeding cultivars containing France (G4 and Barrakat (G10 possessed the heaviest seed weight, 161.33, 139, 119.67 and 166 g, respectively. G1 and G10 presented the highest values for dry seed weight (473.98 and 495.44 g m-2, respectively. G1 and G10 showed significantly higher magnitude values of the other traits. Broad sense heritability (h2 estimates were generally high to moderate for all of the studied traits. The highest estimates of broad sense heritability was inscribed as 98 % for pod length, dry seed length and dry seed width and 0.95 for hundred seed weight. The estimated broad-sense heritability was 0.80 for dry seed yield per m2. These results suggested that the environmental factors had a small effect on the inheritance of traits with high heritability. High estimates of heritability indicated that selection based on mean would be successful in improving of these traits. High heritability indicate an additive gene action for the traits, and hence, possible trait improvement through selection. Path coefficient analysis indicated that the traits containing day to harvesting, pod length, hundred seed weight and number of stems per plant play major role in seed yield determination of faba bean. Attention should be paid to these characters for augmentation of seed yield and these traits could be used as selection criteria in faba bean breeding programs. These findings indicate that selection for each or full of the above traits would be accompanied by high yielding ability under such conditions. 

  14. Variation in fruit size and susceptibility to seed predation among and within populations of the cocklebur, Xanthium strumarium L.

    Science.gov (United States)

    Hare, J Daniel

    1980-01-01

    Burr size is the major factor affecting variation in the intensity of predation by two species of insect on the seeds of the cocklebur, Xanthium strumarium. Mean burr size varied among 10 adjacent local populations studied over three years, as did intensity of seed predation. Seed predation was more intense in populations with low mean burr length and declined linearly with increasing burr length under field and experimental conditions. Seed predation thus is a selective factor influencing the evolution of both burr size and correlated protective characteristics such as burr spine length and wall thickness. As in some other plants, morphological rather than chemical features appear to pose the major barrier to attack by host-specific seed predators. The advantage of more highly developed tissues protecting seeds may occur at the expense of total seed production.

  15. Geographic variation in speed of seed germination in central Oregon ponderosa pine (Pinus ponderosa Dougl. ex Laws.).

    Science.gov (United States)

    John C. Weber; Frank C. Sorensen

    1992-01-01

    Variation in speed of seed germination was investigated among ponderosa pine trees representing 225 locations in central Oregon. Results suggested that at least some of the geographic variation is related to the severity of summer drought. In general, germination speed was greater in locations with shod, drought-limited growing seasons. Levels of geographic variation...

  16. Nutritional variation in baobab (Adansonia digitata L.) fruit pulp and seeds based on Africa geographical regions.

    Science.gov (United States)

    Muthai, Kinuthia U; Karori, Mbuthia S; Muchugi, Alice; Indieka, Abwao S; Dembele, Catherine; Mng'omba, Simon; Jamnadass, Ramni

    2017-11-01

    Baobab ( Adansonia digitata L.) is an indigenous fruit tree associated with the Savannah drylands of sub-Saharan Africa. Local communities mainly utilize the leaves, pulp, and seeds of baobab as a source of food and for income generation. The present study was conducted to determine the nutritive attributes of baobab fruit pulp and seeds across provenances in east, west, and southern Africa and to determine whether the nutrient content varied with the provenance of origin. Pulp and seed proximate composition and mineral element concentration were determined using the AOAC 1984 methods and inductively coupled plasma atomic emission spectroscopy (ICP-AES), respectively. The results showed that there exist significant variation ( p  < .05) in pulp moisture, protein, fiber, ash, and elemental content among provenances. The highest mean pulp crude fiber (8.68 g 100 g -1 dw) was recorded in Kenya. At country level, Malawi had the highest mean pulp potassium (22.2 mg g -1 ), calcium (4,300 mg kg -1 ), magnesium (2,300 mg kg -1 ), sodium (1,000 mg kg -1 ), and phosphorus (1,100 mg kg -1 ) levels. Kenya had the highest mean pulp iron (57.4 μg g -1 ) and manganese (27.2 μg g -1 ) content, while Mali had the lowest iron (13.1 μg g -1 ) and manganese (8.6 μg g -1 ). At country level, the mean seed calcium content was highest (3,200 mg kg -1 ) in Malawi and lowest (2,000 mg kg -1 ) in Kenya. The highest mean iron content of 63.7 μg g -1 was recorded in seeds from Kenya, while the lowest (25.8 μg g -1 ) was in Mali. Baobab seed mineral and proximate content varied significantly ( p  < .001) among the selected countries. Overall, baobab fruit pulp and seeds contain significant amounts of nutritionally essential minerals and proximate components but the amounts varied significantly among the selected countries. This variation offers opportunities for selecting provenances to concentrate on during germplasm collection for conservation and

  17. Seed size and nutrient content variation for twenty-one invasive and native California and Oregon taxa of the tribe Cynareae (Asteraceae)

    Science.gov (United States)

    Seed characteristics are important for seed dispersal, seedling growth, and seedling survival, but there is little information on seed characteristics for several taxa of the tribe Cynareae (Family: Asteraceae). We determined seed characteristics and their variation from natural populations of twen...

  18. Genome-wide association study, genomic prediction and marker-assisted selection for seed weight in soybean (Glycine max).

    Science.gov (United States)

    Zhang, Jiaoping; Song, Qijian; Cregan, Perry B; Jiang, Guo-Liang

    2016-01-01

    Twenty-two loci for soybean SW and candidate genes conditioning seed development were identified; and prediction accuracies of GS and MAS were estimated through cross-validation and validation with unrelated populations. Soybean (Glycine max) is a major crop for plant protein and oil production, and seed weight (SW) is important for yield and quality in food/vegetable uses of soybean. However, our knowledge of genes controlling SW remains limited. To better understand the molecular mechanism underlying the trait and explore marker-based breeding approaches, we conducted a genome-wide association study in a population of 309 soybean germplasm accessions using 31,045 single nucleotide polymorphisms (SNPs), and estimated the prediction accuracy of genomic selection (GS) and marker-assisted selection (MAS) for SW. Twenty-two loci of minor effect associated with SW were identified, including hotspots on Gm04 and Gm19. The mixed model containing these loci explained 83.4% of phenotypic variation. Candidate genes with Arabidopsis orthologs conditioning SW were also proposed. The prediction accuracies of GS and MAS by cross-validation were 0.75-0.87 and 0.62-0.75, respectively, depending on the number of SNPs used and the size of training population. GS also outperformed MAS when the validation was performed using unrelated panels across a wide range of maturities, with an average prediction accuracy of 0.74 versus 0.53. This study convincingly demonstrated that soybean SW is controlled by numerous minor-effect loci. It greatly enhances our understanding of the genetic basis of SW in soybean and facilitates the identification of genes controlling the trait. It also suggests that GS holds promise for accelerating soybean breeding progress. The results are helpful for genetic improvement and genomic prediction of yield in soybean.

  19. Longitudinal Analysis of Leptin Variation during Weight Regain after Weight Loss in Obese Children

    DEFF Research Database (Denmark)

    Holm, Jens-Christian; Gamborg, Michael; Ward, Leigh

    2009-01-01

    Objective: This study assessed if lower than predicted serum leptin concentrations seen during weight loss persisted during weight regain, with possible implications for weight control. Methods: 115 children were investigated during a 12-week weight loss program. 90 children completed the program....... Results: Children with the greatest increases in BMI standard deviation score (SDS) exhibited the largest leptin increments. The disproportionate reduction of leptin seen during weight loss recovered after weight loss. Leptin increases mirrored increases in BMI SDS during weight regain, and the leptin......-BMI SDS relationship seen during follow-up resembled the baseline leptin-BMI SDS relationship. Conclusion: Proportional increases of leptin and BMI SDS during weight regain suggests an intact leptin response during re-accumulation of fat. Following the pronounced reduction of leptin during weight loss...

  20. Genetic variation in flowering phenology and avoidance of seed predation in native populations of Ulex europaeus.

    Science.gov (United States)

    Atlan, A; Barat, M; Legionnet, A S; Parize, L; Tarayre, M

    2010-02-01

    The genetic variation in flowering phenology may be an important component of a species' capacity to colonize new environments. In native populations of the invasive species Ulex europaeus, flowering phenology has been shown to be bimodal and related to seed predation. The aim of the present study was to determine if this bimodality has a genetic basis, and to investigate whether the polymorphism in flowering phenology is genetically linked to seed predation, pod production and growth patterns. We set up an experiment raising maternal families in a common garden. Based on mixed analyses of variance and correlations among maternal family means, we found genetic differences between the two main flowering types and confirmed that they reduced seed predation in two different ways: escape in time or predator satiation. We suggest that this polymorphism in strategy may facilitate maintain high genetic diversity for flowering phenology and related life-history traits in native populations of this species, hence providing high evolutionary potential for these traits in invaded areas.

  1. Seasonal variation in soil seed bank size and species composition of selected habitat types in Maputaland, South Africa

    Directory of Open Access Journals (Sweden)

    M. J. S. Kellerman

    2007-08-01

    Full Text Available Seasonal variation in seed bank size and species composition of five selected habitat types within the Tembe Elephant Park. South Africa, was investigated. At three-month intervals, soil samples were randomly collected from five different habitat types: a, Licuati forest; b, Licuati thicket; c, a bare or sparsely vegetated zone surrounding the forest edge, referred to as the forest/grassland ecotone; d, grassland; and e, open woodland. Most species in the seed bank flora were either grasses, sedges, or forbs, with hardly any evidence of woody species. The Licuati forest and thicket soils produced the lowest seed densities in all seasons.  Licuati forest and grassland seed banks showed a two-fold seasonal variation in size, those of the Licuati thicket and woodland a three-fold variation in size, whereas the forest/grassland ecotone maintained a relatively large seed bank all year round. The woodland seed bank had the highest species richness, whereas the Licuati forest and thicket soils were poor in species. Generally, it was found that the greatest correspondence in species composition was between the Licuati forest and thicket, as well as the forest/grassland ecotone and grassland seed bank floras.

  2. 48 CFR 245.7309-8 - Variations in quantity or weight.

    Science.gov (United States)

    2010-10-01

    ... Inventory 245.7309-8 Variations in quantity or weight. When property is sold on a “unit price” basis, the Contractor reserves the right to vary by up to 15 percent the quantity or weight listed in the Invitation and... price shall be adjusted in accordance with the unit price and on the basis of the quantity or weight...

  3. Induced variation in pod and seed traits of wild and cultivated beans

    International Nuclear Information System (INIS)

    Ignacimuthu, S.; Babu, C.R.

    1992-01-01

    With a view to evaluate the induced genetic variation in yield traits of wild and cultivated urd and mung bean, seeds of Vigna radiata. V. mungo (cultivars) and V. sublobata (wild relative) were given mutagenic treatments. Different concentrations of EMS and gamma rays were used as mutagens separately and in combination. Genetic variation in yield traits was analysed in M 2 plants. There was a broad spectrum of induced variability in most yield traits. Genetic variance, heritability and genetic advance were high in most of the traits. The results demonstrate that induced mutations are random, polydirectional and quantitative in nature. The wild relative is more resistant than the cultivars. (author). 14 refs., 4 tabs

  4. Temporal variation in seed predation by insects in a population of Syagrus romanzoffiana (Arecaceae) in Santa Catarina Island, SC, Brazil.

    Science.gov (United States)

    da Silva, F R; Begnini, R M; Lopes, B C; Castellani, T T

    2012-02-01

    Insect seed predation may vary depending on seed production. The present study considers the hypothesis that the rates of seed predation tend to be smaller in years of higher fruit production. Thus, we monitored the production of fruits and predation of seeds of the palm Syagrus romanzoffiana over 2 years in the Atlantic Forest (Parque Municipal da Lagoa do Peri, Florianópolis, SC, Brazil), between July 2006 and June 2008. Plots of 0.25 m(2) were fitted under 20 mother plants and fruits were monthly collected for assessment of abundance and seed predation. There was variation in fruit production between the 2 years and among reproductive plants. Predation rates were high and occurred in the predispersal phase by the Curculionidae Revena rubiginosa Boheman, Anchylorhynchus aegrotus Fahraeus, and Anchylorhynchus variabilis Gyllenhal. Seed predation by these species of Anchylorhynchus is first registered in the present study. In average, about 60% of the seeds monthly produced in the population tend to escape insect predation in year of high or low production, becoming available for recruitment. The predation rate was not related to the amount of fruits produced per reproductive plant. Also, different than expected, there was a positive relation between the rates of seed predation and the total of fruits produced monthly on the plots. Thus, no evidence for the satiation of insect seed predators was found in this study with S. romanzoffiana.

  5. seeds

    African Journals Online (AJOL)

    Owner

    peptidohydrolase (8.0%) from mung bean seedlings. (Baumgartner and Chrispeels, 1977), EP-HG (4.5%) from horse gram seedlings ( Rajeswari, 1997), acidic protease (15%) from germinating winged-bean seeds. (Usha and Singh, 1996) and EP-1 (1.6%) from barley seedlings and GA3-induced cysteine protease (3.38%).

  6. Clonal variation in growth, flowering and cone production in a seed ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-09-01

    Sep 1, 2009 ... production in a seed orchard of Scots pine (Pinus sylvestris L.) in ... one of the important seed sources for forest plantations. And also, these seed ...... Ph.D. Thesis, Swedish University of Agricultural Science, Umea ,. Sweden.

  7. Effect of gamma rays on fruit weight and number of seeds in Abelmoschus esculentus (L.) Moench and Momordica charantia L

    International Nuclear Information System (INIS)

    Jha, B.K.

    1994-01-01

    Among 5,15,30,60,90 and 120 kR doses of gamma rays, lower doses showed stimulatory effects on fresh and dry weight of fruit, while higher doses proved inhibitory in Abelmoschus esculentus and Momordica charantia. Abortion of mature seeds was also higher at 30 kR and above doses. (author). 12 refs., 2 tabs

  8. Uncovering the genetic architecture of seed weight and size in intermediate wheatgrass through linkage and association mapping

    Science.gov (United States)

    Intermediate wheatgrass (IWG); Thinopyrum intermedium) is being developed as a new perennial grain crop that has a large allohexaploid genome similar to that of wheat (Triticum aestivum). Breeding for increased seed weight is one of the primary goals for improving grain yield of IWG. As a new crop, ...

  9. Purification and partial characterization of low molecular weight vicilin-like glycoprotein from the seeds of Citrullus lanatus.

    Science.gov (United States)

    Yadav, Sushila; Tomar, Anil Kumar; Jithesh, O; Khan, Meraj Alam; Yadav, R N; Srinivasan, A; Singh, Tej P; Yadav, Savita

    2011-12-01

    The watermelon (Citrullus lanatus) seeds are highly nutritive and contain large amount of proteins and many beneficial minerals such as magnesium, calcium, potassium, iron, phosphorous, zinc etc. In various parts of the world, C. lanatus seed extracts are used to cure cancer, cardiovascular diseases, hypertension, and blood pressure. C. lanatus seed extracts are also used as home remedy for edema and urinary tract problems. In this study, we isolated protein fraction of C. lanatus seeds using various protein separation methods. We successfully purified a low molecular weight vicilin-like glycoprotein using chromatographic methods followed by SDS-PAGE and MALDI-TOF/MS identification. This is the first report of purification of a vicilin like polypeptide from C. lanatus seeds. In next step, we extracted mRNA from immature seeds and reverse transcribed it using suitable forward and reverse primers for purified glycoprotein. The PCR product was analysed on 1% agarose gel and was subsequently sequenced by Dideoxy DNA sequencing method. An amino acid translation of the gene is in agreement with amino acid sequences of the identified peptides.

  10. Secular trends in seasonal variation in birth weight

    DEFF Research Database (Denmark)

    Jensen, Camilla Bjørn; Gamborg, M; Raymond, K

    2015-01-01

    and phase of the yearly cycles to change. RESULTS: There was a clear seasonal pattern in BW which, however, changed gradually across the study period. The highest BWs were seen during fall (September - October) from 1936 to 1963, but a new peak gradually grew from the early 1940s during early summer (May...... again. Sunshine did not explain the seasonal variation in BW. CONCLUSION: There was a clear seasonal pattern in BW in Denmark 1936-1989, which however changed across the study period. Throughout the study period we observed a peak in BW during the fall, but gradually, starting in the early 1940s...

  11. Variation of nutrients and antioxidant activity in seed and exocarp layer of some Persian pistachio genotypes

    Directory of Open Access Journals (Sweden)

    Somayeh Tayefeh Aliakbarkhani

    2017-06-01

    Full Text Available Pistachio nuts are rich sources of nutrients which are essential for human wellbeing. In the present study we investigate the variation of oil, protein, total phenol, mineral contents, and antioxidant activity of twenty rare Persian pistachio nuts and exocarp layer. Among the 20 pistachio genotypes, in seeds Mn concentration was varied from 5.73 to 17.33 mg/kg; Fe ranged from 17 to 62.4 mg/kg; Zn varied from 6.76 to 30.3 mg/kg; Na ranged from 0.06 to 0.126%; K varied from 0.68 to 1.35%; P varied from 0.42 to 0.73%; N ranged from 2.6 to 4.29%; Mg varied from 0.11 to 0.17%, Ca varied from 0.23 to 0.47%, oil ranged from 47.94 to 57.29% and protein ranged from 16.26 to 25.5%. The G3 genotype had the highest total phenol content (35.64 mg GAEs/g and antioxidant activity (90.55% in exocarp layer and oil content in seeds (57.29%. The highest phosphorus (0.73% in exocarp layer and phenol (4.2 mg GAEs/g contents in seeds were observed in G19. According to the correlation analysis, there were a correlation between total phenol (in exocarp layer and oil contents gain with some values; these two values had a significant correlation with PC1. Cluster analysis separated the genotypes into three groups considering all measured Values.

  12. Fermi energy 5f spectral weight variation in uranium alloys

    Energy Technology Data Exchange (ETDEWEB)

    Denlinger, J.D.; Clack, J.; Allen, J.W. [Univ. of Michigan, Ann Arbor, MI (United States)] [and others

    1997-04-01

    Uranium materials display a wide range of thermal, electrical and magnetic properties, often exotic. For more than a decade there have been efforts to use photoemission spectroscopy to develop a systematic and unified understanding of the 5f electron states giving rise to this behavior. These efforts have been hampered by a paucity of systems where changes in transport properties are accompanied by substantial spectral changes, so as to allow an attempt to correlate the two kinds of properties within some model. The authors have made resonant photoemission measurements to extract the 5f spectral weight in three systems which show varying degrees of promise of permitting such an attempt, Y{sub 1{minus}x}U{sub x}Pd{sub 3}, U(Pd{sub x}Pt{sub 1{minus}x}){sub 3} and U(Pd{sub x}Cu{sub 1{minus}x}){sub 5}. They have also measured U 4f core level spectra. The 4f spectra can be modeled with some success by the impurity Anderson model (IAM), and the 5f spectra are currently being analyzed in that framework. The IAM characterizes the 5f-electrons of a single site by an f binding energy {epsilon}{sub f}, an f Coulomb interaction and a hybridization V to conduction electrons. Latent in the model are the phenomena of 5f mixed valence and the Kondo effect.

  13. SYNTHESIS OF BIODIESEL FROM KAPUK SEED OIL (Ceiba Pentandra L AT VARIATION STIRRING DURATION IN TRANSESTERIFICATION PROCESS

    Directory of Open Access Journals (Sweden)

    Endang Dwi Siswani

    2016-05-01

    Full Text Available The synthesis of biodiesel targeted as SNI 04-7182-2006 standard has been done from kapuk randu seed, following two steps i.e. sokhlet extraction process of kapuk seed oil from kapuk seed using n-heksane as a solvent, and the production of biodiesel from kapuk seed oil by transesterification process using methanol and KOH as catalyst. Transesterificatin process was performed at temperature 50 oC with the variation of stirring duration as followed  50, 75, 100 and 125 minutes. The kapuk randu extraction resulted  % kapuk randu seed oil, while the transestherification process resulted around 55 - 65%. The biodiesel product characteristics provided the density value of all biodiesel at stirring durations variation are suitable with SNI standard (850 – 890 kg/m3, the viscosity value of all biodiesel are  higher than the range SNI value (2,3 – 6,0 cSt. While the flash point values are lesser than SNI standard (10160 - 11000 cal/g.   Keywords: kapuk randu seed, transestherification, biodiesel

  14. The atomic weight and isotopic composition of boron and their variation in nature

    International Nuclear Information System (INIS)

    Holden, N.E.

    1993-01-01

    The boron isotopic composition and atomic weight value and their variation in nature are reviewed. Questions are raised about the previously recommended value and the uncertainty for the atomic weight. The problem of what constitutes an acceptable range for normal material and what should then be considered geologically exceptional is discussed. Recent measurements make some previous decisions in need of re-evaluation

  15. Longitudinal Analysis of Leptin Variation during Weight Regain after Weight Loss in Obese Children

    DEFF Research Database (Denmark)

    Jens-Christian, Holm; Michael, Gamborg; Leigh, Ward

    2009-01-01

    , and 68 children entered a follow-up program spanning 28 months. Measurements were performed at baseline and day 82 as well as at months 10, 16, and 28. Height, weight, body composition, Tanner stages, testicular size, and serum concentrations of leptin, and insulin were measured at all time points...

  16. Clonal Variations in Flower Production at the Anatolian Black Pine (Pinus nigra Arnold.subsp. pallasiana Seed Orchard

    Directory of Open Access Journals (Sweden)

    Murat ERTEKİN, Korhan TUNÇTANER

    2009-01-01

    Full Text Available This study was conducted for three years (2002-2004 in a black pine seed orchard established with 30 clonesoriginating from the forest of Yenice-Bakraz in Bartın, 1990. During the research, the variations between theclones in the seed orchard were determined based on the number of male and female flowers. According to theresults, the average values of flower production in three years at seed orchard showed considerable variations. Itwas determined that the number of the male and female flowers were 817,2 and 99,3 respectively. 62% ofaverage number of male flowers and 49% of female flowers were produced by 10 clones in 3 years. It was alsodetermined that the amount of the flowers for the clones showed significant differences within the years.

  17. Exploring the Natural Variation for Seedling Traits and Their link with Seed Dimensions in Tomato

    NARCIS (Netherlands)

    Khan, N.; Kazmi, R.H.; Willems, L.A.J.; Heusden, van A.W.; Ligterink, W.; Hilhorst, H.W.M.

    2012-01-01

    The success of germination, growth and final yield of every crop depends to a large extent on the quality of the seeds used to grow the crop. Seed quality is defined as the viability and vigor attribute of a seed that enables the emergence and establishment of normal seedlings under a wide range of

  18. VARIATION IN RHIZOBIUM GROWTH DUE TO SEED AND ROOT EXUDATES RELEASED FROM GAMMA IRRADIATED GLYCINE MAX SEEDS

    International Nuclear Information System (INIS)

    KAMEL, H.A.; ASKER, M.M.S

    2008-01-01

    In this study, seeds of Glycine max Giza 122 were irradiated with gamma rays from 60 Co source at various doses (10 to 200 Gy), sterilized and soaked into an aerated solution of CaSO 4 (1 mmol and pH 6.5). The capacities of the released seed exudates (SEs) and root exudates (REs) to promote Rhizobium leguminosarum growth were investigated as well as biochemical analysis of the exudates was carried out. SE of both control and gamma irradiated seeds resulted in a higher Rhizobium population and polysaccharide production than RE. Relative to control, the highly effective doses in Rhizobium growth and polysaccharide production were 25 and 200 Gy; the former was a promoter while the later was an inhibitor. HPLC analysis of soluble carbohydrates revealed the presence of glucose (Glu), rhamnose (Rha) and fructose (Fru) in the SE and RE. Protein content in SE was lower than that in RE; the highest values were due to 10 Gy and 25 Gy in SE and RE, respectively. Free amino acids content in SE was increased up to 25 Gy then decreased while RE was increased by increasing gamma doses from 10 to 200 Gy

  19. Genetic variation and heritability for cotton seed, fiber and oil traits in gossypium hirsutum

    International Nuclear Information System (INIS)

    Khan, N.U.; Farhatullah; Batool, S.; Makhdoom, K.; Marwat, K.B.; Hassan, G.; Ahmad, W.; Khan, H.U.

    2010-01-01

    The research work pertaining to the study of genetic variability, heritability, genetic gain and correlation for cottonseed, fiber and cottonseed oil % in Gossypium hirsutum cultivars was conducted during 2005 at NWFP Agricultural University Peshawar, Pakistan. Analysis of variance manifested highly significant differences among the genotypes for all the traits except seeds per locule. Genetic potential range of eight cotton cultivars for different parameters was recorded i.e. seeds locule-1 (6.33 to 6.60), seeds boll-1 (26.10 to 28.47), seed index (8.61 to 9.69 g), lint index (5.35 to 6.05 g), lint % (35.17 to 38.13 %), seed cotton yield (1200 to 2450 kg ha/sup -1/) and cottonseed oil % (27.52 to 30.15%). Genetic variances were found almost greater than the environmental variances for all the traits except seeds locule-1 and seed index. High broad sense heritability and selection response were also formulated for seeds boll-1 (0.67, 0.84), seed index (0.77, 0.47 g), lint index (0.96, 0.33 g), lint % (0.96, 1.66 %), seed cotton yield (0.98, 643.16 kg) and cottonseed oil % (0.87, 1.28 %), respectively. Correlation of yield with other traits was found positive for majority of traits except seeds locule-1 and cotton seed oil %. Seed cotton yield is our ultimate goal in growing cotton besides lint %. Highest seed cotton yield was recorded in CIM-499 followed by CIM-473, CIM-496 and CIM-506 and were also found as the second and third top scoring genotypes for seeds per boll, seed index, lint % and cottonseed oil %. Cultivar SLH-279 performed better for lint index, lint % and oil %. This type of correlation is rarely found and ultra desirable by the cotton breeders and a little genetic gain in seed and lint traits, and oil content is a great accomplishment. (author)

  20. Genetic and Cytological Analyses of the Natural Variation of Seed Number per Pod in Rapeseed (Brassica napus L.

    Directory of Open Access Journals (Sweden)

    Yuhua Yang

    2017-11-01

    Full Text Available Seed number is one of the key traits related to plant evolution/domestication and crop improvement/breeding. In rapeseed germplasm, the seed number per pod (SNPP shows a very wide variation from several to nearly 30; however, the underlying causations/mechanisms for this variation are poorly known. In the current study, the genetic and cytological bases for the natural variation of SNPP in rapeseed was firstly and systematically investigated using the representative four high-SNPP and five low-SNPP lines. The results of self- or cross-pollination experiment between the high- and low-SNPP lines showed that the natural variation of SNPP was mainly controlled by maternal effect (mean = 0.79, followed by paternal effect (mean = 0.21. Analysis of the data using diploid seed embryo–cytoplasmic–maternal model further showed that the maternal genotype, embryo, and cytoplasm effects, respectively, explained 47.6, 35.2, and 7.5% of the genetic variance. In addition, the analysis of combining ability showed that for the SNPP of hybrid F1 was mainly determined by the general combining ability of parents (63.0%, followed by special combining ability of parental combination (37.0%. More importantly, the cytological observation showed that the SNPP difference between the high- and low-SNPP lines was attributable to the accumulative differences in its components. Of which, the number of ovules, the proportion of fertile ovules, the proportion of fertile ovules to be fertilized, and the proportion of fertilized ovules to develop into seeds accounted for 30.7, 18.2, 7.1, and 43.9%, respectively. The accordant results of both genetic and cytological analyses provide solid evidences and systematic insights to further understand the mechanisms underlying the natural variation of SNPP, which will facilitate the development of high-yield cultivars in rapeseed.

  1. Effect of litter size on the variation in birth and weaning weights of Landrace piglets

    Directory of Open Access Journals (Sweden)

    Camila Duarte Prazeres

    2016-03-01

    Full Text Available The objective of this study was to evaluate the effect of the size class of the litter at birth on the variation in birth and weaning weights and on the survival rate of piglets from birth to weaning. For this purpose, records of individual weight at birth and weaning of piglets obtained from a database of 295 Landrace litters born between 2000 and 2010 on a pig farm in the western region of the State of Paraná were used. The litters were classified as small (up to 7 piglets, medium (8 to 13 piglets, and large (> 14 piglets according to the total number of piglets born. The data were analyzed considering the effects of the year of sow mating and size class of the litter at birth. The correlations between mean weight and variance in litter weight and size were higher for medium and large litters. The size class of the litter significantly influenced the mean weight of piglets at birth and weaning and the variance in birth weight. Piglets born in medium and large litters weighed less and exhibited greater birth weight variation and a lower survival rate until weaning than piglets born in small litters.

  2. Study of variation of tocochromanol and phytosterol contents in black and yellow seeds of Brassica napus L. doubled haploid populations.

    Science.gov (United States)

    Cegielska-Taras, Teresa; Nogala-Kałucka, Małgorzata; Szala, Laurencja; Siger, Aleksander

    2016-01-01

    In the study, an analysis of tocopherols, plastochomanol-8 and phytosterols was conducted using DH lines obtained from F1 hybrids of reciprocal crosses between yellow- and black-seeded lines. The biological material for the study consisted of two DH populations of winter oilseed rape obtained from F1 hybrids of reciprocal crosses between two DH lines: yellow- and black-seeded. Seed color was determined using a ColorFlex spectrophotometer. Fat content was determined via pulsed NMR. The levels of tocopherols, and plastochromanol-8 are analyzed using HPLC. Phytosterol contents and composition were determined by the GC method. The fat content of the black-seeded parental line was 49% and this was higher than that of the yellow-seeded parental line (44%). The fat content of DH line populations ranged from 44 to 51%. Total tocopherol content ranged from 460 to 602 mg/kg and the α-T/γ-T ratio was from 0.66 to 1.09. In parental lines H2-26 and Z-114 the total tocopherol content was 534 and 525 mg/kg, but the α-T/γ-T ratios were 0.81 and 1.21, respectively. The yellow-seeded parental line (Z-114) was characterized by a higher PC-8 content (81 mg/kg) than the H2-26 black-seeded parental line (58 mg/kg). The largest part of the total phytosterol content in seeds of both populations was β-sitosterol from 976 to 2148 mg/kg, followed by campasterol, from 636 to 1364 mg/kg, and brassicasterol from 375 to 678 mg/kg. The total tocopherol content ranged from 462 to 595 mg/kg (population HxZ) and from 460 to 602 mg/kg (population ZxH). Significantly positive correlations were observed between the seed color with α-T (r = 0.38, p phytosterol content were not noted. Considering the range of genetic variation among doubled haploids of two populations, selected DH lines may be good parents for further breeding programs focused on increasing the amount and improving the quality of oilseed rapeseed oil. However, further studies will also be made to determine the influence of the

  3. Seasonal and annual variation in body weight, nutrient stores and mortality of Oystercatchers Haematopus ostralegus

    NARCIS (Netherlands)

    Zwarts, L.; Hulscher, J.B.; Koopman, K.; Piersma, T.; Zegers, P.M.

    1996-01-01

    The average body weight of Oystercatchers captured in the Dutch Wadden Sea and ajoining breeding areas varies between 520 g in mid summer and 620 g in mid winter, but the individual differences remain large: between 450 and 650 g in summer and 500 and 725 g in winter. A part of this variation can be

  4. Variation in sagebrush communities historically seeded with crested wheatgrass in the eastern great basin

    Science.gov (United States)

    Although crested wheatgrass (CWG; Agropyron cristatum [L.] Gaertn.) has been one of the most commonly seeded exotic species in the western United States, long-term successional trajectories of seeded sites are poorly characterized, especially for big sagebrush (Artemisia tridentana Nutt.) ecosystems...

  5. Stochastic and deterministic processes regulate spatio-temporal variation in seed bank diversity

    Science.gov (United States)

    Alejandro A. Royo; Todd E. Ristau

    2013-01-01

    Seed banks often serve as reservoirs of taxonomic and genetic diversity that buffer plant populations and influence post-disturbance vegetation trajectories; yet evaluating their importance requires understanding how their composition varies within and across spatial and temporal scales (α- and β-diversity). Shifts in seed bank diversity are strongly...

  6. Genetic and environmental effects on seed weight in subspecies of big sagebrush: Applications for restoration

    Science.gov (United States)

    Bryce A. Richardson; Hector G. Ortiz; Stephanie L. Carlson; Deidre M. Jaeger; Nancy L. Shaw

    2015-01-01

    The sagebrush steppe is a patchwork of species and subspecies occupying distinct environmental niches across the intermountain regions of western North America. These ecosystems face degradation from disturbances and exotic weeds. Using sagebrush seed that is matched to its appropriate niche is a critical component to successful restoration, improving habitat for the...

  7. Juglans regia L., phenotypic selection and assessment of genetic variation within a simulated seed orchard

    Directory of Open Access Journals (Sweden)

    Fulvio Ducci

    2010-12-01

    Full Text Available Normal 0 14 false false false MicrosoftInternetExplorer4 Noble hardwoods are very important for the Italian furniture industry. Since 1985, approximately 170,000 ha have been planted in Italy with noble hardwoods. Among them, about 50% of species are represented by walnuts. Walnut (Juglans regia L., not native in Italy, has been the focus of a substantial research effort for breeding and improvement programmes. The priority has been to preserve the in situ genetic resource still existing after intensive felling. Phenotypes suitable for timber production showing important traits such as straight stem, nice branch architecture, dominance and adaptation (phenology have needed to be developed and selected. In order to reach this goals, selection of valuable progenies and the evaluation of the interaction genotype x environment, methods based essentially on a multi-trait Selection Index, were developed. Studies have been undertaken also to measure the variation of phenological traits, more correlated to traits valuable for architecture; in addition, neutral markers were used to assess genetic variation among different intensities of the adopted selections. The individual genetic component was found to be higher than at the inter-population level. Results showed that a hypothetical seed orchard made with progenies selected by morphology, phenology and genetic traits could provide material with a good performance and supply a variability similar to larger populations as the total plantation or the pseudo-natural system chosen for comparison. st1\\:*{behavior:url(#ieooui } /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Tabella normale"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin:0cm; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:10.0pt; font-family:"Times New Roman"; mso-ansi-language:#0400; mso

  8. Isotope-abundance variations and atomic weights of selected elements: 2016 (IUPAC Technical Report)

    Science.gov (United States)

    Coplen, Tyler B.; Shrestha, Yesha

    2016-01-01

    There are 63 chemical elements that have two or more isotopes that are used to determine their standard atomic weights. The isotopic abundances and atomic weights of these elements can vary in normal materials due to physical and chemical fractionation processes (not due to radioactive decay). These variations are well known for 12 elements (hydrogen, lithium, boron, carbon, nitrogen, oxygen, magnesium, silicon, sulfur, chlorine, bromine, and thallium), and the standard atomic weight of each of these elements is given by IUPAC as an interval with lower and upper bounds. Graphical plots of selected materials and compounds of each of these elements have been published previously. Herein and at the URL http://dx.doi.org/10.5066/F7GF0RN2, we provide isotopic abundances, isotope-delta values, and atomic weights for each of the upper and lower bounds of these materials and compounds.

  9. Preliminary notes on brain weight variation across labrid fish species with different levels of cooperative behaviour

    Institute of Scientific and Technical Information of China (English)

    Marta C.SOARES; Gon(c)alo I.ANDR(E); José R.PAULA

    2015-01-01

    Brain size and weight vary tremendously in the animal kingdom.It has been suggested that brain structural development must evolve balanced between the advantages of dealing with greater social challenges and the energetic costs of maintaining and developing larger brains.Here we ask if interspecific differences in cooperative behaviour (i.e.cleaning behaviour) are related to brain weight variations in four close-related species of Labrid fish:two are obligatory cleanerfish throughout their entire life (Labroides dimidiatus and L.bicolor),one facultative cleaner fish Labropsis australis and one last species that never engage in cleaning Labrichthys unilineatus.We first search for the link between the rate of species' cooperation and its relative brain weight,and finally,if the degree of social complexity and cooperation are reflected in the weight of its major brain substructures.Overall,no differences were found in relative brain weight (in relation to body weight) across species.Fine-scale differences were solely demonstrated for the facultative cleaner L.australis,at the brainstem level.Furthermore,data visual examination indicates that the average cerebellum and brainstem weights appear to be larger for L.dimidiatus.Because variation was solely found at specific brain areas (such as cerebellum and brainstem) and not for the whole brain weight values,it suggests that species social-ecological and cognitive demands may be directly contributing to a selective investment in relevant brain areas.This study provides first preliminary evidence that links potential differences in cognitive ability in cooperative behaviour to how these may mediate the evolution of brain structural development in non-mammal vertebrate groups [Current Zoology 61 (2):274-280,2015].

  10. Induced variation for Pelshenke value and caryopsis weight in bread wheat

    International Nuclear Information System (INIS)

    Siddiqui, K.A.; Arain, M.A.

    1986-01-01

    The paper presents the evidence of induced mutations for Pelshenke value and caryopsis weight. M 2 population of bread wheat (Triticum aestivum L.) variety Pak 70 derived from different doses of gamma rays (100, 150, 200 Gy) and fast neutrons (300, 450, 600 Rads) were screened. The coefficient of variation for Pelshenke value was considerably higher in Nf 450 Rads and 100 Gy gamma ray treatments in comparison with the untreated control. Gamma ray treatments were more effective than fast neutrons in increasing the caryopsis weight. Selection strategy based on highly heritable traits can result in breeding varieties with high yield and improved baking quality. (author)

  11. The role of seed size in the non-genetic variation exhibited in salt tolerance studies involving the bread wheat cv. chinese spring

    Directory of Open Access Journals (Sweden)

    P. K. Martin

    2014-01-01

    Full Text Available The intention of this study was to confirm the role of seed size in the non-genetic variation exhibited during salinity tolerance experiments involving the bread wheat cv. Chinese Spring. The nutrient film/rockwool hydroponics technique was utilised. This study concluded that seed size does not play a significant role in the non-genetic variation generated during a study of salinity tolerance of the bread wheat cv. Chinese Spring.

  12. Correlation of maturity groups with seed composition in soybeans, as influenced by genotypic variation.

    Directory of Open Access Journals (Sweden)

    Maestri, Damián M.

    1998-12-01

    Full Text Available Seeds of 19 soybean cultivars (Glycine max (L. Merrill with maturity groups V, VI or VII were analyzed for proximate composition, fatty acids and sterols. Protein, oil, carbohydrate and ash contents varied between 344-463 g kg-1, 178-233 g kg-1, 234-338 g kg-1, and 40.0-49.3 g kg-1 of dry matter, respectively. Fatty acid profiles revealed that the major acids were palmitic (9.2-12.5%, oleic (17.7-22.1% and linoleic (53.6-56.9%. Linolenic acid ranged from 8.6 to 10.4%. Sitosterol (48.1-56.8% was the main component of the sterol fraction, followed by campesterol (18.4-21.7% and stigmasterol (13.4-18.0%. Statistically significant differences between genotypes were found for the majority of parameters evaluated, but there are not significant variations among maturity groups.

    Se analizaron la humedad, contenido en proteínas, carbohidratos, grasas y cenizas, y las composiciones en ácidos grasos y esteróles de las semillas de 19 cultivares de soja (Glycine max (L. Merrill con grupos de madurez V, VI o VIl. Los contenidos de proteínas, aceites, carbohidratos y cenizas variaron entre 344-463 g kg-1, 178-233 g kg-1, 234-338 g kg-1 y 40.0-49.3 g kg-1 de materia seca, respectivamente. Los ácidos grasos mayoritarios fueron palmítico (9.2-12.5%, oleico (17.7-22.1% y linoleico (53.6-56.9%. El porcentaje de ácido linolénico varió desde 8.6 hasta 10.4%. El principal componente de la fracción de esteroles del aceite fue el sitosterol (48.1-56.8%, seguido por el campesterol (18.4-21.7% y el estigmasterol (13.4-18.0%. Se encontraron diferencias estadísticamente significativas entre los genotipos para la mayoría de los parámetros evaluados, pero no hubo variaciones significativas entre grupos de madurez.

  13. INTRA-AND INTER-POPULATION VARIATION IN SEED SIZE AND DORMANCY IN Schizolobium parahyba (Vell. Blake IN THE ATLANTIC FOREST

    Directory of Open Access Journals (Sweden)

    Juliana Müller Freire

    2015-01-01

    Full Text Available Seed size and dormancy level were studied in 20 trees from two populations of Schizolobium parahybato evaluate how these characteristics occurbetween and within populations, and whether seed germination was affected by its morphometry. These two populations are located in the coastal (Paraty or mountain (Miguel Pereira regions in the state of Rio de Janeiro, Brazil. The seed morphometrictraits (length, width, thickness and weight were measured. Germination with or without seedcoatdormancy treatment (mechanical scarification wasassessedbya randomized emergence test in nursey. All morphometric traits differed significantly among individuals and between populations. The trees from the mountain region showed a larger seed size and a lower dormancy level than that of trees from the coastal region. Seed size had no effect on seed germination or seedling development. Climate influence on the determination of germination behavior is discussed based on the results.

  14. Seed Characteristics Diversity in Sponge Gourd (Luffa aegyptiaca Mill. Germplasms from Hatay Region in Turkey

    Directory of Open Access Journals (Sweden)

    Kazım MAVİ

    2018-05-01

    Full Text Available The objective of this study was to evaluate seed characteristics of sponge gourd, to establish a core collection of sponge gourd with the germplasm collected throughout the Hatay region. A mini-core collection was assessed for morphological performance and some seed traits. Substantial variations of seed characteristics: seed length, seed width, seed thickness (mm, seed index (length/width, seed size (length × width, mm2, seed colour, seed-coat surface, seed shape, seed wing, and 100-seed weight were investigated. Seed length, width and thickness were varied as 15.12-8.97 mm, 9.71-6.25 mm and 2.86-2.16 mm respectively. The seed sizes were determined from small (31 DÖ 06 to big (31 DE 04. Seed colours were ranged from black to white, even a brown colour like 07 MA 01. A hundred seed weights were observed as 16.43 g (31 AL 02 and 7.41 (31 DÖ 06. The results of dendrogram indicated that seed traits of the sponge gourd genotypes were separating in five groups. This collection of sponge gourds will be useful for the gene pools and a wide range of phenotypic variations to provide a good source of diversity for developing of sponge gourd cultivars in breeding programs.

  15. Seed protein variations of Salicornia L. and allied taxa in Turkey.

    Science.gov (United States)

    Yaprak, A E; Yurdakulol, E

    2007-06-01

    Electrophoretic seed protein patterns of a number of accessions of Salicornia europaea L. sl., S. prostrata Palas, S. fragilis P.W. Ball and Tutin, Sarcocornia fruticosa (L.) A. J. Scott, Sarcocornia perennis (Miller.) A. J. Scott, Arthrocnemum glaucum (Del.) Ung.-Sternb., Microcnemum coralloides (Loscos and Pardo) subsp. anatolicum Wagenitz and Halocnemum strobilaceum (Pall.) Bieb. were electrophoretically analysed on SDS-PAGE. In total 48 different bands were identified. The obtained data have been treated numerically using the cluster analysis method of unweighted pair group (UPGMA). Finally it was determined that all species separated according to seed protein profiles. And the cladogram obtained studied taxa have been given.

  16. A further contribution to the seasonal variation of weighted mean temperature

    Science.gov (United States)

    Ding, Maohua; Hu, Wusheng

    2017-12-01

    The weighted mean temperature Tm is a variable parameter in the Global Navigation Satellite System (GNSS) meteorology and the Askne-Nordius zenith wet delay (ZWD) model. Some parameters about the Tm seasonal variation (e.g. the annual mean value, the annual range, the annual and semi-annual amplitudes, and the long-term trend) were discussed before. In this study, some additional results about the Tm seasonal variation on a global scale were found by using the Tm time series at 309 global radiosonde sites. Periodic signals of the annual and semi-annual variations were detected in these Tm time series by using the Lomb-Scargle periodogram. The annual variation is the main component of the periodic Tm in non-tropical regions, while the annual variation or the semiannual variation can be the main component of the periodic Tm in tropics. The mean annual Tm almost keeps constant with the increasing latitude in tropics, while it decreases with the increasing latitude in non-tropical regions. From a global perspective, Tm has an increasing trend of 0.22 K/decade on average, which may be caused by the global warming effects. The annual phase is almost found in about January for the non-tropical regions of the Southern Hemisphere and in about July for the non-tropical regions of the Northern Hemisphere, but it has no clear symmetry in tropics. Unlike the annual phase, the geographical distributions of semi-annual phase do not follow obvious rules. In non-tropical regions, the maximum and minimum Tm of the seasonal model are usually found in respective summer and winter days while the maximum and minimum Tm are distributed over a whole year but not in any fixed seasons for tropical regions. The seasonal model errors increase with the increasing value of annual amplitude. A primary reason for the irregular seasonal variation in tropics is that Tm has rather small variations in this region.

  17. Intra-stand variation of cone structure and seed production in Siberian stone pine: pattern and use for breeding

    Directory of Open Access Journals (Sweden)

    V.S. Akimov

    2013-12-01

    Full Text Available Siberian stone pine (Pinus sibirica Du Tour in Russia is primarily valued as a nut-bearing species. Therefore, intra-standvariation in its cone structure and seed production have been actively studied during the last 50 years. However, these studies arepoorly related to practical breeding. We used a novel system of traits to characterize yearly seed crops at the different levels of itsstructural organization. The purpose is to analyze the results of long-term observations of the intra-stand variation of the reproductivefeatures complex, and to reveal the pattern and character of its diversity. This information would be useful to develop the method ofsearching the initial material for breeding. The research plot is established in the Nizhne-Sechenovo forest located 25 km fromTomsk in the south part of the boreal zone (170 years old, mean height 22 m, mean d.b.h. 60 cm. The number of sampled trees variedbetween 40-120 among years. The registration of seed crop and analysis of its structure was conducted every year from 1990 to 2005. Theintra-stand variation of the traits' level was determined as a standard deviation in percent from the simple average. The level ofvariability rose sharply and the correlations between them decreased in the years of the low crops. The results concerning variation in seedand cone traits are listed in the next table. The number of full seeds depended rather on losses in the processes of development (r =0.80*-0.85* than on their starting number (r =0.55*-0.60*. The mass of one seed with sound endosperm rose with an increase in the ratio ofthe ovules, which were lost at the earlier stagesof development (r = 0.20-0.25* and the flat seed ratio (r = 0.35*-0.40*. In year-to-year dynamics, the number of cones per tree ispositively connected with the number of filled seeds per cone (r = 0.78* and with other indices characterizing 'the crop quality'.The breeding rank of trees by all important

  18. Genome-wide conserved non-coding microsatellite (CNMS) marker-based integrative genetical genomics for quantitative dissection of seed weight in chickpea.

    Science.gov (United States)

    Bajaj, Deepak; Saxena, Maneesha S; Kujur, Alice; Das, Shouvik; Badoni, Saurabh; Tripathi, Shailesh; Upadhyaya, Hari D; Gowda, C L L; Sharma, Shivali; Singh, Sube; Tyagi, Akhilesh K; Parida, Swarup K

    2015-03-01

    Phylogenetic footprinting identified 666 genome-wide paralogous and orthologous CNMS (conserved non-coding microsatellite) markers from 5'-untranslated and regulatory regions (URRs) of 603 protein-coding chickpea genes. The (CT)n and (GA)n CNMS carrying CTRMCAMV35S and GAGA8BKN3 regulatory elements, respectively, are abundant in the chickpea genome. The mapped genic CNMS markers with robust amplification efficiencies (94.7%) detected higher intraspecific polymorphic potential (37.6%) among genotypes, implying their immense utility in chickpea breeding and genetic analyses. Seventeen differentially expressed CNMS marker-associated genes showing strong preferential and seed tissue/developmental stage-specific expression in contrasting genotypes were selected to narrow down the gene targets underlying seed weight quantitative trait loci (QTLs)/eQTLs (expression QTLs) through integrative genetical genomics. The integration of transcript profiling with seed weight QTL/eQTL mapping, molecular haplotyping, and association analyses identified potential molecular tags (GAGA8BKN3 and RAV1AAT regulatory elements and alleles/haplotypes) in the LOB-domain-containing protein- and KANADI protein-encoding transcription factor genes controlling the cis-regulated expression for seed weight in the chickpea. This emphasizes the potential of CNMS marker-based integrative genetical genomics for the quantitative genetic dissection of complex seed weight in chickpea. © The Author 2014. Published by Oxford University Press on behalf of the Society for Experimental Biology.

  19. Genetic basis for natural variation in seed vitamin E levels in Arabidopsis thaliana

    NARCIS (Netherlands)

    Gilliland, L.U.; Magallanes-Lundback, M.; Hemming, C.; Suppllee, A.; Koornneef, M.; Bentsink, L.; DellaPenna, D.

    2006-01-01

    Vitamin E is an essential nutrient for humans and is obtained primarily from food, especially oil, derived from the seed of plants. Genes encoding the committed steps in vitamin E synthesis in plants (VTE, loci 1-5) have been isolated and used for tocopherol pathway engineering with various degrees

  20. Spatial variation in seed bank dynamics of two annual brome species in the northern Great Plains

    Science.gov (United States)

    Annual bromes decrease forage production in northern central plains rangelands of North America. Early life history stages are when plants are most failure-prone, yet studying death post-germination and prior to emergence is difficult. In seed bank collections conducted over the course of two growin...

  1. How much genetic variation is stored in the seed bank? A study of Atriplex tatarica (Chenopodiaceae)

    Czech Academy of Sciences Publication Activity Database

    Mandák, Bohumil; Bímová, Kateřina; Mahelka, Václav; Plačková, Ivana

    2006-01-01

    Roč. 15, - (2006), s. 2653-2663 ISSN 0962-1083 R&D Projects: GA AV ČR IAA6005206 Institutional research plan: CEZ:AV0Z60050516 Keywords : seed bank * population genetic structure * competition Subject RIV: EF - Botanics Impact factor: 4.825, year: 2006

  2. Estimated Uncertainty in Segmented Gamma Scanner Assay Results due to the Variation in Drum Tare Weights

    International Nuclear Information System (INIS)

    Bosko, A.; Croft, St.; Gulbransen, E.

    2009-01-01

    General purpose gamma scanners are often used to assay unknown drums that differ from those used to create the default calibration. This introduces a potential source of bias into the matrix correction when the correction is based on the estimation of the mean density of the drum contents from a weigh scale measurement. In this paper we evaluate the magnitude of this bias that may be introduced by performing assay measurements with a system whose matrix correction algorithm was calibrated with a set of standard drums but applied to a population of drums whose tare weight may be different. The matrix correction factors are perturbed in such cases because the unknown difference in tare weight gets reflected as a bias in the derived matrix density. This would be the only impact if the difference in tare weight was due solely to the weight of the lid or base, say. But in reality the reason for the difference may be because the steel wall of the drum is of a different thickness. Thus, there is an opposing interplay at work which tends to compensate. The purpose of this work is to evaluate and bound the magnitude of the resulting assay uncertainty introduced by tare weight variation. We compare the results obtained using simple analytical models and the 3-D ray tracing with ISOCS software to illustrate and quantify the problem. The numerical results allow a contribution to the Total Measurement Uncertainty (TMU) to be propagated into the final assay result. (authors)

  3. Gas exchange, dry weights, and chlorophyll contents of Populus tremuloides seedlings grown from gamma-irradiated seeds

    International Nuclear Information System (INIS)

    Salmonson, B.J.; Zavitkovski, J.

    1977-01-01

    Photosynthesis and respiration rates of Populus tremuloides seedlings grown from seeds acutely irradiated with gamma rays (at levels of 0, 0.47, 0.94, 1.8, 3.7, 7.5, and 15 kr) were measured using a closed system and infrared (IR) gas analyzer. Dry weights of seedling roots and shoots and chlorophyll contents were also determined. In general, gamma irradiation of seed had little effect on subsequent gas-exchange processes in the plant. Net photosynthesis and dark respiration rates of the seedling at any radiation level were not significantly different from those of the control group. Pooled net photosynthesis of all irradiated seedlings was nonsignificantly lower than that of the control seedlings. The data suggested a slight stimulation in dry-matter production of shoots by low levels of gamma radiation. At the highest levels of radiation, shoot dry weight was significantly reduced. Root production displayed a pattern similar to that of shoots. No trends different from controls were evident in the shoot/root ratios. Total chlorophyll concentrations of the seedling increased over the controls by radiation treatment. Age and radiation effects were evident in the chlorophyll a/b ratios. The chlorophyll a/b ratios decreased with age in both the control and treatment groups. Although in seedlings 39 through 46 days old chlorophyll a/b ratios were higher in the control, chlorophyll a/b ratios were significantly higher in the treatment seedlings at 68 days. Changes in chlorophyll a were primarily responsible for this change

  4. Use of chemical mutagen for induction of useful genetic variation in different oil seed rape (brassica napus L.) cultivars

    International Nuclear Information System (INIS)

    Ali, I.; Shah, S.A.; Shah, S.J.A.; Rehman, K.

    1995-01-01

    Pre soaked seeds for 16 hrs of oil seed Rape cvs. Tower and Wester were treated with 1-3% concentrations of ethylene methane sulphonate (EMS) for 4 hrs with the objective to generate variation in characters of importance such as, early maturity, semi dwarf stature, lodging resistance and different yield components. After post washing (4 hrs) the seeds were filter dried and planted directly in the field as M1. Selection for desirable mutants was carried out in M2 and a number of mutants with desirable traits were selected during 1990-91. The mutants were tested for stability of the selected traits in plant to progenies in M3/M4 during 1992 and 1993. The stable 17 mutants were evaluated for yield and other agronomic characters in M5, in preliminary yield trials, during 1993-94. Eleven mutants exhibited early maturity and high yield potential than parent and local commercial variety. The promising mutants will be further tested in yield trials in future for confirmation of results. (author)

  5. Variations in resting energy expenditure: impact on gestational weight gain.

    Science.gov (United States)

    Berggren, E K; O'Tierney-Ginn, P; Lewis, S; Presley, L; De-Mouzon, S Hauguel; Catalano, P M

    2017-10-01

    There are significant variations in gestational weight gain, with many women gaining in excess of the Institute of Medicine guidelines. Unfortunately, efforts to improve appropriate gestational weight gain have had only limited success. To date, interventions have focused primarily on decreasing energy intake and/or increasing physical activity. Maternal resting energy expenditure, which comprises ∼60% of total energy expenditure compared with the ∼20% that comes from physical activity, may be an important consideration in understanding variations in gestational weight gain. Our objective was to quantify the changes in resting energy expenditure during pregnancy and their relationship to gestational weight gain and body composition changes among healthy women. We hypothesized that greater gestational weight gain, and fat mass accrual in particular, are inversely related to variations in resting energy expenditure. We conducted a secondary analysis of a prospective cohort studied before conception and late pregnancy (34-36 weeks). Body composition (estimated using hydrodensitometry) and resting energy expenditure (estimated using indirect calorimetry) were measured. The relationship between the changes in resting energy expenditure and gestational weight gain and the change in fat mass and fat-free mass were quantified. Resting energy expenditure was expressed as kilocalories per kilogram of fat-free mass per day (kilocalories per kilogram of fat-free mass -1 /day -1 ) and kilocalories per day. Correlations are reported as r. Among 51 women, preconception body mass index was 23.0 (4.7) kg/m 2 ; gestational weight gain was 12.8 (4.7) kg. Preconception and late pregnancy resting energy expenditure (kilocalories per day) correlated positively with the change in fat-free mass (r = 0.37, P = .008; r = 0.51, P = .001). Late-pregnancy resting energy expenditure (kilocalories per kilogram of fat-free mass -1 /day -1 ) was inversely associated with the change in fat

  6. Variations and controlling factors of the coccolith weight in the Western Pacific Warm Pool over the last 200 ka

    Science.gov (United States)

    Liang, Dan; Liu, Chuanlian

    2016-06-01

    Using a coccolith weight analytic software (Particle Analyser), we analyze most abundant coccolith species in a sediment core from the central Western Pacific Warm Pool (WPWP) and calculate coccolith size and weight variations over the last 200 ka. These variations are compared with the trends of sea surface temperature (SST), primary productivity (PP), sea surface salinity (SSS), and insolation. Our results demonstrate that the size and weight of the coccoliths varied in response to variations of these factors, and their average total weight is primarily related to the relative abundance of the dominant species GEO ( Gephyrocapsa oceanica). The variation in weight of EMI ( Emiliania huxleyi) and GEE ( Gephyrocapsa ericsonii) are mainly influenced by nutrients, and the variation of GEM ( G. muellerae conformis) and GEO ( G. oceanica) weight are mainly influenced by SST. For all of the taxa weight, PP and SST present apparent precession or semi-precession cycles, we consider that the mono-coccolith weight of the Equatorial Western Pacific is primarily affected by precession drived thermocline and nutricline variation.

  7. Changes of seed weight, fatty acid composition, oil and protein contents from different peanut FAD2 genotypes at different seed developmental and maturation stages

    Science.gov (United States)

    The level of oleic acid in peanut seed is one of the most important factors in determining seed quality and is controlled by two pairs of homeologous genes Fatty Acid Desaturase 2A and 2B (FAD2A and FAD2B). The genotypes of eight F8 breeding lines were determined as AABB, aaBB, AAbb, and aabb by rea...

  8. Variation of radiosensitivity of bean seeds depending where they come from

    International Nuclear Information System (INIS)

    Perez Talavera, S.

    1988-01-01

    Seeds from three cuban beans varieties were irradiated at different doses in a gamma source. They were cultivated in Krimsk, USSR by 5-8 generations and in Havana, Cuba. The height, root longitude and the fresh mass of the plantules 10-11 days after being sown in laboratory conditions were used as radiosensitivity indicators. Values significantly higher were obtained from 50-200 Gy for the relative values of the three indexes taken as radiosensitivity criteria in plantules from the tree

  9. De novo Genome Assembly and Single Nucleotide Variations for Soybean Mosaic Virus Using Soybean Seed Transcriptome Data

    Directory of Open Access Journals (Sweden)

    Yeonhwa Jo

    2017-10-01

    Full Text Available Soybean is the most important legume crop in the world. Several diseases in soybean lead to serious yield losses in major soybean-producing countries. Moreover, soybean can be infected by diverse viruses. Recently, we carried out a large-scale screening to identify viruses infecting soybean using available soybean transcriptome data. Of the screened transcriptomes, a soybean transcriptome for soybean seed development analysis contains several virus-associated sequences. In this study, we identified five viruses, including soybean mosaic virus (SMV, infecting soybean by de novo transcriptome assembly followed by blast search. We assembled a nearly complete consensus genome sequence of SMV China using transcriptome data. Based on phylogenetic analysis, the consensus genome sequence of SMV China was closely related to SMV isolates from South Korea. We examined single nucleotide variations (SNVs for SMVs in the soybean seed transcriptome revealing 780 SNVs, which were evenly distributed on the SMV genome. Four SNVs, C-U, U-C, A-G, and G-A, were frequently identified. This result demonstrated the quasispecies variation of the SMV genome. Taken together, this study carried out bioinformatics analyses to identify viruses using soybean transcriptome data. In addition, we demonstrated the application of soybean transcriptome data for virus genome assembly and SNV analysis.

  10. The atomic weight and isotopic composition of nitrogen and their variation in nature

    International Nuclear Information System (INIS)

    Holden, N.E.

    1987-01-01

    Two stable isotopes of nitrogen exist in nature, 14 N and 15 N. The less abundant isotope, 15 N, was discovered in 1929 by Naude, who studied the band spectra of nitric oxide, NO. However, the main source of a standard for this element is the air in the atmosphere, which is made up of approximately 78% N 2 . Reviewed in this paper is the measurements of the isotopic composition in air and its variation around the world. Also investigated is the variation of the isotopic composition in the various compounds or sources of nitrogen compared to the value in air. Data on the atomic weight and non-terrestrial data for nitrogen is also reviewed

  11. The effect of maternal breast variations on neonatal weight gain in the first seven days of life

    Directory of Open Access Journals (Sweden)

    Esmaeili Abbas

    2009-11-01

    Full Text Available Abstract Background This study aims to examine whether specific maternal breast variations (such as flat nipple, inverted nipple, large breast or/and large nipple are barriers for weight gain in breastfed infants during the first seven days of life. Methods In this prospective cohort study, 100 healthy term neonates were followed from birth to day seven in two groups; Group A: fifty neonates born to mothers with specified breast variations and Group B: fifty neonates born to mothers without such breast variations ("normal breasts". All neonates were the first child of their families and there was no sex ratio difference between the two groups. Neonates' weight at birth and day seven were measured and the mean weight differences in the two groups were compared using paired t-test. Results Neonates born to mothers without the specified breast variations had a mean weight gain of (+ 53 ± 154.4 g at day seven., Not only there was no increase in the mean weight of neonates in the other group, but they had a mean decrease of weight of (- 162 ± 125.5 g by the seventh day of their life compared to birth weight. Thus, neonates born to mothers without breast variations had significantly greater weight gain than neonates born to the mothers with the specified variations (p Conclusion Breast variation among first-time mothers acts as an important barrier to weight gain among breastfed neonates in the early days of life. Health professionals need skills in the management of breastfeeding among mothers with the specified breast variations, so that mothers are given appropriate advice on how to breastfeed and overcome these problems.

  12. Identification of seed-related QTL in Brassica rapa

    Directory of Open Access Journals (Sweden)

    H. Bagheri

    2013-10-01

    Full Text Available To reveal the genetic variation, and loci involved, for a range of seed-related traits, a new F2 mapping population was developed by crossing Brassica rapa ssp. parachinensis L58 (CaiXin with B. rapa ssp. trilocularis R-o-18 (spring oil seed, both rapid flowering and self-compatible. A linkage map was constructed using 97 AFLPs and 21 SSRs, covering a map distance of 757 cM with an average resolution of 6.4 cM, and 13 quantitative trait loci (QTL were detected for nine traits. A strong seed colour QTL (LOD 26 co-localized with QTL for seed size (LOD 7, seed weight (LOD 4.6, seed oil content (LOD 6.6, number of siliques (LOD 3 and number of seeds per silique (LOD 3. There was only a significant positive correlation between seed colour and seed oil content in the yellow coloured classes. Seed coat colour and seed size were controlled by the maternal plant genotype. Plants with more siliques tended to have more, but smaller, seeds and higher seed oil content. Seed colour and seed oil content appeared to be controlled by two closely linked loci in repulsion phase. Thus, it may not always be advantageous to select for yellow-seededness when breeding for high seed oil content in Brassicas.

  13. Exchange bias variations of the seed and top NiFe layers in NiFe/FeMn/NiFe trilayer as a function of seed layer thickness

    International Nuclear Information System (INIS)

    Sankaranarayanan, V.K.; Yoon, S.M.; Kim, C.G.; Kim, C.O.

    2005-01-01

    Development of exchange bias at the seed and top NiFe layers in the NiFe (t nm)/FeMn(10 nm)/NiFe(5 nm) trilayer structure is investigated as a function of seed layer thickness, in the range of 2-20 nm. The seed NiFe layer shows maximum exchange bias at 4 nm seed layer thickness. The bias shows inverse thickness dependence with increasing thickness. The top NiFe layer on the other hand shows only half the bias of the seed layer which is retained even after the sharp fall in seed layer bias. The much smaller bias for the top NiFe layer is related to the difference in crystalline texture and spin orientations at the top FeMn/NiFe interface, in comparison to the bottom NiFe/FeMn interface which grows on a saturated NiFe layer with (1 1 1) orientation

  14. Variations in Enzymatic Activities of Shoots and Roots as an Indicator for Irradiated Seeds

    International Nuclear Information System (INIS)

    Abdelbbaary, N.A.; Elagamay, M.R.

    2005-01-01

    Germinated seedlings from oil seeds (sesame and sunflower) and legumes (Trigonella, Haricot, broad bean and cow pea) were irradiated with gamma rays at doses of 0, 0.2, 0.4, 0.8 and 1 kGy and the data were collected from shoots and roots. Enzymatic activities appeared to be correlated with gamma irradiation dose. The enzymatic activities of irradiated seeds understudy were significantly higher than controls. The peroxidase activities were nearly similar in both roots and shoots, while acid phosphatase activities in roots were higher than in shoots. Also protein contents were higher in roots. The peroxidase and acid phosphatase specific activities in roots were similar. Shoots peroxidase enzymatic activity increased with increased gamma doses. The seedling under study showed two different levels of peroxidase activity, higher as sesame, Trigonella and Sunflower, and lower such as all other legumes understudy. Similar tendency have been also noticed in roots-enzymatic activity, positive correlation between gamma doses treatment and peroxidase enzymatic activity, again two groups higher activity cow pea, broad bean, bean and Trigonella lower such as sesame, such as sesame, sunflower and haircut

  15. Gamma irradiation-induced variation in carrots (Daucus carota L.)

    International Nuclear Information System (INIS)

    Al-Safadi, B.; Simon, P.W.

    1996-01-01

    Carrot tissue cultures, germinating seed, and dry seed were exposed to gamma radiation. Irradiation accelerated germination of carrot seed in the M1 generation at low doses (0.5 and 1 krad), whereas higher doses delayed germination. A high negative correlation was observed between dose and survival of plants after seed irradiation. Plant size and root weight were 20% to 35% greater than control plants after seeds, but not tissue cultures, were exposed to low doses of gamma irradiation. Higher doses reduced M1 plant size by 50% in germinating seed and tissue culture treatments but less for the dry seed treatment. Seed production decreased while phenotypic variation of M1 plants increased with increasing gamma ray dosage. Root weight and total dissolved solids were highly variable in M2 families. Less variation was observed in total carotene content and none was seen in sugar type (reducing vs. non reducing sugars). Induced variation in root color and root shape was also observed. Irradiation of germinating seed and tissue cultures yielded more M2 variation than irradiation of dry seed. Putative point mutations were not observed. Unirradiated carrot tissue cultures did not yield significant M2 somaclonal variation. Average root weight of M2 plants increased with increasing gamma ray dosage, especially for the dry seed treatment

  16. Gamma irradiation induced variation in carrots (Daucus Carota L.)

    International Nuclear Information System (INIS)

    Al-Safady, B.; Simon, P.W.

    1999-01-01

    Carrot tissue cultures, germinating seed, and dry seed were exposed to gamma radiation. Irradiation accelerated germination of carrot seed in the M 1 generation at low doses (0.5 and 1 krad), whereas higher doses delayed germination. A high negative correlation was observed between dose and survival of plants after seed irradiation. Plant size and root weight were 20% to 35% greater than control plants after seeds, but not tissue culture, were exposed to low doses of gamma irradiation. Higher doses reduced M 1 plant size by > 50% in germinating seed and tissue culture treatments but less for the dry seed treatment. Seed production decreased while phenotypic variation of M 1 plants increased with increasing gamma ray dosage. Root weight and total dissolved solids were highly variable in M 2 families. Less variation was observed in total carotene content and none was seen in sugar type [reducing vs. non reducing sugars]. Induced variation in root color and rot shape was also observed. Irradiation of germinating seed and tissue cultures yielded more M 2 variation than irradiation of dry seed. Putative point mutations were not observed. Unirradiated carrot tissue cultures did not yield significant M 2 somaclonal variation. Average root weight of M 2 plants increased with increasing gamma ray dosage, especially for the dry seed treatment (Author)

  17. Natural genetic variation of seed micronutrients of Arabidopsis thaliana grown in zinc-deficient and zinc-amended soil

    Directory of Open Access Journals (Sweden)

    Xiaochao Chen

    2016-07-01

    Full Text Available The quality of edible seeds for human and animal nutrition is crucially dependent on high zinc (Zn and iron (Fe seed concentrations. The micronutrient bioavailability is strongly reduced by seed phytate that forms complexes with seed cations. Superior genotypes with increased seed Zn concentrations had been identified, but low micronutrient seed levels often prevail when the plants are grown in Zn-deficient soils, which are globally widespread and correlate with human Zn-deficiency. Here, seed Zn concentrations of Arabidopsis accessions grown in Zn-deficient and Zn-amended conditions were measured together with seed Fe and manganese (Mn, in a panel of 108 accessions. By applying genome-wide association, de novo candidate genes potentially involved in the seed micronutrient accumulation were identified. However, a candidate inositol 1,3,4-trisphosphate 5/6-kinase 3 gene (ITPK3, located close to a significant nucleotide polymorphism associated with relative Zn seed concentrations, was dispensable for seed micronutrients accumulation in Col-0. Loss of this gene in itpk3-1 did neither affect phytate seed levels, nor seed Zn, Fe and Mn. It is concluded that large natural variance of micronutrient seed levels is identified in the population and several accessions maintain high seed Zn despite growth in Zn-deficient conditions.

  18. Development of Insertion and Deletion Markers based on Biparental Resequencing for Fine Mapping Seed Weight in Soybean

    Directory of Open Access Journals (Sweden)

    Ying-hui Li

    2014-11-01

    Full Text Available As a complement to single nucleotide polymorphisms (SNPs and simple sequence repeats (SSRs, biallelic insertions and deletions (InDels represent powerful molecular markers with desirable features for filling the gap in current genetic linkage maps. In this study, 28,908 small InDel polymorphisms (1–5 base pair, bp distributed genome-wide were identified and annotated by comparison of a whole-genome resequencing data set from two soybean [ (L. Merr.] genotypes, cultivar Zhonghunag13 (ZH and line Zhongpin03-5373 (ZP. The physical distribution of InDel polymorphisms in soybean genome was uneven, and matched closely with the distribution of previously annotated genes. The average density of InDel in the arm region was significantly higher than that in the pericentromeric region. The genomic regions that were fixed between the two elites were elucidated. With this information, five InDel markers within a putative quantitative trait locus (QTL for seed weight (SW, , were developed and used to genotype 254 recombinant inbred lines (RILs derived from the cross of ZP × ZH. Adding these five InDel markers to previously used SNP and SSR markers facilitated the discovery of further recombination events allowing fine-mapping the QTL to a 0.5 Mbp region. Our study clearly underlines the high value of InDel markers for map-based cloning and marker-assisted selection in soybean.

  19. Genetic variation of γ-tocopherol methyltransferase gene contributes to elevated α-tocopherol content in soybean seeds.

    Science.gov (United States)

    Dwiyanti, Maria S; Yamada, Tetsuya; Sato, Masako; Abe, Jun; Kitamura, Keisuke

    2011-11-07

    Improvement of α-tocopherol content is an important breeding aim to increase the nutritional value of crops. Several efforts have been conducted to improve the α-tocopherol content in soybean [Glycine max (L.) Merr.] through transgenic technology by overexpressing genes related to α-tocopherol biosynthesis or through changes to crop management practices. Varieties with high α-tocopherol content have been identified in soybean germplasms. The heritability of this trait has been characterized in a cross between high α-tocopherol variety Keszthelyi Aproszemu Sarga (KAS) and low α-tocopherol variety Ichihime. In this study, the genetic mechanism of the high α-tocopherol content trait of KAS was elucidated. Through QTL analysis and fine mapping in populations from a cross between KAS and a Japanese variety Ichihime, we identified γ-TMT3, which encodes γ-tocopherol methyltransferase, as a candidate gene responsible for high α-tocopherol concentration in KAS. Several nucleotide polymorphisms including two nonsynonymous mutations were found in the coding region of γ-TMT3 between Ichihime and KAS, but none of which was responsible for the difference in α-tocopherol concentration. Therefore, we focused on transcriptional regulation of γ-TMT3 in developing seeds and leaves. An F5 line that was heterozygous for the region containing γ-TMT3 was self-pollinated. From among the progeny, plants that were homozygous at the γ-TMT3 locus were chosen for further evaluation. The expression level of γ-TMT3 was higher both in developing seeds and leaves of plants homozygous for the γ-TMT3 allele from KAS. The higher expression level was closely correlated with high α-tocopherol content in developing seeds. We generated transgenic Arabidopsis plants harboring GUS gene under the control of γ-TMT3 promoter from KAS or Ichihime. The GUS activity assay showed that the activity of γ-TMT3 promoter from KAS was higher than that of Ichihime. The genetic variation in γ-TMT3

  20. Genetic variation of γ-tocopherol methyltransferase gene contributes to elevated α-tocopherol content in soybean seeds

    Directory of Open Access Journals (Sweden)

    Abe Jun

    2011-11-01

    Ichihime. Conclusions The genetic variation in γ-TMT3, which plays a major role in determining α-tocopherol concentration, provides significant information about the regulation of tocopherol biosynthesis in soybean seeds. This knowledge will help breeding programs to develop new soybean varieties with high α-tocopherol content.

  1. Phenotypic variation in fruit, seed and seedling traits of nine Uapaca ...

    African Journals Online (AJOL)

    Uapaca kirkiana is one of the priority indigenous fruit tree species for domestication in southern Africa. Natural populations of U. kirkiana are declining due to deforestation, forest fragmentation and wildfires. Knowledge of genetic variation is prerequisite for development of conservation strategies. A provenance evaluation ...

  2. DOG1 expression is predicted by the seed-maturation envornment and contributes to geographical variation in germination in Arabidopsis thaliana

    OpenAIRE

    Chiang, G.C.K.; Bartsch, M.; Barua, D.; Nakabayashi, K.; Debieu, M.; Kronholm, I.; Koornneef, M.; Soppe, W.J.J.; Donohue, K.; Meaux, De, J.

    2011-01-01

    Seasonal germination timing of Arabidopsis thaliana strongly influences overall life history expression and is the target of intense natural selection. This seasonal germination timing depends strongly on the interaction between genetics and seasonal environments both before and after seed dispersal. DELAY OF GERMINATION 1 (DOG1) is the first gene that has been identified to be associated with natural variation in primary dormancy in A. thaliana. Here, we report interaccession variation in DO...

  3. The variation of nitrogen and phosphorus contents in M4-generation seeds of an irradiated local sorghum variety originating from northern Ghana

    International Nuclear Information System (INIS)

    Froehlich, W.; Buah, S.S.J.; Abdulai, M.S.; Nyamekye, A.L.

    2001-01-01

    Full text: Natural genetic variability in sorghum (Sorghum bicolor (L.) Moench) is very large, however, a number of attempts have been made to broaden its genetic base by induced mutations. Most authors refer to visible characters in plant and grain. Occasionally, effects on grain quality, e.g. high lysine/high protein, are reported. Sorghum in northern Ghana, commonly called 'guinea corn', is a widely cultivated cereal crop and can be found in three local races among which the caudatum race is represented by 'Naga White', an improved local variety originating from the Upper East Region of Ghana. It is characterized by short straw, earliness, good grain yield, a semi-loose head, and white grains, but with a relatively poor grain quality. The objective in several breeding programmes was the improvement of its grain quality, and an induced mutations programme was started at Nyankpala Agricultural Experiment Station (NAES) in 1988. About 10,000 seeds of Naga White were treated with 200Gy from a 60 Co gamma-rays source. The M 1 -generation was planted at NAES and multiplied up to M 4 in 1991, subject to selection for agronomic value. Protein contents (Nx5.7) varied from 9 to 10% for grains of parental genotype and from 8 to 12% in M 2 grains harvested in 1990. In 1992, the agronomically best 112 seed samples of M 4 lines were analyzed for N and P contents, 1000-grain weight (GW) and protein contents. Protein contents ranged from 7.0 to 13.6%, phosphorus from 0.15 to 0.45%, and thousand grain weight varied from 11.8 to 19.0 g. The coefficient of the phenotypic correlation between N and P was + 0.337, and several lines with both high N and P contents could be identified. The coefficients of correlation between grain size and both N and P contents were slightly negative but not statistically significant. The coefficient of variation for the P content was twice as high as that for the N content. This might indicate a considerable microvariability in soil phosphorus due to

  4. Developmental variation during seed germination and biochemical responses of Brassica rapa exposed to various colored lights.

    Science.gov (United States)

    Nawaz, Tausif; Ahmad, Nisar; Ali, Shahid; Khan, Maaz; Fazal, Hina; Khalil, Shahid Akbar

    2018-02-01

    Light acting as elicitor or stress inducer, it plays a pivotal role in all developmental processes of plant providing necessary building blocks for growth and primary and secondary metabolites production. The main objective of the current study was to investigate the individual effect of colored lights on developmental processes and production of polyphenolics contents in Brassica rapa. In this study, the red and white lights (control) were found to be the most effective sources for seed germination (91%) in Brassica rapa. Similarly, red light enhanced radicle growth (102 mm), while green light suppressed radicle growth (60 mm) as compared to control (67 mm). The red light also promoted the plumule growth (50 mm) as compared to control (37 mm). The maximum biomass gain (67 mg) was observed under red light as compared to control (55 mg). Currently, the maximum total phenolics content (9.49 mg/g-DW) and phenolics production (379.616 mg/L) was observed under the influence of blue lights as compared to control (0.23 mg/g-DW and 8.91 mg/L). Similarly, the blue lights also enhanced the biosynthesis of total flavonoids content (2.2611 mg/g-DW) and flavonoids production (90.44 mg/L) as compared to control (0.0318 md/g-DW and 0.8268 mg/L). The current results represents that red and blue lights are the most effective sources for plantlets development and production of polyphenolics content in Brassica rapa. Copyright © 2018. Published by Elsevier B.V.

  5. Over-expression of a tobacco nitrate reductase gene in wheat (Triticum aestivum L. increases seed protein content and weight without augmenting nitrogen supplying.

    Directory of Open Access Journals (Sweden)

    Xiao-Qiang Zhao

    Full Text Available Heavy nitrogen (N application to gain higher yield of wheat (Triticum aestivum L. resulted in increased production cost and environment pollution. How to diminish the N supply without losing yield and/or quality remains a challenge. To meet the challenge, we integrated and expressed a tobacco nitrate reductase gene (NR in transgenic wheat. The 35S-NR gene was transferred into two winter cultivars, "Nongda146" and "Jimai6358", by Agrobacterium-mediation. Over-expression of the transgene remarkably enhanced T1 foliar NR activity and significantly augmented T2 seed protein content and 1000-grain weight in 63.8% and 68.1% of T1 offspring (total 67 individuals analyzed, respectively. Our results suggest that constitutive expression of foreign nitrate reductase gene(s in wheat might improve nitrogen use efficiency and thus make it possible to increase seed protein content and weight without augmenting N supplying.

  6. Over-expression of a tobacco nitrate reductase gene in wheat (Triticum aestivum L.) increases seed protein content and weight without augmenting nitrogen supplying.

    Science.gov (United States)

    Zhao, Xiao-Qiang; Nie, Xuan-Li; Xiao, Xing-Guo

    2013-01-01

    Heavy nitrogen (N) application to gain higher yield of wheat (Triticum aestivum L.) resulted in increased production cost and environment pollution. How to diminish the N supply without losing yield and/or quality remains a challenge. To meet the challenge, we integrated and expressed a tobacco nitrate reductase gene (NR) in transgenic wheat. The 35S-NR gene was transferred into two winter cultivars, "Nongda146" and "Jimai6358", by Agrobacterium-mediation. Over-expression of the transgene remarkably enhanced T1 foliar NR activity and significantly augmented T2 seed protein content and 1000-grain weight in 63.8% and 68.1% of T1 offspring (total 67 individuals analyzed), respectively. Our results suggest that constitutive expression of foreign nitrate reductase gene(s) in wheat might improve nitrogen use efficiency and thus make it possible to increase seed protein content and weight without augmenting N supplying.

  7. Variations in seed protein content of cotton (Gossypium hirsutum L.) mutant lines by in vivo and in vitro mutagenesis.

    Science.gov (United States)

    Muthusamy, Annamalai; Jayabalan, Narayanasamy

    2013-01-01

    The present work describes the influence of gamma irradiation (GR), ethyl methane sulphonate (EMS) and sodium azide (SA) treatment on yield and protein content of selected mutant lines of cotton. Seeds of MCU 5 and MCU 11 were exposed to gamma rays (GR), ethyl methane sulphonate (EMS) and sodium azide (SA). Lower dose of gamma irradiation (100-500 Gy), 10-50 mM EMS and SA at lower concentration effectively influences in improving the yield and protein content. Significant increase in yield (258.9 g plant(-1)) and protein content (18.63 mg g(-1) d. wt.) as compared to parental lines was noted in M2 generations. During the subsequent field trials, number of mutant lines varied morphologically in terms of yield as well as biochemical characters such as protein. The selected mutant lines were bred true to their characters in M3 and M4 generations. The significant increase in protein content and profiles of the mutant lines with range of 10.21-18.63 mg g(-1). The SDS-PAGE analysis of mutant lines revealed 9 distinct bands of different intensities with range of 26-81 kDa. The difference in intensity of bands was more (41, 50 and 58 kDa) in the mutant lines obtained from in vitro mutation than in vivo mutation. Significance of such stimulation in protein content correlated with yielding ability of the mutant lines of cotton in terms of seed weight per plant. The results confirm that in cotton it is possible to enhance the both yield and biochemical characters by in vivo and in vitro mutagenic treatments.

  8. Mapping genetic variation and seed zones for Bromus carinatus in the Blue Mountains of eastern Oregon, USA

    Science.gov (United States)

    R.C. Johnson; Vicky J. Erickson; Nancy L. Mandel; J. Bradley St. Clair; Kenneth W. Vance-Borland

    2010-01-01

    Seed transfer zones ensure that germplasm selected for restoration is suitable and sustainable in diverse environments. In this study, seed zones were developed for mountain brome (Bromus carinatus Hook. & Arn.) in the Blue Mountains of northeastern Oregon and adjoining Washington. Plants from 148 Blue Mountain seed source locations were...

  9. Intraspecific growth variation among rainbow trout and brook trout: Impact of initial body weight and feeding level

    DEFF Research Database (Denmark)

    Rasmussen, Richard Skøtt; Ostenfeld, T.

    2010-01-01

    larger body weight (BW) CVs compared to BT (0.257 vs. 0.206, P differences in weight gains enhance size variations in terms...... for species (RT: 3.71, BT: 2.32, P > 0.05). The magnitude of slopes decreased over time (weeks 0–3:4.27, weeks 3–6:3.02 and weeks 6–9:1.74, P differences in weight gains between experimental groups were reflected in differences in coefficients of variations (CVs) for body growth. RT had...... of higher CVs, and this may have implications for feeding tactics in aquaculture where large size variations in groups may be disadvantageous to fish farmers....

  10. The Effect of Flax Seed (Linum Usitatissimum) Hydroalcoholic Extract on Brain, Weight and Plasma Sexual Hormone Levels in Aged and Young Mice.

    Science.gov (United States)

    Bahmanpour, Soghra; Kamali, Mahsa

    2016-05-01

    Flax is a food and fiber crop that is grown in some regions of the world. Its value will account for its great popularity as a food, medical and cosmetic applications. Flax fibers are taken from the stem of the plant and are two to three times as strong as cotton. In this study, we compared brain weight and plasma sex hormone levels in young and aged mice after the administration of Linum usitatissimum (flax seed) hydro alcoholic extract. In this study, 32 aged and 32 young mice were divided into 4 groups. Controls remained untreated and experimental groups were fed with flax seed hydroalcoholic extract by oral gavages during 3 weeks. After 3 weeks, the brain was removed and blood samples were collected to measure sex hormone levels by ELISA. Data analysis was done by statistical ANOVA test using SPSS version 18 (P<0.05). The results of this study shows that the brain weight of mice did not change significantly, but the sex hormone levels in the experimental groups in comparison with the control groups increased significantly (P<0.05). The hydroalcoholic extract of flax seed had no effect on the brain weight, but this extract improved the sexual hormone levels.

  11. Human cerebral cortices: signal variation on diffusion-weighted MR imaging

    Energy Technology Data Exchange (ETDEWEB)

    Asao, Chiaki [Kumamoto Regional Medical Center, Department of Radiology, Kumamoto (Japan); National Hospital Organization Kumamoto Medical Center, Department of Radiology, Kumamoto (Japan); Hirai, Toshinori; Yamashita, Yasuyuki [Kumamoto University Graduate School of Medical Sciences, Department of Diagnostic Radiology, Kumamoto (Japan); Yoshimatsu, Shunji [National Hospital Organization Kumamoto Medical Center, Department of Radiology, Kumamoto (Japan); Matsukawa, Tetsuya; Imuta, Masanori [Kumamoto Regional Medical Center, Department of Radiology, Kumamoto (Japan); Sagara, Katsuro [Kumamoto Regional Medical Center, Department of Internal Medicine, Kumamoto (Japan)

    2008-03-15

    We have often encountered high signal intensity (SI) of the cingulate gyrus and insula during diffusion-weighted magnetic resonance imaging (DW-MRI) on neurologically healthy adults. To date, cortical signal heterogeneity on DW images has not been investigated systematically. The purpose of our study was to determine whether there is regional signal variation in the brain cortices of neurologically healthy adults on DW-MR images. The SI of the cerebral cortices on DW-MR images at 1.5 T was evaluated in 50 neurologically healthy subjects (34 men, 16 women; age range 33-84 years; mean age 57.6 years). The cortical SI in the cingulate gyrus, insula, and temporal, occipital, and parietal lobes was graded relative to the SI of the frontal lobe. Contrast-to-noise ratios (CNRs) on DW-MR images were compared for each cortical area. Diffusion changes were analyzed by visually assessment of the differences in appearance among the cortices on apparent diffusion coefficient (ADC) maps. Increased SI was frequently seen in the cingulate gyrus and insula regardless of patient age. There were no significant gender- or laterality-related differences. The CNR was significantly higher in the cingulate gyrus and insula than in the other cortices (p <.01), and significant differences existed among the cortical regions (p <.001). There were no apparent ADC differences among the cortices on ADC maps. Regional signal variation of the brain cortices was observed on DW-MR images of healthy subjects, and the cingulate gyrus and insula frequently manifested high SI. These findings may help in the recognition of cortical signal abnormalities as visualized on DW-MR images. (orig.)

  12. Human cerebral cortices: signal variation on diffusion-weighted MR imaging

    International Nuclear Information System (INIS)

    Asao, Chiaki; Hirai, Toshinori; Yamashita, Yasuyuki; Yoshimatsu, Shunji; Matsukawa, Tetsuya; Imuta, Masanori; Sagara, Katsuro

    2008-01-01

    We have often encountered high signal intensity (SI) of the cingulate gyrus and insula during diffusion-weighted magnetic resonance imaging (DW-MRI) on neurologically healthy adults. To date, cortical signal heterogeneity on DW images has not been investigated systematically. The purpose of our study was to determine whether there is regional signal variation in the brain cortices of neurologically healthy adults on DW-MR images. The SI of the cerebral cortices on DW-MR images at 1.5 T was evaluated in 50 neurologically healthy subjects (34 men, 16 women; age range 33-84 years; mean age 57.6 years). The cortical SI in the cingulate gyrus, insula, and temporal, occipital, and parietal lobes was graded relative to the SI of the frontal lobe. Contrast-to-noise ratios (CNRs) on DW-MR images were compared for each cortical area. Diffusion changes were analyzed by visually assessment of the differences in appearance among the cortices on apparent diffusion coefficient (ADC) maps. Increased SI was frequently seen in the cingulate gyrus and insula regardless of patient age. There were no significant gender- or laterality-related differences. The CNR was significantly higher in the cingulate gyrus and insula than in the other cortices (p <.01), and significant differences existed among the cortical regions (p <.001). There were no apparent ADC differences among the cortices on ADC maps. Regional signal variation of the brain cortices was observed on DW-MR images of healthy subjects, and the cingulate gyrus and insula frequently manifested high SI. These findings may help in the recognition of cortical signal abnormalities as visualized on DW-MR images. (orig.)

  13. Temporal variation in the prevalence of weight and obesity excess in adults: Brazil, 2006 to 2009.

    Science.gov (United States)

    Gigante, Denise Petrucci; de França, Giovanny Vinícius Araújo; Sardinha, Luciana Monteiro Vasconcelos; Iser, Betine Pinto Moehlecke; Meléndez, Gustavo Velasquez

    2011-09-01

    Overweight and obesity are public health issues that affect an important part of the world population. This study aims at describing the trends in overweight and obesity prevalence rates from 2006 to 2009, by means of telephone surveys in 27 Brazilian cities, with a population aged 18 years or older. The body mass index (BMI) was calculated by the reported height and weight; overweight and obesity were considered as BMI >25 kg/m² and >30 kg/m², respectively. Temporal variation in overweight and obesity prevalence is presented for men and women, according to age group, schooling, stable relationship, and skin color. Poisson regression was used for the analysis. Overweight prevalence was 43.0, 42.7, 44.2 and 46.6%,for each year of the period from 2006 to 2009, respectively. For obesity, in the same period, the trend was: 11.4, 12.7, 13.2 and 13.8%. The temporal trend varied in relation to some demographic and socioeconomic variables. The prevalence was higher among women and young adults. The temporal trend was independent of the relationship status of the interviewees, but the prevalence was higher among white women and those with less years of schooling. The results in this study confirmed the urgent need for effective prevention and control measures, as the increasing trend is occurring in a short period of time, especially among youngsters.

  14. a Study on Variations of Shoreline Changes and Temporal-Spatial Potentiality for Cloud Seeding at Urumia Lake

    Science.gov (United States)

    Agha Taher, R.; Jafari, M.; Fallah, M.; Alavi, A.

    2015-12-01

    time period has been used. In order to reach better results, images from MODIS satellite has been used as auxiliary data for the images that are with an error margin. Initial classification on the images was conducted to distinguish water and non water applications. Neural network classification was applied with specific scales on the images and the two major applications were thereby extracted. Then, in order to authenticate the proceedings, Error matrix and Kappa coefficient has been applied on the classified images. Base pixel method of neural network was used for the purpose of information extraction while authenticity of that was evaluated too. The outcomes display the trend of Urmia shoreline has been approximately constant between the years of 1976 to 1995 and has experienced very low variations. In 1998 the lake experienced increase of water and therefore advancement of the shoreline of the lake due to increase of precipitation and the volume of inflowing water to the basin. During 2000 to 20125, however, the lake's shoreline has experienced a downward trend, which was intensified in 2007 and reached to its most critical level ever since, that is decreasing to about one third. Further, temporal and spatial potentiality evaluation of clouds seeding in Urmia lake zone has been studied as a solution for improvement and recovery of the current status of the lake, and an algorithm was proposed for optimized temporal- spatial study on could seeding. Ecological, meteorological and synoptic data were used for timing study of the cloud's seeding plan, which upon study; it is easy to evaluate precipitation potential and quality of the system. At the next step, the rate of humidity and also stability of the precipitating system can be analyzed using radar acquired data. Whereas extracted date from MODIS images are expressing the spatial position, therefore in order to study the location of the cloud's seeding, MODIS images of the selected time intervals along with

  15. A STUDY ON VARIATIONS OF SHORELINE CHANGES AND TEMPORAL-SPATIAL POTENTIALITY FOR CLOUD SEEDING AT URUMIA LAKE

    Directory of Open Access Journals (Sweden)

    R. Agha Taher

    2015-12-01

    + sensors in the 35 time period has been used. In order to reach better results, images from MODIS satellite has been used as auxiliary data for the images that are with an error margin. Initial classification on the images was conducted to distinguish water and non water applications. Neural network classification was applied with specific scales on the images and the two major applications were thereby extracted. Then, in order to authenticate the proceedings, Error matrix and Kappa coefficient has been applied on the classified images. Base pixel method of neural network was used for the purpose of information extraction while authenticity of that was evaluated too. The outcomes display the trend of Urmia shoreline has been approximately constant between the years of 1976 to 1995 and has experienced very low variations. In 1998 the lake experienced increase of water and therefore advancement of the shoreline of the lake due to increase of precipitation and the volume of inflowing water to the basin. During 2000 to 20125, however, the lake’s shoreline has experienced a downward trend, which was intensified in 2007 and reached to its most critical level ever since, that is decreasing to about one third. Further, temporal and spatial potentiality evaluation of clouds seeding in Urmia lake zone has been studied as a solution for improvement and recovery of the current status of the lake, and an algorithm was proposed for optimized temporal- spatial study on could seeding. Ecological, meteorological and synoptic data were used for timing study of the cloud’s seeding plan, which upon study; it is easy to evaluate precipitation potential and quality of the system. At the next step, the rate of humidity and also stability of the precipitating system can be analyzed using radar acquired data. Whereas extracted date from MODIS images are expressing the spatial position, therefore in order to study the location of the cloud’s seeding, MODIS images of the selected time

  16. Analysis of natural allelic variation of Arabidopsis seed germination and seed longevity traits between the accessions Landberg erecta and Shakdara, using a new recombinant inbred line population

    NARCIS (Netherlands)

    Clerkx, E.J.M.; El-Lithy, M.E.M.; Vierling, E.; Ruijs, G.J.; Vries, de M.H.C.; Groot, S.P.C.; Vreugdenhil, D.; Koornneef, M.

    2004-01-01

    Quantitative trait loci (QTL) mapping was used to identify loci controlling various aspects of seed longevity during storage and germination. Similar locations for QTLs controlling different traits might be an indication for a common genetic control of such traits. For this analysis we used a new

  17. Hip fracture and anthropometric variations: dominance among trochanteric soft tissue thickness, body height and body weight during sideways fall.

    Science.gov (United States)

    Majumder, Santanu; Roychowdhury, Amit; Pal, Subrata

    2013-01-01

    Hip fracture depends on various anthropometric parameters such as trochanteric soft tissue thickness, body height and body weight. The objective was to evaluate the responses to the variations in anthropometric parameters during sideways fall, and to identify the most dominant parameter among them. Seven finite element models were developed having anthropometric variations in trochanteric soft tissue thickness (5-26 mm), body height (1.70-1.88 m), and body weight (63-93.37 kg). These were simulated for sideways fall with ANSYS-LS-DYNA® code. Significant effect of trochanteric soft tissue thickness variation was found on 'normalized peak impact force with respect to the body weight' (p=0.004, r²=0.808) and strain ratio (p=0.083, r²=0.829). But, variation in body height was found to be less significant on normalized peak impact force (p=0.478, r²=0.105) and strain ratio (p=0.292, r²=0.217). Same was true for the variation in body weight on normalized peak impact force (p=0.075, r²=0.456) and strain ratio (p=0.857, r²=0.007). The risk factor for fracture was also well correlated to the strain ratio for the inter-trochanteric zone (pfractures are clinically observed to happen. Trochanteric soft tissue thickness was found likely to be the most dominant parameter over body height and body weight, signifying that a slimmer elderly person, taller or shorter, with less trochanteric soft tissue thickness should be advised to take preventive measures against hip fracture under sideways fall. © 2013.

  18. Genetic variability of environmental sensitivity revealed by phenotypic variation in body weight and (its correlations to physiological and behavioral traits.

    Directory of Open Access Journals (Sweden)

    Delphine Lallias

    Full Text Available Adaptive phenotypic plasticity is a key component of the ability of organisms to cope with changing environmental conditions. Fish have been shown to exhibit a substantial level of phenotypic plasticity in response to abiotic and biotic factors. In the present study, we investigate the link between environmental sensitivity assessed globally (revealed by phenotypic variation in body weight and more targeted physiological and behavioral indicators that are generally used to assess the sensitivity of a fish to environmental stressors. We took advantage of original biological material, the rainbow trout isogenic lines, which allowed the disentangling of the genetic and environmental parts of the phenotypic variance. Ten lines were characterized for the changes of body weight variability (weight measurements taken every month during 18 months, the plasma cortisol response to confinement stress (3 challenges and a set of selected behavioral indicators. This study unambiguously demonstrated the existence of genetic determinism of environmental sensitivity, with some lines being particularly sensitive to environmental fluctuations and others rather insensitive. Correlations between coefficient of variation (CV for body weight and behavioral and physiological traits were observed. This confirmed that CV for body weight could be used as an indicator of environmental sensitivity. As the relationship between indicators (CV weight, risk-taking, exploration and cortisol was shown to be likely depending on the nature and intensity of the stressor, the joint use of several indicators should help to investigate the biological complexity of environmental sensitivity.

  19. Massa de sementes e profundidades de semeadura no desenvolvimento de mudas de tamarindeiro Seeds weight and sowing depths in the development of tamarind seedlings

    Directory of Open Access Journals (Sweden)

    Marcelo Sales de Almeida

    2010-06-01

    Full Text Available Com o objetivo de avaliar a influência de massa de sementes e profundidades de semeadura sobre o vigor e o desenvolvimento vegetativo de mudas de tamarindeiro (Tamarindus indica L., conduziu-se um experimento em viveiro telado, de malha 0,38 mm², no Setor de Fruticultura da Fazenda Experimental Água Limpa, município de Uberlândia (MG, no período de 26 de dezembro de 2006 a 04 de junho de 2007. O delineamento experimental foi o inteiramente casualizado, com os tratamentos distribuídos em esquema fatorial 2 x 3, com 5 repetições e 5 mudas por parcela, sendo os fatores: duas massas de sementes, leves e pesadas (65,60 g/100 sementes; 94,54 g/100 sementes, respectivamente, e três profundidades de semeadura (1; 2 e 3 cm. Avaliaram-se o número de folhas, diâmetro do caule, altura da muda, comprimento da raiz principal, massas secas da parte aérea e de raízes. Os resultados demonstraram que sementes de maior massa proporcionam melhor desenvolvimento inicial das mudas. E quanto à profundidade de semeadura, não houve diferença significativa entre todas as características avaliadas.The effect of seeds weight and different sowing depths on tamarind (Tamarindus indica L. seedling vigor and vegetative growth was evaluated in a trial done in a screened nursery, with 0.38 mm² opening, at the experimental farm Água Limpa, in a nursery with anti-aphid screens, in the county of Uberlândia. The farm is located at 18º55'33''S and 48º17'19''W, at 872 m altitude, Minas Gerais, from December 26 2006 to June 4 2007. The experimental design was randomized blocks, in a 2 x 3 factorial, with 5 repetitions and 5 plants per plot. The factors were two seeds weight, slight and weighty (65.60 g and 94.54 g respectively, defined according to the weight of 100 seeds and three sowing depths (1cm; 2cm or 3cm. The number of leaves, stem diameter, plant height, root length, fresh and dry weight of roots and above ground matter were evaluated. The results

  20. Adipose tissue CIDEA is associated, independently of weight variation, to change in insulin resistance during a longitudinal weight control dietary program in obese individuals.

    Science.gov (United States)

    Montastier, Emilie; Déjean, Sébastien; Le Gall, Caroline; Saris, Wim H M; Langin, Dominique; Viguerie, Nathalie

    2014-01-01

    Weight loss reduces risk factors associated with obesity. However, long-term metabolic improvement remains a challenge. We investigated quantitative gene expression of subcutaneous adipose tissue in obese individuals and its relationship with low calorie diet and long term weight maintenance induced changes in insulin resistance. Three hundred eleven overweight and obese individuals followed a dietary protocol consisting of an 8-week low calorie diet followed by a 6-month ad libitum weight-maintenance diet. Individuals were clustered according to insulin resistance trajectories assessed using homeostasis model assessment of insulin resistance (HOMA-IR) index. Adipose tissue mRNA levels of 267 genes selected for regulation according to obesity, metabolic status and response to dieting was assessed using high throughput RT-qPCR. A combination of discriminant analyses was used to identify genes with regulation according to insulin resistance trajectories. Partial correlation was used to control for change in body mass index. Three different HOMA-IR profile groups were determined. HOMA-IR improved during low calorie diet in the 3 groups. At the end of the 6-month follow-up, groups A and B had reduced HOMA-IR by 50%. In group C, HOMA-IR had returned to baseline values. Genes were differentially expressed in the adipose tissue of individuals according to groups but a single gene, CIDEA, was common to all phases of the dietary intervention. Changes in adipose tissue CIDEA mRNA levels paralleled variations in insulin sensitivity independently of change in body mass index. Overall, CIDEA was up-regulated in adipose tissue of individuals with successful long term insulin resistance relapse and not in adipose tissue of unsuccessful individuals. The concomitant change in adipose tissue CIDEA mRNA levels and insulin sensitivity suggests a beneficial role of adipose tissue CIDEA in long term glucose homeostasis, independently of weight variation. ClinicalTrials.gov NCT00390637.

  1. Genetic variation in the leptin receptor gene, leptin, and weight gain in young Dutch adults.

    Science.gov (United States)

    van Rossum, Caroline T M; Hoebee, Barbara; van Baak, Marleen A; Mars, Monica; Saris, Wim H M; Seidell, Jacob C

    2003-03-01

    To investigate the association between leptin levels, polymorphisms in the leptin receptor (LEPR) gene, and weight gain. From two large prospective cohorts in The Netherlands (n = 17,500), we compared the baseline leptin of 259 subjects who had gained an average of 12.6 kg (range 5.5 to 33 kg) with 277 subjects who kept stable weight (range -2.6 to 3.1 kg) after a mean follow-up of 6.8 years. Three polymorphisms in the LEPR gene (Lys109Arg, Gln223Arg, and Lys656Asn) were determined. Weight gainers had significantly higher baseline leptin levels than those who kept stable weight (odds ratio = 1.27, 95% confidence interval 1.1 to 1.5, per SD increase in log(e)-transformed leptin). Weight gainers with the Arg109 or the Arg223 alleles had higher leptin levels compared with the noncarriers of these alleles. Only among men, the association between leptin and weight gain tended to be stronger among those with an Arg223 allele compared with those without this mutation. Relatively high leptin levels predict weight gain, suggesting that leptin resistance plays a role in the development of obesity in the general population. Higher leptin levels for those with a Lys109Arg or Gln223Arg mutation (or a linked other marker) may imply that these subjects have a modified functional leptin receptor. However, the role of these mutations on weight gain is limited.

  2. Genetic variation in variability: phenotypic variability of fledging weight and its evolution in a songbird population

    NARCIS (Netherlands)

    Mulder, H.A.; Gienapp, P; Visser, ME

    2016-01-01

    Variation in traits is essential for natural selection to operate and genetic and environmental effects can contribute to this phenotypic variation. From domesticated populations, we know that families can differ in their level of within-family variance, which leads to the intriguing situation that

  3. Mathematical modeling of ethanol production in solid-state fermentation based on solid medium' dry weight variation.

    Science.gov (United States)

    Mazaheri, Davood; Shojaosadati, Seyed Abbas; Zamir, Seyed Morteza; Mousavi, Seyyed Mohammad

    2018-04-21

    In this work, mathematical modeling of ethanol production in solid-state fermentation (SSF) has been done based on the variation in the dry weight of solid medium. This method was previously used for mathematical modeling of enzyme production; however, the model should be modified to predict the production of a volatile compound like ethanol. The experimental results of bioethanol production from the mixture of carob pods and wheat bran by Zymomonas mobilis in SSF were used for the model validation. Exponential and logistic kinetic models were used for modeling the growth of microorganism. In both cases, the model predictions matched well with the experimental results during the exponential growth phase, indicating the good ability of solid medium weight variation method for modeling a volatile product formation in solid-state fermentation. In addition, using logistic model, better predictions were obtained.

  4. Interacting effects of genetic variation for seed dormancy and flowering time on phenology, life history, and fitness of experimental Arabidopsis thaliana populations over multiple generations in the field.

    Science.gov (United States)

    Taylor, Mark A; Cooper, Martha D; Sellamuthu, Reena; Braun, Peter; Migneault, Andrew; Browning, Alyssa; Perry, Emily; Schmitt, Johanna

    2017-10-01

    Major alleles for seed dormancy and flowering time are well studied, and can interact to influence seasonal timing and fitness within generations. However, little is known about how this interaction controls phenology, life history, and population fitness across multiple generations in natural seasonal environments. To examine how seed dormancy and flowering time shape annual plant life cycles over multiple generations, we established naturally dispersing populations of recombinant inbred lines of Arabidopsis thaliana segregating early and late alleles for seed dormancy and flowering time in a field experiment. We recorded seasonal phenology and fitness of each genotype over 2 yr and several generations. Strong seed dormancy suppressed mid-summer germination in both early- and late-flowering genetic backgrounds. Strong dormancy and late-flowering genotypes were both necessary to confer a winter annual life history; other genotypes were rapid-cycling. Strong dormancy increased within-season fecundity in an early-flowering background, but decreased it in a late-flowering background. However, there were no detectable differences among genotypes in population growth rates. Seasonal phenology, life history, and cohort fitness over multiple generations depend strongly upon interacting genetic variation for dormancy and flowering. However, similar population growth rates across generations suggest that different life cycle genotypes can coexist in natural populations. © 2017 The Authors. New Phytologist © 2017 New Phytologist Trust.

  5. Yellow Oleander Seed, or "Codo de Fraile" (Thevetia spp.): A Review of Its Potential Toxicity as a Purported Weight-Loss Supplement.

    Science.gov (United States)

    González-Stuart, Armando; Rivera, José O

    2018-05-04

    The Dietary Supplements and Health Education Act (DSHEA), passed by the United States Congress in October of 1994, defines herbal products as nutritional supplements, not medications. This opened the market for diverse products made from plants, including teas, extracts, essential oils, and syrups. Mexico and the United States share an extensive border, where diverse herbal products are available to the public without a medical prescription. Research undertaken in the neighboring cities of Ciudad Juarez, Mexico, and El Paso, Texas, USA, shows the use of herbs is higher in this border area compared to the rest of the United States. A portion of the population is still under the erroneous impression that "natural" products are completely safe to use and therefore lack side effects. We review the dangers of ingesting the toxic seed of Thevetia spp. (family Apocynaceae), commonly known as "yellow oleander" or "codo de fraile," misleadingly advertised on the Internet as an effective and safe dietary supplement for weight loss. Lack of proper quality control regarding herbs generates a great variability in the quantity and quality of the products' content. Herb-drug interactions occur between some herbal products and certain prescription pharmaceuticals. Certain herbs recently introduced into the U.S. market may not have been previously tested adequately for purity, safety, and efficacy. Due to the lack of reliable clinical data regarding the safe use of various herbal products currently available, the public should be made aware regarding the possible health hazards of using certain herbs for therapeutic purposes. The potentially fatal toxicity of yellow oleander seed is confirmed by cases reported from various countries, while the purported benefits of using it for weight loss have not been evaluated by any known clinical trials. For this reason, the use of yellow oleander seed as a dietary supplement should be avoided.

  6. IW-Scoring: an Integrative Weighted Scoring framework for annotating and prioritizing genetic variations in the noncoding genome.

    Science.gov (United States)

    Wang, Jun; Dayem Ullah, Abu Z; Chelala, Claude

    2018-01-30

    The vast majority of germline and somatic variations occur in the noncoding part of the genome, only a small fraction of which are believed to be functional. From the tens of thousands of noncoding variations detectable in each genome, identifying and prioritizing driver candidates with putative functional significance is challenging. To address this, we implemented IW-Scoring, a new Integrative Weighted Scoring model to annotate and prioritise functionally relevant noncoding variations. We evaluate 11 scoring methods, and apply an unsupervised spectral approach for subsequent selective integration into two linear weighted functional scoring schemas for known and novel variations. IW-Scoring produces stable high-quality performance as the best predictors for three independent data sets. We demonstrate the robustness of IW-Scoring in identifying recurrent functional mutations in the TERT promoter, as well as disease SNPs in proximity to consensus motifs and with gene regulatory effects. Using follicular lymphoma as a paradigmatic cancer model, we apply IW-Scoring to locate 11 recurrently mutated noncoding regions in 14 follicular lymphoma genomes, and validate 9 of these regions in an extension cohort, including the promoter and enhancer regions of PAX5. Overall, IW-Scoring demonstrates greater versatility in identifying trait- and disease-associated noncoding variants. Scores from IW-Scoring as well as other methods are freely available from http://www.snp-nexus.org/IW-Scoring/. © The Author(s) 2018. Published by Oxford University Press on behalf of Nucleic Acids Research.

  7. Morpho-physiological variation of white spruce seedlings from various seed sources and implications for deployment under climate change

    Directory of Open Access Journals (Sweden)

    Isabelle Villeneuve

    2016-09-01

    Full Text Available Because of changes in climatic conditions, tree seeds originating from breeding programs may no longer be suited to sites where they are currently sent. As a consequence, new seed zones may have to be delineated. Assisted migration consists of transferring seed sources that match the future climatic conditions to which they are currently adapted. It represents a strategy that could be used to mitigate the potential negative consequences of climate change on forest productivity. Decisions with regard to the choice of the most appropriate seed sources have to rely on appropriate knowledge of morpho-physiological responses of trees. To meet this goal, white spruce (Picea glauca [Moench] Voss seedlings from eight seed orchards were evaluated during two years in a forest nursery, and at the end of the first growing season on three plantation sites located in different bioclimatic domains in Quebec.The morpho-physiological responses obtained at the end of the second growing season (2+0 in the nursery made it possible to cluster the orchards into three distinct groups. Modelling growth curves of these different groups showed that the height growth of seedlings from the second-generation and southern first-generation seed orchards was significantly higher than that of those from other orchards, by at least 6%. A multiple regression model with three climatic variables (average growing season temperature, average July temperature, length of the growing season showed that the final height of seedlings (2+0 from the first-generation seed orchards was significantly related to the local climatic conditions at the orchard sites of origin where parental trees from surrounding natural populations were sampled to provide grafts for orchard establishment. Seedling height growth was significantly affected by both seed source origins and planting sites, but the relative ranking of the different seed sources was maintained regardless of reforestation site. This

  8. Body weight variation and control of cardiovascular risk factors in essential hypertension.

    Science.gov (United States)

    Pascual, Jose Maria; Rodilla, Enrique; Costa, Jose Antonio; Perez-Lahiguera, Francisco; Gonzalez, Carmen; Lurbe, Empar; Redón, Josep

    2009-01-01

    The objective was to assess the impact of weight changes on blood pressure (BP), lipids and glucose goals in a cohort of hypertensive subjects. Prospective follow-up. Hypertension clinic. 326 hypertensive non-diabetic subjects, 46% with metabolic syndrome (MS). Usual care treatment, which included diet, physical exercise and drugs prescribed when indicated. All patients were observed for up to 1 year. BP and low-density lipoprotein-cholesterol (LDL-C) goal were those in ESH/ESC and ATP III recommendations, respectively. The glucose goal was to delay progression to type 2 diabetes mellitus, or to achieve blood glucose <100 mg/dl for non-diabetics. According to body weight changes, patients were categorized using adjusted ROC curves models. Overall, there was a significant weight increment of 0.5 kg (95% CI 0.1-0.9 kg); 28 patients (8.6%) lost more than 5 kg, and only four (1.2%) lost more than 10 kg. BP, LDL-C and glucose goals were achieved in 56%, 78% and 61% of patients, respectively. To lose or not gain weight was an independent prognostic factor to achieve the BP goal in all the patients and the LDL goal in the presence of MS. For glucose control, being treated with beta-blockers and/or diuretics was a negative factor. In hypertensive subjects, even small changes in weight may have an important impact on achieving cardiovascular goals, mainly in those with MS.

  9. Variation in seed mineral elements profile and yield in field bean (Vicia faba L. var. minor genotypes

    Directory of Open Access Journals (Sweden)

    Sara Lombardo

    2016-12-01

    Full Text Available Field bean (Vicia faba L. var. minor is one of the major leguminous crops cultivated in the world and mainly destined for animal feed. Although its seed is generally recognised as a good protein source, little is known about its mineral elements profile, which is an important aspect for a balanced animal diet. Therefore, the aim of the present work was to assess the seed mineral elements composition, along with some key production parameters, in eight field bean genotypes grown in a Mediterranean environment, without intensive management, over two years (2009/10 and 2010/11. Independently of the year, the seed of Chiaro di Torre Lama was the richest in phosphorus (P, magnesium, calcium and iron contents, while that of Sint 6 and Motta Chiaro 69 were the most effective accumulators of potassium and zinc, respectively. While all the genotypes yielded better in the second year (with more rainfall, the seasonal effect on seed mineral elements composition depended on the genotype. Indeed, the P content was 46% lower in Chiaro di Torre Lama, Motta Chiaro 69 and Sint 6 in the second year, while there was only a negligible seasonal effect for Sint 8 with respect to Fe content. Overall, this crop is reasonably productive under a low management regime and its seed can supply significant amounts of certain minerals (particularly P in feed formulations. Both aspects are important in a perspective of optimising field bean production in the Mediterranean area and, hence, improving farmers’ income.

  10. Exercise Training and Grape Seed Extract Co-Administration Improves Lipid Profile, Weight Loss, Bradycardia, and Hypotension of STZ-Induced Diabetic Rats

    Directory of Open Access Journals (Sweden)

    Mohammad Badavi

    2013-12-01

    Full Text Available Background:: Exercise Training (ET and Grape Seed Extract (GSE as an antioxidant have many positive effects on controlling diabetes mellitus and its complications. Objectives:: This study aimed to determine the effects of GSE alone or combined with ET on body weight, plasma lipid profile, blood pressure, and heart rate in STZ-induced diabetic rats. Methods:: In this study, male Wistar rats were randomly assigned to five groups: sedentary control, sedentary diabetic, trained diabetic, GSE treated sedentary diabetic, and GSE treated trained diabetic. ET was conducted on the treadmill daily for 8 weeks. One way ANOVA followed by LSD test was used for statistical analysis. Results:: Reduction of body weight, high density lipoproteins, heart rate, and systolic blood pressure and increment of total cholesterol, triglyceride, low density lipoprotein, and very low density lipoproteins were observed after STZ injection. Co-administration of GSE and ET had more positive effects on lipid profile compared to each method alone. In addition, GSE and ET modified heart rate partially, while their combination was more effective in improvement of heart rat in conscious rats. On the other hand, administration of ET or GSE alone did not affect systolic blood pressure and body weight, while their combination restored systolic blood pressure completely and improved body weight partially. Conclusions:: The study findings indicated that ET combined with GSE had more beneficial effects compared to each one alone on the complications of STZ induced diabetes. This may constitute a convenient and inexpensive therapeutic approach to diabetic complications.

  11. [Study on seed testing for Salvia miltiorrhiza].

    Science.gov (United States)

    Dan, Hong-mei; Qi, Jian-jun; Zhou, Li-li; Li, Xian-en

    2008-09-01

    To establish a seed testing methods for Salvia miltiorrhiza. Referring to the International Seed Testing Rules made by ISTA and the Seed Testing for Crops (GB/T3543. 1-1995) issued by China. The seeds are selected by winnowing; the seed purity is about 50%-60%; 100 grain weight is used to determine the quality of the seed; the seed moisture content is determined by air drying, the drying hour is 3 h. Seed viability is tested by TFC method.

  12. Floral and Seed Variability Patterns among Ethiopian Mustard (B. carinata A. Braun of East Africa

    Directory of Open Access Journals (Sweden)

    Adeniji, OT.

    2012-01-01

    Full Text Available In East Africa, Ethiopian mustard (Brassica carinata A. Braun is cultivated primarily for its leaves, but in Ethiopia preference is high for oil in the seed. Dual purpose importance of the seeds for planting and for oil suggests the need to improve seed production efficiency through understanding variation pattern for floral morphology and seed characters. We investigated genetic diversity and correlations for floral and seed characteristics among 14 accessions of Ethiopian mustard to improve seed set and yield. Field trials were conducted during 2008 and 2009; flowers were examined for short stamen height, long stamen height, pistil height, and silliqua for seed weight, seeds/silliqua and silliqua/plant. Results were largely consistent between years, indicating that the variation measured was mainly controlled by genetic factors. High genetic variation for seed characters and reproductive phenology among the accessions was noted. The number of days to appearance of flowers showed high discriminatory ability among the accessions. A wide continuous variation was observed among accessions for anther-stigma separation. Accessions 1, 3 and 14 were identified as early flowering. A significant and positive correlation coefficient between short stamen height and seed weight indicated a substantial complementation among these characters for seed yield improvement. The short stamen height is a good indicator for selection in favour of seed commercialization and indices for selection of pollen parent for seed yield improvement. Accessions 5, 7, 14, 16 and 22 are best for multiple characters and are recommended for seed production for any of the seasons in Arusha, Tanzania.

  13. Rapid analysis of seed size in Arabidopsis for mutant and QTL discovery

    Directory of Open Access Journals (Sweden)

    Baldwin Samantha

    2011-02-01

    Full Text Available Abstract Background Arabidopsis thaliana is a useful model organism for deciphering the genetic determinants of seed size; however the small size of its seeds makes measurements difficult. Bulk seed weights are often used as an indicator of average seed size, but details of individual seed is obscured. Analysis of seed images is possible but issues arise from variations in seed pigmentation and shadowing making analysis laborious. We therefore investigated the use of a consumer level scanner to facilitate seed size measurements in conjunction with open source image-processing software. Results By using the transmitted light from the slide scanning function of a flatbed scanner and particle analysis of the resulting images, we have developed a method for the rapid and high throughput analysis of seed size and seed size distribution. The technical variation due to the approach was negligible enabling us to identify aspects of maternal plant growth that contribute to biological variation in seed size. By controlling for these factors, differences in seed size caused by altered parental genome dosage and mutation were easily detected. The method has high reproducibility and sensitivity, such that a mutant with a 10% reduction in seed size was identified in a screen of endosperm-expressed genes. Our study also generated average seed size data for 91 Arabidopsis accessions and identified a number of quantitative trait loci from two recombinant inbred line populations, generated from Cape Verde Islands and Burren accessions crossed with Columbia. Conclusions This study describes a sensitive, high-throughput approach for measuring seed size and seed size distribution. The method provides a low cost and robust solution that can be easily implemented into the workflow of studies relating to various aspects of seed development.

  14. Genetic Variation in the Leptin Receptor Gene, Leptin, and Weight Gain in Young Dutch Adults

    NARCIS (Netherlands)

    Rossum, van C.T.M.; Hoebee, B.; Baak, van M.A.; Mars, M.; Saris, W.H.M.; Seidell, J.C.

    2003-01-01

    Objective: To investigate the association between leptin levels, polymorphisms in the leptin receptor (LEPR) gene, and weight gain. Research Methods and Procedures: From two large prospective cohorts in The Netherlands (n = 17, 500), we compared the baseline leptin of 259 subjects who had gained an

  15. Adipose tissue transcriptome reflects variations between subjects with continued weight loss and subjects regaining weight 6 mo after caloric restriction independent of energy intake

    DEFF Research Database (Denmark)

    Márquez-Quinõnes, Adriana; Mutch, David M.; Debard, Cyrille

    2010-01-01

    The mechanisms underlying body weight evolution after diet-induced weight loss are poorly understood.......The mechanisms underlying body weight evolution after diet-induced weight loss are poorly understood....

  16. Dynamic re-weighted total variation technique and statistic Iterative reconstruction method for x-ray CT metal artifact reduction

    Science.gov (United States)

    Peng, Chengtao; Qiu, Bensheng; Zhang, Cheng; Ma, Changyu; Yuan, Gang; Li, Ming

    2017-07-01

    Over the years, the X-ray computed tomography (CT) has been successfully used in clinical diagnosis. However, when the body of the patient to be examined contains metal objects, the image reconstructed would be polluted by severe metal artifacts, which affect the doctor's diagnosis of disease. In this work, we proposed a dynamic re-weighted total variation (DRWTV) technique combined with the statistic iterative reconstruction (SIR) method to reduce the artifacts. The DRWTV method is based on the total variation (TV) and re-weighted total variation (RWTV) techniques, but it provides a sparser representation than TV and protects the tissue details better than RWTV. Besides, the DRWTV can suppress the artifacts and noise, and the SIR convergence speed is also accelerated. The performance of the algorithm is tested on both simulated phantom dataset and clinical dataset, which are the teeth phantom with two metal implants and the skull with three metal implants, respectively. The proposed algorithm (SIR-DRWTV) is compared with two traditional iterative algorithms, which are SIR and SIR constrained by RWTV regulation (SIR-RWTV). The results show that the proposed algorithm has the best performance in reducing metal artifacts and protecting tissue details.

  17. Variations in fatty acid composition, glucosinolate profile and some phytochemical contents in selected oil seed rape (Brassica napus L. cultivars

    Directory of Open Access Journals (Sweden)

    Amin Mohamed, Amal

    2010-06-01

    Full Text Available Rapeseed (Brassica napus L. is now the third most important source of edible oil in the world after soybean and palm oil. In this study seeds of five different rapeseed cultivars namely; pactol, silvo, topas, serw 4 and serw 6 were evaluated for their fatty acid composition, glucosinolate profile, amino acids, total tocopherols and phenolic content. Among all cultivars significant variability in fatty acids were observed. The oleic acid (C18:1 ranged from 56.31% to 58.67%, linoleic acid (C18:2 from 10.52% to 13.74%, α-linolenic acid (C18:3 from 8.83% to 10.32% and erucic acid (22:1 from 0.15% to 0.91%. The glucosinolate profile of rapeseed was also separated and identified using high-performance liquid chromatography. Small variations in the glucosinolate profile were observed among all tested cultivars; however, progoitrin and gluconapin were the major glucosinolate found. Additionally, silvo cultivar showed the highest total glucosinolate c ontents (5.97 μmol/g dw. Generally, the contents of aspartic, glutamic, arginine and leucine were high, while the contents of tyrosine and isoleucine were low among all cultivars. For total tocopherols, the results indicated that both serw 6 and pactol cultivars had the highest total tocopherol contents (138.3 and 102.8 mg/100 g oil, respectively. Total phenolic contents varied from 28.0 to 35.4 mg/g dw. The highest total phenolic content was found in topas while the lowest value was detected in serw 6. These parameters; fatty acid contents, glucosinolate profile and amino acids together with total tocopherols and phenolic contents, could be taken into consideration by oilseed rape breeders as selection criteria for developing genotypes with modified seed quality traits in Brassica napus L.La colza (Brassica napus L. es hoy en día el tercer cultivo más importante de aceites comestibles en el mundo tras el aceite de soja y de palma. En este estudio semillas de cinco cultivos diferentes de colza

  18. Reproductive habitus, psychosocial health, and birth weight variation in Mexican immigrant and Mexican American women in south Texas.

    Science.gov (United States)

    Fleuriet, K Jill; Sunil, T S

    2015-08-01

    The Latina Paradox, or persistent, unexplained variation in low birth weight rates in recently immigrated Mexican women and the trend toward higher rates in subsequent generations of Mexican American women, is most often attributed to unidentified sociocultural causes. We suggest herein that different disciplinary approaches can be synthesized under the constructs of reproductive habitus and subjective social status to identify influences of sociocultural processes on birth weight. Reproductive habitus are "modes of living the reproductive body, bodily practices, and the creation of new subjects through interactions between people and structures" (Smith-Oka, 2012: 2276). Subjective social status infers comparison of self to others based on community definitions of status or socioeconomic status (Adler 2007). We present results from a prospective study of low-income Mexican immigrant and Mexican American women from south Texas that tested the ability of reproductive habitus and subjective social status to elucidate the Latina Paradox. We hypothesized that reproductive habitus between Mexican immigrant women and Mexican American women inform different subjective social statuses during pregnancy, and different subjective social statuses mediate responses to psychosocial stressors known to correlate with low birth weight. Six hundred thirty-one women were surveyed for psychosocial health, subjective social status, and reproductive histories between 2011 and 2013. Eighty-three women were interviewed between 2012 and 2013 for status during pregnancy, prenatal care practices, and pregnancy narratives and associations. Birth weight was extracted from medical records. Results were mixed. Subjective social status and pregnancy-related anxiety predicted low birth weight in Mexican immigrant but not Mexican American women. Mexican immigrant women had significantly lower subjective social status scores but a distinct reproductive habitus that could explain improved psychosocial

  19. Relationship Between Gender, Age, and Weight and the Serum Ionized Calcium Variations in Dog Periodontal Disease Evolution.

    Science.gov (United States)

    Carreira, L Miguel; Dias, Daniela; Azevedo, Pedro

    2015-06-01

    To analyze the relationships between gender, age, weight, and variations in the levels of serum ionized calcium ([iCa(2+)]) during periodontal disease (PD) evolution. In this study, dogs (n = 50) were divided into 5 groups according to the stage of PD: G0 (no PD), G1 (gingivitis), G2 (initial periodontitis), G3 (moderate periodontitis), and G4 (severe periodontitis). Statistically significant correlations were observed between age, [iCa(2+)] levels, and PD stage. Older dogs had lower [iCa(2+)] levels and more advanced PD stages (high positive correlation), and their body weight decreased as PD developed (negative correlation). Lower [iCa(2+)] values were associated with more severe PD. Copyright © 2015 Elsevier Inc. All rights reserved.

  20. How do low/high height and weight variation affect upper limb movements during manual material handling of industrial boxes?

    Directory of Open Access Journals (Sweden)

    Ana B. Oliveira

    Full Text Available OBJECTIVES: To evaluate the effect of surface height and load weight on upper limb movements and electromyographic (EMG recordings during manual handling performed by both experienced and inexperienced lifter subjects. METHODS: Sixteen experienced and sixteen inexperienced lifters handled a box (both 7 and 15 kg from an intermediate height (waist level to either a high or low surface. Electromyography and video images were recorded during the tasks. The 10th, 50th and 90th percentiles were calculated for the deltoid and biceps muscles, shoulder flexion, shoulder abduction, and elbow flexion movements. Groups, right/left sides, weights and heights were compared. There were no differences between either groups or sides. RESULTS: Weight and height variations affected EMG and posture, although weight had more impact on EMG. Shoulder abduction and flexion movements higher than 60º occurred, particularly for the higher surface. Shoulder flexion was also higher when the box was moved to the low height. This study provides new evidence as shoulder postures during boxes handling on low surfaces had not previously been evaluated. CONCLUSIONS: The high demand of upper limb in manual material handling tasks is clear, particularly for the shoulder. This knowledge can be used by physical therapists to plan better rehabilitation programs for manual material handling-related disorders, particularly focusing on return to work.

  1. Spatial and temporal variation in proportional stock density and relative weight of smallmouth bass in a reservoir

    Science.gov (United States)

    Mesa, Matthew G.; Duke, S.D.; Ward, David L.

    1990-01-01

    Population data for smallmouth bass Micropterus dolomieui in 20,235 ha John Day Reservoir on the Columbia River were used to (1) determine whether Proportional Stock Density (PSD) and Relative Weight (Wr) varied spatially and temporally in two areas of the reservoir with established smallmouth bass fisheries; (2) explore possible causes of any observed variation; and (3) discuss some management implications and recommendations. Both PSD and Wr varied spatially and monthly in all years examined. On an annual basis, PSD varied at one area but not at the other, whereas Wr showed little variation. Possible explanations for the variation in PSD and Wr are differences in growth, mortality, recruitment, and exploitation. Our data suggested that regulations established or changed on a reservoir-wide basis may have different effects on the fishery, depending on location in the reservoir. Also, pooling data from various areas within a reservoir to yield point estimates of structural indices may not represent the variation present in the population as a whole. The significant temporal variability reflects the importance of determining the proper time to sample fish to yield representative estimates of the variable of interest. In areas with valuable fisheries or markedly different population structures, we suggest that an area-specific approach be made to reservoir fishery management, and that efforts be made toward effecting consistent harvest regulations in interstate waters.

  2. A Weighted Difference of Anisotropic and Isotropic Total Variation for Relaxed Mumford-Shah Image Segmentation

    Science.gov (United States)

    2016-05-01

    norm does not cap - ture the geometry completely. The L1−L2 in (c) does a better job than TV while L1 in (b) and L1−0.5L2 in (d) capture the squares most...and isotropic total variation (TV) norms into a relaxed formu- lation of the two phase Mumford-Shah (MS) model for image segmentation. We show...results exceeding those obtained by the MS model when using the standard TV norm to regular- ize partition boundaries. In particular, examples illustrating

  3. Low molecular weight procyanidins from grape seeds enhance the impact of 5-Fluorouracil chemotherapy on Caco-2 human colon cancer cells.

    Directory of Open Access Journals (Sweden)

    Ker Y Cheah

    Full Text Available OBJECTIVE: Grape seed procyanidins (PC are flavan-3-ol oligomers and polymers known for their biological activity in the gut. Grape seed extract (GSE have been reported to reduce intestinal injury in a rat model of mucositis. We sought to investigate effects of purified PC fractions differing in mean degree of polymerization (mDP combined with 5-Fluorouracil (5-FU chemotherapy on the viability of colon cancer cells (Caco-2. DESIGN: SixPC fractions (F1-F6 were isolated from Cabernet Sauvignon seeds at two ripeness stages: pre-veraison unripe (immature and ripe (mature, utilizing step gradient, low-pressure chromatography on a Sephadex LH-20 resin. Fractions were tested on Caco-2 cells, alone and in combination with 5-FU. Eluted fractions were characterized by phloroglucinolysis and gel permeation chromatography. Cell viability was determined by the 3-(4,5-Dimethylthiazol-2yl-2,5-diphenyl-tetrazolium bromide (MTT assay. RESULTS: All isolated fractions significantly reduced Caco-2 cell viability compared to the control (P<0.05, but F2 and F3 (mDP 2-6 were the most active fractions (immature F2 = 32% mDP 2.4, F3 = 35% mDP 5.8 and mature F2 = 13% mDP 3.6 and F3 = 17% mDP 5.9; percentage of viable cells remaining on Caco-2 cells. When combined with 5-FU, immature fractions F1-F3 enhanced the cell toxicity effects of 5-FU by 27-73% (P<0.05. Mature seed PC fractions (F1-F4 significantly enhanced the toxicity of 5-FU by 60-83% against Caco-2 cells (P<0.05. Moreover, some fractions alone were more potent at decreasing viability in Caco-2 cells (P<0.05; immature fractions = 65-68% and mature fractions = 83-87% compared to 5-FU alone (37%. CONCLUSIONS: PCs of mDP 2-6 (immature F1-F3 and mature F1 and F4not only enhanced the impact of 5-FU in killing Caco-2 cells, but also surpassed standard 5-FU chemotherapy as an anti-cancer agent.The bioactivity of PC is therefore attributed primarily to lower molecular weight PCs.

  4. Strong correlation effects on the d-wave superconductor- spectral weight analysis by variational wave functions

    International Nuclear Information System (INIS)

    Chou, C-P; Lee, T K; Ho, C-M

    2009-01-01

    We examine the strong correlation effects of the d-wave superconducting state by including the Gutzwiller projection for no electron double occupancy at each lattice site. The spectral weights (SW's) for adding and removing an electron on the projected superconducting state, the ground state of the 2-dimensional t-t'-t - J model with moderate doped holes describing the high T c cuprates, are studied numerically on finite lattices and compared with the observation made by low-temperature tunneling (particle asymmetry of tunneling conductance) and angle-resolved photoemission (SW transfer from the projected Fermi liquid state) spectroscopies. The contrast with the d-wave case without projection is alo presented.

  5. Electrophoretic variation in low molecular weight lens crystallins from inbred strains of rats.

    Science.gov (United States)

    Donner, M E; Skow, L C; Kunz, H W; Gill, T J

    1985-10-01

    Analysis of rat lens soluble proteins by analytical isoelectric focusing detected two inherited electrophoretic differences in low molecular weight (LM) crystallins from inbred strains of rats (Rattus norvegicus). The polymorphic lens crystallins were shown to be similar to a genetically variant LM crystallin, LEN-1, previously described in mice (Mus musculus) and encoded on chromosome 1, at a locus linked to Pep-3 (dipeptidase). Linkage analysis demonstrated that the rat crystallin locus was loosely linked to Pep-3 at a recombination distance of 38 +/- 4.5 U. These data suggest the conservation of a large chromosomal region during the evolution of Rodentia and support the hypothesis that the gamma-crystallins are evolving more rapidly than alpha- or beta-crystallins.

  6. Child health in Peru: importance of regional variation and community effects on children's height and weight.

    Science.gov (United States)

    Shin, Heeju

    2007-12-01

    In developing countries, height and weight are good indicators of children's health and nutritional status. Maternal education has been accepted as one of the most important influences on child health. Using the 2000 Demographic and Health Survey of Peru, however, I find that the effect of maternal education varies as a function of region. In the most prosperous urban region, maternal education is less important for child health than in poor rural areas, and a higher level of education has a greater effect in rural areas. Multilevel analysis shows that a significant part of the observed correlation between maternal education and child health is moderated by regional differences and community characteristics. The finding suggests that Peruvian public policy should emphasize resource redistribution as well as women's education, and that investment in maternal education should be considered within regional contexts to enhance child health in rural areas.

  7. Use of linear discriminant function analysis in seed morphotype ...

    African Journals Online (AJOL)

    Use of linear discriminant function analysis in seed morphotype relationship study in 31 ... Data were collected on 100-seed weight, seed length and seed width. ... to the Mesoamerican gene pool, comprising the cultigroups Sieva-Big Lima, ...

  8. VARIABILITY IN PHENOTYPIC EXPRESSION OF SEED QUALITY TRAITS IN SOYBEAN GERMPLASM

    Directory of Open Access Journals (Sweden)

    Aleksandra Sudarić

    2017-01-01

    Full Text Available The aim of this research was to determine the genetic variability of chosen soybean lines in seed quality by determining diversity in phenotypic expression of 1000 seed weight, as well as protein and oil concentrations in the seed. Field trials were set up in a randomized, complete block design with two replications, at the Agricultural Institute Osijek during three growing seasons (2010-2012. Each year, after harvest, 1000 seed weight, and protein and oil concentrations in the seed were determined. Statistical analyses of the results included: calculating basic measures of variation and analysis of variance. The analyzed data showed the existence of plant material's diversity in phenotypic expression of investigated seed quality traits, as well as the existence of statistically significant genotype and year effects.

  9. Studies on the Vigour of Soybean Seeds : II. Varietal Differences in Seed Coat Quality and Swelling Components of Seed during Moisture Imbibition

    OpenAIRE

    Mugnisjah, Wahju Qamara; Shimano, Itaru; Matsumoto, Shigeo; 島野, 至; 松本, 重男

    1987-01-01

    Laboratory experiment was conducted to elucidate the physiological factor determining the association of seed size and seed coat quality with varietal differences in seed vigour, and to pursue an alternative on the mechanism of varietal differences in seed resistance to field weathering. Results of this study revealed that seed polymer change (seed volume change minus seed weight change during moisture imbibition) was the physiological factor determining the association of seed size and seed ...

  10. Variation in the fatty-acid content in seeds of various black, red, and white currant varieties.

    Science.gov (United States)

    Šavikin, Katarina P; Ðorđević, Boban S; Ristić, Mihailo S; Krivokuća-Ðokić, Dragana; Pljevljakušić, Dejan S; Vulić, Todor

    2013-01-01

    Currant seeds, a by-product of juice production, are recognized as a valuable source of oil rich in polyunsaturated fatty acids. We have evaluated 28 currant varieties for their oil content and fatty-acid composition. The oil content in the seeds ranged from 18.2-27.7%, and no statistical difference between varieties of different fruit color were recorded. Furthermore, the estimated oil yields in the field production ranged from 26.4-212.4 kg/ha. The GC and GC/MS chemical profiles of the seed oils extracted from all examined varieties were common for currants. Linoleic acid (LA) was the major component, with contents ranging from 32.7-46.9% of total fatty acids, followed by α-linolenic acid (ALA; 2.9-32.0 %), oleic acid (OA; 9.8-19.9%), γ-linolenic acid (GLA; 3.3-18.5%), palmitic acid (PA; 4.4-8.1%), stearidonic acid (SDA; 2.2-4.7%), and stearic acid (SA; 1.2-2.4%). Quantitative differences in the fatty-acid profiles between varieties of different fruit color were observed. Blackcurrant varieties showed significantly higher contents of LA, GLA, and PA than red and white currant varieties, whereas significantly higher amounts of ALA and OL were detected in the red and white varieties. Cluster analysis based on the chemical oil profiles joined the blackcurrants in one group, while most of the red and white cultivars joined in a second group at the same linkage distance. Copyright © 2013 Verlag Helvetica Chimica Acta AG, Zürich.

  11. Dialysate bicarbonate variation in maintenance hemodiafiltration patients: Impact on serum bicarbonate, intradialytic hypotension and interdialytic weight gain.

    Science.gov (United States)

    Viegas, Márcio; Cândido, Cristina; Felgueiras, Joana; Clemente, José; Barros, Sara; Farbota, Rostislav; Vera, Filipa; Matos, Antero; Sousa, Francisco

    2017-07-01

    The dialysate bicarbonate (DB) influences the acid-base balance in dialysis patients. Very low and high serum bicarbonate (SB) have been related with a higher mortality. Acid-base balance also has been associated with hemodynamic effects in these patients. The trial aim was to compare the effect of DB concentration variation on SB levels in maintenance hemodiafiltration (HDF) patients and the effect on intradialytic hypotension and interdialytic weight gain. A prospective study, with 9 months of follow-up, involving 93 patients, divided in two groups: group 1 and group 2 with a DB of 34 mmol/L and 30 mmol/L, respectively, with monitoring of pre and post HDF SB, intradialytic hypotension, and interdialytic weight gain. Pre dialysis SB was higher in group 1: median concentration of 22.7 mmol/L vs. 21.1 mmol/L (P < 0.001). Post dialysis SB levels were higher in group 1: median concentration of 28.0 mmol/L vs. 25.3 mmol/L (P < 0.001). Post dialysis SB in alkalotic range was only detected in group 1 (51.2% of the patients). No significant differences were detected in intradialytic hypotension rate [28.0 vs. 27.4 episodes per 1000 sessions in group 1 and 2, respectively, (P = 0.906)] or in average interdialytic weight gain [2.9% vs. 3.0% in group 1 and 2, respectively, (P = 0.710)]. DB of 30 mmol/L appears to be associated with SB levels closer to physiological levels than 34 mmol/L. The bicarbonate dialysate, in the tested concentrations, did not appear to have a significant impact on intradialytic hypotension and interdialytic weight gain in maintenance HDF patients. © 2016 International Society for Hemodialysis.

  12. Emotional Experiences of Obese Women with Adequate Gestational Weight Variation: A Qualitative Study.

    Directory of Open Access Journals (Sweden)

    Débora Bicudo Faria-Schützer

    Full Text Available As a result of the growth of the obese population, the number of obese women of fertile age has increased in the last few years. Obesity in pregnancy is related to greater levels of anxiety, depression and physical harm. However, pregnancy is an opportune moment for the intervention of health care professionals to address obesity. The objective of this study was to describe how obese pregnant women emotionally experience success in adequate weight control.Using a qualitative design that seeks to understand content in the field of health, the sample of subjects was deliberated, with thirteen obese pregnant women selected to participate in an individual interview. Data was analysed by inductive content analysis and includes complete transcription of the interviews, re-readings using suspended attention, categorization in discussion topics and the qualitative and inductive analysis of the content. The analysis revealed four categories, three of which show the trajectory of body care that obese women experience during pregnancy: 1 The obese pregnant woman starts to think about her body;2 The challenge of the diet for the obese pregnant woman; 3 The relation of the obese pregnant woman with the team of antenatal professionals. The fourth category reveals the origin of the motivation for the change: 4 The potentializing factors for change: the motivation of the obese woman while pregnant.During pregnancy, obese women are more in touch with themselves and with their emotional conflicts. Through the transformations of their bodies, women can start a more refined self-care process and experience of the body-mind unit. The fear for their own and their baby's life, due to the risks posed by obesity, appears to be a great potentializing factor for change. The relationship with the professionals of the health care team plays an important role in the motivational support of the obese pregnant woman.

  13. Emotional Experiences of Obese Women with Adequate Gestational Weight Variation: A Qualitative Study

    Science.gov (United States)

    Faria-Schützer, Débora Bicudo; Surita, Fernanda Garanhani de Castro; Alves, Vera Lucia Pereira; Vieira, Carla Maria; Turato, Egberto Ribeiro

    2015-01-01

    Background As a result of the growth of the obese population, the number of obese women of fertile age has increased in the last few years. Obesity in pregnancy is related to greater levels of anxiety, depression and physical harm. However, pregnancy is an opportune moment for the intervention of health care professionals to address obesity. The objective of this study was to describe how obese pregnant women emotionally experience success in adequate weight control. Methods and Findings Using a qualitative design that seeks to understand content in the field of health, the sample of subjects was deliberated, with thirteen obese pregnant women selected to participate in an individual interview. Data was analysed by inductive content analysis and includes complete transcription of the interviews, re-readings using suspended attention, categorization in discussion topics and the qualitative and inductive analysis of the content. The analysis revealed four categories, three of which show the trajectory of body care that obese women experience during pregnancy: 1) The obese pregnant woman starts to think about her body;2) The challenge of the diet for the obese pregnant woman; 3) The relation of the obese pregnant woman with the team of antenatal professionals. The fourth category reveals the origin of the motivation for the change: 4) The potentializing factors for change: the motivation of the obese woman while pregnant. Conclusions During pregnancy, obese women are more in touch with themselves and with their emotional conflicts. Through the transformations of their bodies, women can start a more refined self-care process and experience of the body-mind unit. The fear for their own and their baby's life, due to the risks posed by obesity, appears to be a great potentializing factor for change. The relationship with the professionals of the health care team plays an important role in the motivational support of the obese pregnant woman. PMID:26529600

  14. heritability and number of genes controlling seed yield in bottle ...

    African Journals Online (AJOL)

    USER

    2018-05-10

    May 10, 2018 ... For seed yield per plant, 100-seed weight per fruit, and number of seeds per fruit, a positive hypothetical heterosis was observed when calabash type was a maternal parent. ...... genes controlled fruit weight in watermelon.

  15. Closed-form expressions for flip angle variation that maximize total signal in T1-weighted rapid gradient echo MRI.

    Science.gov (United States)

    Drobnitzky, Matthias; Klose, Uwe

    2017-03-01

    Magnetization-prepared rapid gradient-echo (MPRAGE) sequences are commonly employed for T1-weighted structural brain imaging. Following a contrast preparation radiofrequency (RF) pulse, the data acquisition proceeds under nonequilibrium conditions of the relaxing longitudinal magnetization. Variation of the flip angle can be used to maximize total available signal. Simulated annealing or greedy algorithms have so far been published to numerically solve this problem, with signal-to-noise ratios optimized for clinical imaging scenarios by adhering to a predefined shape of the signal evolution. We propose an unconstrained optimization of the MPRAGE experiment that employs techniques from resource allocation theory. A new dynamic programming solution is introduced that yields closed-form expressions for optimal flip angle variation. Flip angle series are proposed that maximize total transverse magnetization (Mxy) for a range of physiologic T1 values. A 3D MPRAGE sequence is modified to allow for a controlled variation of the excitation angle. Experiments employing a T1 contrast phantom are performed at 3T. 1D acquisitions without phase encoding permit measurement of the temporal development of Mxy. Image mean signal and standard deviation for reference flip angle trains are compared in 2D measurements. Signal profiles at sharp phantom edges are acquired to access image blurring related to nonuniform Mxy development. A novel closed-form expression for flip angle variation is found that constitutes the optimal policy to reach maximum total signal. It numerically equals previously published results of other authors when evaluated under their simplifying assumptions. Longitudinal magnetization (Mz) is exhaustively used without causing abrupt changes in the measured MR signal, which is a prerequisite for artifact free images. Phantom experiments at 3T verify the expected benefit for total accumulated k-space signal when compared with published flip angle series. Describing

  16. Inheritance of seed yield and related traits in some lentil (lens culinaris medik) genotypes

    International Nuclear Information System (INIS)

    Rasheed, S.; Hanif, M.; Sadiq, S.; Abbas, G.; Asghar, M.J.; Haq, M.A.

    2008-01-01

    The study was conducted at Nuclear Institute for Agriculture and Biology (NIAB), Faisalabad during the year 2006-2007. Fifteen lentil lines/varieties were evaluated to exploit yield components to the maximum extent and to formulate section criteria for the improvement of seed yield. Significant genetic variation was observed for all the traits. All the traits under study had high heritability values except number of primary branches. Higher values of heritability coupled with genetic advance were observed for seed yield (98.30%, 128.20%), harvest index (97.10%, 79.40%), biological yield (94.30%, 56.10%) and hundred seed weight (88.30%, 50.80%) which indicates The role of additive genes to control these traits. Hundred seed weight (0.67, 0.65), harvest index (0.94, 0.93) and Biological yield (0.81, 0.80) had positive and highly significant correlation with seed yield at both genotypic and phenotypic levels. Number of primary branches, hundred seed weight, harvest index and biological yield showed positive direct effect along with positive genotypic correlation with seed yield. Finally, it was concluded that the traits like hundred seed weight, harvest index and biological yield can be exploited for the improvement of seed yield in lentil. (author)

  17. Genetics and Forest Seed Handling

    DEFF Research Database (Denmark)

    Schmidt, Lars Holger

    2016-01-01

    High genetic quality seed is obtained from seed sources that match the planting site, have a good outcrossing rate, and are superior in some desirable characters. Non-degraded natural forests and plantations may be used as untested seed sources, which can sometimes be managed to promote outbreeding...... and increase seed production. Planted seed orchards aim at capturing large genetic variation and are planted in a design that facilitates genetic evaluation and promotes outbred seed production. Good seed production relies upon success of the whole range of reproductive events from flower differentiation...

  18. Regional variations in the economic burden attributable to excess weight, physical inactivity and tobacco smoking across British Columbia

    Directory of Open Access Journals (Sweden)

    H. Krueger

    2016-04-01

    Full Text Available Introduction: Prevalence rates of excess weight, tobacco smoking and physical inactivity vary substantially by geographical region within British Columbia (B.C.. The purpose of this study is to determine the potential reduction in economic burden in B.C. if all regions in the province achieved prevalence rates of these three risk factors equivalent to those of the region with the lowest rates. Methods: We used a previously developed approach based on population-attributable fractions to estimate the economic burden associated with the various risk factors. Sexspecific relative risk and age/sex-specific prevalence data was used in the modelling. Results: The annual economic burden attributable to the three risk factors in B.C. was about $5.6 billion in 2013, with a higher proportion of this total attributable to excess weight ($2.6 billion than to tobacco smoking ($2.0 billion. While B.C. has lower prevalence rates of the risk factors than any other Canadian province, there is significant variation within the province. If each region in the province were to achieve the best prevalence rates for the three risk factors, then $1.4 billion (24% of the $5.6 billion in economic burden could be avoided annually. Conclusion: There are notable disparities in the prevalence of each risk factor across health regions within B.C., which were mirrored in each region’s attributable economic burden. A variety of social, environmental and economic factors likely drive some of this geographical variation and these underlying factors should be considered when developing prevention programs.

  19. Adaptive-weighted total variation minimization for sparse data toward low-dose x-ray computed tomography image reconstruction.

    Science.gov (United States)

    Liu, Yan; Ma, Jianhua; Fan, Yi; Liang, Zhengrong

    2012-12-07

    Previous studies have shown that by minimizing the total variation (TV) of the to-be-estimated image with some data and other constraints, piecewise-smooth x-ray computed tomography (CT) can be reconstructed from sparse-view projection data without introducing notable artifacts. However, due to the piecewise constant assumption for the image, a conventional TV minimization algorithm often suffers from over-smoothness on the edges of the resulting image. To mitigate this drawback, we present an adaptive-weighted TV (AwTV) minimization algorithm in this paper. The presented AwTV model is derived by considering the anisotropic edge property among neighboring image voxels, where the associated weights are expressed as an exponential function and can be adaptively adjusted by the local image-intensity gradient for the purpose of preserving the edge details. Inspired by the previously reported TV-POCS (projection onto convex sets) implementation, a similar AwTV-POCS implementation was developed to minimize the AwTV subject to data and other constraints for the purpose of sparse-view low-dose CT image reconstruction. To evaluate the presented AwTV-POCS algorithm, both qualitative and quantitative studies were performed by computer simulations and phantom experiments. The results show that the presented AwTV-POCS algorithm can yield images with several notable gains, in terms of noise-resolution tradeoff plots and full-width at half-maximum values, as compared to the corresponding conventional TV-POCS algorithm.

  20. Length-Weight Realtionship and Seasonal Distrubition of Magalaspis cordyla (Linnaeus 1758 fish Size frequency Variation from Karachi Coast

    Directory of Open Access Journals (Sweden)

    Quratulan AHMED

    2013-09-01

    Full Text Available The study of seasonal variation in distribution of 167 fishes of magalaspis cordyla from the Karachi fish harbour collected seasonally (pre-monsoon, mon-soon, post-monsoon between September 2011-August 2012. The highest catch of fish (68 was recorded in pre-monsoon season and the lowest catch of fish (47 was recorded in monsoon season. The highest mean length (38.6+ 0.746 and weight (288+ 21.90 was measured during pre-monsoon season and lowest mean length (22.5+ 0.671 and weight (120.5+ 2.73 was measured during mon-soon season. The highest mean condition factor (1.192+ 0.817 and minimum (0.500+ 0.038 was recorded in pre-monsoon season. Fish estimated negative and positive allometric growth because b values larger and less then 3 in pre-monsoon and monsoon season but post-monsoon season showed positive allometric growth because b value larger then 3 in all size classes

  1. The role of annealing temperature variation on ZnO nanorods array deposited on TiO2 seed layer

    Science.gov (United States)

    Asib, N. A. M.; Aadila, A.; Afaah, A. N.; Rusop, M.; Khusaimi, Z.

    2018-05-01

    Seed layer of Titanium dioxide (TiO2) by sol-gel spin coating technique were coated on glass substrate to grow Zinc oxide nanorods (ZNR) by solution-immersion method. The fabricated ZNR were annealed at various temperatures ranged from 400 to 600° C. FESEM images revealed that smaller ZNR were densely grown at optimum temperature of 450 and 500°C. Meanwhile, for all samples a dominant (0 0 2) diffraction peak of ZNR recorded by XRD patterns was at 34.4° which corresponding to hexagonal ZNR with a wurtzite structure. UV-Vis absorbance spectra showed the maximum absorption properties at UV region were detected at 450 and 500°C. The samples also showed high absorbance values at visible region.

  2. Examining Spatial Variation in the Effects of Japanese Red Pine (Pinus densiflora on Burn Severity Using Geographically Weighted Regression

    Directory of Open Access Journals (Sweden)

    Hyun-Joo Lee

    2017-05-01

    Full Text Available Burn severity has profound impacts on the response of post-fire forest ecosystems to fire events. Numerous previous studies have reported that burn severity is determined by variables such as meteorological conditions, pre-fire forest structure, and fuel characteristics. An underlying assumption of these studies was the constant effects of environmental variables on burn severity over space, and these analyses therefore did not consider the spatial dimension. This study examined spatial variation in the effects of Japanese red pine (Pinus densiflora on burn severity. Specifically, this study investigated the presence of spatially varying relationships between Japanese red pine and burn severity due to changes in slope and elevation. We estimated conventional ordinary least squares (OLS and geographically weighted regression (GWR models and compared them using three criteria; the coefficients of determination (R2, Akaike information criterion for small samples (AICc, and Moran’s I-value. The GWR model performed considerably better than the OLS model in explaining variation in burn severity. The results provided strong evidence that the effect of Japanese red pine on burn severity was not constant but varied spatially. Elevation was a significant factor in the variation in the effects of Japanese red pine on burn severity. The influence of red pine on burn severity was considerably higher in low-elevation areas but became less important than the other variables in high-elevation areas. The results of this study can be applied to location-specific strategies for forest managers and can be adopted to improve fire simulation models to more realistically mimic the nature of fire behavior.

  3. Genetic variation in adaptive traits and seed transfer zones for Pseudoroegneria spicata (bluebunch wheatgrass) in the northwestern United States

    Science.gov (United States)

    John Bradley St. Clair; Francis F. Kilkenny; Richard C. Johnson; Nancy L. Shaw; George Weaver

    2013-01-01

    A genecological approach was used to explore genetic variation in adaptive traits in Pseudoroegneria spicata, a key restoration grass, in the intermountain western United States. Common garden experiments were established at three contrasting sites with seedlings from two maternal parents from each of 114 populations along with five commercial...

  4. FERMENTATION BY Lactobacillus paracasei OF GALACTOOLIGOSACCHARIDES AND LOW-MOLECULAR-WEIGHT CARBOHYDRATES EXTRACTED FROM SQUASH (Curcubita maxima AND LUPIN (Lupinus albus SEEDS

    Directory of Open Access Journals (Sweden)

    María I. Palacio

    2014-02-01

    Full Text Available The in vitro prebiotic activity of galactooligosaccharides (GOS and low-molecular-weight carbohydrates (LMWC extracted from lupin and squash seeds on the growth of Lactobacillus paracasei BGP1 was studied. To this end, the change in cell density after 24 h of L. paracasei growth on 1% (w/v glucose, 1% (w/v raffinose, 1% (w/v commercial inulin GR, 1% (w/v lupin extract, and 1% (w/v squash extract relative to the change in cell density of a mixture of enteric strains under the same culture conditions were evaluated. Additionally, the principal components of GOS and LMWC in the extracts were identified using Thin Layer Chromatography. The highest prebiotic activity score was for L. paracasei grown on squash extract (0.55±0.03, followed by lupin extract (0.49±0.02, inulin (0.38±0.05 and raffinose (0.37±0.05. These results will contribute to selecting plant species as potential sources of prebiotic ingredients for the development of functional foods.

  5. Seed-mediated synthesis of gold nanorods: control of the aspect ratio by variation of the reducing agent

    International Nuclear Information System (INIS)

    Koeppl, Susanne; Ghielmetti, Nico; Caseri, Walter; Spolenak, Ralph

    2013-01-01

    Seed-mediated growth methods involving reduction of tetrachloroaurate(III) with ascorbic acid are common for the synthesis of gold nanorods. This study shows, however, that simply by appropriate choice of the reducing agent a drastic influence on the aspect ratio can be attained. Weaker reducing agents, such as dihydroxybenzene isomers (hydroquinone, catechol or resorcinol) or glucose can increase the aspect ratio of the nanorods by an order of magnitude, up to values as high as 100 (nanowires). The increase in aspect ratio is mainly a consequence of an increase in length of the particles (up to 1–3 μm). This effect is probably associated with a decrease in the reduction rate of gold(III) species by dihydroxybenzenes or glucose compared to ascorbic acid. The reduction potential of the reducing agents strongly depends on the pH value, and related effects on the dimensions of the nanoparticles are also reflected in this study. The nanorods exhibited penta-twinned nature without noteworthy defects (e.g. stacking faults and dislocations).

  6. Spatial distributions of and diurnal variations in low molecular weight carbonyl compounds in coastal seawater, and the controlling factors

    Energy Technology Data Exchange (ETDEWEB)

    Takeda, Kazuhiko, E-mail: takedaq@hiroshima-u.ac.jp [Graduate School of Biosphere Science, Hiroshima University, 1-7-1 Kagamiyama, Higashi-Hiroshima, Hiroshima 739-8521 (Japan); Katoh, Shinya; Mitsui, Yumi; Nakano, Shinichi [Graduate School of Biosphere Science, Hiroshima University, 1-7-1 Kagamiyama, Higashi-Hiroshima, Hiroshima 739-8521 (Japan); Nakatani, Nobutake [Graduate School of Biosphere Science, Hiroshima University, 1-7-1 Kagamiyama, Higashi-Hiroshima, Hiroshima 739-8521 (Japan); Department of Environmental and Symbiotic Sciences, Rakuno Gakuen University, 582 Bunkyodai-Midorimachi, Ebetsu, Hokkaido 069-8501 (Japan); Sakugawa, Hiroshi [Graduate School of Biosphere Science, Hiroshima University, 1-7-1 Kagamiyama, Higashi-Hiroshima, Hiroshima 739-8521 (Japan)

    2014-09-15

    We studied the spatial distributions of and the diurnal variations in four low molecular weight (LMW) carbonyl compounds, formaldehyde, acetaldehyde, propionaldehyde, and glyoxal, in coastal seawater. The samples were taken from the coastal areas of Hiroshima Bay, the Iyo Nada, and the Bungo Channel, western Japan. The formaldehyde, acetaldehyde, and glyoxal concentrations were higher in the northern part of Hiroshima Bay than at offshore sampling points in the Iyo Nada and the Bungo Channel. These three compounds were found at much higher concentrations in the surface water than in deeper water layers in Hiroshima Bay. It is noteworthy that propionaldehyde was not detected in any of the seawater samples, the concentrations present being lower than the detection limit (1 nanomole per liter (nM)) of the high performance liquid chromatography (HPLC) system we used. Photochemical and biological experiments were performed in the laboratory to help understand the characteristic distributions and fates of the LMW carbonyl compounds. The primary process controlling their fate in the coastal environment appears to be their biological consumption. The direct photo degradation of propionaldehyde, initiated by ultraviolet (UV) absorption, was observed, although formaldehyde and acetaldehyde were not degraded by UV irradiation. Our results suggest that the degradation of the LMW carbonyl compounds by photochemically formed hydroxyl radicals is relatively insignificant in the study area. Atmospheric deposition is a possible source of soluble carbonyl compounds in coastal surface seawater, but it may not influence the carbonyl concentrations in offshore waters. - Highlights: • Low molecular weight (LMW) carbonyl compounds in coastal seawater were determined. • Photochemical productions of LMW carbonyl compounds in seawater were observed. • LMW carbonyl compounds were largely consumed biologically. • Photochemical degradation was relatively insignificant in the study area.

  7. Spatial distributions of and diurnal variations in low molecular weight carbonyl compounds in coastal seawater, and the controlling factors

    International Nuclear Information System (INIS)

    Takeda, Kazuhiko; Katoh, Shinya; Mitsui, Yumi; Nakano, Shinichi; Nakatani, Nobutake; Sakugawa, Hiroshi

    2014-01-01

    We studied the spatial distributions of and the diurnal variations in four low molecular weight (LMW) carbonyl compounds, formaldehyde, acetaldehyde, propionaldehyde, and glyoxal, in coastal seawater. The samples were taken from the coastal areas of Hiroshima Bay, the Iyo Nada, and the Bungo Channel, western Japan. The formaldehyde, acetaldehyde, and glyoxal concentrations were higher in the northern part of Hiroshima Bay than at offshore sampling points in the Iyo Nada and the Bungo Channel. These three compounds were found at much higher concentrations in the surface water than in deeper water layers in Hiroshima Bay. It is noteworthy that propionaldehyde was not detected in any of the seawater samples, the concentrations present being lower than the detection limit (1 nanomole per liter (nM)) of the high performance liquid chromatography (HPLC) system we used. Photochemical and biological experiments were performed in the laboratory to help understand the characteristic distributions and fates of the LMW carbonyl compounds. The primary process controlling their fate in the coastal environment appears to be their biological consumption. The direct photo degradation of propionaldehyde, initiated by ultraviolet (UV) absorption, was observed, although formaldehyde and acetaldehyde were not degraded by UV irradiation. Our results suggest that the degradation of the LMW carbonyl compounds by photochemically formed hydroxyl radicals is relatively insignificant in the study area. Atmospheric deposition is a possible source of soluble carbonyl compounds in coastal surface seawater, but it may not influence the carbonyl concentrations in offshore waters. - Highlights: • Low molecular weight (LMW) carbonyl compounds in coastal seawater were determined. • Photochemical productions of LMW carbonyl compounds in seawater were observed. • LMW carbonyl compounds were largely consumed biologically. • Photochemical degradation was relatively insignificant in the study area

  8. Evaluation of seed production of scots pine ( Pinus sylvestris L ...

    African Journals Online (AJOL)

    This research was carried out to investigate seed production in a 13 years-old scots pine (Pinus sylvestris L.) clonal seed orchard, including 30 clones. Eight of cone and seed traits as number of fertile and infertile scales, cone volume, cone number, filled and empty seed number, seed efficiency and 1000 seed weight were ...

  9. Latitudinal cogradient variation of development time and growth rate and a negative latitudinal body weight cline in a widely distributed cabbage beetle.

    Directory of Open Access Journals (Sweden)

    Jianjun Tang

    Full Text Available The evolutionary and phenotypic responses to environmental gradients are often assumed to be the same, a phenomenon known as "cogradient variation". However, only a few insect species display cogradient variation in physiological traits along a latitudinal gradient. We found evidence for such a response in the examination of the life history traits of the cabbage beetle Colaphellus bowringi from 6 different geographical populations at 16, 19, 22, 24, 26 and 28°C. Our results showed that larval and pupal development times significantly decreased as rearing temperature increased, and that growth rates were positively correlated with temperature. Body weight tended to decrease with increasing temperature, consistent with the general pattern in ectothermic animals. Larval development time was positively correlated with latitude, whereas the growth rate decreased as latitude increased, showing an example of latitudinal cogradient variation. Body weight significantly decreased with increasing latitude in a stepwise manner, showing a negative latitudinal body weight cline. Females were significantly larger than males, consistent with the female biased sex dimorphism in insects. Body weight tended to decrease with increasing rearing temperature, whereas the differences in sexual size dimorphism (SSD tended to decrease with increasing body weight, which biased our results toward acceptance of Rensch's rule. We found that weight loss was an important regulator of SSD, and because male pupae lost significantly more weight at metamorphosis than female pupae, SSD was greater in adults than in pupae. Overall, our data provide a new example that a latitudinal cogradient variation in physiological traits is associated with a negative latitudinal body weight cline.

  10. Modelling long-term fire occurrence factors in Spain by accounting for local variations with geographically weighted regression

    Science.gov (United States)

    Martínez-Fernández, J.; Chuvieco, E.; Koutsias, N.

    2013-02-01

    Humans are responsible for most forest fires in Europe, but anthropogenic factors behind these events are still poorly understood. We tried to identify the driving factors of human-caused fire occurrence in Spain by applying two different statistical approaches. Firstly, assuming stationary processes for the whole country, we created models based on multiple linear regression and binary logistic regression to find factors associated with fire density and fire presence, respectively. Secondly, we used geographically weighted regression (GWR) to better understand and explore the local and regional variations of those factors behind human-caused fire occurrence. The number of human-caused fires occurring within a 25-yr period (1983-2007) was computed for each of the 7638 Spanish mainland municipalities, creating a binary variable (fire/no fire) to develop logistic models, and a continuous variable (fire density) to build standard linear regression models. A total of 383 657 fires were registered in the study dataset. The binary logistic model, which estimates the probability of having/not having a fire, successfully classified 76.4% of the total observations, while the ordinary least squares (OLS) regression model explained 53% of the variation of the fire density patterns (adjusted R2 = 0.53). Both approaches confirmed, in addition to forest and climatic variables, the importance of variables related with agrarian activities, land abandonment, rural population exodus and developmental processes as underlying factors of fire occurrence. For the GWR approach, the explanatory power of the GW linear model for fire density using an adaptive bandwidth increased from 53% to 67%, while for the GW logistic model the correctly classified observations improved only slightly, from 76.4% to 78.4%, but significantly according to the corrected Akaike Information Criterion (AICc), from 3451.19 to 3321.19. The results from GWR indicated a significant spatial variation in the local

  11. Analysis of seed quality in NS sunflower hybrid seed processed between 2010 and 2014

    Directory of Open Access Journals (Sweden)

    Jokić Goran

    2015-01-01

    Full Text Available This paper analyzed the processed seed of five sunflower hybrid seed developed at the Institute of Field and Vegetable Crops in Novi Sad. The cultivars were Rimi PR, Duško, NS Dukat, Sumo 1 PR and Sremac. The analysis was conducted on seed lots processed between 2010 and 2014 and involved the following parameters: seed purity percentage, 1000-seed weight, germination energy, germination, seed moisture, number of weed seeds per 1000 grams of seed. The results of the study produced the following average values: seed purity - 99.72%, 1000-seed weight - 67.59g, germination energy - 88.2%, germination - 91.8%, seed moisture - 8.3%. There were not found weeds seeds as well as pathogens on the seed samples, these values are all within the legally prescribed limits.

  12. Low-molecular-weight organic acids correlate with cultivar variation in ciprofloxacin accumulation in Brassica parachinensis L.

    Science.gov (United States)

    Zhao, Hai-Ming; Xiang, Lei; Wu, Xiao-Lian; Jiang, Yuan-Neng; Li, Hui; Li, Yan-Wen; Cai, Quan-Ying; Mo, Ce-Hui; Liu, Jie-Sheng; Wong, Ming-Hung

    2017-08-31

    To understand the mechanism controlling cultivar differences in the accumulation of ciprofloxacin (CIP) in Chinese flowering cabbage (Brassica parachinensis L.), low-molecular-weight organic acids (LMWOAs) secreted from the roots of high- and low-CIP cultivars (Sijiu and Cutai, respectively) and their effects on the bioavailability of CIP in soil were investigated. Significant differences in the content of LMWOAs (especially maleic acid) between the two cultivars played a key role in the variation in CIP accumulation. Based on the Freundlich sorption coefficient (K f ) and distribution coefficient (K d ), the presence of LMWOAs reduced the CIP sorption onto soil particles, and higher concentrations of LMWOAs led to less CIP sorption onto soil. On the other hand, LMWOAs enhanced CIP desorption by lowering the solution pH, which changed the surface charge of soil particles and the degree of CIP ionization. LMWOAs promoted CIP desorption from soil by breaking cation bridges and dissolving metal cations, particularly Cu 2+ . These results implied that the LMWOAs (mainly maleic acid) secreted from Sijiu inhibited CIP sorption onto soil and improved CIP desorption from soil to a greater extent than those secreted from Cutai, resulting in higher bioavailability of CIP and more uptake and accumulation of CIP in the former.

  13. Resonance sensor measurements of stiffness variations in prostate tissue in vitro--a weighted tissue proportion model.

    Science.gov (United States)

    Jalkanen, Ville; Andersson, Britt M; Bergh, Anders; Ljungberg, Börje; Lindahl, Olof A

    2006-12-01

    Prostate cancer is the most common type of cancer in men in Europe and the US. The methods to detect prostate cancer are still precarious and new techniques are needed. A piezoelectric transducer element in a feedback system is set to vibrate with its resonance frequency. When the sensor element contacts an object a change in the resonance frequency is observed, and this feature has been utilized in sensor systems to describe physical properties of different objects. For medical applications it has been used to measure stiffness variations due to various patho-physiological conditions. In this study the sensor's ability to measure the stiffness of prostate tissue, from two excised prostatectomy specimens in vitro, was analysed. The specimens were also subjected to morphometric measurements, and the sensor parameter was compared with the morphology of the tissue with linear regression. In the probe impression interval 0.5-1.7 mm, the maximum R(2) > or = 0.60 (p sensor was pressed, the greater, i.e., deeper, volume it sensed. Tissue sections deeper in the tissue were assigned a lower mathematical weighting than sections closer to the sensor probe. It is concluded that cancer increases the measured stiffness as compared with healthy glandular tissue, but areas with predominantly stroma or many stones could be more difficult to differ from cancer.

  14. Variations in fatty acid composition, glucosinolate profile and some phyto chemical contents in selected oil seed rape (Brassica napus L.) cultivars

    Energy Technology Data Exchange (ETDEWEB)

    El-Din Saad El-Beltag, H.; Mohamed, A. A.

    2010-07-01

    Rapeseed (Brassica napus L.) is now the third most important source of edible oil in the world after soybean and palm oil. In this study seeds of five different rapeseed cultivars namely; pactol, silvo, topas, serw 4 and serw 6 were evaluated for their fatty acid composition, glucosinolate profile, amino acids, total tocopherols and phenolic content. Among all cultivars significant variability in fatty acids were observed. The oleic acid (C18:1) ranged from 56.31% to 58.67%, linoleic acid (C18:2) from 10.52% to 13.74%, {alpha}-linolenic acid (C18:3) from 8.83% to 10.32% and erucic acid (22:1) from 0.15% to 0.91%. The glucosinolate profile of rapeseed was also separated and identified using high-performance liquid chromatography. Small variations in the glucosinolate profile were observed among all tested cultivars; however, progoitrin and gluconapin were the major glucosinolate found. Additionally, silvo cultivar showed the highest total glucosinolate contents (5.97 {mu}mol/g dw). Generally, the contents of aspartic, glutamic, arginine and leucine were high, while the contents of tyrosine and isoleucine were low among all cultivars. For total tocopherols, the results indicated that both serw 6 and pactol cultivars had the highest total tocopherol contents (138.3 and 102.8 mg/100 g oil, respectively). Total phenolic contents varied from 28.0 to 35.4 mg/g dw. The highest total phenolic content was found in topas while the lowest value was detected in serw 6. These parameters; fatty acid contents, glucosinolate profile and amino acids together with total tocopherols and phenolic contents, could be taken into consideration by oilseed rape breeders as selection criteria for developing genotypes with modified seed quality traits in Brassica napus L. (Author)

  15. Genetic variability and divergence studies in seed traits and oil content of Jatropha (Jatropha curcas L.) accessions

    Energy Technology Data Exchange (ETDEWEB)

    Kaushik, N.; Kumar, Krishan; Kumar, Sushil [CCS HAU, Regional Research Station, Bawal (Rewari) (India); Kaushik, Nutan; Roy, S. [The Energy Resource Institute, New Delhi (India)

    2007-07-15

    Variability in seed traits and oil content of 24 accessions of Jatropha curcas collected from different agroclimatic zones of Haryana state, India were assessed. There were significant differences (P<0.05) in seed size, 100-seed weight and oil content between accessions. Maximum seed weight was recorded in seeds collected from IC-520602 and the least weight was recorded in IC-520587. Oil variability ranged from 28.00% in IC-520589 to 38.80% in IC-520601. In general phenotypic coefficient of variation was higher than the genotypic coefficient of variation indicating the predominant role of environment. High heritability and genetic gain were recorded for oil content (99.00% and 18.90%) and seed weight (96.00% and 18.00%), respectively, indicating the additive gene action. Seed weight had positive correlation with seed length, breadth, thickness and oil content. On the basis of non-hierarchical Euclidian cluster analysis, six clusters were obtained with highest number of accession falling under cluster III. Maximum and minimum intra cluster distance was observed for cluster VI (2.499) and for cluster III (2.252), respectively. Whereas maximum inter-cluster distance was observed between cluster VI and IV (5.129) and minimum between cluster III and II (2.472). Among the six clusters formed cluster IV showed maximum cluster value for seed size whereas, cluster VI showed maximum value for oil content and seed weight. Thus on the basis of present finding it is suggested that the crossing between accessions of cluster IV and VI will result in wide spectrum of variability in subsequent generations. (author)

  16. Effects of altrenogest treatment in sows on the variation of piglet birth weight and pre-weaning piglet performance

    Directory of Open Access Journals (Sweden)

    Supatee Kitkha

    2017-08-01

    Full Text Available The effect of altrenogest (ALT feeding combined with induced ovulation by human chorionic gonadotropin (hCG in sows was evaluated on piglet birth weight (BW variation and pre-weaning performance. Sows were divided into four groups: the control (no ALT; without hCG induction; artificial inseminated (AI at 12 and 36 h after estrus; n = 40, ALT + hCG72 (ALT 20 mg/d, D-4–D2 (D0: weaning day; hCG 750 IU at 72 h post ALT; AI at 24 and 40 h after hCG; n = 41, ALT + hCG96 (ALT 20 mg/d, D-4–D2; hCG 750 IU at 96 h post ALT; AI at 24 and 40 h after hCG; n = 41 and ALT + no hCG (20 mg/d, D-4–D2; without hCG induction; AI at 12 and 36 h after estrus; n = 41. The results revealed that piglet BW was not different among the groups (p > 0.05. However, the standard deviation of piglet BW (SDBW was lower in ALT + hCG72 (0.32 ± 0.02 kg; p = 0.032, compared to ALT + hCG96 (0.40 ± 0.02 kg and ALT + no hCG (0.40 ± 0.02 kg, except for the control (0.39 ± 0.02 kg. In addition, the pre-weaning mortality rate (%PWM due to underweight elimination at weaning (below 3.50 kg was decreased in ALT + hCG72 (8.33% compared to the control (32.50%; p = 0.007 but similar to ALT + hCG96 (10.71% and ALT + no hCG (24.05%. Therefore, ALT + hCG72 treatment in sows could reduce piglet BW variation and the number of piglets eliminated at weaning.

  17. (Heckel) seeds

    African Journals Online (AJOL)

    UTILISATEUR

    Garcinia kola seeds to six different hormonal pre-germination treatments. This consisted of ... Thus, seed dormancy in this case is not a coat- imposed .... development of the cultivation of the species. The cause .... Hormonal regulation of seed ...

  18. Diffusion-weighted magnetic resonance imaging of the normal endometrium: temporal and spatial variations of the apparent diffusion coefficient

    International Nuclear Information System (INIS)

    Fornasa, Francesca; Montemezzi, Stefania

    2012-01-01

    Background: Diffusion-weighted magnetic resonance imaging (DWI) is increasingly used in the diagnosis of endometrial disease. No complete knowledge, however, exists yet of the influence of physiology on the endometrial apparent diffusion coefficient (ADC) values on which DWI is based. Purpose: To establish whether the ADC values measured with DWI in the endometrium of healthy reproductive-aged women significantly vary from the early proliferative to the periovulatory phase of the menstrual cycle and between the fundus and the isthmus of the uterus. Material and Methods: In 17 women the endometrial ADC values measured on the fifth menstrual day, both at the fundus and at the isthmus of the uterus, were compared to the values obtained on the 14th day before the subsequent cycle. In 81 women (menstrual day: fifth through 21st) the endometrial ADC values measured at the fundus were compared to the values obtained at the isthmus of the uterus. All examinations were performed with a 1.5 T magnet (b values: 0 and 800 mm/s 2 ). The results were analyzed by means of Student's t-test per paired data. Results: The endometrial ADC values measured on the fifth day of the menstrual cycle were lower than those obtained in the periovulatory phase both at the fundus (mean 0.923 vs. 1.256 x 10 - 3 mm 2 /s) and at the isthmus (mean 1.297 vs. 1.529 x 10 - 3 mm 2 /s) of the uterus. The endometrial ADC values measured at the fundus of the uterus were lower than those obtained at the isthmus (mean 1.132 vs. 1.420 x 10 - 3 mm 2 /s) through the menstrual cycle. All these differences were highly significant (P < 0.001) at statistical analysis. Conclusion: Physiological variations occurring in endometrial ADC values of healthy women should be considered by the radiologists when interpreting DWI examinations in patients with endometrial disease

  19. LMWOA (low molecular weight organic acid) exudation by salt marsh plants: Natural variation and response to Cu contamination

    Science.gov (United States)

    Mucha, Ana P.; Almeida, C. Marisa R.; Bordalo, Adriano A.; Vasconcelos, M. Teresa S. D.

    2010-06-01

    This work aimed to evaluate, in vitro, the capability of roots of two salt marsh plants to release low molecular weight organic acids (LMWOAs) and to ascertain whether Cu contamination would stimulate or not organic acids exudation. The sea rush Juncus maritimus and the sea-club rush Scirpus maritimus, both from the lower Douro river estuary (NW Portugal), were used. Plants were collected seasonally, four times a year in 2004, during low tide. After sampling, plant roots were washed for removal of adherent particles and immersed for 2 h in a solution that matched salinity (3) and pH (7.5) of the pore water from the same location to obtain plant exudates. In one of the seasons, similar experiments were carried out but spiking the solution with different amounts of Cu in order to embrace the range between 0 and 1600 nM. In the final solutions as well as in sediment pore water LMWOAs were determined by high performance liquid chromatography. Plants were able to release, in a short period of time, relatively high amounts of LMWOAs (oxalate, citrate, malate, malonate, and succinate). In the sediment pore water oxalate, succinate and acetate were also detected. Therefore, plant roots probably contributed to the presence of some of these organic compounds in pore water. Exudation differed between the plant species and also showed some seasonally variation, particularly for S. maritimus. The release of oxalate by J. maritimus increased with Cu increase in the media. However, exudation of the other LMWOAs did not seem to be stimulated by Cu contamination in the media. This fact is compatible with the existence of alternative internal mechanisms for Cu detoxification, as denoted by the fact that in media contaminated with Cu both plant species accumulated relatively high amounts (29-83%) of the initially dissolved Cu. This study expands our knowledge on the contribution of globally dominant salt marsh plants to the release of LMWOAs into the environment.

  20. Seed size effects on the response of seedlings of Acacia asak (Forssk.) Willd to water stress

    International Nuclear Information System (INIS)

    El Atta, H.A.; Areef, I.M.; Ahmed, A.I.

    2016-01-01

    Dry tropical forests are characterized by unpredictable spells of drought and climate change. Saudi Arabia mostly falls within the arid zone and some few scattered areas fall in the semiarid zone mainly in the South Western region. Rainfall is sparse and with sporadic distribution. Drought is the most critical factor for restoration of the tree cover. Within a tree, seeds vary in size from large to small seeds. Although several researchers have studied the effect of within species variation in seed size on seedlings growth parameters, however there is a lack of knowledge regarding the effect of seed size on stress tolerance (Khurana and Singh 2000). We assumed that seedlings grown from different seed sizes from the same tree species may influence their response to water stress. Seeds of Acacia asak (Forssk.) Willd. were categorized into large, medium and small seeds on the basis of the seed weight. Seedlings from the three seed sizes were grown in potted soil and subjected to 5 levels of field water capacity (FC) (100, 75, 50, 25 and 15 percent) in the greenhouse. The Objective was to evaluate the response of seedling grown (from different seed sizes) to water stress and to understand the acclimation of seedlings to water stress. Water stress significantly reduced RWC, leaf area, and shoot length, fresh and dry weight. Significant correlations between growth parameters and water stress level were recorded. Seedlings from large seeds were heavier and comparatively less affected by drought compared to seedlings from smaller seeds. In all seedlings root length increased significantly and more biomass was allocated to roots than to shoots. However, at severe water stress (15 percent FC) no significant differences were reported between the three seedling categories. Therefore, raising of seedlings from large seeds is more appropriate for tree restoration programs under drought conditions. (author)

  1. Seed yield components and their potential interaction in grasses - to what extend does seed weigth influence yield?

    DEFF Research Database (Denmark)

    Boelt, B; Gislum, R

    2010-01-01

     In a first-year seed crop of red fescue (Festuca rubra L.) the degree of lodging was controlled by the use of Moddus (Trinexapac-ethyl). Seed weight was found to increase by the decreasing degree of lodging prior to harvest. The higher seed weights were accompanied by higher yields even though...... the number of reproductive tillers and floret site utilization (FSU) were unaffected by the treatments. Seed yield is affected by several yield components and reflects the interaction between the seed yield potential (e.g. number of reproductive tillers, number of spikelets and florets/spikelet per...... reproductive tiller), the utilization of the potential (e.g. seed set, seed weight) and the realization of the seed yield potential, defined as the number of florets forming a saleable seed. The realization of the seed yield potential is affected by seed retention, seed weight and other traits associated...

  2. Altitudinal variation in growth, bud break and susceptibility to balsam twig aphid damage of balsam fir from 6 Vermont seed sources

    Science.gov (United States)

    Ronald C. Wilkinson; Paul G. Schaberg

    1992-01-01

    Differences in 10-year heights, 4-year growth from 1987 through 1990, relative timing of budbreak and damage by the balsam twig aphid (Mindarus abietinus Koch.) among balsam fir (Abies balsamea (L.) Mill.) from 6 Vermont seed sources originating from different elevations were examined. Height differences among seed sources were...

  3. Complex genetics controls natural variation among seed quality phenotypes in a recombinant inbred population of an interspecific cross between Solanum lycopersicum × Solanum pimpinellifolium

    NARCIS (Netherlands)

    Kazmi, R.H.; Khan, N.; Willems, L.A.J.; Heusden, van A.W.; Ligterink, J.W.; Hilhorst, H.W.M.

    2012-01-01

    Seed quality in tomato is associated with many complex physiological and genetic traits. While plant processes are frequently controlled by the action of small- to large-effect genes that follow classic Mendelian inheritance, our study suggests that seed quality is primarily quantitative and

  4. Investigation on Genetic Variation of Iran Watermelon Accession

    Directory of Open Access Journals (Sweden)

    majid reza kiyani

    2009-06-01

    Full Text Available In order to determine of genetic variation in germplasm of 120 watermelon accessions, a field trial conducted at agricultural and natural resource research center of khorasan . These Accessions with four commercial cultivars as control were planted in agnomental design with six replications. 15 quantitative morphological traits were measured and some statistical parameter and analysis include of Mean, Coefficient variance, cluster analysis, correlation regression coefficients were determine for this traits. yield, Sugar percent , time between flowering and ripping, fruit length, fruit width, fruit mass to fruit weight ratio , fruit skin to fruit weight ratio , seed weight to fruit weight ratio , 100 seed weight , seed length , seed diameter , seed width were the most useful traits for identifying of genotypes from each other. A one side analysis of variance was performed for different regions genetic diversity detection, which indicated a significant difference between regions for all traits except fruit Ph and fruit skin thickness. Cluster analysis divided genotypes into eight groups based on quantitative data. Correlation analysis between traits showed a significant relation between yield and all traits except fruit ph, time to flowering and seed fruit length.

  5. Germinação de sementes e desenvolvimento de plântulas de moringa (Moringa oleifera Lam. em função do peso da semente e do tipo de substrato Germination of seeds and seedling development of drumstick as a function of seed weight and substrate type

    Directory of Open Access Journals (Sweden)

    Antonio Marcos E. Bezerra

    2004-06-01

    Full Text Available Moringa oleifera Lam. é uma espécie arbórea originária do noroeste indiano, cultivada graças ao seu valor alimentar, medicinal, industrial e no tratamento de água para o consumo humano. Os efeitos do peso de sementes e do substrato na germinação e desenvolvimento das plântulas foram determinados, sob condições de casa de vegetação (sombrite 50% com nebulização intermitente em Fortaleza (CE, de 29/11 a 14/12/02. Os tratamentos constaram de arranjo fatorial 3x3 referente a três categorias de semente: pesadas (272,41 g/1000 sementes, médias (218,88 g/1000 sementes e leves (177,07 g/1000 sementes; e três substratos: vermiculita; Plantmax® e uma mistura à base de solo esterilizado (S, húmus de minhoca (H e pó de coco lavado (PC, na proporção de 2:1:1, dispostos em delineamento inteiramente casualizado com quatro repetições (24 sementes/repetição. Efetuou-se a semeadura das três classes de pesos de sementes em bandejas de isopor de 72 células contendo os substratos, avaliando-se a percentagem, velocidade e tempo médio de germinação, altura da plântula, massa seca da parte aérea e massa seca total. As sementes pesadas e médias apresentaram maior percentagem e velocidade de germinação do que as leves; as sementes pesadas proporcionaram plântulas mais vigorosas; no substrato Plantmax® e na mistura (S+H+PC a percentagem e a velocidade de germinação foi superior à vermiculita; e as plântulas desenvolveram-se melhor no substrato Plantmax®.To compensate the shortage of information on the influence of seed weight and substrate over the germination and seedling development of Moringa oleifera an experiment was conducted under greenhouse conditions (50% of natural light with intermittent nebulization in Fortaleza, Ceará State, Brazil. The treatments consisted of a 3x3 factorial arrangement [three seed weights: heavy (272.41 g/1000 seeds; medium (218.88 g/1000 seeds and light (177.07 g/1000 seeds and three substrates

  6. Consistent individual differences in seed disperser quality in a seed-eating fish

    NARCIS (Netherlands)

    Pollux, Bart J.A.

    2017-01-01

    Animal-mediated seed dispersal (zoochory) is considered to be an important mechanism regulating biological processes at larger spatial scales. To date, intra-specific variation in seed disperser quality within seed-dispersing animals has not been studied. Here, I employed seed feeding trials to

  7. Ecological correlates of seed survival after ingestion by Fallow Deer

    NARCIS (Netherlands)

    Mouissie, AM; Van der Veen, CEJ; Veen, GF; Van Diggelen, R

    1. The survival and retention of seeds was studied by feeding known quantities of seeds of 25 species to four captive Fallow Deer (Dama dama L.). To test for ecological correlates, plant species were selected to represent large variation in seed size, seed shape, seed longevity and habitat

  8. Effects of elevated CO2 and temperature on seed quality

    DEFF Research Database (Denmark)

    Hampton, John G; Boelt, Birte; Rolston, M P

    2013-01-01

    production on three seed quality components: seed mass, germination and seed vigour. In response to elevated CO2, seed mass has been reported to both increase and decrease in C3 plants, but not change in C4 plants. Increases are greater in legumes than non-legumes, and there is considerable variation among...... species. Seed mass increases may result in a decrease of seed nitrogen (N) concentration in non-legumes. Increasing temperature may decrease seed mass because of an accelerated growth rate and reduced seed filling duration, but lower seed mass does not necessarily reduce seed germination or vigour. Like...

  9. Induction and selection of superior genetic variables of oil seed rape (brassica napus L.)

    International Nuclear Information System (INIS)

    Shah, S.S.; Ali, I.; Rehman, K.

    1990-01-01

    Dry and uniform seeds of two rape seed varieties, Ganyou-5 and Tower, were subjected to different doses of gamma rays. Genetic variation in yield and yield components generated in M1 was studied in M2 and 30 useful variants were isolated from a large magnetized population. The selected mutants were progeny tested for stability of the characters in M3. Only five out of 30 progenies were identified to be uniform and stable. Further selection was made in the segregating m3 progenies. Results on some of the promising mutants are reported. The effect of irradiation treatment was highly pronounced on pod length, seeds per pod and 1000-seed weight. The genetic changes thus induced would help to evolve high yielding versions of different rape seed varieties under local environmental conditions. (author)

  10. Copy Number Variation of Cytokinin Oxidase Gene Tackx4 Associated with Grain Weight and Chlorophyll Content of Flag Leaf in Common Wheat.

    Science.gov (United States)

    Chang, Cheng; Lu, Jie; Zhang, Hai-Ping; Ma, Chuan-Xi; Sun, Genlou

    2015-01-01

    As the main pigment in photosynthesis, chlorophyll significantly affects grain filling and grain weight of crop. Cytokinin (CTK) can effectively increase chlorophyll content and chloroplast stability, but it is irreversibly inactivated by cytokinin oxidase (CKX). In this study, therefore, twenty-four pairs of primers were designed to identify variations of wheat CKX (Tackx) genes associated with flag leaf chlorophyll content after anthesis, as well as grain weight in 169 recombinant inbred lines (RIL) derived from Triticum aestivum Jing 411 × Hongmangchun 21. Results indicated variation of Tackx4, identified by primer pair T19-20, was proven to significantly associate with chlorophyll content and grain weight in the RIL population. Here, two Tackx4 patterns were identified: one with two co-segregated fragments (Tackx4-1/Tackx4-2) containing 618 bp and 620 bp in size (as in Jing 411), and another with no PCR product. The two genotypes were designated as genotype-A and genotype-B, respectively. Grain weight and leaf chlorophyll content at 5~15 days after anthesis (DAA) were significantly higher in genotype-A lines than those in genotype-B lines. Mapping analysis indicated Tackx4 was closely linked to Xwmc169 on chromosome 3AL, as well as co-segregated with a major quantitative trait locus (QTL) for both grain weight and chlorophyll content of flag leaf at 5~15 DAA. This QTL explained 8.9~22.3% phenotypic variations of the two traits across four cropping seasons. Among 102 wheat varieties, a third genotype of Tackx4 was found and designated as genotype-C, also having two co-segregated fragments, Tackx4-2 and Tackx4-3 (615bp). The sequences of three fragments, Tackx4-1, Tackx4-2, and Tackx4-3, showed high identity (>98%). Therefore, these fragments could be considered as different copies at Tackx4 locus on chromosome 3AL. The effect of copy number variation (CNV) of Tackx4 was further validated. In general, genotype-A contains both significantly higher grain weight

  11. Spatio-Temporal Variation in Contrasting Effects of Resident Vegetation on Establishment, Growth and Reproduction of Dry Grassland Plants: Implications for Seed Addition Experiments

    Czech Academy of Sciences Publication Activity Database

    Knappová, Jana; Knapp, J.; Münzbergová, Zuzana

    2013-01-01

    Roč. 8, č. 6 (2013), no.-e65879 E-ISSN 1932-6203 Institutional support: RVO:67985939 Keywords : germination * seed sowing * habitat suitability Subject RIV: EF - Botanics Impact factor: 3.534, year: 2013

  12. DOG1 expression is predicted by the seed-maturation envornment and contributes to geographical variation in germination in Arabidopsis thaliana

    NARCIS (Netherlands)

    Chiang, G.C.K.; Bartsch, M.; Barua, D.; Nakabayashi, K.; Debieu, M.; Kronholm, I.; Koornneef, M.; Soppe, W.J.J.; Donohue, K.; Meaux, De J.

    2011-01-01

    Seasonal germination timing of Arabidopsis thaliana strongly influences overall life history expression and is the target of intense natural selection. This seasonal germination timing depends strongly on the interaction between genetics and seasonal environments both before and after seed

  13. [Procedure of seed quality testing and seed grading standard of Prunus humilis].

    Science.gov (United States)

    Wen, Hao; Ren, Guang-Xi; Gao, Ya; Luo, Jun; Liu, Chun-Sheng; Li, Wei-Dong

    2014-11-01

    So far there exists no corresponding quality test procedures and grading standards for the seed of Prunus humilis, which is one of the important source of base of semen pruni. Therefor we set up test procedures that are adapt to characteristics of the P. humilis seed through the study of the test of sampling, seed purity, thousand-grain weight, seed moisture, seed viability and germination percentage. 50 cases of seed specimens of P. humilis tested. The related data were analyzed by cluster analysis. Through this research, the seed quality test procedure was developed, and the seed quality grading standard was formulated. The seed quality of each grade should meet the following requirements: for first grade seeds, germination percentage ≥ 68%, thousand-grain weight 383 g, purity ≥ 93%, seed moisture ≤ 5%; for second grade seeds, germination percentage ≥ 26%, thousand-grain weight ≥ 266 g, purity ≥ 73%, seed moisture ≤9%; for third grade seeds, germination percentage ≥ 10%, purity ≥ 50%, thousand-grain weight ≥ 08 g, seed moisture ≤ 13%.

  14. Breeding for Grass Seed Yield

    DEFF Research Database (Denmark)

    Boelt, Birte; Studer, Bruno

    2010-01-01

    Seed yield is a trait of major interest for many fodder and amenity grass species and has received increasing attention since seed multiplication is economically relevant for novel grass cultivars to compete in the commercial market. Although seed yield is a complex trait and affected...... by agricultural practices as well as environmental factors, traits related to seed production reveal considerable genetic variation, prerequisite for improvement by direct or indirect selection. This chapter first reports on the biological and physiological basics of the grass reproduction system, then highlights...... important aspects and components affecting the seed yield potential and the agronomic and environmental aspects affecting the utilization and realization of the seed yield potential. Finally, it discusses the potential of plant breeding to sustainably improve total seed yield in fodder and amenity grasses....

  15. Genetic variation of fasting glucose and changes in glycemia in response to 2-year weight-loss diet intervention: the POUNDS Lost trial

    Science.gov (United States)

    Wang, Tiange; Huang, Tao; Zheng, Yan; Rood, Jennifer; Bray, George A.; Sacks, Frank M.; Qi, Lu

    2016-01-01

    Objective Weight loss intervention through diet modification has been widely used to improve obesity-related hyperglycemia; however, little is known about whether genetic variation modifies the intervention effect. We examined the interaction between weight-loss diets and genetic variation of fasting glucose on changes in glycemic traits in a dietary intervention trial. Research Design and Methods The Preventing Overweight Using Novel Dietary Strategies (POUNDS LOST) trial is a randomized, controlled 2-year weight-loss trial. We assessed overall genetic variation of fasting glucose by calculating a genetic risk score (GRS) based on 14 fasting glucose-associated single nucleotide polymorphisms, and examined the progression in fasting glucose and insulin levels, and insulin resistance and insulin sensitivity in 733 adults from this trial. Results The GRS was associated with 6-month changes in fasting glucose (Pfasting insulin (P=0.042), homeostasis model assessment of insulin resistance (HOMA-IR, P=0.009) and insulin sensitivity (HOMA-S, P=0.043). We observed significant interaction between the GRS and dietary fat on 6-month changes in fasting glucose, HOMA-IR and HOMA-S after multivariable adjustment (P-interaction=0.007, 0.045, and 0.028, respectively). After further adjustment for weight loss, the interaction remained significant on change in fasting glucose (P=0.015). In the high-fat diet group, participants in the highest GRS tertile showed increased fasting glucose, whereas participants in the lowest tertile showed decreased fasting glucose (P-trend<0.001); in contrast, the genetic association was not significant in the low-fat diet group (P-trend=0.087). Conclusions Our data suggest that participants with a higher genetic risk may benefit more by eating a low-fat diet to improve glucose metabolism. PMID:27113490

  16. Transcriptome Analysis of a New Peanut Seed Coat Mutant for the Physiological Regulatory Mechanism Involved in Seed Coat Cracking and Pigmentation.

    Science.gov (United States)

    Wan, Liyun; Li, Bei; Pandey, Manish K; Wu, Yanshan; Lei, Yong; Yan, Liying; Dai, Xiaofeng; Jiang, Huifang; Zhang, Juncheng; Wei, Guo; Varshney, Rajeev K; Liao, Boshou

    2016-01-01

    Seed-coat cracking and undesirable color of seed coat highly affects external appearance and commercial value of peanuts ( Arachis hypogaea L.). With an objective to find genetic solution to the above problems, a peanut mutant with cracking and brown colored seed coat (testa) was identified from an EMS treated mutant population and designated as "peanut seed coat crack and brown color mutant line ( pscb )." The seed coat weight of the mutant was almost twice of the wild type, and the germination time was significantly shorter than wild type. Further, the mutant had lower level of lignin, anthocyanin, proanthocyanidin content, and highly increased level of melanin content as compared to wild type. Using RNA-Seq, we examined the seed coat transcriptome in three stages of seed development in the wild type and the pscb mutant. The RNA-Seq analysis revealed presence of highly differentially expressed phenylpropanoid and flavonoid pathway genes in all the three seed development stages, especially at 40 days after flowering (DAF40). Also, the expression of polyphenol oxidases and peroxidase were found to be activated significantly especially in the late seed developmental stage. The genome-wide comparative study of the expression profiles revealed 62 differentially expressed genes common across all the three stages. By analyzing the expression patterns and the sequences of the common differentially expressed genes of the three stages, three candidate genes namely c36498_g1 (CCoAOMT1), c40902_g2 (kinesin) , and c33560_g1 (MYB3) were identified responsible for seed-coat cracking and brown color phenotype. Therefore, this study not only provided candidate genes but also provided greater insights and molecular genetic control of peanut seed-coat cracking and color variation. The information generated in this study will facilitate further identification of causal gene and diagnostic markers for breeding improved peanut varieties with smooth and desirable seed coat color.

  17. Transcriptome Analysis of a New Peanut Seed Coat Mutant for the Physiological Regulatory Mechanism Involved in Seed Coat Cracking and Pigmentation

    Science.gov (United States)

    Wan, Liyun; Li, Bei; Pandey, Manish K.; Wu, Yanshan; Lei, Yong; Yan, Liying; Dai, Xiaofeng; Jiang, Huifang; Zhang, Juncheng; Wei, Guo; Varshney, Rajeev K.; Liao, Boshou

    2016-01-01

    Seed-coat cracking and undesirable color of seed coat highly affects external appearance and commercial value of peanuts (Arachis hypogaea L.). With an objective to find genetic solution to the above problems, a peanut mutant with cracking and brown colored seed coat (testa) was identified from an EMS treated mutant population and designated as “peanut seed coat crack and brown color mutant line (pscb).” The seed coat weight of the mutant was almost twice of the wild type, and the germination time was significantly shorter than wild type. Further, the mutant had lower level of lignin, anthocyanin, proanthocyanidin content, and highly increased level of melanin content as compared to wild type. Using RNA-Seq, we examined the seed coat transcriptome in three stages of seed development in the wild type and the pscb mutant. The RNA-Seq analysis revealed presence of highly differentially expressed phenylpropanoid and flavonoid pathway genes in all the three seed development stages, especially at 40 days after flowering (DAF40). Also, the expression of polyphenol oxidases and peroxidase were found to be activated significantly especially in the late seed developmental stage. The genome-wide comparative study of the expression profiles revealed 62 differentially expressed genes common across all the three stages. By analyzing the expression patterns and the sequences of the common differentially expressed genes of the three stages, three candidate genes namely c36498_g1 (CCoAOMT1), c40902_g2 (kinesin), and c33560_g1 (MYB3) were identified responsible for seed-coat cracking and brown color phenotype. Therefore, this study not only provided candidate genes but also provided greater insights and molecular genetic control of peanut seed-coat cracking and color variation. The information generated in this study will facilitate further identification of causal gene and diagnostic markers for breeding improved peanut varieties with smooth and desirable seed coat color. PMID

  18. Variation in the maternal corticotrophin releasing hormone-binding protein (CRH-BP gene and birth weight in Blacks, Hispanics and Whites.

    Directory of Open Access Journals (Sweden)

    Pathik D Wadhwa

    Full Text Available Given the unique role of the corticotrophin-releasing hormone (CRH system in human fetal development, the aim of our study was to estimate the association of birth weight with DNA sequence variation in three maternal genes involved in regulating CRH production, bioavailability and action: CRH, CRH-Binding Protein (CRH-BP, and CRH type 1 receptor (CRH-R1, respectively, in three racial groups (African-Americans, Hispanics, and non-Hispanic Whites.Our study was carried out on a population-based sample of 575 mother-child dyads. We resequenced the three genes in mouse-human hybrid somatic cell lines and selected SNPs for genotyping.A significant association was observed in each race between birth weight and maternal CRH-BP SNP genotypes. Estimates of linkage disequilibrium and haplotypes established three common haplotypes marked by the rs1053989 SNP in all three races. This SNP predicted significant birth weight variation after adjustment for gestational age, maternal BMI, parity, and smoking. African American and Hispanic mothers carrying the A allele had infants whose birth weight was on average 254 and 302 grams, respectively, less than infants having C/C mothers. Non-Hispanic White mothers homozygous for the A allele had infants who were on average 148 grams less than those infants having A/C and C/C mothers.The magnitudes of the estimates of the birth weight effects are comparable to the combined effects of multiple SNPs reported in a recent meta-analysis of 6 GWAS studies and is quantitatively larger than that associated with maternal cigarette smoking. This effect was persistent across subpopulations that vary with respect to ancestry and environment.

  19. Optimum harvest maturity for Leymus chinensis seed

    Directory of Open Access Journals (Sweden)

    Jixiang Lin

    2016-06-01

    Full Text Available Timely harvest is critical to achieve maximum seed viability and vigour in agricultural production. However, little information exists concerning how to reap the best quality seeds of Leymus chinensis, which is the dominant and most promising grass species in the Songnen Grassland of Northern China. The objective of this study was to investigate and evaluate possible quality indices of the seeds at different days after peak anthesis. Seed quality at different development stages was assessed by the colours of the seed and lemmas, seed weight, moisture content, electrical conductivity of seed leachate and germination indices. Two consecutive years of experimental results showed that the maximum seed quality was recorded at 39 days after peak anthesis. At this date, the colours of the seed and lemmas reached heavy brown and yellow, respectively. The seed weight was highest and the moisture content and the electrical conductivity of seed leachate were lowest. In addition, the seed also reached its maximum germination percentage and energy at this stage, determined using a standard germination test (SGT and accelerated ageing test (AAT. Thus, Leymus chinensis can be harvested at 39 days after peak anthesis based on the changes in parameters. Colour identification can be used as an additional indicator to provide a more rapid and reliable measure of optimum seed maturity; approximately 10 days after the colour of the lemmas reached yellow and the colour of the seed reached heavy brown, the seed of this species was suitable for harvest.

  20. A variational image-based approach to the correction of susceptibility artifacts in the alignment of diffusion weighted and structural MRI.

    Science.gov (United States)

    Tao, Ran; Fletcher, P Thomas; Gerber, Samuel; Whitaker, Ross T

    2009-01-01

    This paper presents a method for correcting the geometric and greyscale distortions in diffusion-weighted MRI that result from inhomogeneities in the static magnetic field. These inhomogeneities may due to imperfections in the magnet or to spatial variations in the magnetic susceptibility of the object being imaged--so called susceptibility artifacts. Echo-planar imaging (EPI), used in virtually all diffusion weighted acquisition protocols, assumes a homogeneous static field, which generally does not hold for head MRI. The resulting distortions are significant, sometimes more than ten millimeters. These artifacts impede accurate alignment of diffusion images with structural MRI, and are generally considered an obstacle to the joint analysis of connectivity and structure in head MRI. In principle, susceptibility artifacts can be corrected by acquiring (and applying) a field map. However, as shown in the literature and demonstrated in this paper, field map corrections of susceptibility artifacts are not entirely accurate and reliable, and thus field maps do not produce reliable alignment of EPIs with corresponding structural images. This paper presents a new, image-based method for correcting susceptibility artifacts. The method relies on a variational formulation of the match between an EPI baseline image and a corresponding T2-weighted structural image but also specifically accounts for the physics of susceptibility artifacts. We derive a set of partial differential equations associated with the optimization, describe the numerical methods for solving these equations, and present results that demonstrate the effectiveness of the proposed method compared with field-map correction.

  1. Genetic consequences of seed dispersal to sleeping trees by white-bellied spider monkeys

    Science.gov (United States)

    Karubian, Jordan; Ottewell, Kym; Link, Andres; Di Fiore, Anthony

    2015-10-01

    Frugivorous animals frequently generate clumped distributions of seeds away from source trees via 'destination-based' dispersal processes. For example, use of traditional sleeping trees by white-bellied spider monkeys Ateles belzebuth generates high densities of seeds of a preferred food source, the palm Oenocarpus bataua, at these sites. Little is known about the maternal seed source diversity and population genetic metrics of seed pools encountered at these sites. Given the repeated use of sleeping trees over time, and the fluid social organization and wide ranging movements exhibited by spider monkeys, we predicted that O. bataua seed pools beneath sleeping trees would be characterized by relatively high values of maternal seed source diversity and standard metrics of genetic diversity. Contrary to these expectations, we found relatively low average maternal seed source diversity beneath each of 6 sleeping trees we studied (weighted mean α = 3.74), but considerable variation in diversity of maternal seed sources between sleeping trees (range = 1.75-10.1) and high heterogeneity in standard genetic diversity measures between sleeping trees. There was no evidence for overlap in maternal seed sources between sleeping tree sites (δ = 1.0), resulting in significant genetic differentiation (Fst = 0.055-0.319) between these sites. Observed variation between sleeping trees could not be explained by the number of individual spider monkeys whose core home ranges included a given tree, nor by distance to a central mineral lick, a focal point of spider monkey activity. These findings suggest that spider monkey seed dispersal to sleeping trees is spatially restricted, perhaps because the animals visit sleeping trees at the end of the day and therefore only disperse O. bataua fruits that they ingest late in the day. These results add to our growing appreciation of the ways frugivore behavior mechanistically shapes seed dispersal outcomes.

  2. Spatial Variation in Seasonal Water Poverty Index for Laos: An Application of Geographically Weighted Principal Component Analysis

    OpenAIRE

    Kallio, Marko; Guillaume, Joseph; Kummu, Matti; Virrantaus, Kirsi-Kanerva

    2017-01-01

    Water poverty, defined as insufficient water of adequate quality to cover basic needs, is an issue that may manifest itself in multiple ways. Extreme seasonal variation in water availability, such as in Laos, located in Monsoon Asia, results in large differences in water poverty conditions between dry and wet seasons. In this study, seasonal Water Poverty Indices (WPI) are developed for 8215 villages in Laos. WPI is a multidimensional composite index integrating five dimensions of water: reso...

  3. Genetic variation for lettuce seed thermoinhibition is associated with temperature-sensitive expression of abscisic Acid, gibberellin, and ethylene biosynthesis, metabolism, and response genes.

    Science.gov (United States)

    Argyris, Jason; Dahal, Peetambar; Hayashi, Eiji; Still, David W; Bradford, Kent J

    2008-10-01

    Lettuce (Lactuca sativa 'Salinas') seeds fail to germinate when imbibed at temperatures above 25 degrees C to 30 degrees C (termed thermoinhibition). However, seeds of an accession of Lactuca serriola (UC96US23) do not exhibit thermoinhibition up to 37 degrees C in the light. Comparative genetics, physiology, and gene expression were analyzed in these genotypes to determine the mechanisms governing the regulation of seed germination by temperature. Germination of the two genotypes was differentially sensitive to abscisic acid (ABA) and gibberellin (GA) at elevated temperatures. Quantitative trait loci associated with these phenotypes colocated with a major quantitative trait locus (Htg6.1) from UC96US23 conferring germination thermotolerance. ABA contents were elevated in Salinas seeds that exhibited thermoinhibition, consistent with the ability of fluridone (an ABA biosynthesis inhibitor) to improve germination at high temperatures. Expression of many genes involved in ABA, GA, and ethylene biosynthesis, metabolism, and response was differentially affected by high temperature and light in the two genotypes. In general, ABA-related genes were more highly expressed when germination was inhibited, and GA- and ethylene-related genes were more highly expressed when germination was permitted. In particular, LsNCED4, a gene encoding an enzyme in the ABA biosynthetic pathway, was up-regulated by high temperature only in Salinas seeds and also colocated with Htg6.1. The temperature sensitivity of expression of LsNCED4 may determine the upper temperature limit for lettuce seed germination and may indirectly influence other regulatory pathways via interconnected effects of increased ABA biosynthesis.

  4. Seed coat darkening in Cowpea bean

    Science.gov (United States)

    Seed coat of cowpea bean (Vigna unguiculata L. Walp) slowly browns to a darker color during storage. High temperature and humidity during storage might contribute to this color change. Variation in browning rate among seeds in a lot leads to a mixture of seed colors creating an unacceptable product...

  5. Sorghum Seed Maturity Affects the Weight and Feeding Duration of Immature Corn Earworm, Helicoverpa zea, and Fall Armyworm, Spodoptera frugiperda, in the Laboratory

    Science.gov (United States)

    Soper, Alysha M.; Whitworth, R. Jeff; McCornack, Brian P.

    2013-01-01

    Corn earworm, Helicoverpa zea Boddie (Lepidoptera: Noctuidae), and fall armyworm, Spodoptera frugiperda J.E. Smith, are occasional pests in sorghum, Sorghum bicolor L. Moench (Poales: Poaceae), and can be economically damaging when conditions are favorable. Despite the frequent occurrence of mixed-species infestations, the quantitative data necessary for developing yield loss relationships for S. frugiperda are not available. Although these species share similar biological characteristics, it is unknown whether their damage potentials in developing grain sorghum panicles are the same. Using no-choice feeding assays in the laboratory, this study examined larval growth and feeding duration for H. zea and S. frugiperda in the absence of competition. Each species responded positively when exposed to sorghum seed in the soft-dough stage, supporting evidence for the interactions between host-quality and larval growth and development. The results of this study also confirmed the suitability of using laboratory-reared H. zea to develop sorghum yield loss estimates in the field, and provided insights into the biological responses of S. frugiperda feeding on developing sorghum seed. PMID:24219328

  6. Sorghum seed maturity affects the weight and feeding duration of immature corn earworm, Helicoverpa zea, and fall armyworm, Spodoptera frugiperda, in the laboratory.

    Science.gov (United States)

    Soper, Alysha M; Whitworth, R Jeff; McCornack, Brian P

    2013-01-01

    Corn earworm, Helicoverpa zea Boddie (Lepidoptera: Noctuidae), and fall armyworm, Spodoptera frugiperda J.E. Smith, are occasional pests in sorghum, Sorghum bicolor L. Moench (Poales: Poaceae), and can be economically damaging when conditions are favorable. Despite the frequent occurrence of mixed-species infestations, the quantitative data necessary for developing yield loss relationships for S. frugiperda are not available. Although these species share similar biological characteristics, it is unknown whether their damage potentials in developing grain sorghum panicles are the same. Using no-choice feeding assays in the laboratory, this study examined larval growth and feeding duration for H. zea and S. frugiperda in the absence of competition. Each species responded positively when exposed to sorghum seed in the soft-dough stage, supporting evidence for the interactions between host-quality and larval growth and development. The results of this study also confirmed the suitability of using laboratory-reared H. zea to develop sorghum yield loss estimates in the field, and provided insights into the biological responses of S. frugiperda feeding on developing sorghum seed.

  7. Genetic Variations of Circulating Adiponectin Levels Modulate Changes in Appetite in Response to Weight-Loss Diets.

    Science.gov (United States)

    Ma, Wenjie; Huang, Tao; Heianza, Yoriko; Wang, Tiange; Sun, Dianjianyi; Tong, Jenny; Williamson, Donald A; Bray, George A; Sacks, Frank M; Qi, Lu

    2017-01-01

    Adiponectin plays key roles in regulating appetite and food intake. To investigate interactions between the genetic risk score (GRS) for adiponectin levels and weight-loss diets varying in macronutrient intake on long-term changes in appetite and adiponectin levels. A GRS was calculated based on 5 adiponectin-associated variants in 692 overweight adults from the 2-year Preventing Overweight Using Novel Dietary Strategies trial. Repeated measurements of plasma adiponectin levels and appetite-related traits, including cravings, fullness, prospective consumption, and hunger. Dietary fat showed nominally significant interactions with the adiponectin GRS on changes in appetite score and prospective consumption from baseline to 6 months (P for interaction = 0.014 and 0.017, respectively) after adjusting for age, sex, ethnicity, baseline body mass index, and baseline respective outcome values. The GRS for lower adiponectin levels was associated with a greater decrease in appetite (P appetite and adiponectin levels to weight-loss diets varying in fat intake. Copyright © 2017 by the Endocrine Society

  8. Seed yield and quality of pepper plants grown under salt stress ...

    African Journals Online (AJOL)

    The effect of salinity on seed yield and quality of pepper plants were evaluated. Plants were grown in five salt levels (electrical conductivity, EC): 1.0, 1.5, 2.0, 4.0 to 6.0 dSm-1 in glasshouse. Seed yield was assessed by seed weight/fruit, seed weight/plant and individual seed weight. Seed quality was measured by ...

  9. Seed yield and quality of pepper plants grown under salt stress

    African Journals Online (AJOL)

    İbrahim Demir

    2013-12-04

    Dec 4, 2013 ... The effect of salinity on seed yield and quality of pepper plants were evaluated. Plants were grown in five salt levels (electrical conductivity, EC): 1.0, 1.5, 2.0, 4.0 to 6.0 dSm-1 in glasshouse. Seed yield was assessed by seed weight/fruit, seed weight/plant and individual seed weight. Seed quality was.

  10. Are environmental factors responsible for geographic variation in the sex ratio of the Greenlandic seed-bug Nysius groenlandicus?

    DEFF Research Database (Denmark)

    Bøcher, Jens Jensenius; Nachman, Gøsta Støger

    2010-01-01

    Until recently nothing indicated an unequal sex ratio in the widespread Greenland seed-bug Nysius groenlandicus (Zetterstedt) (Heteroptera: Lygaeidae). However, recently populations more or less devoid of males were discovered in high arctic Northeast Greenland. This initiated an inspection of th...

  11. Updated Methods for Seed Shape Analysis

    Directory of Open Access Journals (Sweden)

    Emilio Cervantes

    2016-01-01

    Full Text Available Morphological variation in seed characters includes differences in seed size and shape. Seed shape is an important trait in plant identification and classification. In addition it has agronomic importance because it reflects genetic, physiological, and ecological components and affects yield, quality, and market price. The use of digital technologies, together with development of quantification and modeling methods, allows a better description of seed shape. Image processing systems are used in the automatic determination of seed size and shape, becoming a basic tool in the study of diversity. Seed shape is determined by a variety of indexes (circularity, roundness, and J index. The comparison of the seed images to a geometrical figure (circle, cardioid, ellipse, ellipsoid, etc. provides a precise quantification of shape. The methods of shape quantification based on these models are useful for an accurate description allowing to compare between genotypes or along developmental phases as well as to establish the level of variation in different sets of seeds.

  12. Increasing seed size and quality by manipulating BIG SEEDS1 in legume species.

    Science.gov (United States)

    Ge, Liangfa; Yu, Jianbin; Wang, Hongliang; Luth, Diane; Bai, Guihua; Wang, Kan; Chen, Rujin

    2016-11-01

    Plant organs, such as seeds, are primary sources of food for both humans and animals. Seed size is one of the major agronomic traits that have been selected in crop plants during their domestication. Legume seeds are a major source of dietary proteins and oils. Here, we report a conserved role for the BIG SEEDS1 (BS1) gene in the control of seed size and weight in the model legume Medicago truncatula and the grain legume soybean (Glycine max). BS1 encodes a plant-specific transcription regulator and plays a key role in the control of the size of plant organs, including seeds, seed pods, and leaves, through a regulatory module that targets primary cell proliferation. Importantly, down-regulation of BS1 orthologs in soybean by an artificial microRNA significantly increased soybean seed size, weight, and amino acid content. Our results provide a strategy for the increase in yield and seed quality in legumes.

  13. Storage of sunflower seeds

    Directory of Open Access Journals (Sweden)

    Denise de Castro Lima

    Full Text Available The sunflower is among the top five crops in the world for the production of edible vegetable oil. The species displays rustic behavior, with an excellent edaphic and climatic adaptability index, being able to be cultivated throughout Brazil. Seed quality is the key to increasing production and productivity in the sunflower. The objective of this work was to monitor the viability of sunflower seeds with a view to their conservation when stored in different environments and packaging. The seeds were packed in paper bags, multilayered paper, black polyethylene and PET bottles; and stored for a period of twelve months in the following environments: dry cold room (10 ºC and 55% RH, the ambient conditions of Fortaleza, Ceará, Brazil (30-32 ºC and 75% RH, refrigerator (4 ºC and 38-43% RH and freezer (-20 ºC. Every three months, the water content of the seeds was determined and germination, accelerated ageing, speed of emergence index, and seedling dry weight were evaluated. The experimental design was completely randomized, in a scheme of split-lots, with four replications. It can be concluded that the natural environment is not suitable for the storage of sunflower seeds. Sunflower seeds remain viable for 12 months when stored in a dry cold room, refrigerator or freezer, irrespective of the type of packaging used.

  14. Seed quality in informal seed systems

    NARCIS (Netherlands)

    Biemond, P.C.

    2013-01-01

    Keywords: informal seed systems, seed recycling, seed quality, germination, seed pathology, seed health, seed-borne diseases, mycotoxigenic fungi, Fusarium verticillioides, mycotoxins, Vigna unguiculata, Zea mays, Nigeria.

    Seed is a crucial input for agricultural production.

  15. Genetic variation in PNPLA3 (adiponutrin) confers sensitivity to weight loss-induced decrease in liver fat in humans.

    Science.gov (United States)

    Sevastianova, Ksenia; Kotronen, Anna; Gastaldelli, Amalia; Perttilä, Julia; Hakkarainen, Antti; Lundbom, Jesper; Suojanen, Laura; Orho-Melander, Marju; Lundbom, Nina; Ferrannini, Eleuterio; Rissanen, Aila; Olkkonen, Vesa M; Yki-Järvinen, Hannele

    2011-07-01

    The rs738409 C→G single nucleotide polymorphism in the patatin-like phospholipase domain-containing 3 (PNPLA3; adiponutrin) leads to a missense mutation (I148M), which is associated with increased liver fat but not insulin resistance. The I148M mutation impedes triglyceride hydrolysis in vitro, and its carriers have an increased risk of developing severe liver disease. We explored whether the rs738409 PNPLA3 G allele influences the ability of weight loss to decrease liver fat or change insulin sensitivity. We recruited 8 subjects who were homozygous for the rs738409 PNPLA3 G allele (PNPLA3-148MM) and 10 who were homozygous for the rs738409 PNPLA3 C allele (PNPLA3-148II). To allow comparison of changes in liver fat, the groups were matched with respect to baseline age, sex, body mass index, and liver fat. The subjects were placed on a hypocaloric low-carbohydrate diet for 6 d. Liver fat content (proton magnetic resonance spectroscopy), whole-body insulin sensitivity of glucose metabolism (euglycemic clamp technique), and lipolysis ([(2)H(5)]glycerol infusion) were measured before and after the diet. At baseline, fasting serum insulin and C-peptide concentrations were significantly lower in the PNPLA3-148MM group than in the PNPLA3-148II group, as predicted by study design. Weight loss was not significantly different between groups (PNPLA3-148MM: -3.1 ± 0.5 kg; PNPLA3-148II: -3.1 ± 0.4 kg). Liver fat decreased by 45% in the PNPLA3-148MM group (P loss is effective in decreasing liver fat in subjects who are homozygous for the rs738409 PNPLA3 G or C allele. This trial was registered at www.hus.fi as 233775.

  16. Diffusion Weighted Imaging of the Uterus: Regional ADC Variation with Oral Contraceptive Usage and Comparison with Cervical Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Messiou, Christina; Morgan, Veronica A.; Silva, Sonali S. de; Souza, Nandita M. de (Cancer Research UK Clinical Magnetic Resonance Research Group, Institute of Cancer Research and Royal Marsden NHS Foundation Trust, Surrey (United Kingdom)); Ind, Thomas E. (Dept. of Gynaecology and Obstetrics, St George' s Hospital NHS Trust, London (United Kingdom))

    2009-07-15

    Background: There is growing interest in diffusion weighted magnetic resonance imaging (MRI) of cervical carcinoma but normal uterine appearances and effects of the oral contraceptive pill (OCP) have not been described. Purpose: To establish apparent diffusion coefficient (ADC) values for normal regions of uterus, determine the effect of the OCP on these values, and compare them with ADCs from cervical cancer. Material and Methods: Twenty-seven premenopausal women (19 taking the OCP) with cervical intraepithelial neoplasia (CIN) were studied with T2W and diffusion weighted MRI (DW-MRI). Regions of interest were drawn on ADC maps by visual matching with T2W images on different zones of the uterus and values compared between women not taking and taking the OCp.A further group of 25 women with clinically obvious tumors of the cervix were also studied with T2W and DW-MRI and ADC values of tumor were compared with ADC values of cervical epithelium and stroma. Results: The ADC values of adjacent zones of the uterus and cervix were significantly different from one another (P<0.001). The junctional zone was seen as a band of restricted diffusion between endometrium and outer myometrium. The ADC value of the junctional zone of the uterus was significantly greater (P<0.001) in patients taking the OCP than those patients not taking the OCp.There was no significant affect of the OCP on the ADC values of other uterine zones. Conclusion: The zonal anatomy of the uterus is well demonstrated by DW-MRI with hormonal effects secondary to the OCP affecting junctional zone alone. ADC of cervical tumor is significantly different to cervical epithelium and stroma indicating a role in cervical cancer detection and local staging

  17. Diffusion Weighted Imaging of the Uterus: Regional ADC Variation with Oral Contraceptive Usage and Comparison with Cervical Cancer

    International Nuclear Information System (INIS)

    Messiou, Christina; Morgan, Veronica A.; Silva, Sonali S. de; Souza, Nandita M. de; Ind, Thomas E.

    2009-01-01

    Background: There is growing interest in diffusion weighted magnetic resonance imaging (MRI) of cervical carcinoma but normal uterine appearances and effects of the oral contraceptive pill (OCP) have not been described. Purpose: To establish apparent diffusion coefficient (ADC) values for normal regions of uterus, determine the effect of the OCP on these values, and compare them with ADCs from cervical cancer. Material and Methods: Twenty-seven premenopausal women (19 taking the OCP) with cervical intraepithelial neoplasia (CIN) were studied with T2W and diffusion weighted MRI (DW-MRI). Regions of interest were drawn on ADC maps by visual matching with T2W images on different zones of the uterus and values compared between women not taking and taking the OCp.A further group of 25 women with clinically obvious tumors of the cervix were also studied with T2W and DW-MRI and ADC values of tumor were compared with ADC values of cervical epithelium and stroma. Results: The ADC values of adjacent zones of the uterus and cervix were significantly different from one another (P<0.001). The junctional zone was seen as a band of restricted diffusion between endometrium and outer myometrium. The ADC value of the junctional zone of the uterus was significantly greater (P<0.001) in patients taking the OCP than those patients not taking the OCp.There was no significant affect of the OCP on the ADC values of other uterine zones. Conclusion: The zonal anatomy of the uterus is well demonstrated by DW-MRI with hormonal effects secondary to the OCP affecting junctional zone alone. ADC of cervical tumor is significantly different to cervical epithelium and stroma indicating a role in cervical cancer detection and local staging

  18. [Seed geography: its concept and basic scientific issues].

    Science.gov (United States)

    Yu, Shun-Li; Wang, Zong-Shuai; Zeren, Wangmu

    2010-01-01

    In this paper, a new concept 'seed geography' was provided, and its definition, research contents, and scientific issues were put forward. Seed geography is a newly developed interdisciplinary science from plant geography, seed ecology, and phytosociology, which studies the geographic variation patterns of seed biological traits as well as their relationships with environmental factors from macroscopic to microscopic, and the seed formation, development, and change trends. The main research contents would include geography of seed mass, geography of seed chemical components, geography of seed morphology, geography of seed cell biological characteristics, geography of seed physiological characteristics, geography of seed genetic characteristics, and geography of flower and fruit. To explore the scientific issues in seed geography would help us to better understand the long-term adaptation and evolution of seed characteristics to natural environments.

  19. Evaluation of Wheat (Triticum aestivum, L. Seed Quality of Certified Seed and Farm-Saved Seed in Three Provinces of Iran

    Directory of Open Access Journals (Sweden)

    Khazaei Fardin

    2016-06-01

    Full Text Available The objective of this study was to study the seed quality aspects of wheat (Triticum aestivum L. and the extent of weed seed contamination present in wheat seeds produced in different regions of Iran. Four districts (cities, each including 12 fields (six certified seed fields and six farm-saved seed fields, were selected in each regions (provinces. One kilogram of the wheat seed sample was collected from each field for analysis in the laboratory. Wheat seeding was commonly done by farm-saved seed sourced from within the farm due to the high costs of certified seeds purchased from outside sources, followed by the low seed quality. The use of a farm-saved seed resulted in a higher germination rate and a lower mean time to germination compared with another system. The more positive temperatures experienced by mother plants could decrease the number of normal seedling and seedling length vigor index. Generally there was virtually no difference about physiological quality between certified seed and farm-saved seed sector that is related to lower quality of certified seed. The certified produced seeds had the lower number of weed seed, species and genus before and after cleaning. The highest seed purity and 1000 seed weight was obtained from the certified seed production system. The need for cleaning the farm-saved seed samples before sowing is one of the important findings of this survey.

  20. Testing Optimum Seeding Rates for five Bread Wheat Cultivars

    International Nuclear Information System (INIS)

    Wekesa, S.J.; Kiriswa, F.; Owuoche, J.

    1999-01-01

    A cultivar by seed rate trial was conducted in 1994-1995 crop seasons at Njoro, Kenya. Yield results were found to be significant (P > 0.01) for year, variety, seed rate and year by seed rate interaction. Test weight was highly significant (P -1 were grouped together for significantly higher yields (A) whereas seed rates 85 and 50 kg ha -1 had lower significant yields (B and C respectively). The same grouping was repeated for test weight. There was no significant cultivar by seed rate interaction and no cultivar, specific seed rate. However, since seed rates 245, 205, 165 and 125 kg ha -1 were grouped together, the lowest seed rate, 125 kg ha -1 can be recommended as the optimum seed rate for the above cultivars, as higher seed rates do not give significantly higher yields or higher test weights

  1. Variation and inheritance of iron reductase activity in the roots of common bean (Phaseolus vulgaris L.) and association with seed iron accumulation QTL.

    Science.gov (United States)

    Blair, Matthew W; Knewtson, Sharon Jb; Astudillo, Carolina; Li, Chee-Ming; Fernandez, Andrea C; Grusak, Michael A

    2010-10-05

    Iron deficiency anemia is a global problem which often affects women and children of developing countries. Strategy I plants, such as common bean (Phaseolus vulgaris L.) take up iron through a process that involves an iron reduction mechanism in their roots; this reduction is required to convert ferric iron to ferrous iron. Root absorbed iron is critical for the iron nutrition of the plant, and for the delivery of iron to the shoot and ultimately the seeds. The objectives of this study were to determine the variability and inheritance for iron reductase activity in a range of genotypes and in a low × high seed iron cross (DOR364 x G19833), to identify quantitative trait loci (QTL) for this trait, and to assess possible associations with seed iron levels. The experiments were carried out with hydroponically grown plants provided different amounts of iron varying between 0 and 20 μM Fe(III)-EDDHA. The parents, DOR364 and G19833, plus 13 other cultivated or wild beans, were found to differ in iron reductase activity. Based on these initial experiments, two growth conditions (iron limited and iron sufficient) were selected as treatments for evaluating the DOR364 × G19833 recombinant inbred lines. A single major QTL was found for iron reductase activity under iron-limited conditions (1 μM Fe) on linkage group b02 and another major QTL was found under iron sufficient conditions (15 μM Fe) on linkage group b11. Associations between the b11 QTL were found with several QTL for seed iron. Genes conditioning iron reductase activity in iron sufficient bean plants appear to be associated with genes contributing to seed iron accumulation. Markers for bean iron reductase (FRO) homologues were found with in silico mapping based on common bean synteny with soybean and Medicago truncatula on b06 and b07; however, neither locus aligned with the QTL for iron reductase activity. In summary, the QTL for iron reductase activity under iron limited conditions may be useful in

  2. Variation and inheritance of iron reductase activity in the roots of common bean (Phaseolus vulgaris L. and association with seed iron accumulation QTL

    Directory of Open Access Journals (Sweden)

    Fernandez Andrea C

    2010-10-01

    Full Text Available Abstract Background Iron deficiency anemia is a global problem which often affects women and children of developing countries. Strategy I plants, such as common bean (Phaseolus vulgaris L. take up iron through a process that involves an iron reduction mechanism in their roots; this reduction is required to convert ferric iron to ferrous iron. Root absorbed iron is critical for the iron nutrition of the plant, and for the delivery of iron to the shoot and ultimately the seeds. The objectives of this study were to determine the variability and inheritance for iron reductase activity in a range of genotypes and in a low × high seed iron cross (DOR364 × G19833, to identify quantitative trait loci (QTL for this trait, and to assess possible associations with seed iron levels. Results The experiments were carried out with hydroponically grown plants provided different amounts of iron varying between 0 and 20 μM Fe(III-EDDHA. The parents, DOR364 and G19833, plus 13 other cultivated or wild beans, were found to differ in iron reductase activity. Based on these initial experiments, two growth conditions (iron limited and iron sufficient were selected as treatments for evaluating the DOR364 × G19833 recombinant inbred lines. A single major QTL was found for iron reductase activity under iron-limited conditions (1 μM Fe on linkage group b02 and another major QTL was found under iron sufficient conditions (15 μM Fe on linkage group b11. Associations between the b11 QTL were found with several QTL for seed iron. Conclusions Genes conditioning iron reductase activity in iron sufficient bean plants appear to be associated with genes contributing to seed iron accumulation. Markers for bean iron reductase (FRO homologues were found with in silico mapping based on common bean synteny with soybean and Medicago truncatula on b06 and b07; however, neither locus aligned with the QTL for iron reductase activity. In summary, the QTL for iron reductase activity

  3. In healthy elderly postmenopausal women variations in BMD and BMC at various skeletal sites are associated with differences in weight and lean body mass rather than by variations in habitual physical activity, strength or VO2max.

    Science.gov (United States)

    Schöffl, I; Kemmler, W; Kladny, B; Vonstengel, S; Kalender, W A; Engelke, K

    2008-01-01

    The objective of this study was an integrated cross-sectional investigation for answering the question whether differences in bone mineral density in elderly postmenopausal women are associated with differences in habitual physical activity and unspecific exercise levels. Two hundred and ninety nine elderly women (69-/+3 years), without diseases or medication affecting bone metabolism were investigated. The influence of weight, body composition and physical activity on BMD was measured at multiple sites using different techniques (DXA, QCT, and QUS). Physical activity and exercise level were assessed by questionnaire, maximum strength of the legs and aerobic capacity. Variations in physical activity or habitual exercise had no effect on bone. The only significant univariate relation between strength/VO(2)max and BMD/BMC that remained after adjusting for confounding variables was between arm BMD (DXA) and hand-grip strength. The most important variable for explaining BMD was weight and for cortical BMC of the femur (QCT) lean body mass. Weight and lean body mass emerge as predominant predictors of BMD in normal elderly women, whereas the isolated effect of habitual physical activity, unspecific exercise participation, and muscle strength on bone parameters is negligible. Thus, an increase in the amount of habitual physical activity will probably have no beneficial impact on bone.

  4. seed oils

    African Journals Online (AJOL)

    Timothy Ademakinwa

    processes, production of biodiesel, as lubricant and in deep-frying purposes. They could ... for its juice, nectars and fruit while its seeds are ... Malaysia. The fine seed powder was stored in a plastic container inside a refrigerator at between 4 o.

  5. seed flour

    African Journals Online (AJOL)

    ONOS

    2010-09-06

    Sep 6, 2010 ... and with a nice taste, used for cooking or as lamp oil. The fatty acid ... Pra seeds were obtained from a local market in Nakhon Si Thammarat. Page 2. Table 1. Proximate composition of pra seed flour. Constituent. Percentage ...

  6. Gene regulation in seeds : insights into translational dynamics

    NARCIS (Netherlands)

    Bai, B.

    2016-01-01

    Seeds are unique structures in the plant life cycle. The variation in the timing of seed maturation, dispersion, and the establishment of seed dormancy and longevity, increases the chances of plant survival and enlarge the distance that plants could disperse in the natural habitat. Seeds contain

  7. Genetic Variation for Thermotolerance in Lettuce Seed Germination Is Associated with Temperature-Sensitive Regulation of ETHYLENE RESPONSE FACTOR1 (ERF1)1[OPEN

    Science.gov (United States)

    O’Brien, Laurel K.; Truco, Maria Jose; Huo, Heqiang; Sideman, Rebecca; Hayes, Ryan; Michelmore, Richard W.

    2016-01-01

    Seeds of most lettuce (Lactuca sativa) cultivars are susceptible to thermoinhibition, or failure to germinate at temperatures above approximately 28°C, creating problems for crop establishment in the field. Identifying genes controlling thermoinhibition would enable the development of cultivars lacking this trait and, therefore, being less sensitive to high temperatures during planting. Seeds of a primitive accession (PI251246) of lettuce exhibited high-temperature germination capacity up to 33°C. Screening a recombinant inbred line population developed from PI215246 and cv Salinas identified a major quantitative trait locus (Htg9.1) from PI251246 associated with the high-temperature germination phenotype. Further genetic analyses discovered a tight linkage of the Htg9.1 phenotype with a specific DNA marker (NM4182) located on a single genomic sequence scaffold. Expression analyses of the 44 genes encoded in this genomic region revealed that only a homolog of Arabidopsis (Arabidopsis thaliana) ETHYLENE RESPONSE FACTOR1 (termed LsERF1) was differentially expressed between PI251246 and cv Salinas seeds imbibed at high temperature (30°C). LsERF1 belongs to a large family of transcription factors associated with the ethylene-signaling pathway. Physiological assays of ethylene synthesis, response, and action in parental and near-isogenic Htg9.1 genotypes strongly implicate LsERF1 as the gene responsible for the Htg9.1 phenotype, consistent with the established role for ethylene in germination thermotolerance of Compositae seeds. Expression analyses of genes associated with the abscisic acid and gibberellin biosynthetic pathways and results of biosynthetic inhibitor and hormone response experiments also support the hypothesis that differential regulation of LsERF1 expression in PI251246 seeds elevates their upper temperature limit for germination through interactions among pathways regulated by these hormones. Our results support a model in which LsERF1 acts through

  8. Robotic seeding

    DEFF Research Database (Denmark)

    Pedersen, Søren Marcus; Fountas, Spyros; Sørensen, Claus Aage Grøn

    2017-01-01

    Agricultural robotics has received attention for approximately 20 years, but today there are only a few examples of the application of robots in agricultural practice. The lack of uptake may be (at least partly) because in many cases there is either no compelling economic benefit......, or there is a benefit but it is not recognized. The aim of this chapter is to quantify the economic benefits from the application of agricultural robots under a specific condition where such a benefit is assumed to exist, namely the case of early seeding and re-seeding in sugar beet. With some predefined assumptions...... with regard to speed, capacity and seed mapping, we found that among these two technical systems both early seeding with a small robot and re-seeding using a robot for a smaller part of the field appear to be financially viable solutions in sugar beet production....

  9. Variações espaço-temporais no estoque de sementes do solo na floresta amazônica Space-time variations in soil seed stock in an amazon rainforest

    Directory of Open Access Journals (Sweden)

    Niwton Leal Filho

    2013-09-01

    Full Text Available A dispersão eficiente, a longevidade e a capacidade das sementes de permanecer em estado latente a espera de condições adequadas de germinação no banco de sementes do solo da floresta garantem a presença de espécies arbóreas pioneiras nas áreas perturbadas. As variações estacionais e espaciais na densidade e na composição florística do banco de sementes em Florestas Tropicais Úmidas são assuntos ainda pouco compreendidos. Este trabalho verificou a existência de modificações espaço-temporais do banco de sementes presente em áreas de Floresta Tropical úmida localizadas próximas a Manaus, AM. Em cada uma das seis áreas estudadas, foram coletadas 40 amostras circulares de solo superficial (10 cm de diâmetro e 2 cm de profundidade ao acaso. Essas amostras foram coletadas a cada dois meses, entre agosto/2004 e junho/2005,. As amostras de solo foram distribuídas em bandejas em casa de vegetação e a emergência das sementes presentes no solo foi acompanhada por 4 meses. Houve uma redução significativa (H: 14,09, p The dispersion efficiency, longevity and the ability of seeds to remain latent waiting for suitable conditions for germination in the forest soil seed bank ensures the presence of pioneer tree species in disturbed areas. The seasonal and spatial variations in the density and floristic composition of the seed bank in tropical rainforests is a subject still little understood. This work verified the existence of spatio-temporal changes of the seed bank present in areas of humid tropical rain forest located near Manaus, Amazonas. In each of the six study areas, 40 circular samples of topsoil (10 cm in diameter and 2 cm deep were randomly collected every two months, from August 2004 to June/2005. Inside a greenhouse, the collected soil samples were distributed in trays and the emergence of seeds present in the soil was accompanied during four months. There was a significant reduction (H: 14.09112, p <0.05 in the mean

  10. Recruitment of childhood leukaemia patients to clinical trials in Great Britain during 1980-2007: variation by birth weight, congenital malformation, socioeconomic status and ethnicity.

    Science.gov (United States)

    Shah, Anjali; Diggens, Nicole; Stiller, Charles; Richards, Sue; Stevens, Michael C G; Murphy, Michael F G

    2014-05-01

    To assess recruitment of children to national clinical trials for acute lymphoblastic leukaemia (ALL) and acute myeloid leukaemia (AML) in Great Britain during 1980-2007 and describe variation by some factors that might influence trial entry. Records of leukaemia patients aged 0-14 years at diagnosis were identified in the National Registry of Childhood Tumours and linked to birth registrations, Children's Cancer and Leukaemia Group records, Hospital Episode Statistics and Medical Research Council clinical trial registers. Trial entry rates were compared between categories of birth weight, congenital malformation, socioeconomic status and ethnicity. 9147 ALL and 1466 AML patients were eligible for national clinical trials during 1980-2007. Overall recruitment rates were 81% and 60% respectively. For ALL, rates varied significantly with congenital malformation (Down syndrome 61%, other malformations 80%, none 82%; p4000 g 67%; p=0.001) and congenital malformation (Down syndrome 28%, other malformations 56%, none 63%; pcongenital malformations.

  11. Tea seed upgrading facilities and economic assessment of biodiesel production from tea seed oil

    Energy Technology Data Exchange (ETDEWEB)

    Demirbas, Ayhan [Sirnak University, Engineering Faculty, Sirnak (Turkey); Sila Science, Trabzon (Turkey)

    2010-12-15

    Green tea seed (Camellia sinensis L. Kuntze) oil was used in this work. The tea seed oil contains more than 84% unsaturated fatty acid, such as oleic acid (62.5% by weight), linoleic acid (18.1% by weight) and linolenic acid. The biodiesel from tea seed oil in itself is not significantly different from biodiesel produced from vegetable oils. However, tea seed oil has lower pour point and lower viscosity as different common vegetable oils. Crude tea seed oil is one of the cheapest vegetable oil feedstocks with average price, 514 (US$/ton). (author)

  12. Tea seed upgrading facilities and economic assessment of biodiesel production from tea seed oil

    International Nuclear Information System (INIS)

    Demirbas, Ayhan

    2010-01-01

    Green tea seed (Camellia sinensisL. Kuntze) oil was used in this work. The tea seed oil contains more than 84% unsaturated fatty acid, such as oleic acid (62.5% by weight), linoleic acid (18.1% by weight) and linolenic acid. The biodiesel from tea seed oil in itself is not significantly different from biodiesel produced from vegetable oils. However, tea seed oil has lower pour point and lower viscosity as different common vegetable oils. Crude tea seed oil is one of the cheapest vegetable oil feedstocks with average price, 514 (US$/ton).

  13. Seed regulations and local seed systems

    NARCIS (Netherlands)

    Louwaars, N.

    2000-01-01

    Seed regulations have been introduced in most countries based on the development of formal seed production. Concerns about seed quality and about the varietal identity of the seeds have commonly led to seed laws. However, formal regulations are often inappropriate for informal seed systems, which

  14. Seed drill depth control system for precision seeding

    DEFF Research Database (Denmark)

    Kirkegaard Nielsen, Søren; Munkholm, Lars Juhl; Lamandé, Mathieu

    2018-01-01

    acting on the drill coulters, which generates unwanted vibrations and, consequently, a non-uniform seed placement. Therefore, a proof-of-concept dynamic coulter depth control system for a low-cost seed drill was developed and studied in a field experiment. The performance of the active control system...... depth control system this variability was reduced to±2 mm. The system with the active control system operated more accurately at an operational speed of 12 km h−1 than at 4 km h−1 without the activated control system.......An adequate and uniform seeding depth is crucial for the homogeneous development of a crop, as it affects time of emergence and germination rate. The considerable depth variations observed during seeding operations - even for modern seed drills - are mainly caused by variability in soil resistance...

  15. Seedling vigor and genetic variability for rice seed, seedling emergence and seedling traits

    International Nuclear Information System (INIS)

    Ali, S.S.; Jafri, S.J.H.; Jamil, M.; Ijaz, M.

    1994-01-01

    Eleven local rice cultivars including Basmati 370 were evaluated for seedling vigor. Three groups of traits were evaluated viz; seed traits (Seed density, seed volume see weight, paddy length and grain length), seed emergence traits (emergence %, emergence index and emergence rate index), and seedling traits (fresh root length, dry root weight, emergence percentage, root length, dry root weight, seed weight and relative root weight were observed significant, respectively. Seed density, relative root weight, emergence rate index and root to shoot ratio were relatively more amenable to improvement. Relative expected genetic advance was the function of heritability and coefficient of phenotypic variability, latter being more important. (author)

  16. Variations in fatty acid composition, glucosinolate profile and some phytochemical contents in selected oil seed rape (Brassica napus L.) cultivars

    OpenAIRE

    Amin Mohamed, Amal; El-Din Saad El-Beltagi, Hossam

    2010-01-01

    Rapeseed (Brassica napus L.) is now the third most important source of edible oil in the world after soybean and palm oil. In this study seeds of five different rapeseed cultivars namely; pactol, silvo, topas, serw 4 and serw 6 were evaluated for their fatty acid composition, glucosinolate profile, amino acids, total tocopherols and phenolic content. Among all cultivars significant variability in fatty acids were observed. The oleic acid (C18:1) ranged from 56.31% to 58.67%, linoleic acid (C1...

  17. Comprehensive speciation of low-molecular weight selenium metabolites in mustard seeds using HPLC-electrospray linear trap/Orbitrap tandem mass spectrometry.

    Science.gov (United States)

    Ouerdane, Laurent; Aureli, Federica; Flis, Paulina; Bierla, Katarzyna; Preud'homme, Hugues; Cubadda, Francesco; Szpunar, Joanna

    2013-09-01

    An analytical methodology based on high-resolution high mass accuracy electrospray ionization (ESI) tandem MS assisted by Se-specific detection using inductively coupled plasma mass spectrometry (ICP MS) was developed for speciation of selenium (Se) in seeds of black mustard (Brassica nigra) grown on Se-rich soil. Size-exclusion LC-ICP MS allowed the determination of the Se distribution according to the molecular mass and the control of the species stability during extraction. The optimization of hydrophilic interaction of LC and cation-exchange HPLC resulted in analytical conditions making it possible to detect and characterize over 30 Se species using ESI MS, including a number of minor (<0.5%) metabolites. Selenoglucosinolates were found to be the most important class of species accounting for at least 15% of the total Se present and over 50% of all the metabolites. They were found particularly unstable during aqueous extraction leading to the loss of Se by volatilization as methylselenonitriles and methylselenoisothiocyanates identified using gas chromatography (GC) with the parallel ICP MS and atmospheric pressure chemical ionization (APCI) MS/MS detection. However, selenoglucosinolates could be efficiently recovered by extraction with 70% methanol. Other classes of identified species included selenoamino acids, selenosugars, selenosinapine and selenourea derivatives. The three types of reactions leading to the formation of selenometabolites were: the Se-S substitution in the metabolic pathway, oxidative reactions of -SeH groups with endogenous biomolecules, and chemical reactions, e.g., esterification, of Se-containing molecules and other biomolecules through functional groups not involving Se.

  18. Use of geographically weighted logistic regression to quantify spatial variation in the environmental and sociodemographic drivers of leptospirosis in Fiji: a modelling study

    Directory of Open Access Journals (Sweden)

    Helen J Mayfield, PhD

    2018-05-01

    Full Text Available Summary: Background: Leptospirosis is a globally important zoonotic disease, with complex exposure pathways that depend on interactions between human beings, animals, and the environment. Major drivers of outbreaks include flooding, urbanisation, poverty, and agricultural intensification. The intensity of these drivers and their relative importance vary between geographical areas; however, non-spatial regression methods are incapable of capturing the spatial variations. This study aimed to explore the use of geographically weighted logistic regression (GWLR to provide insights into the ecoepidemiology of human leptospirosis in Fiji. Methods: We obtained field data from a cross-sectional community survey done in 2013 in the three main islands of Fiji. A blood sample obtained from each participant (aged 1–90 years was tested for anti-Leptospira antibodies and household locations were recorded using GPS receivers. We used GWLR to quantify the spatial variation in the relative importance of five environmental and sociodemographic covariates (cattle density, distance to river, poverty rate, residential setting [urban or rural], and maximum rainfall in the wettest month on leptospirosis transmission in Fiji. We developed two models, one using GWLR and one with standard logistic regression; for each model, the dependent variable was the presence or absence of anti-Leptospira antibodies. GWLR results were compared with results obtained with standard logistic regression, and used to produce a predictive risk map and maps showing the spatial variation in odds ratios (OR for each covariate. Findings: The dataset contained location information for 2046 participants from 1922 households representing 81 communities. The Aikaike information criterion value of the GWLR model was 1935·2 compared with 1254·2 for the standard logistic regression model, indicating that the GWLR model was more efficient. Both models produced similar OR for the covariates, but

  19. Genetic variation of habitual coffee consumption and glycemic changes in response to weight-loss diet intervention: the Preventing Overweight Using Novel Dietary Strategies (POUNDS LOST) trial.

    Science.gov (United States)

    Han, Liyuan; Ma, Wenjie; Sun, Dianjianyi; Heianza, Yoriko; Wang, Tiange; Zheng, Yan; Huang, Tao; Duan, Donghui; Bray, J George A; Champagne, Catherine M; Sacks, Frank M; Qi, Lu

    2017-11-01

    Background: Coffee consumption has been associated with glucose metabolism and risk of type 2 diabetes. Objective: We examined whether the genetic variation determining habitual coffee consumption affected glycemic changes in response to weight-loss dietary intervention. Design: A genetic risk score (GRS) was calculated based on 8 habitual coffee consumption-associated single nucleotide polymorphisms. We used general linear models to test changes in glycemic traits in groups randomly assigned to high- and low-fat diets according to tertiles of the GRS. Results: We observed significant interactions between the GRS and low compared with high dietary fat intake on 6-mo changes in fasting insulin and homeostasis model assessment of insulin resistance (HOMA-IR) ( P -interaction = 0.023 and 0.022, respectively), adjusting for age, sex, race, physical activity, smoking, alcohol, seasonal variation, and baseline values of the respective outcomes. Participants with a higher GRS of habitual coffee consumption showed a greater reduction in fasting insulin and a marginally greater decrease in HOMA-IR in the low-fat diet intervention group. Conclusions: Our data suggest that participants with genetically determined high coffee consumption may benefit more by eating a low-fat diet in improving fasting insulin and HOMA-IR in a short term. This trial was registered at clinicaltrials.gov as NCT00072995 and NCT03258203. © 2017 American Society for Nutrition.

  20. Seed yield and agronomic parameters of cowpea (Vigna ...

    African Journals Online (AJOL)

    Jane

    2011-10-12

    Oct 12, 2011 ... 1Department of Field Crops, Faculty of Agriculture, Bozok University, Sivas ... Key words: Vigna unguiculata, seed yield, thousand seed weight, Black Sea. INTRODUCTION. The cowpea (Vigna unguiculata L.) is an important.

  1. Does apricot seeds consumption cause changes in human urine?

    Directory of Open Access Journals (Sweden)

    Eva Tušimová

    2017-01-01

    Full Text Available Natural substances, such as amygdalin, used in alternative medicine gained high popularity. Common people as well as patients with different diseases have almost unlimited access to various natural supplements. To protect human health, it is very important to study effect of these substances. Amygdalin is a cyanogenic glucoside derived from seeds of rosaceous plants, for example seeds of bitter almonds (Prunus dulcis, or apricot, cherry, apple, peach, plum, etc. It is a natural product that owns antitumor activity, it has also been used for the treatment of asthma, bronchitis, emphysema, leprosy and diabetes and produces a kind of antitussive and antiasthmatic effects. The present in vivo study was designed to reveal whether amygdalin in apricot seeds has got an effect on human urine composition, pH value and urine associated health status after six weeks of oral administration. The study group finally consisted of 34 healthy adult volunteers (21 females and 13 males. All participants were asked to consume 60 mg.kg-1 body weight of bitter apricot seeds daily (approximately 3.0 mg.kg-1 of amygdalin during 6 weeks. During the experiment, three urine collections were carried out (first collection - at the beginning of the experiment; second collection - after 21 days; third collection - after 42 days. Quantification of urine calcium (Ca, magnesium (Mg, phosphorus (P, sodium (Na, potassium (K, chlorides (Cl-, urea and pH value after apricot seeds supplementation was performed. Statistical analysis of variance showed, that consumption of bitter apricot seeds during 42 days had a significant (p <0.01 effect on amount of calcium excreted in urine, though this decrease shifted its level from elevated mean value in control collection into normal physiological range. Significant changes were observed in urea (p <0.05 and phosphorus (p <0.01 levels in urine after apricot seed ingestion, but gender was also considered to be a source of their variation.

  2. Rapid evaluation of seed vigor by the absolute content of protein in seed within the same crop.

    Science.gov (United States)

    Wen, Daxing; Hou, Hongcun; Meng, Aiju; Meng, Jie; Xie, Liuyong; Zhang, Chunqing

    2018-04-03

    Seed vigor, an important index of seed quality, determines the potential for rapid and uniform emergence of plants. The objective of this study was to explore a rapid method for evaluating seed vigor. To analyze the correlation of seed traits and seedling traits related to seed vigor, we designed five experiments including nitrogen fertilizer, irrigation and seed sorting treatments in wheat. The results showed that only the absolute content of protein (ACP) in wheat seed was significantly correlated with plant dry weight in five experiments. Subsequently, another experiment including 30 wheat seed lots was used to validate the above results. Although 100-grain weight was also correlated with plant dry weight (R = 0.799, p vigor and could potentially be used for processing and screening high vigor seeds.

  3. Composicion y variabilidad espacialdel banco de semillas de malezas en un area agricolade azul (Argentina Composition and spatial variation of a weed seed bank on an agricultural area in Azul, Argentina

    Directory of Open Access Journals (Sweden)

    Eduardo Requesens

    1999-08-01

    characterize the weed seed bank of such area in a global way. The whole rank of seed density and the relative abundance distribution and spatial design of species were analyzed. The basic information was obtained applying the germination technique to soil samples corresponding to 20 sites on a regional transect of 14 km. The seed density rank for the study area was 1173-44000 seeds/m2, and 33 species were recorded. Digitaria sanguinalis is the predominant species with 43 % of the seed bank, followed by Polygonum aviculare with 15 %. Both species together with Anagallis arvensis and Setaria viridis constitute the 70 % of the seed bank. The spatial distribution of species along the transect showed a variable aggregation degree, recording a significant positive correlation between the contribution to seed bank and the variance/mean ratio. This correlation demostrates that the most abundant species show a greater spatial variation, although different distribution patterns were observed.

  4. Myrmecochory and short-term seed fate in Rhamnus alaternus: Ant species and seed characteristics

    Science.gov (United States)

    Bas, J. M.; Oliveras, J.; Gómez, C.

    2009-05-01

    Benefits conferred on plants in ant-mediated seed dispersal mutualisms (myrmecochory) depend on the fate of transported seeds. We studied the effects of elaiosome presence, seed size and seed treatment (with and without passage through a bird's digestive tract) on short-term seed fate in Rhamnus alaternus. In our study, we define short-term seed, or initial, seed fate, as the location where ants release the seeds after ant contact with it. The elaiosomes had the most influence on short-term fate, i.e. whether or not seeds were transported to the nest. The workers usually transported big seeds more often than small ones, but small ants did not transport large seeds. Effect of seed size on transport depended on the ant species and on the treatment of the seed (manual extraction simulating a direct fall from the parent plant vs. bird deposition corresponding to preliminary primary dispersal). Probability of removal of elaiosome-bearing seeds to the nest by Aphaenogaster senilis increased with increasing seed weight.

  5. IGOB131, a novel seed extract of the West African plant Irvingia gabonensis, significantly reduces body weight and improves metabolic parameters in overweight humans in a randomized double-blind placebo controlled investigation

    Directory of Open Access Journals (Sweden)

    Mbofung Carl MF

    2009-03-01

    Full Text Available Abstract Background A recent in vitro study indicates that IGOB131, a novel seed extract of the traditional West African food plant Irvingia gabonensis, favorably impacts adipogenesis through a variety of critical metabolic pathways including PPAR gamma, leptin, adiponectin, and glycerol-3 phosphate dehydrogenase. This study was therefore aimed at evaluating the effects of IGOB131, an extract of Irvingia gabonensis, on body weight and associated metabolic parameters in overweight human volunteers. Methods The study participants comprised of 102 healthy, overweight and/or obese volunteers (defined as BMI > 25 kg/m2 randomly divided into two groups. The groups received on a daily basis, either 150 mg of IGOB131 or matching placebo in a double blinded fashion, 30–60 minutes before lunch and dinner. At baseline, 4, 8 and 10 weeks of the study, subjects were evaluated for changes in anthropometrics and metabolic parameters to include fasting lipids, blood glucose, C-reactive protein, adiponectin, and leptin. Results Significant improvements in body weight, body fat, and waist circumference as well as plasma total cholesterol, LDL cholesterol, blood glucose, C-reactive protein, adiponectin and leptin levels were observed in the IGOB131 group compared with the placebo group. Conclusion Irvingia gabonensis administered 150 mg twice daily before meals to overweight and/or obese human volunteers favorably impacts body weight and a variety of parameters characteristic of the metabolic syndrome. This is the first double blind randomized placebo controlled clinical trial regarding the anti-obesity and lipid profile modulating effects of an Irvingia gabonensis extract. The positive clinical results, together with our previously published mechanisms of gene expression modulation related to key metabolic pathways in lipid metabolism, provide impetus for much larger clinical studies. Irvingia gabonensis extract may prove to be a useful tool in dealing with the

  6. Quantitative weight of evidence assessment of risk to honeybee colonies from use of imidacloprid, clothianidin, and thiamethoxam as seed treatments: a postscript.

    Science.gov (United States)

    Solomon, Keith R; Stephenson, Gladys L

    2017-01-01

    This paper is a postscript to the four companion papers in this issue of the Journal (Solomon and Stephenson 2017a , 2017b ; Stephenson and Solomon 2017a , 2017b ). The first paper in the series described the conceptual model and the methods of the QWoE process. The other three papers described the application of the QWoE process to studies on imidacloprid (IMI), clothianidin (CTD), and thiamethoxam (TMX). This postscript was written to summarize the utility of the methods used in the quantitative weight of evidence (QWoE), the overall relevance of the results, and the environmental implications of the findings. Hopefully, this will be helpful to others who wish to conduct QWoEs and use these methods in assessment of risks.

  7. Genetic diversity of dispersed seeds is highly variable among leks of the long-wattled umbrellabird

    Science.gov (United States)

    Ottewell, Kym; Browne, Luke; Cabrera, Domingo; Olivo, Jorge; Karubian, Jordan

    2018-01-01

    Frugivorous animals frequently generate clumped distributions of seeds away from source trees, but genetic consequences of this phenomenon remain poorly resolved. Seed dispersal of the palm Oenocarpus bataua by long-wattled umbrellabirds Cephalopterus penduliger generates high seed densities in leks (i.e., multi-male display sites), providing a suitable venue to investigate how dispersal by this frugivore may influence seed source diversity and genetic structure at local and landscape levels. We found moderate levels of maternal seed source diversity in primary seed rain across five leks in northwest Ecuador (unweighted mean alpha diversity α = 9.52, weighted mean αr = 3.52), with considerable variation among leks (αr range: 1.81-24.55). Qualitatively similar findings were obtained for allelic diversity and heterozygosity. Higher densities of O. bataua adults around leks were associated with higher values of αr and heterozygosity (non-significant trends) and allelic diversity (significant correlation). Seed source overlap between different leks was not common but did occur at low frequency, providing evidence for long-distance seed dispersal by umbrellabirds into leks. Our findings are consistent with the idea that seed pool diversity within leks may be shaped by the interaction between density of local trees, which can vary considerably between leks, and umbrellabird foraging ecology, particularly a lack of territorial defense of fruiting trees. Taken as a whole, this work adds to our growing appreciation of the ways resource distribution and associated frugivore foraging behaviors mechanistically shape seed dispersal outcomes and the distribution of plant genotypes across the landscape.

  8. High-throughput phenotyping (HTP) identifies seedling root traits linked to variation in seed yield and nutrient capture in field-grown oilseed rape (Brassica napus L.).

    Science.gov (United States)

    Thomas, C L; Graham, N S; Hayden, R; Meacham, M C; Neugebauer, K; Nightingale, M; Dupuy, L X; Hammond, J P; White, P J; Broadley, M R

    2016-04-06

    Root traits can be selected for crop improvement. Techniques such as soil excavations can be used to screen root traits in the field, but are limited to genotypes that are well-adapted to field conditions. The aim of this study was to compare a low-cost, high-throughput root phenotyping (HTP) technique in a controlled environment with field performance, using oilseed rape (OSR;Brassica napus) varieties. Primary root length (PRL), lateral root length and lateral root density (LRD) were measured on 14-d-old seedlings of elite OSR varieties (n = 32) using a 'pouch and wick' HTP system (∼40 replicates). Six field experiments were conducted using the same varieties at two UK sites each year for 3 years. Plants were excavated at the 6- to 8-leaf stage for general vigour assessments of roots and shoots in all six experiments, and final seed yield was determined. Leaves were sampled for mineral composition from one of the field experiments. Seedling PRL in the HTP system correlated with seed yield in four out of six (r = 0·50, 0·50, 0·33, 0·49;P emergence in three out of five (r = 0·59, 0·22, 0·49;P emergence, general early vigour or yield in the field. Associations between PRL and field performance are generally related to early vigour. These root traits might therefore be of limited additional selection value, given that vigour can be measured easily on shoots/canopies. In contrast, LRD cannot be assessed easily in the field and, if LRD can improve nutrient uptake, then it may be possible to use HTP systems to screen this trait in both elite and more genetically diverse, non-field-adapted OSR. © The Author 2016. Published by Oxford University Press on behalf of the Annals of Botany Company.

  9. Efficient computation of spaced seeds

    Directory of Open Access Journals (Sweden)

    Ilie Silvana

    2012-02-01

    Full Text Available Abstract Background The most frequently used tools in bioinformatics are those searching for similarities, or local alignments, between biological sequences. Since the exact dynamic programming algorithm is quadratic, linear-time heuristics such as BLAST are used. Spaced seeds are much more sensitive than the consecutive seed of BLAST and using several seeds represents the current state of the art in approximate search for biological sequences. The most important aspect is computing highly sensitive seeds. Since the problem seems hard, heuristic algorithms are used. The leading software in the common Bernoulli model is the SpEED program. Findings SpEED uses a hill climbing method based on the overlap complexity heuristic. We propose a new algorithm for this heuristic that improves its speed by over one order of magnitude. We use the new implementation to compute improved seeds for several software programs. We compute as well multiple seeds of the same weight as MegaBLAST, that greatly improve its sensitivity. Conclusion Multiple spaced seeds are being successfully used in bioinformatics software programs. Enabling researchers to compute very fast high quality seeds will help expanding the range of their applications.

  10. [Seed quality test methods of Paeonia suffruticosa].

    Science.gov (United States)

    Cao, Ya-Yue; Zhu, Zai-Biao; Guo, Qiao-Sheng; Liu, Li; Wang, Chang-Lin

    2014-11-01

    In order to optimize the testing methods for Paeonia suffruticosa seed quality, and provide basis for establishing seed testing rules and seed quality standard of P. suffruticosa. The seed quality of P. suffruticosa from different producing areas was measured based on the related seed testing regulations. The seed testing methods for quality items of P. suffruticosa was established preliminarily. The samples weight of P. suffruticosa was at least 7 000 g for purity analysis and was at least 700 g for test. The phenotypic observation and size measurement were used for authenticity testing. The 1 000-seed weight was determined by 100-seed method, and the water content was carried out by low temperature drying method (10 hours). After soaking in distilled water for 24 h, the seeds was treated with different temperature stratifications of day and night (25 degrees C/20 degrees C, day/night) in the dark for 60 d. After soaking in the liquor of GA3 300 mg x L(-1) for 24 h, the P. suffruticos seeds were cultured in wet sand at 15 degrees C for 12-60 days for germination testing. Seed viability was tested by TlC method.

  11. Wheat seed enhancement by vitamin and hormonal priming

    International Nuclear Information System (INIS)

    Khan, M.B.; Gurchani, M.A.; Hussain, M.

    2011-01-01

    Seed priming has proven beneficial in many important agricultural crops. The present study was conducted to explore the role (if any) of hormonal and vitamin seed priming to improve the germination, seedling emergence, early seedling establishment, electrolyte leakage and nutrients uptake in wheat seedlings. The wheat seeds were soaked for 48 hours in aerated solution of salicylic acid, ascorbic acid, kinetin and GA3 with 20 ppm concentration of each solution, whereas untreated seeds were taken as control. Seed priming with ascorbic acid resulted in maximum final germination and emergence percentage (FGP and FEP), radical and plumule length, root and shoot length, number of secondary roots, root shoot ratio, root dry weight, shoot dry weight and seedling dry weight compared to control (untreated seeds). Minimum mean germination and emergence time (MGT and MET) was recorded in seeds primed with kinetin and GA3. While in case of biochemical attributes, seedling potassium contents were decreased by hormonal seed priming while total soluble sugars were increased by salicylic acid and ascorbic acid seed priming. Hormonal seed priming had non-significant effect on phosphorus seedling contents. Untreated (Control) seeds showed maximum electrical conductivity at 0.5, 1, 2, 6, 12 and 24 h after inbibition than primed seeds against the minimum electrical conductivity that was recorded in seeds primed with salicylic acid and ascorbic acid. In conclusion, the wheat seeds primed with 20 ppm solution of ascorbic acid may be used for wheat seed invigoration. (author)

  12. Diffusion weighted imaging of the normal breast: reproducibility of apparent diffusion coefficient measurements and variation with menstrual cycle and menopausal status

    International Nuclear Information System (INIS)

    O'Flynn, Elizabeth A.M.; Morgan, Veronica A.; Giles, Sharon L.; de Souza, Nandita M.

    2012-01-01

    To establish the reproducibility of apparent diffusion coefficient (ADC) measurements in normal fibroglandular breast tissue and to assess variation in ADC values with phase of the menstrual cycle and menopausal status. Thirty-one volunteers (13 premenopausal, 18 postmenopausal) underwent magnetic resonance twice (interval 11-22 days) using diffusion-weighted MRI. ADC total and a perfusion-insensitive ADC high (omitting b = 0) were calculated. Reproducibility and inter-observer variability of mean ADC values were assessed. The difference in mean ADC values between the two phases of the menstrual cycle and the postmenopausal breast were evaluated. ADC total and ADC high showed good reproducibility (r% = 17.6, 22.4). ADC high showed very good inter-observer agreement (kappa = 0.83). The intraclass correlation coefficients (ICC) were 0.93 and 0.91. Mean ADC values were significantly lower in the postmenopausal breast (ADC total 1.46 ± 0.3 x 10 -3 mm 2 /s, ADC high 1.33 ± 0.3 x 10 -3 mm 2 /s) compared with the premenopausal breast (ADC total 1.84 ± 0.26 x 10 -3 mm 2 /s, ADC high 1.77 ± 0.26 x 10 -3 mm 2 /s; both P total P = 0.2, ADC high P = 0.24) or between postmenopausal women taking or not taking oestrogen supplements (ADC total P = 0.6, ADC high P = 0.46). ADC values in fibroglandular breast tissue are reproducible. Lower ADC values within the postmenopausal breast may reduce diffusion-weighted contrast and have implications for accurately detecting tumours. (orig.)

  13. Diffusion weighted imaging of the normal breast: reproducibility of apparent diffusion coefficient measurements and variation with menstrual cycle and menopausal status

    Energy Technology Data Exchange (ETDEWEB)

    O' Flynn, Elizabeth A.M.; Morgan, Veronica A.; Giles, Sharon L. [Cancer Research UK and ESPSRC Cancer Imaging Centre, Clinical Magnetic Resonance Group, Surrey (United Kingdom); deSouza, Nandita M. [Royal Marsden NHS Foundation Trust, Clinical Magnetic Resonance Group, Institute of Cancer Research, Surrey (United Kingdom)

    2012-07-15

    To establish the reproducibility of apparent diffusion coefficient (ADC) measurements in normal fibroglandular breast tissue and to assess variation in ADC values with phase of the menstrual cycle and menopausal status. Thirty-one volunteers (13 premenopausal, 18 postmenopausal) underwent magnetic resonance twice (interval 11-22 days) using diffusion-weighted MRI. ADC{sub total} and a perfusion-insensitive ADC{sub high} (omitting b = 0) were calculated. Reproducibility and inter-observer variability of mean ADC values were assessed. The difference in mean ADC values between the two phases of the menstrual cycle and the postmenopausal breast were evaluated. ADC{sub total} and ADC{sub high} showed good reproducibility (r% = 17.6, 22.4). ADC{sub high} showed very good inter-observer agreement (kappa = 0.83). The intraclass correlation coefficients (ICC) were 0.93 and 0.91. Mean ADC values were significantly lower in the postmenopausal breast (ADC{sub total} 1.46 {+-} 0.3 x 10{sup -3} mm{sup 2}/s, ADC{sub high} 1.33 {+-} 0.3 x 10{sup -3} mm{sup 2}/s) compared with the premenopausal breast (ADC{sub total} 1.84 {+-} 0.26 x 10{sup -3} mm{sup 2}/s, ADC{sub high} 1.77 {+-} 0.26 x 10{sup -3} mm{sup 2}/s; both P < 0.001). No significant difference was seen in ADC values in relation to menstrual cycle (ADC{sub total} P = 0.2, ADC{sub high} P = 0.24) or between postmenopausal women taking or not taking oestrogen supplements (ADC{sub total} P = 0.6, ADC{sub high} P = 0.46). ADC values in fibroglandular breast tissue are reproducible. Lower ADC values within the postmenopausal breast may reduce diffusion-weighted contrast and have implications for accurately detecting tumours. (orig.)

  14. Factors associated with inter-institutional variations in sepsis rates of very-low-birth-weight infants in 34 Malaysian neonatal intensive care units.

    Science.gov (United States)

    Boo, Nem-Yun; Cheah, Irene Guat-Sim

    2016-03-01

    This study aimed to determine whether patient loads, infant status on admission and treatment interventions were significantly associated with inter-institutional variations in sepsis rates in very-low-birth-weight (VLBW) infants in the Malaysian National Neonatal Registry (MNNR). This was a retrospective study of 3,880 VLBW (≤ 1,500 g) infants admitted to 34 neonatal intensive care units (NICUs) in the MNNR. Sepsis was diagnosed in symptomatic infants with positive blood culture. Sepsis developed in 623 (16.1%) infants; 61 (9.8%) had early-onset sepsis (EOS) and 562 (90.2%) had late-onset sepsis (LOS). The median EOS rate of all NICUs was 1.0% (interquartile range [IQR] 0%, 2.0%). Compared with NICUs reporting no EOS (n = 14), NICUs reporting EOS (n = 20) had significantly higher patient loads (total live births, admissions, VLBW infants, outborns); more mothers with a history of abortions, and antenatal steroids and intrapartum antibiotic use; more infants requiring resuscitation procedures at birth; higher rates of surfactant therapy, pneumonia and insertion of central venous catheters. The median LOS rate of all NICUs was 14.5% (IQR 7.8%, 19.2%). Compared with NICUs with LOS rates below the first quartile (n = 8), those above the third quartile (n = 8) used less intrapartum antibiotics, and had significantly bigger and more mature infants, more outborns, as well as a higher number of sick infants requiring ventilator support and total parenteral nutrition. Patient loads, resuscitation at birth, status of infants on admission and treatment interventions were significantly associated with inter-institutional variations in sepsis. Copyright: © Singapore Medical Association.

  15. Rapid Gene Turnover as a Significant Source of Genetic Variation in a Recently Seeded Population of a Healthcare-Associated Pathogen

    Directory of Open Access Journals (Sweden)

    Lucía Graña-Miraglia

    2017-09-01

    Full Text Available Genome sequencing has been useful to gain an understanding of bacterial evolution. It has been used for studying the phylogeography and/or the impact of mutation and recombination on bacterial populations. However, it has rarely been used to study gene turnover at microevolutionary scales. Here, we sequenced Mexican strains of the human pathogen Acinetobacter baumannii sampled from the same locale over a 3 year period to obtain insights into the microevolutionary dynamics of gene content variability. We found that the Mexican A. baumannii population was recently founded and has been emerging due to a rapid clonal expansion. Furthermore, we noticed that on average the Mexican strains differed from each other by over 300 genes and, notably, this gene content variation has accrued more frequently and faster than the accumulation of mutations. Moreover, due to its rapid pace, gene content variation reflects the phylogeny only at very short periods of time. Additionally, we found that the external branches of the phylogeny had almost 100 more genes than the internal branches. All in all, these results show that rapid gene turnover has been of paramount importance in producing genetic variation within this population and demonstrate the utility of genome sequencing to study alternative forms of genetic variation.

  16. Activity uniformity of Ir-192 seeds

    International Nuclear Information System (INIS)

    Ling, C.C.; Gromadzki, Z.C.

    1981-01-01

    A simple device that uses materials and apparatus commonly available in a radiotherapy department has been designed, fabricated and used in routine quality control relative to the activity uniformity of clinical Ir-192 seeds in ribbons. Detailed evaluation indicated that this system is easy to use and can yield relative activity measurements of individual Ir-192 seeds accurate to within 2%. With this device, activity uniformity of commercial Ir-192 seeds from two manufacturers has been assessed. For the seven shipments of Ir-192 seeds studied, the root mean square variations of individual seed strength from the average of each shipment ranged from 3.4 to 7.1%. Variation in seed activity by more than +- 10% from the average is not uncommon

  17. Use of geographically weighted logistic regression to quantify spatial variation in the environmental and sociodemographic drivers of leptospirosis in Fiji: a modelling study.

    Science.gov (United States)

    Mayfield, Helen J; Lowry, John H; Watson, Conall H; Kama, Mike; Nilles, Eric J; Lau, Colleen L

    2018-05-01

    Leptospirosis is a globally important zoonotic disease, with complex exposure pathways that depend on interactions between human beings, animals, and the environment. Major drivers of outbreaks include flooding, urbanisation, poverty, and agricultural intensification. The intensity of these drivers and their relative importance vary between geographical areas; however, non-spatial regression methods are incapable of capturing the spatial variations. This study aimed to explore the use of geographically weighted logistic regression (GWLR) to provide insights into the ecoepidemiology of human leptospirosis in Fiji. We obtained field data from a cross-sectional community survey done in 2013 in the three main islands of Fiji. A blood sample obtained from each participant (aged 1-90 years) was tested for anti-Leptospira antibodies and household locations were recorded using GPS receivers. We used GWLR to quantify the spatial variation in the relative importance of five environmental and sociodemographic covariates (cattle density, distance to river, poverty rate, residential setting [urban or rural], and maximum rainfall in the wettest month) on leptospirosis transmission in Fiji. We developed two models, one using GWLR and one with standard logistic regression; for each model, the dependent variable was the presence or absence of anti-Leptospira antibodies. GWLR results were compared with results obtained with standard logistic regression, and used to produce a predictive risk map and maps showing the spatial variation in odds ratios (OR) for each covariate. The dataset contained location information for 2046 participants from 1922 households representing 81 communities. The Aikaike information criterion value of the GWLR model was 1935·2 compared with 1254·2 for the standard logistic regression model, indicating that the GWLR model was more efficient. Both models produced similar OR for the covariates, but GWLR also detected spatial variation in the effect of each

  18. Variations and Determinants of Mortality and Length of Stay of Very Low Birth Weight and Very Low for Gestational Age Infants in Seven European Countries.

    Science.gov (United States)

    Fatttore, Giovanni; Numerato, Dino; Peltola, Mikko; Banks, Helen; Graziani, Rebecca; Heijink, Richard; Over, Eelco; Klitkou, Søren Toksvig; Fletcher, Eilidh; Mihalicza, Péter; Sveréus, Sofia

    2015-12-01

    The EuroHOPE very low birth weight and very low for gestational age infants study aimed to measure and explain variation in mortality and length of stay (LoS) in the populations of seven European nations (Finland, Hungary, Italy (only the province of Rome), the Netherlands, Norway, Scotland and Sweden). Data were linked from birth, hospital discharge and mortality registries. For each infant basic clinical and demographic information, infant mortality and LoS at 1 year were retrieved. In addition, socio-economic variables at the regional level were used. Results based on 16,087 infants confirm that gestational age and Apgar score at 5 min are important determinants of both mortality and LoS. In most countries, infants admitted or transferred to third-level hospitals showed lower probability of death and longer LoS. In the meta-analyses, the combined estimates show that being male, multiple births, presence of malformations, per capita income and low population density are significant risk factors for death. It is essential that national policies improve the quality of administrative datasets and address systemic problems in assigning identification numbers at birth. European policy should aim at improving the comparability of data across jurisdictions. Copyright © 2015 John Wiley & Sons, Ltd.

  19. seed oil

    African Journals Online (AJOL)

    Wara

    Neem seed oil from the neem tree (Azadiracta indica) finds wide usage one of which is its utilization for cosmetics particularly .... obtained which is higher than that of olive oil 17. mgKOH/g (Davine ... The skin tolerance of shea fat employed as ...

  20. Autoradiography for iodine-125 seeds

    International Nuclear Information System (INIS)

    Alberti, W.; Divoux, S.; Pothmann, B.; Tabor, P.; Hermann, K.P.; Harder, D.

    1993-01-01

    To study the interior design of model 6702 and 6711 iodine-125 seeds, contact autoradiographs were performed using mammography film. Improved resolution was obtained using a pin-hole camera with a hole of 0.1 mm x 0.1 mm. With these techniques, qualitative determination of the relative activity distribution within each seed was possible. The number of the activated resin spheres and the positions of the centers of these spheres can be exactly determined. A model calculation shows that variations in the arrangement of the activated spheres within a seed have a moderate influence on the dose distribution at source distances below 10 mm. Knowing the exact source configuration may be useful when comparing dose calculations with measured data for model 6702 125 I seeds which are currently employed in ophthalmic plaque and implant therapy of other tumors. 16 refs., 5 figs., 2 tabs

  1. The role of seed priming in improving seed germination and ...

    African Journals Online (AJOL)

    win7

    2013-11-13

    Nov 13, 2013 ... As a result, fresh and dry weights of shoot and root were improved. Seed priming alleviated the inhibitory effect of salt stress on germination and seedling growth of maize under salt stress. ... Salinization is more spreading in irrigated lands because of inappropriate management of irrigation and drainage.

  2. [Testing methods for seed quality of Bletilla striata].

    Science.gov (United States)

    Zhang, Zhi-Hui; Liu, Da-Hui; Zhu, Xin-Yan; Ji, Peng-Zhang; Wang, Li; Shi, Ya-Na; Ma, Cong-Ji

    2016-06-01

    In order to provide a basis for establishing seed testing rules and seed quality standard of Bletilla striata, the seed quality of B.striata from different producing area was measured referring to the Rules for Agricultural Seed Testing(GB/T 3543-1995).The results showed that the seeds of B.striata passed through 20-mesh sieve for purity analysis.The weight of seeds was measured by 1000-seed method and the water content was measured at the higher temperature (133±2) ℃ for 3 hours.The seeds were cultured on the wet filter paper at 30 ℃ for 4-20 days in light for germination testing.The method of testing seed viability was that seeds were dipped into 1% TTC solution for 7 hours at temperature of 40 ℃. Copyright© by the Chinese Pharmaceutical Association.

  3. Genetic Basis of Variation in Rice Seed Storage Protein (Albumin, Globulin, Prolamin, and Glutelin) Content Revealed by Genome-Wide Association Analysis.

    Science.gov (United States)

    Chen, Pingli; Shen, Zhikang; Ming, Luchang; Li, Yibo; Dan, Wenhan; Lou, Guangming; Peng, Bo; Wu, Bian; Li, Yanhua; Zhao, Da; Gao, Guanjun; Zhang, Qinglu; Xiao, Jinghua; Li, Xianghua; Wang, Gongwei; He, Yuqing

    2018-01-01

    Rice seed storage protein (SSP) is an important source of nutrition and energy. Understanding the genetic basis of SSP content and mining favorable alleles that control it will be helpful for breeding new improved cultivars. An association analysis for SSP content was performed to identify underlying genes using 527 diverse Oryza sativa accessions grown in two environments. We identified more than 107 associations for five different traits, including the contents of albumin (Alb), globulin (Glo), prolamin (Pro), glutelin (Glu), and total SSP (Total). A total of 28 associations were located at previously reported QTLs or intervals. A lead SNP sf0709447538, associated for Glu content in the indica subpopulation in 2015, was further validated in near isogenic lines NIL(Zhenshan97) and NIL(Delong208), and the Glu phenotype had significantly difference between two NILs. The association region could be target for map-based cloning of the candidate genes. There were 13 associations in regions close to grain-quality-related genes; five lead single nucleotide polymorphisms (SNPs) were located less than 20 kb upstream from grain-quality-related genes ( PG5a , Wx , AGPS2a , RP6 , and, RM1 ). Several starch-metabolism-related genes ( AGPS2a , OsACS6 , PUL , GBSSII , and ISA2 ) were also associated with SSP content. We identified favorable alleles of functional candidate genes, such as RP6 , RM1 , Wx , and other four candidate genes by haplotype analysis and expression pattern. Genotypes of RP6 and RM1 with higher Pro were not identified in japonica and exhibited much higher expression levels in indica group. The lead SNP sf0601764762, repeatedly detected for Alb content in 2 years in the whole association population, was located in the Wx locus that controls the synthesis of amylose. And Alb content was significantly and negatively correlated with amylose content and the level of 2.3 kb Wx pre-mRNA examined in this study. The associations or candidate genes identified would

  4. Genetic Basis of Variation in Rice Seed Storage Protein (Albumin, Globulin, Prolamin, and Glutelin Content Revealed by Genome-Wide Association Analysis

    Directory of Open Access Journals (Sweden)

    Pingli Chen

    2018-05-01

    Full Text Available Rice seed storage protein (SSP is an important source of nutrition and energy. Understanding the genetic basis of SSP content and mining favorable alleles that control it will be helpful for breeding new improved cultivars. An association analysis for SSP content was performed to identify underlying genes using 527 diverse Oryza sativa accessions grown in two environments. We identified more than 107 associations for five different traits, including the contents of albumin (Alb, globulin (Glo, prolamin (Pro, glutelin (Glu, and total SSP (Total. A total of 28 associations were located at previously reported QTLs or intervals. A lead SNP sf0709447538, associated for Glu content in the indica subpopulation in 2015, was further validated in near isogenic lines NIL(Zhenshan97 and NIL(Delong208, and the Glu phenotype had significantly difference between two NILs. The association region could be target for map-based cloning of the candidate genes. There were 13 associations in regions close to grain-quality-related genes; five lead single nucleotide polymorphisms (SNPs were located less than 20 kb upstream from grain-quality-related genes (PG5a, Wx, AGPS2a, RP6, and, RM1. Several starch-metabolism-related genes (AGPS2a, OsACS6, PUL, GBSSII, and ISA2 were also associated with SSP content. We identified favorable alleles of functional candidate genes, such as RP6, RM1, Wx, and other four candidate genes by haplotype analysis and expression pattern. Genotypes of RP6 and RM1 with higher Pro were not identified in japonica and exhibited much higher expression levels in indica group. The lead SNP sf0601764762, repeatedly detected for Alb content in 2 years in the whole association population, was located in the Wx locus that controls the synthesis of amylose. And Alb content was significantly and negatively correlated with amylose content and the level of 2.3 kb Wx pre-mRNA examined in this study. The associations or candidate genes identified would provide

  5. Diffusion-weighted MR imaging of the normal pancreas: reproducibility and variations of apparent diffusion coefficient measurement at 1.5- and 3.0-Tesla.

    Science.gov (United States)

    Barral, M; Soyer, P; Ben Hassen, W; Gayat, E; Aout, M; Chiaradia, M; Rahmouni, A; Luciani, A

    2013-04-01

    To evaluate reproducibility and variations in apparent diffusion coefficient (ADC) measurement in normal pancreatic parenchyma at 1.5- and 3.0-Tesla and determine if differences may exist between the four pancreatic segments. Diffusion-weighted MR imaging of the pancreas was performed at 1.5-Tesla in 20 patients and at 3.0-Tesla in other 20 patients strictly matched for gender and age using the same b values (0, 400 and 800s/mm(2)). Two independent observers placed regions of interest within the four pancreatic segments to measure ADC at both fields. Intra- and inter-observer agreement in ADC measurement was assessed using Bland-Altman analysis and comparison between ADC values obtained at both fields using non-parametrical tests. There were no significant differences in ADC between repeated measurements and between ADC obtained at 1.5-Tesla and those at 3.0-Tesla. The 95% limits of intra-observer agreement between ADC were 2.3%-22.7% at 1.5-Tesla and 1%-24.2% at 3.0-Tesla and those for inter-observer agreement between 1.9%-14% at 1.5-Tesla and 8%-25% at 3.0-Tesla. ADC values were similar in all pancreatic segments at 3.0-T whereas the tail had lower ADC at 1.5-Tesla. ADC measurement conveys high degrees of intra- and inter-observer reproducibility. ADC have homogeneous distribution among the four pancreatic segments at 3.0-Tesla. Copyright © 2012 Éditions françaises de radiologie. Published by Elsevier Masson SAS. All rights reserved.

  6. Seed source, seed traits, and frugivore habits: Implications for dispersal quality of two sympatric primates.

    Science.gov (United States)

    Benítez-Malvido, Julieta; González-Di Pierro, Ana Ma; Lombera, Rafael; Guillén, Susana; Estrada, Alejandro

    2014-06-01

    • Premise of the study: Frugivore selection of fruits and treatment of seeds together with seed deposition site are crucial for the population dynamics of vertebrate-dispersed plants. However, frugivore species may influence dispersal quality differently even when feeding on the same fruit species and, while animals disperse some seeds, others simply fall beneath the parent plant.• Methods: In southern Mexico, we investigated to see if within-species seed traits (i.e., length, width, weight, and volume) and germination success differed according to seed source. For five tropical tree species we obtained ingested seeds from two sources, howler monkey (Alouatta pigra) and spider monkey (Ateles geoffroyi) feces; and noningested seeds from two sources, the ground and tree crowns (with predispersed seeds used as control).• Key results: A principal components' analysis showed that traits of seeds ingested by howler monkeys differed from other sources while seeds ingested by spider monkeys were similar to noningested seeds. Howlers consumed on average the larger seeds in Ampelocera hottlei, Brosimum lactescens, and Dialium guianense. Both primate species consumed the smaller seeds in Spondias mombin, while no seed trait differences among seed sources were found in Spondias radlkoferi. For all five tree species, germination rate was greatest for seeds ingested by howler monkeys.• Conclusions: For the studied plant species, seed ingestion by howler monkeys confers higher dispersal quality than ingestion by spider monkeys or nondispersal. Dispersal services of both primate species, however, are not redundant and may contribute to germination heterogeneity within plant populations in tropical forests. © 2014 Botanical Society of America, Inc.

  7. HARVEST SEASON AND PHYSIOLOGICAL QUALITY OF ENTEROLOBIUM SCHOMBURGKII SEEDS. BENTH.

    Directory of Open Access Journals (Sweden)

    P. A. Mojena

    2016-09-01

    Full Text Available The objective of this research was to evaluate the physiological quality of seeds Enterolobium shomburgkii collected in different months of the year 2014. There were made fruit harvests from trees located in the urban area of Sinop-MT, in the months of June, July, August and September. In each crop was rated the number of seeds per fruit, weight of 1,000 seeds, water content of the seeds, dry weight, germination percentage, germination speed index and it was also applied the electrical conductivity test. The results show that the harvest of Enterolobium schomburgkii seeds should be held in August and September

  8. Seed dimorphism, nutrients and salinity differentially affect seed traits of the desert halophyte Suaeda aralocaspica via multiple maternal effects.

    Science.gov (United States)

    Wang, Lei; Baskin, Jerry M; Baskin, Carol C; Cornelissen, J Hans C; Dong, Ming; Huang, Zhenying

    2012-09-25

    Maternal effects may influence a range of seed traits simultaneously and are likely to be context-dependent. Disentangling the interactions of plant phenotype and growth environment on various seed traits is important for understanding regeneration and establishment of species in natural environments. Here, we used the seed-dimorphic plant Suaeda aralocaspica to test the hypothesis that seed traits are regulated by multiple maternal effects. Plants grown from brown seeds had a higher brown:black seed ratio than plants from black seeds, and germination percentage of brown seeds was higher than that of black seeds under all conditions tested. However, the coefficient of variation (CV) for size of black seeds was higher than that of brown seeds. Seeds had the smallest CV at low nutrient and high salinity for plants from brown seeds and at low nutrient and low salinity for plants from black seeds. Low levels of nutrients increased size and germinability of black seeds but did not change the seed morph ratio or size and germinability of brown seeds. High levels of salinity decreased seed size but did not change the seed morph ratio. Seeds from high-salinity maternal plants had a higher germination percentage regardless of level of germination salinity. Our study supports the multiple maternal effects hypothesis. Seed dimorphism, nutrient and salinity interacted in determining a range of seed traits of S. aralocaspica via bet-hedging and anticipatory maternal effects. This study highlights the importance of examining different maternal factors and various offspring traits in studies that estimate maternal effects on regeneration.

  9. Sci—Fri PM: Topics — 02: Evaluation of Dosimetric Variations in Partial Breast Seed Implant (PBSI) due to Patient Arm Position (Up vs. Down)

    International Nuclear Information System (INIS)

    Watt, E; Long, K; Husain, S; Meyer, T

    2014-01-01

    The planning for PBSI is done with the patient's ipsilateral arm raised, however, anatomical changes and variations are unavoidable as the patient resumes her daily activities, potentially resulting in significant deviations in implant geometry from the treatment plan. This study aims to quantify the impact of the ipsilateral arm position on the geometry and dosimetry of the implant at eight weeks, evaluated on post-plans using the MIM Symphony™ software (MIM Software, Cleveland, OH). The average dose metrics for the three patients treated at the TBCC thus far using rigid fusion and contour transfer for the arms up position were 76% for the CTV V100, 61% for the PTV V100, and 37% for the PTV V200; and for the arms down position 81% for the CTV V100, 64% for the PTV V100, and 42% for the PTV V200. Qualitative analysis of the post-implant CT for one of the three patients showed poor agreement between the seroma contour transferred from the pre-implant CT and the seroma visible on the post-implant CT. To obtain a clinically accurate plan for that patient, contour modifications were used, yielding improved dose metric averages for the arms-up position for all three patients of 87% for the CTV V100, 68% for the PTV V100, and 39% for the PTV V200. Overall, the data available shows that dosimetric parameters increase with the patient's arm down, both in terms of coverage and in terms of the hot spot, and accrual of more patients may confirm this in a larger population

  10. The Effect of Osmo and Hormone Priming on Germination and Seed Reserve Utilization of Millet Seeds under Drought Stress

    Directory of Open Access Journals (Sweden)

    Maasoumeh Asadi Aghbolaghi

    2014-03-01

    Full Text Available The objective of this research was to evaluate the effect of seed priming with osmo and hormone priming on growth and seed reserve utilization of millet seeds under drought stress. Treatments were combinations of 4 levels of drought stress (0, -4, -8 and -12 bar and 3 levels of seed priming and control with 3 replications. Results showed that with increase in drought stress, germination components such as germination percentage, germination index, mean time to germination, normal seedling percentage, seedling length, seedling dry weight, weight of utilized (mobilized seed and seed reserve utilization efficiency decreased, but seed priming showed lower reduction. The highest germination characteristics and seed reserve utilization was obtained by priming in control conditions. It is concluded that priming results in improvement in germination components of millet in drought stress conditions.

  11. The Seed Proteome Web Portal

    Directory of Open Access Journals (Sweden)

    Marc eGalland

    2012-06-01

    Full Text Available The Seed Proteome Web Portal (SPWP; http://www.seedproteome.com/ gives access to information both on quantitative seed proteomic data and on seed-related protocols. Firstly, the SPWP provides access to the 475 different Arabidopsis seed proteins annotated from 2 dimensional electrophoresis (2DE maps. Quantitative data are available for each protein according to their accumulation profile during the germination process. These proteins can be retrieved either in list format or directly on scanned 2DE maps. These proteomic data reveal that 40% of seed proteins maintain a stable abundance over germination, up to radicle protrusion. During sensu stricto germination (24 h upon imbibition about 50% of the proteins display quantitative variations, exhibiting an increased abundance (35% or a decreasing abundance (15%. Moreover, during radicle protrusion (24 h to 48 h upon imbibition, 41% proteins display quantitative variations with an increased (23% or a decreasing abundance (18%. In addition, an analysis of the seed proteome revealed the importance of protein post-translational modifications as demonstrated by the poor correlation (r2 = 0.29 between the theoretical (predicted from Arabidopsis genome and the observed protein isoelectric points. Secondly, the SPWP is a relevant technical resource for protocols specifically dedicated to Arabidopsis seed proteome studies. Concerning 2D electrophoresis, the user can find efficient procedures for sample preparation, electrophoresis coupled with gel analysis and protein identification by mass spectrometry, which we have routinely used during the last 12 years. Particular applications such as the detection of oxidized proteins or de novo synthetized proteins radiolabeled by [35S]-methionine are also given in great details. Future developments of this portal will include proteomic data from studies such as dormancy release and protein turnover through de novo protein synthesis analyses during germination.

  12. Genetic variation for phytic acid content in mungbean (Vigna radiata L. Wilczek

    Directory of Open Access Journals (Sweden)

    Vinod Janardan Dhole

    2015-03-01

    Full Text Available Mungbean (Vigna radiata L. Wilczek is a short-duration legume crop cultivated for seeds that are rich in protein and carbohydrates. Mungbeans contain phytic acid (PA, an anti-nutritional factor that is the main storage form of organic phosphorus in seeds. It is a strong inhibitor against the absorption of nutrients including iron, zinc, calcium and magnesium in monogastric animals. Genotypes with low phytic acid (lpa in seed may show increased assimilation of nutrients and be useful in breeding lpa cultivars. The present study was conducted to identify lpa sources, genetic variation, heritability, and association with seed coat color, inorganic phosphorus (IP, and seed size in 102 mungbean genotypes including released varieties, land races, mutants, and wild species grown in two seasons: summer 2011 and rabi 2012. PA and IP in dry seeds were estimated by modified colorimetric method and Chen's modified method, respectively. PA, IP, and 100-seed weight differed significantly in the two seasons. PA content in 102 genotypes ranged from 5.74 to 18.98 mg g− 1 and 5.85 to 20.02 mg g− 1 in summer 2011 and rabi 2012, respectively. High heritability was found for PA (0.87 and 0.86 and seed size (0.82 and 0.83 but low heritability for IP (0.61 and 0.60. A negative correlation was found between PA and seed size (r = − 0.183 and − 0.267. Yellow and green seed coat genotypes contained significantly less PA than black seed coat genotypes. Cluster analysis revealed the distinctness of wild species, land races and cultivated varieties on the basis of PA content. The genotypes YBSM (6.001 mg g− 1 and JL-781 (6.179 mg g− 1 showed lowest PA. These lpa sources can be used to develop high-yielding mungbean cultivars with low phytic acid.

  13. Organic leek seed production - securing seed quality

    DEFF Research Database (Denmark)

    Deleuran, Lise Christina; Boelt, Birte

    2011-01-01

    To maintain integrity in organic farming, availability of organically produced GM-free seed of varieties adapted to organic production systems is of vital impor-tance. Despite recent achievements, organic seed supply for a number of vegetable species is insufficient. Still, in many countries...... seeds. Tunnel production is a means of securing seed of high genetic purity and quality, and organic leek (Allium porrum L.) seed production was tested in tunnels in Denmark. The present trial focused on steckling size and in all years large stecklings had a positive effect on both seed yield...

  14. Organic Leek Seed Production - Securing Seed Quality

    DEFF Research Database (Denmark)

    Deleuran, L C; Boelt, B

    2011-01-01

    To maintain integrity in organic farming, availability of organically produced GM-free seed of varieties adapted to organic production systems is of vital impor-tance. Despite recent achievements, organic seed supply for a number of vegetable species is insufficient. Still, in many countries...... seeds. Tunnel production is a means of securing seed of high genetic purity and quality, and organic leek (Allium porrum L.) seed production was tested in tunnels in Denmark. The present trial focused on steckling size and in all years large stecklings had a positive effect on both seed yield...

  15. Studies on optimum harvest time for hybrid rice seed.

    Science.gov (United States)

    Fu, Hong; Cao, Dong-Dong; Hu, Wei-Min; Guan, Ya-Jing; Fu, Yu-Ying; Fang, Yong-Feng; Hu, Jin

    2017-03-01

    Timely harvest is critical for hybrid rice to achieve maximum seed viability, vigor and yield. However, how to predict the optimum harvest time has been rarely reported so far. The seed vigor of Zhuliangyou 06 (ZLY06) increased and reached the highest level at 20 days after pollination (DAP), when seed moisture content had a lower value, which was maintained until final seed maturation. For Chunyou 84 (CY84), seed vigor, fresh and dry weight had relatively high values at 25 DAP, when seed moisture content reached the lowest value and changed slightly from 25 to 55 DAP. In both hybrid rice varieties, seed glume chlorophyll content declined rapidly from 10 to 30 DAP and remained at a very low level after 35 DAP. Starch content exhibited an increasing trend during seed maturation, while both soluble sugar content and amylase activity decreased significantly at the early stages of seed development. Moreover, correlation analyses showed that seed dry weight, starch content and superoxide dismutase activity were significantly positively correlated with seed vigor. In contrast, chlorophyll content, moisture content, soluble sugar, soluble protein, abscisic acid, gibberellin content, electrical conductivity, catalase and ascorbate peroxidase activities were significantly negatively correlated with seed vigor. Physiological and biochemical parameters were obviously more closely related with seed vigor than with seed germinability during seed development. Seed vigor could be better used as a comprehensive factor to predict the optimum seed harvest time. It is suggested that for ZLY06 seeds could be harvested as early as 20 DAP, whereas for CY84 the earliest optimum harvest time was 25 DAP. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

  16. Changes in seed water status as characterized by NMR in developing soybean seed grown under moisture stress conditions

    International Nuclear Information System (INIS)

    Krishnan, P.; Singh, Ravender; Verma, A.P.S.; Joshi, D.K.; Singh, Sheoraj

    2014-01-01

    Highlights: • In developing soybean seeds, moisture stress resulted in more proportion of water to bound state. • These changes are further corroborated by concomitant changes in seed metabolites. • Thus there exists a moisture stress and development stage dependence of seed tissue water status. - Abstract: Changes in water status of developing seeds of Soybean (Glycine max L. Merrill.) grown under different moisture stress conditions were characterized by proton nuclear magnetic resonance (NMR)- spin–spin relaxation time (T 2 ). A comparison of the seed development characteristics, composition and physical properties indicated that, characteristics like seed weight, seed number/ear, rate of seed filling increased with development stages but decreased with moisture stress conditions. The NMR- spin–spin relaxation (T 2 ) component like bound water increased with seed maturation (40–50%) but decreased with moisture stress conditions (30–40%). The changes in seed water status to increasing levels of moisture stress and seed maturity indicates that moisture stress resulted in more proportion of water to bound state and intermediate state and less proportion of water in free-state. These changes are further corroborated by significant changes in protein and starch contents in seeds under high moisture stress treatments. Thus seed water status during its development is not only affected by development processes but also by moisture stress conditions. This study strongly indicated a clear moisture stress and development stage dependence of seed tissue water status in developing soybean seeds

  17. Changes in seed water status as characterized by NMR in developing soybean seed grown under moisture stress conditions

    Energy Technology Data Exchange (ETDEWEB)

    Krishnan, P., E-mail: pkrishnan@iari.res.in; Singh, Ravender; Verma, A.P.S.; Joshi, D.K.; Singh, Sheoraj

    2014-02-21

    Highlights: • In developing soybean seeds, moisture stress resulted in more proportion of water to bound state. • These changes are further corroborated by concomitant changes in seed metabolites. • Thus there exists a moisture stress and development stage dependence of seed tissue water status. - Abstract: Changes in water status of developing seeds of Soybean (Glycine max L. Merrill.) grown under different moisture stress conditions were characterized by proton nuclear magnetic resonance (NMR)- spin–spin relaxation time (T{sub 2}). A comparison of the seed development characteristics, composition and physical properties indicated that, characteristics like seed weight, seed number/ear, rate of seed filling increased with development stages but decreased with moisture stress conditions. The NMR- spin–spin relaxation (T{sub 2}) component like bound water increased with seed maturation (40–50%) but decreased with moisture stress conditions (30–40%). The changes in seed water status to increasing levels of moisture stress and seed maturity indicates that moisture stress resulted in more proportion of water to bound state and intermediate state and less proportion of water in free-state. These changes are further corroborated by significant changes in protein and starch contents in seeds under high moisture stress treatments. Thus seed water status during its development is not only affected by development processes but also by moisture stress conditions. This study strongly indicated a clear moisture stress and development stage dependence of seed tissue water status in developing soybean seeds.

  18. Seed Priming with Melatonin Effects on Seed Germination and Seedling Growth in Maize under Salinity Stress

    International Nuclear Information System (INIS)

    Jiang, X.; Li, H.; Song, X.

    2016-01-01

    The effects on seed germination and seedling growth in maize under salinity stress by seed priming with melatonin were investigated. Seeds of maize cultivar Nonghua101 were soaked in 0.4, 0.8 and 1.6 mM aerated solution of melatonin for 24 h, and primed seeds were germinated under the condition of 150 mM NaCl with paper media. The results showed seed priming with 0.8 mM melatonin was the best performance of all the treatments to seed germination and seedling growth in maize under salinity stress. Then primed with 0.8 mM melatonin or water for 24 h and unprimed seeds were germination under the condition of 150 mM NaCl with sand media. The results showed seed priming with 0.8 mM melatonin significantly improved germination energy, germination percentage, seedling vigor index, shoot and root lengths, seedling fresh and dry weights, K/sup +/ content, relative water content, proline and total phenolic contents, superoxide dismutase, catalase and phenylalanin ammonia lyase activities; and significantly decreased mean emergence time, Na/sup +/ content, electrolyte leakage and malondialdehyde content compared with untreated seeds under salinity stress. These results suggest that seed priming with melatonin alleviates the salinity damage to maize and seed priming with melatonin may be an important alternative approach to decrease the impact of salinity stress in maize. (author)

  19. Analysis the parameters of seed quality in ns sunflower hybrid after processing in gravity separator

    Directory of Open Access Journals (Sweden)

    Jokić Goran

    2016-01-01

    Full Text Available This paper analyzed the processed seed of five sunflower hybrid seed developed at the Institute of Field and Vegetable Crops in Novi Sad before and after processing in gravity separator. The cultivars were Pegaz, Duško, NS Fantazija, Sumo 1 PR and NS Oskar. The analysis was conducted on seed lots processed in 2015 and involved the following parameters: seed purity percentage, 1.000-seed weight, germination energy, germination, seed moisture, number of sclerotinia per 1.000. The results showed that all the parameters of seed quality of sunflower hybrids were better after processing seeds in the gravity separator.

  20. Variation of functional clonal traits along elevation in two fern species

    International Nuclear Information System (INIS)

    Song, Y.B.; Chen, L.Y.; Xiong, W.

    2015-01-01

    Phenotypical plasticity is generally considered among adaptive strategies by which plants can cope with environmental variation in space and time. Although much is known about plasticity in seed plants in terms of functional clonal traits while little is known about ferns. Variation of functional clonal traits of two ferns Dicranopteris dichotoma and Diplopterygium glaucum among plots differing in elevation in a subtropical evergreen broad-leaved forest in southern China was investigated. Along with elevation increasing the two fern species showed similar variation pattern of functional clonal traits: stable spacer length, increasing specific spacer length and decreasing spacer weight per ramet and specific spacer weight. The two ferns species had similar variation pattern of ramet performance traits but different variation pattern of ramet population properties. These results suggest an evolutionary trade-off between functions of foraging for and storing of resources in the two ferns, with a functional preference for the foraging in response to environmental change. (author)

  1. Seeds and plantlets of Myrciaria dubia “camu-camu”: biometry, germination, and initial growth

    Directory of Open Access Journals (Sweden)

    Anderson E. Medina Bardales

    2014-06-01

    Full Text Available The objectives were to determine seed biometrics, recording cellular respiration in the imbibition process, evaluate the effect of inducing chemicals in germination and early growth analysis. Cellular respiration during imbibition was measured by reduction of methylene blue and Janus Green B. The inductor effect of five chemical compounds in germination was evaluated. Initial growth was recorded by stereoscopic. Results showed that the seeds have an average weight of 520 ± 172 mg, length of 13.50 ± 1.76 mm, width of 10.61 ± 1.14 mm, and thickness of 4.68 ± 0 62 mm. These variables showed significant correlations (r of 0.494 to 0.897 and p 90% and 65% respectively. Seedling initial growth consisted of six stages and occurred over a period of 22 days after radicle emergence. In conclusion, M. dubia seeds show wide variation in their biometrics (weight, length, width and thickness, but show significant correlations with each other. Likewise, seeds are metabolically active in imbibition process, and germination is induced by sodium nitrite and potassium cyanide. Furthermore, seedling initial growth to occur over a period of 22 days after emergence of the radicle and consists of six distinct stages.

  2. Microscale Insight into Microbial Seed Banks.

    Science.gov (United States)

    Locey, Kenneth J; Fisk, Melany C; Lennon, J T

    2016-01-01

    Microbial dormancy leads to the emergence of seed banks in environmental, engineered, and host-associated ecosystems. These seed banks act as reservoirs of diversity that allow microbes to persist under adverse conditions, including extreme limitation of resources. While microbial seed banks may be influenced by macroscale factors, such as the supply of resources, the importance of microscale encounters between organisms and resource particles is often overlooked. We hypothesized that dimensions of spatial, trophic, and resource complexity determine rates of encounter, which in turn, drive the abundance, productivity, and size of seed banks. We tested this using >10,000 stochastic individual based models (IBMs) that simulated energetic, physiological, and ecological processes across combinations of resource, spatial, and trophic complexity. These IBMs allowed realistic dynamics and the emergence of seed banks from ecological selection on random variation in species traits. Macroscale factors like the supply and concentration of resources had little effect on resource encounter rates. In contrast, encounter rates were strongly influenced by interactions between dispersal mode and spatial structure, and also by the recalcitrance of resources. In turn, encounter rates drove abundance, productivity, and seed bank dynamics. Time series revealed that energetically costly traits can lead to large seed banks and that recalcitrant resources can lead to greater stability through the formation of seed banks and the slow consumption of resources. Our findings suggest that microbial seed banks emerge from microscale dimensions of ecological complexity and their influence on resource limitation and energetic costs.

  3. Seed reserve utilization and hydrolytic enzyme activities in germinating seeds of sweet corn

    International Nuclear Information System (INIS)

    Cheng, X.; Xiong, F.; Wang, C.; He, S.; Zhou, Y.

    2018-01-01

    In this study, two sh2 sweet corn cultivars (i.e., the initial seed dry weight for FT018 and TB010 was 0.16+-0.02 g/grain and 0.09+-0.01 g/grain, respectively) were used to determine the physiological characteristics of seed reserve utilization in germination. The data implied that the weight of mobilized seed reserve (WMSR) and seed reserve utilization efficiency (SRUE) increased with seed germination. FT018 exhibited higher SRUE than TB010 due to its sufficient energy production for growth. Sugar (sucrose and fructose) contents were at different levels in the germinating seed of sh2 sweet corn. The protein content and number of protein species were highest in the early stage of germination. Enzyme activity in the germinating seed indicated that enzymes for starch and sugar hydrolysis were important and that enzyme activities significantly differed at each germination stage and between the cultivars under dark conditions. Succinate dehydrogenase, sucrose synthase, and glucose-6-phosphate dehydrogenase accumulated in the late germination stage. Thus, appropriate efforts should be focused on improving the seed reserve utilization in sweet corn by identifying the physiological mechanism of germinating seed. (author)

  4. [Study on seed quality test and quality standard of Pesudostellaria heterophylla].

    Science.gov (United States)

    Xiao, Cheng-Hong; Zhou, Tao; Jiang, Wei-Ke; Chen, Min; Xiong, Hou-Xi; Liao, Ming-Wu

    2014-08-01

    Referring to the rules for agricultural seed testing (GB /T 3543-1995) issued by China, the test of sampling, seed purity, weight per 1 000 seeds, seed moisture, seed viability and germination rate had been studied for screening seed quality test methods of Pesudostellaria heterophylla. The seed quality from different collection areas was measured. The results showed that at least 6.5 g seeds should be sampled and passed through 10-mesh sieve for purity analysis. The weight of 1 000 seeds was determined by using the 500-seed method. The phenotypic observation and size measurement were used for authenticity testing. The seed moisture was determined under the higher temperature (130 ± 2) degrees C for 5 hours. The seeds were dipped into 0.2% TTC sustaining 1 hour at 40 degrees C, then the viability could be determined. The break dormancy seeds were cultured on sand at 10 degrees C. K cluster analysis was applied for the data analysis, the seed quality from different collection areas grading of P. Heterophylla was described as three grades. The seed quality of each grade should reach following requirements: for first grade seeds, germination rate ≥ 86%, 1 000-grain weight ≥ 2.59 g, purity ≥ 87%, moisture ≤ 13.1%; for second grade seeds, germination rate ≥ 70%, 1 000-grain weight ≥ 2.40 g, purity ≥ 77%, moisture ≤ 14.3%; for third grade seeds, germination rate ≥ 41%, 1 000-grain weight ≥ 2.29 g, purity ≥ 76%, moisture ≤ 15.8%. The seed testing methods for quality items of P. heterophylla had been initially established, as well as the primary P. heterophylla seed quality classification standard.

  5. Seed germination, seedling traits, and seed bank of the tree Moringa peregrina (Moringaceae) in a hyper-arid environment.

    Science.gov (United States)

    Gomaa, Nasr H; Picó, F Xavier

    2011-06-01

    Water-limited hot environments are good examples of hyper-aridity. Trees are scarce in these environments but some manage to survive, such as the tree Moringa peregrina. Understanding how trees maintain viable populations in extremely arid environments may provide insight into the adaptive mechanisms by which trees cope with extremely arid weather conditions. This understanding is relevant to the current increasing aridity in several regions of the world. Seed germination experiments were conducted to assess variation in seed mass, seed germination, and seedling traits of Moringa peregrina plants and the correlations among these traits. A seed burial experiment was also designed to study the fate of M. peregrina seeds buried at two depths in the soil for two time periods. On average, seeds germinated in three days and seedling shoots grew 0.7 cm per day over three weeks. Larger seeds decreased germination time and increased seedling growth rates relative to smaller seeds. Seeds remained quiescent in the soil and germination was very high at both depths and burial times. The after-ripening time of Moringa peregrina seeds is short and seeds germinate quickly after imbibition. Plants of M. peregrina may increase in hyper-arid environments from seeds with larger mass, shorter germination times, and faster seedling growth rates. The results also illustrate the adjustment in allocation to seed biomass and correlations among seed and seedling traits that allows M. peregrina to be successful in coping with aridity in its environment.

  6. A multicenter randomized clinical trial of etonogestrel- and levonorgestrel- contraceptive implants with nonrandomized copper-IUD controls: effect on weight variations up to three years after placement.

    Science.gov (United States)

    Bahamondes, Luis; Brache, Vivian; Ali, Moazzam; Habib, Ndema

    2018-05-16

    To evaluate weight changes in women randomized to either the etonogestrel (ENG)- or the levonorgestrel (LNG)-releasing contraceptive implants and to compare with users of the TCu380A intrauterine device (IUD). A multi-center randomized trial with 1:1 allocation ratio of the ENG- and the LNG- implants with non-randomized, age-matched control group of women choosing TCu380A IUD. The primary objective was to assess contraceptive efficacy and method continuation rates, and secondarily the incidence of common complaints and side effects (including weight changes) associated with use of the three contraceptives. All women were enrolled in nine centers at seven countries. Weight change was evaluated from time at device(s) placement. Confounders were socio-demographic, baseline weight and body mass index, center, and time from insertion. We used a linear mixed effects regression modeling with random intercept and slope. Weight was compared between the two implants groups and between the implants and the IUD-groups, through linear mixed multivariable regression model. A total of 995, 997 and 971 users in the ENG-, LNG-implant and IUD-groups respectively, were included. At 36months of use, ENG- and LNG-implants users had similar significant mean weight increase of 3.0 kg (95% CI 2.5-3.5) and 2.9 kg (95% CI 2.4-3.4), respectively (p than 50 kg. These findings must be useful for clinicians to counsel implant-users which could improve method continuation. Copyright © 2018. Published by Elsevier Inc.

  7. Investigating Seed Longevity of Big Sagebrush (Artemisia tridentata)

    Science.gov (United States)

    Wijayratne, Upekala C.; Pyke, David A.

    2009-01-01

    from each site, as well as several environmental variables, were used to evaluate seed viability within the context of habitat variation. Initial viability of seeds used in the seed retrieval experiment was 81 and 92 percent for mountain and Wyoming big sagebrush, respectively. After remaining in the field for 24 months, buried Wyoming big sagebrush seeds retained 28-58 percent viability,11-23 percent of seeds under litter remained viable, and no seeds remained viable on the surface (estimates are 95-percent confidence intervals). The odds of remaining viable did not change from 12 to 24 months. However, after 24 months the odds of seeds beneath litter being viable decreased to 75 percent of the odds of viability at 12 months. Similar to Wyoming big sagebrush, buried seeds of mountain big sagebrush were 31-68 percent viable, seeds under litter retained 10-22 percent of their viability, and no surface seeds were viable after 24 months. Both subspecies of big sagebrush had some portion of seed that remained viable for more than one growing season provided they were buried or under litter. Although seeds beneath litter may remain viable in intact communities, seeds are susceptible to incineration during fires. Nine months after seed dispersal, seed bank estimates for Wyoming big sagebrush ranged from 19 to 49 viable seeds/m2 in litter samples and 19-57 viable seeds/m2 in soil samples (95-percent confidence interval). For mountain big sagebrush, estimates were 27-75 viable seeds/m2 in litter samples and 54-139 viable seeds/m2 in soil (95-percent confidence interval). The number of viable seeds present in the seed bank 9 months after seed dispersal was not significantly different from the number present immediately after seed dispersal. Seed viability was highest in mountain big sagebrush sites for seeds on the surface and beneath litter, but decreased after one season. Buried seeds of both subspecies were in equal abundances and may be insulated from the effect

  8. Responses of Seed Germination, Seedling Growth, and Seed Yield Traits to Seed Pretreatment in Maize (Zea mays L.

    Directory of Open Access Journals (Sweden)

    Yu Tian

    2014-01-01

    Full Text Available A series of seed priming experiments were conducted to test the effects of different pretreatment methods to seed germination, seedling growth, and seed yield traits in maize (Zea mays L.. Results indicated that the seeds primed by gibberellins (GA, NaCl, and polyethylene glycol (PEG reagents showed a higher imbibitions rate compared to those primed with water. The final germination percentage and germination rate varied with different reagents significantly (P<0.05. The recommended prime reagents were GA at 10 mg/L, NaCl at 50 mM, and PEG at 15% on account of germination experiment. 15% PEG priming reagent increased shoot and root biomass of maize seedling. The shoot biomass of seedlings after presoaking the seeds with NaCl reagent was significantly higher than the seedlings without priming treatment. No significant differences of plant height, leaf number, and hundred-grain weight were observed between control group and priming treatments. Presoaking with water, NaCl (50 mM, or PEG (15% significantly increased the hundred-grain weight of maize. Therefore, seed pretreatment is proved to be an effective technique to improve the germination performance, seedling growth, and seed yield of maize. However, when compared with the two methods, if immediate sowing is possible, presoaking is recommended to harvest better benefits compared to priming method.

  9. Responses of seed germination, seedling growth, and seed yield traits to seed pretreatment in maize (Zea mays L.).

    Science.gov (United States)

    Tian, Yu; Guan, Bo; Zhou, Daowei; Yu, Junbao; Li, Guangdi; Lou, Yujie

    2014-01-01

    A series of seed priming experiments were conducted to test the effects of different pretreatment methods to seed germination, seedling growth, and seed yield traits in maize (Zea mays L.). Results indicated that the seeds primed by gibberellins (GA), NaCl, and polyethylene glycol (PEG) reagents showed a higher imbibitions rate compared to those primed with water. The final germination percentage and germination rate varied with different reagents significantly (P germination experiment. 15% PEG priming reagent increased shoot and root biomass of maize seedling. The shoot biomass of seedlings after presoaking the seeds with NaCl reagent was significantly higher than the seedlings without priming treatment. No significant differences of plant height, leaf number, and hundred-grain weight were observed between control group and priming treatments. Presoaking with water, NaCl (50 mM), or PEG (15%) significantly increased the hundred-grain weight of maize. Therefore, seed pretreatment is proved to be an effective technique to improve the germination performance, seedling growth, and seed yield of maize. However, when compared with the two methods, if immediate sowing is possible, presoaking is recommended to harvest better benefits compared to priming method.

  10. Seed-specific overexpression of AtFAX1 increases seed oil content in Arabidopsis.

    Science.gov (United States)

    Tian, Yinshuai; Lv, Xueyan; Xie, Guilan; Zhang, Jing; Xu, Ying; Chen, Fang

    2018-06-02

    Biosynthesis of plant seed oil is accomplished through the coordinate action of multiple enzymes in multiple subcellular compartments. Fatty acid (FA) has to be transported from plastid to endoplasmic reticulum (ER) for TAG synthesis. However, the role of plastid FA transportation during seed oil accumulation has not been evaluated. AtFAX1 (Arabidopsis fatty acid export1) mediated the FA export from plastid. In this study, we overexpressed AtFAX1 under the control of a seed specific promoter in Arabidopsis. The resultant overexpression lines (OEs) produced seeds which contained 21-33% more oil and 24-30% more protein per seed than those of the wild type (WT). The increased oil content was probably because of the enhanced FA and TAG synthetic activity. The seed size and weight were both increased accordingly. In addition, the seed number per silique and silique number per plant had no changes in transgenic plants. Taken together, our results demonstrated that seed specific overexpression of AtFAX1 could promote oil accumulation in Arabidopsis seeds and manipulating FA transportation is a feasible strategy for increasing the seed oil content. Copyright © 2018 Elsevier Inc. All rights reserved.

  11. Effects of Osmo- and Hydro-priming on Seed Parameters of Sage

    African Journals Online (AJOL)

    dastanpoor

    2013-03-13

    Mar 13, 2013 ... Effects of hydropriming on seed germination and seedling ... through stem cuttings. .... and shoot length, and seedling fresh and dry weights were .... division in all the cells of germinating seeds. .... electric field treatments.

  12. Genotypic variability and mutant identification in cicer arietinum L. by seed storage protein profiling

    International Nuclear Information System (INIS)

    Hameed, A.; Iqbal, N.; Shah, T.M.

    2012-01-01

    A collection of thirty-four chickpea genotypes, including five kabuli and twenty-nine desi, were analyzed by SDS-PAGE for seed storage protein profiling. Total soluble seed proteins were resolved on 12% gels. A low level of variability was observed in desi as compared to kabuli genotypes. Dendrogram based on electrophoretic data clustered the thirty-four genotypes in four major groups. As large number of desi genotypes illustrated identical profiles, therefore could not be differentiated on the basis of seed storage protein profiles. One kabuli genotype ILC-195 found to be the most divergent showing 86% similarity with all other genotypes. ILC-195 can be distinguished from its mutant i.e., CM-2000 and other kabuli genotypes on the basis of three peptides i.e. SSP-66, SSP-43 and SSP-39. Some proteins peptides were found to be genotype specific like SSP-26 for ICCV-92311. Uniprot and NCBI protein databases were searched for already reported and characterized seed storage proteins in chickpea. Among 33 observed peptides, only six seed storages proteins from chickpea source were available in databases. On the basis of molecular weight similarity, identified peptides were SSP-64 as Serine/Threonine dehydratase, SSP-56 as Alpha-amylase inhibitor, SSP-50 as Provicillin, SSP-39 as seed imbibition protein, SSP-35 as Isoflavane reductase and SSP-19 as lipid transport protein. Highest variability was observed in vicillin subunits and beta subunits of legumins and its polymorphic forms. In conclusion, seed storage profiling can be economically used to asses the genetic variation, phylogenetic relationship and as markers to differentiate mutants from their parents. (author)

  13. Seed coat development in Velloziaceae: primary homology assessment and insights on seed coat evolution.

    Science.gov (United States)

    Sousa-Baena, Mariane S; de Menezes, Nanuza L

    2014-09-01

    Seed coat characteristics have historically been used to infer taxonomic relationships and are a potential source of characters for phylogenetic reconstruction. In particular, seed coat morphoanatomy has never been studied in detail in Velloziaceae. One character based on seed surface microsculpture has been used in phylogenies, but was excluded from recent studies owing to problems in primary homology. This work aimed to clarify the origin and general composition of seed coat cell layers in Velloziaceae and to propose hypotheses of primary homology among seed characters.• Seed coat development of 24 Velloziaceae species, comprising nine genera, and one species of Pandanaceae (outgroup) was studied using standard anatomical methods. Developmental data were interpreted in the light of a recently published phylogeny.• Eight types of seed coat were identified. Whereas the most common type has four distinct cell layers (two-layered tegmen and testa), we encountered much more variation in seed coat composition than previously reported, the analysis of which revealed some potential synapomorphies. For instance, an exotesta with spiral thickenings may be a synapomorphy of Barbacenia.• Our results showed that the character states previously used in phylogenies are not based on homologous layers and that the same state was misattributed to species exhibiting quite different seed coats. This study is a first step toward a better understanding of seed coat structure evolution in Velloziaceae. © 2014 Botanical Society of America, Inc.

  14. Supplementation of dextrose to the diet during the weaning to estrus interval affects subsequent variation in within-litter piglet birth weight

    NARCIS (Netherlands)

    Brand, van den H.; Soede, N.M.; Kemp, B.

    2006-01-01

    Effects of supplementation of dextrose to the diet of sows during the weaning-to-estrus interval (WEI) on subsequent litter size and within-litter variation were investigated. After weaning, 223 sows (first to fifth parity) were fed 3.5 kg/d. Half of the sows additionally received 150 g of dextrose

  15. The Effect of Salicylic Acid and Gibberellin on Seed Reserve Utilization, Germination and Enzyme Activity of Sorghum (Sorghum bicolor L. Seeds Under Drought Stress

    Directory of Open Access Journals (Sweden)

    Roghayyeh Sheykhbaglou

    2014-03-01

    Full Text Available Seed priming methods have been used to increases germination characteristics under stress conditions. The study aimed was to determine the effect of salicylic acid and gibberellin on seed reserve utilization, germination and enzyme activity of sorghum (Sorghum bicolor L. seeds under drought stress. Factorial experiment was carried out in completely randomized design with three replications. The first factor was the seed treatments (unpriming, salicylic acid and gibberellin and the second factor was drought stress (0, -4, -8 and -12 bar. The results indicated that for these traits: germination percentage, germination index, weight of utilized (mobilized seed, seed reserve utilization efficiency, seedling dry weight and seed reserve depletion percentage was a significant treatment Ч drought interaction. Thus priming improved study traits in Sorghum (Sorghum bicolor L. seeds under drought stress. Also, priming improves enzyme activity as compared to the unprimed seeds.

  16. Influence the Rubber Seed Type and Altitude on Characteristic of Seed, Oil and Biodiesel

    Directory of Open Access Journals (Sweden)

    Salni Salni

    2017-06-01

    Full Text Available This research studies the influence of the type of rubber seed that is superior and local, altitude plant in South Sumatra province to the characteristic of seed, oil and biodiesel (methyl ester. Rubber plants planted from local rubber seed by seeds seedlings and superior rubber seed by selected clones. In the study, rubber plants planted at a different altitude, namely in Banyuasin district (18 m above sea level, Prabumulih District (176 m above sea level and Lahat District (627 m above sea level. The results showed that the weight of the flour, the water content and ash content in the local rubber seeds larger than the superior rubber seed for all altitude, but oil content a large in the superior rubber seeds. The major of fatty acids in the rubber seed oil in all types and altitude are a linoleic acid with a different percentage except local rubber seed oil from Lahat district with the large percentage of octadecanoic acid. Free fatty acids in the oil from the superior seeds rubber of 13.897-15.494 % large than local rubber seed oil was found 9.786-10.399 % for all altitude. By esterification process using sulfuric acid catalyst, Free Fatty Acid (FFA can be reduced to ≤ 2 %. The methyl ester made from the transesterification process of rubber seed oil after esterification using methanol and sodium hydroxide as catalyst. Analysis of methyl esters includes cetane index, flash point, kinematic viscosity, carbon residue, density, moisture content, water and sediment content and distillation compared with SNI 7182 and ASTM 6751-02.  The result indicated that the quality of methyl ester from superior rubber seed oil in the Banyuasin and Prabumulih district better than another methyl ester. The types of rubber seed altitude affect the characteristics of the seed, oil and methyl ester  but the altitude are not significantly different. Keywords: rubber seed, type, altitude, oil, biodiesel Article History: Received March 21st 2017; Received in

  17. Optical sensing method to analyze germination rate of Capsicum annum seeds treated with growth-promoting chemical compounds using optical coherence tomography

    Science.gov (United States)

    Wijesinghe, Ruchire Eranga; Lee, Seung-Yeol; Kim, Pilun; Jung, Hee-Young; Jeon, Mansik; Kim, Jeehyun

    2017-09-01

    Seed germination rate differs based on chemical treatments, and nondestructive measurements of germination rate have become an essential requirement in the field of agriculture. Seed scientists and other biologists are interested in optical sensing technologies-based biological discoveries due to nondestructive detection capability. Optical coherence tomography (OCT) has recently emerged as a powerful method for biological and plant material discoveries. We report an extended application of OCT by monitoring the germination rate acceleration of chemically primed seeds. To validate the versatility of the method, Capsicum annum seeds were primed using three chemical compounds: sterile distilled water (SDW), butandiol, and 1-hexadecene. Monitoring was performed using a 1310-nm swept source OCT system. The results confirmed more rapid morphological variations in the seeds treated with 1-hexadecene medium than the seeds treated with SDW and butandiol within 8 consecutive days. In addition, fresh weight measurements (gold standard) of seeds were monitored for 15 days, and the obtained results were correlated with the OCT results. Thus, such a method can be used in various agricultural fields, and OCT shows potential as a rigorous sensing method for selecting the optimal plant growth-promoting chemical compounds rapidly, when compared with the gold standard methods.

  18. Barley seed proteomics from spots to structures

    DEFF Research Database (Denmark)

    Finnie, Christine; Svensson, Birte

    2009-01-01

    forms on 2D-gels. Specific protein families, including peroxidases and alpha-amylases have been subjected to in-depth analysis resulting in characterisation of different isozymes, post-translational. modifications and processing. A functional proteomics study focusing on the seed thioredoxin system has...... with information from rice and other cereals facilitate identification of barley proteins. Several hundred barley seed proteins are identified and lower abundance proteins including membrane proteins are now being analysed. In the present review we focus on variation in protein profiles of seed tissues during...

  19. Changes in soluble carbohydrates during storage of Caesalpinia echinata LAM. (Brazilwood seeds, an endangered leguminous tree from the Brazilian Atlantic Forest

    Directory of Open Access Journals (Sweden)

    I. S. Garcia

    Full Text Available Caesalpinia echinata seeds stored in laboratory environmental conditions lose their viability in one month whilst under low temperatures germination is maintained for 18 months of storage. These seeds are tolerant to desiccation, keeping their viability up to 0.08 gH2O.gDW-1. Since soluble carbohydrates are believed to be involved with desiccation tolerance and seed storability, the aim of this work is to analyze the content and composition of soluble carbohydrates in C. echinata seeds during storage in paper bags (PB and glass flasks (GF at laboratory room (RT and cool (CT temperatures. In freshly harvested seeds, total soluble carbohydrates comprised approximately 10% of the dry weight, decreasing to ca. 8% over 18 months of storage at RT. In seeds stored at CT, sugars varied differently decreasing initially and being restored at the end of the analysis period. The main neutral sugars in seeds from all treatments were sucrose, fructose and glucose. Raffinose and stachyose were present as traces. Free myo-inositol and other cyclitols were also detected. The main tendency observed was the variation in levels of both glucose and fructose in relation to sucrose, the highest levels of monosaccharides which were found in seeds stored at CT. The values of glucose and fructose were practically constant in seeds stored in paper bags for 18 months at CT, decreasing consistently in the other treatments, mainly at RT. Sucrose contents remained relatively stable. Changes in soluble sugars during storage suggest that the loss of germinability of seeds of C. echinata could be associated with low levels of glucose and fructose in relation to sucrose.

  20. The Conserved and Unique Genetic Architecture of Kernel Size and Weight in Maize and Rice.

    Science.gov (United States)

    Liu, Jie; Huang, Juan; Guo, Huan; Lan, Liu; Wang, Hongze; Xu, Yuancheng; Yang, Xiaohong; Li, Wenqiang; Tong, Hao; Xiao, Yingjie; Pan, Qingchun; Qiao, Feng; Raihan, Mohammad Sharif; Liu, Haijun; Zhang, Xuehai; Yang, Ning; Wang, Xiaqing; Deng, Min; Jin, Minliang; Zhao, Lijun; Luo, Xin; Zhou, Yang; Li, Xiang; Zhan, Wei; Liu, Nannan; Wang, Hong; Chen, Gengshen; Li, Qing; Yan, Jianbing

    2017-10-01

    Maize ( Zea mays ) is a major staple crop. Maize kernel size and weight are important contributors to its yield. Here, we measured kernel length, kernel width, kernel thickness, hundred kernel weight, and kernel test weight in 10 recombinant inbred line populations and dissected their genetic architecture using three statistical models. In total, 729 quantitative trait loci (QTLs) were identified, many of which were identified in all three models, including 22 major QTLs that each can explain more than 10% of phenotypic variation. To provide candidate genes for these QTLs, we identified 30 maize genes that are orthologs of 18 rice ( Oryza sativa ) genes reported to affect rice seed size or weight. Interestingly, 24 of these 30 genes are located in the identified QTLs or within 1 Mb of the significant single-nucleotide polymorphisms. We further confirmed the effects of five genes on maize kernel size/weight in an independent association mapping panel with 540 lines by candidate gene association analysis. Lastly, the function of ZmINCW1 , a homolog of rice GRAIN INCOMPLETE FILLING1 that affects seed size and weight, was characterized in detail. ZmINCW1 is close to QTL peaks for kernel size/weight (less than 1 Mb) and contains significant single-nucleotide polymorphisms affecting kernel size/weight in the association panel. Overexpression of this gene can rescue the reduced weight of the Arabidopsis ( Arabidopsis thaliana ) homozygous mutant line in the AtcwINV2 gene (Arabidopsis ortholog of ZmINCW1 ). These results indicate that the molecular mechanisms affecting seed development are conserved in maize, rice, and possibly Arabidopsis. © 2017 American Society of Plant Biologists. All Rights Reserved.

  1. Genetic variation in the endocannabinoid degrading enzyme fatty acid amide hydrolase (FAAH) and their influence on weight loss and insulin resistance under a high monounsaturated fat hypocaloric diet.

    Science.gov (United States)

    de Luis, Daniel; Aller, Rocio; Izaola, Olatz; Conde, Rosa; de la Fuente, Beatriz; Gonzalez Sagrado, Manuel

    2013-01-01

    The C385A polymorphism of FAAH gene (rs324420C>A) has been associated with obesity. We investigate the role of this polymorphism on anthropometric and metabolic responses after an enriched monounsaturated fat hypocaloric diet. A sample of 95 obese individuals was analyzed at baseline and after 3 months of an enriched monounsaturated fat hypocaloric diet. Sixty two patients (65.3%) had the genotype C385C and 33 (34.7%) patients had C385A genotype (30 patients, 31.6%) or A358A (3 patients, 3.2%) (A carriers group). In subjects with C385C genotype, insulin (-1.9±5.3 mUI/l) and HOMA-R (-0.48±0.75 U) decreased. In A carriers subjects, the decreases in weight were 3.7±3.4 kg (decrease in C385C genotype group 4.4±3.6 kg), fat mass 2.7±3.2 kg (decrease in C385C genotype group 3.4±3.2 kg) and waist circumference 3.1±3.4cm (decrease in C385 genotype group 4.4±4.6 cm). These changes were significantly higher in the C385C genotype group than the A carriers subjects. After weight loss, noncarriers of the allele A385 of FAAH had an improvement on insulin and HOMA-R levels with an enriched monounsaturated fat hypocaloric diet. A better response of weight, fat mass and waist circumference was observed in C385 genotype subjects than A carriers participants. Copyright © 2013 Elsevier Inc. All rights reserved.

  2. The role of genetic variation across IL-1β, IL-2, IL-6, and BDNF in antipsychotic-induced weight gain.

    Science.gov (United States)

    Fonseka, Trehani M; Tiwari, Arun K; Gonçalves, Vanessa F; Lieberman, Jeffrey A; Meltzer, Herbert Y; Goldstein, Benjamin I; Kennedy, James L; Kennedy, Sidney H; Müller, Daniel J

    2015-01-01

    Antipsychotics with high weight gain-inducing propensities influence the expression of immune and neurotrophin genes, which have been independently related to obesity indices. Thus, we investigated whether variants in the genes encoding interleukin (IL)-1β, IL-2, and IL-6 and brain-derived neurotrophic factor (BDNF) Val66Met are associated with antipsychotic-induced weight gain (AIWG). Nineteen polymorphisms were genotyped using Taqman(®) assays in 188 schizophrenia patients on antipsychotic treatment for up to 14 weeks. Mean weight change (%) from baseline was compared across genotypic groups using analysis of covariance (ANCOVA). Epistatic effects between cytokine polymorphisms and BDNF Val66Met were tested using Model-Based Multifactor Dimensionality Reduction. In European patients, IL-1β rs16944*GA (P = 0.013, Pcorrected = 0.182), IL-1β rs1143634*G (P = 0.001, Pcorrected = 0.014), and BDNF Val66Met (Val/Val, P = 0.004, Pcorrected = 0.056) were associated with greater AIWG, as were IL-1β rs4849127*A (P = 0.049, Pcorrected = 0.784), and IL-1β rs16944*GA (P = 0.012, Pcorrected = 0.192) in African Americans. BDNF Val66Met interacted with both IL-1β rs13032029 (Val/Met+ TT, PPerm = 0.029), and IL-6 rs2069837 (Val/Val+ AA, PPerm = 0.021) in Europeans, in addition to IL-1β rs16944 (Val/Val+ GA, PPerm = 0.006) in African Americans. SNPs across IL-1β and BDNF Val66Met may influence AIWG. Replication of these findings in larger, independent samples is warranted.

  3. Nutritional evaluation of dried tomato seeds.

    Science.gov (United States)

    Persia, M E; Parsons, C M; Schang, M; Azcona, J

    2003-01-01

    Two samples of tomato seeds, a by-product of the tomato canning industry were evaluated to determine proximate analysis, amino acid content, and digestibility, TMEn, and protein efficiency ratio. Tomato seeds were also used to replace corn and soybean meal (SBM) in a chick diet on an equal true amino acid digestibility and TMEn basis. Tomato seeds were found to contain 8.5% moisture, 25% CP, 20.0% fat, 3.1% ash, 35.1% total dietary fiber, 0.12% Ca, 0.58% P, and 3,204 kcal/kg of TMEn. The total amounts of methionine, cystine, and lysine in the tomato seeds were 0.39, 0.40, and 1.34%, respectively, and their true digestibility coefficients, determined in cecectomized roosters, were 75, 70, and 54%, respectively. The protein efficiency ratio (weight gain per unit of protein intake) value when fed to chicks at 9% CP was 2.5 compared to 3.6 for SBM (P seeds could replace corn and SBM without any adverse affects on chick weight gain, feed intake, or gain:feed ratio from 8 to 21 d posthatch. Tomato seeds at any level in the diet did not significantly affect skin pigmentation. Although the protein quality of tomato seeds may not be as high as SBM, tomato seeds do contain substantial amounts of digestible amino acids and TMEn. When formulating diets on a true digestible amino acid and TMEn basis, tomato seeds can be supplemented into chick rations at up to 15% without any adverse affects on growth performance.

  4. Genetic Variation for Lettuce Seed Thermoinhibition Is Associated with Temperature-Sensitive Expression of Abscisic Acid, Gibberellin, and Ethylene Biosynthesis, Metabolism, and Response Genes1[C][W][OA

    Science.gov (United States)

    Argyris, Jason; Dahal, Peetambar; Hayashi, Eiji; Still, David W.; Bradford, Kent J.

    2008-01-01

    Lettuce (Lactuca sativa ‘Salinas’) seeds fail to germinate when imbibed at temperatures above 25°C to 30°C (termed thermoinhibition). However, seeds of an accession of Lactuca serriola (UC96US23) do not exhibit thermoinhibition up to 37°C in the light. Comparative genetics, physiology, and gene expression were analyzed in these genotypes to determine the mechanisms governing the regulation of seed germination by temperature. Germination of the two genotypes was differentially sensitive to abscisic acid (ABA) and gibberellin (GA) at elevated temperatures. Quantitative trait loci associated with these phenotypes colocated with a major quantitative trait locus (Htg6.1) from UC96US23 conferring germination thermotolerance. ABA contents were elevated in Salinas seeds that exhibited thermoinhibition, consistent with the ability of fluridone (an ABA biosynthesis inhibitor) to improve germination at high temperatures. Expression of many genes involved in ABA, GA, and ethylene biosynthesis, metabolism, and response was differentially affected by high temperature and light in the two genotypes. In general, ABA-related genes were more highly expressed when germination was inhibited, and GA- and ethylene-related genes were more highly expressed when germination was permitted. In particular, LsNCED4, a gene encoding an enzyme in the ABA biosynthetic pathway, was up-regulated by high temperature only in Salinas seeds and also colocated with Htg6.1. The temperature sensitivity of expression of LsNCED4 may determine the upper temperature limit for lettuce seed germination and may indirectly influence other regulatory pathways via interconnected effects of increased ABA biosynthesis. PMID:18753282

  5. What Are Chia Seeds?

    Science.gov (United States)

    ... your diet? Chia seeds come from the desert plant Salvia hispanica , a member of the mint family. ... ancient Aztec diet. The seeds of a related plant, Salvia columbariae (golden chia), were used primarily by ...

  6. Seeds and Synergies

    International Development Research Centre (IDRC) Digital Library (Canada)

    'Seeds and Synergies presents inspiring evidence of change in practice and policy ... Seeds of inspiration: breathing new life into the formal agricultural research .... and Urban Development and Poverty Alleviation and Agricultural Commodity ...

  7. Seeds as biosocial commons

    NARCIS (Netherlands)

    Patnaik, Archana

    2016-01-01

    This research investigates and describes the conservation and use of Plant Genetic Resources (PGRs), especially seeds through processes of commonisation. Seeds form an important element for sustaining human life (through food production) and social relations (by maintaining agricultural

  8. Seed dispersal in fens

    NARCIS (Netherlands)

    Middleton, Beth; van Diggelen, Rudy; Jensen, Kai

    Question: How does seed dispersal reduce fen isolation and contribute to biodiversity? Location: European and North American fens. Methods: This paper reviews the literature on seed dispersal to fens. Results: Landscape fragmentation may reduce dispersal opportunities thereby isolating fens and

  9. Phosphate fertilization on production and quality of cauliflower seeds

    Directory of Open Access Journals (Sweden)

    Antonio Ismael Inácio Cardoso

    2016-08-01

    Full Text Available ABSTRACT: Due to the scarcity of information related to the effect of fertilizers on production and quality of vegetable seeds, mainly on species which present an increase in the cycle, like cauliflower, more studies are necessary about the influence of nutrients rates which provide high production of high-quality seeds. This research aimed to evaluate the influence of rates of phosphorus (P on the production and quality of cauliflower seeds. Five rates of phosphorus were studied (0, 300, 600, 900 and 1200kg ha-1 of P2O5, in a randomized complete block design, with four replications. Production and quality (weight of a thousand seeds, germination test, first count of germination test and emergence in substrate of the seeds and soil chemical characteristics were evaluated. The higher the rate of phosphorus, the higher P content in the soil and values of sum of bases, cation exchange capacity and saturation of bases were observed at the end of the cycle. Seed quality was not affected by P fertilization, with the exception of the weight of a thousand seeds which was adjusted to a linear model. For seed production quadratic effect was obtained. The highest weight of seeds per plant was estimated for the rate of 862kg ha-1 of P2O5.

  10. Thyroid weight with age

    International Nuclear Information System (INIS)

    Raulier-Fabry, C.; Hammer, R.

    1965-01-01

    A large number of data on thyroid weight of euthyroid subjects have been collected from the literature in this study. The most probable average weight of the gland appears to be 20 g in the adult and 2 g in the newborn. A decrease in weight has been observed during the first year of life (1 g at 6 months) and only in the second year of life the initial birth weight is reached again. The weight curve may be considered as consisting of three straight lines: from 2 to 7, from 7 to 18 and from 18 to 25 years, their slopes being respectively 0.6, 0.9 and 0.5 g/year. The variations in weight of the thyroid during adulthood are sufficiently small to consider it as having constant value between 25 and 55 years. The available information points to a negligible weight difference between sexes. (authors) [fr

  11. Seed development and carbohydrates

    NARCIS (Netherlands)

    Wittich, P.E.

    1998-01-01

    Seeds assure the plant the onset of a next generation and a way of dispersal. They consist of endosperm and an embryo (originating from gametophytic tissue), enveloped by a seed coat (sporophytic tissue). Plants generate different types of seeds. For instance, the endosperm may either be

  12. Effects of gamma radiation in tomato seeds

    Energy Technology Data Exchange (ETDEWEB)

    Wiendl, Toni A.; Wiendl, Fritz W.; Franco, Suely S.H.; Franco, Jose G.; Althur, Valter, E-mail: tawiendl@hotmail.com, E-mail: gilmita@uol.com.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Arthur, Paula B., E-mail: arthur@cena.usp.br [Centro de Energia Nuclear na Agricultura (CENA/USP), Piracicaba, SP (Brazil)

    2013-07-01

    Tomato dry seeds of the hybrid 'Gladiador' F1 were exposed to low doses of gamma radiation from Co-60 source at 0,509 kGy tax rate in order to study stimulation effects of radiation on germination and plant growth. Eight treatments radiation doses were applied as follows: 0 (control); 2,5; 5,0; 7,5; 10,0; 12,5; 15,0; 20,0 Gy. Seed germination as well as green fruits number, harvested fruit number, fruit weight and total production were assessed to identify occurrence of stimulation. Tomato seeds and plants were handled as for usual tomato production in Brazil. Low doses of gamma radiation treatment in the seeds stimulate germination and substantially increase fruit number and total production up to 86% at 10 Gy dose. There are evidences that the use of low doses of gamma radiation can stimulate germination and plant production thus, showing hormetic effects. (author)

  13. Effects of gamma radiation in tomato seeds

    International Nuclear Information System (INIS)

    Wiendl, Toni A.; Wiendl, Fritz W.; Franco, Suely S.H.; Franco, Jose G.; Althur, Valter; Arthur, Paula B.

    2013-01-01

    Tomato dry seeds of the hybrid 'Gladiador' F1 were exposed to low doses of gamma radiation from Co-60 source at 0,509 kGy tax rate in order to study stimulation effects of radiation on germination and plant growth. Eight treatments radiation doses were applied as follows: 0 (control); 2,5; 5,0; 7,5; 10,0; 12,5; 15,0; 20,0 Gy. Seed germination as well as green fruits number, harvested fruit number, fruit weight and total production were assessed to identify occurrence of stimulation. Tomato seeds and plants were handled as for usual tomato production in Brazil. Low doses of gamma radiation treatment in the seeds stimulate germination and substantially increase fruit number and total production up to 86% at 10 Gy dose. There are evidences that the use of low doses of gamma radiation can stimulate germination and plant production thus, showing hormetic effects. (author)

  14. Changes in metallothionein concentrations in response to variation in natural factors (salinity, sex, weight) and metal contamination in crabs from a metal-rich estuary.

    Science.gov (United States)

    Legras; Mouneyrac; Amiard; Amiard-Triquet; Rainbow

    2000-04-05

    Intermoult male and female crabs Pachygrapsus marmoratus and Carcinus maenas were sampled from three sites between the mouth and 25 km upstream in the Gironde, the most Cd-contaminated estuary in France, in order to study the relative importance of natural factors (salinity, sex, weight) and accumulated metal concentrations on metallothionein (MT) concentrations. In the two species studied, higher metal, total protein and MT concentrations were observed in the hepatopancreas than in the gills. In P. marmoratus, MT concentrations were mainly related to changes in the natural factors even if MT and Zn concentrations were positively correlated in the hepatopancreas whereas in C. maenas, the main relationships were with accumulated metal levels. In the case of the natural factors, the most important ones were weight in gills of both crab species, and salinity changes in both hepatopancreas and gills of P. marmoratus. Cd and Cu concentrations in both organs of the two species were inversely related to salinity. The same observation was found for Zn concentrations in C. maenas but not in P. marmoratus. In the hepatopancreas of both species, the highest total protein concentrations were found in crabs from the site with the highest salinity, whereas there were no such differences in the gills. It seems that changes in MT concentrations are linked more to changes in general protein metabolism than to changes in metal accumulation. Thus it was important to examine the storage of metals in other tissue compartments, particularly the insoluble fraction which includes mineral granules which is known to also contribute to trace metal detoxification in invertebrates. In the gills of the crabs, Zn was present mainly in the insoluble fraction, whereas Cd was nearly equally distributed between soluble and insoluble fractions. In contrast, Cu in the gills and all three metals in the hepatopancreas of both species were mainly cytosolic, but this does not necessarily imply a

  15. empirical study of the characteristics of afzelia africana seed under

    African Journals Online (AJOL)

    HP

    significant probably because of the thick seed coat. True density did not show a consistent variation with change in moisture content. 3.2 Mechanical Properties. The mechanical properties study was conducted using the data obtained from the compressive loading of the. Afzelia Africana seeds in a monsan to tensiometer.

  16. Identification of seed-related QTL in Brassica rapa

    NARCIS (Netherlands)

    Bagheri, H.; Pino del Carpio, D.; Hanhart, C.J.; Bonnema, A.B.; Keurentjes, J.J.B.; Aarts, M.G.M.

    2013-01-01

    To reveal the genetic variation, and loci involved, for a range of seed-related traits, a new F2 mapping population was developed by crossing Brassica rapa ssp. parachinensis L58 (CaiXin) with B. rapa ssp. trilocularis R-o-18 (spring oil seed), both rapid flowering and self-compatible. A linkage map

  17. Functional properties and Solubility of date seed proteins as ...

    African Journals Online (AJOL)

    Med ali

    2013-03-06

    Mar 6, 2013 ... Key words: Phoenix dactylifera L, date palm seed, fibre, protein, functional properties. INTRODUCTION. The date .... was employed to perform dynamic measurements. ... are likely to be composed of high-molecular weight.

  18. Immunogenic Properties of Ricinus Communis Var Minor Seed on ...

    African Journals Online (AJOL)

    Prof. Ogunji

    1College of Health Technology, Zawan, Plateau State.2Department of ... Ricinus communis var minor seed included in their feed (5g/100g body weight). ... White Blood cell Count (WBC) count and lymphocytosis in the differential count.

  19. Seed harvesting by a generalist consumer is context-dependent: Interactive effects across multiple spatial scales

    Science.gov (United States)

    Ostoja, Steven M.; Schupp, Eugene W.; Klinger, Rob

    2013-01-01

    Granivore foraging decisions affect consumer success and determine the quantity and spatial pattern of seed survival. These decisions are influenced by environmental variation at spatial scales ranging from landscapes to local foraging patches. In a field experiment, the effects of seed patch variation across three spatial scales on seed removal by western harvester ants Pogonomyrmex occidentalis were evaluated. At the largest scale we assessed harvesting in different plant communities, at the intermediate scale we assessed harvesting at different distances from ant mounds, and at the smallest scale we assessed the effects of interactions among seed species in local seed neighborhoods on seed harvesting (i.e. resource–consumer interface). Selected seed species were presented alone (monospecific treatment) and in mixture with Bromus tectorum (cheatgrass; mixture treatment) at four distances from P. occidentalis mounds in adjacent intact sagebrush and non-native cheatgrass-dominated communities in the Great Basin, Utah, USA. Seed species differed in harvest, with B. tectorum being least preferred. Large and intermediate scale variation influenced harvest. More seeds were harvested in sagebrush than in cheatgrass-dominated communities (largest scale), and the quantity of seed harvested varied with distance from mounds (intermediate-scale), although the form of the distance effect differed between plant communities. At the smallest scale, seed neighborhood affected harvest, but the patterns differed among seed species considered. Ants harvested fewer seeds from mixed-seed neighborhoods than from monospecific neighborhoods, suggesting context dependence and potential associational resistance. Further, the effects of plant community and distance from mound on seed harvest in mixtures differed from their effects in monospecific treatments. Beyond the local seed neighborhood, selection of seed resources is better understood by simultaneously evaluating removal at

  20. Weight Management

    Science.gov (United States)

    ... Health Information Weight Management English English Español Weight Management Obesity is a chronic condition that affects more ... Liver (NASH) Heart Disease & Stroke Sleep Apnea Weight Management Topics About Food Portions Bariatric Surgery for Severe ...

  1. Impact of seeding rate, seeding date, rate and method of phosphorus application in faba bean (Vicia faba L. minor in the absence of moisture stress

    Directory of Open Access Journals (Sweden)

    Turk M.A.

    2002-01-01

    Full Text Available Field experiments were conducted during the winter seasons of 1998-1999, 1999-2000 and 2000-2001 at the semi-arid region in north of Jordan, to study the effect of seeding dates (14 January, 28 January and 12 February, seeding rates (50, 75 and 100 plants per metre, phosphorus levels (0, 17.5, 35.0 and 52.5 kg P per ha and two methods of P placement (banding and broadcast. Seeding rate, seeding date, and rate of phosphorus had a significant effect on most of the measured traits and the yield determinates. Method of phosphorus application had only a significant effect on seed yield and seed weight per plant. In general high yields were obtained by early seeding (14 January, high seeding rate (100-plant per square metre, and P application (52.5 kg P per ha drilled with the seed after cultivation (banded.

  2. Effect of microwave irradiation on germination and seedling growth physiological characteristics of alfalfa seeds after storage

    International Nuclear Information System (INIS)

    Chen Liyu; Zhang Shuqing; Li Jianfeng; Shi Shangli; Huo Pinghui

    2012-01-01

    In order to study the effect of microwave irradiation on germination and growth physiological characteristics of seeds that stored for years, the irradiated alfalfa seeds that stored at room temperature for 2 years were used to conduct the germination and pot culture tests, and the germination rate, radical elongation, growth height, individual nodule, nitrogenase activity, chlorophyll content and chlorophyll fluorescence parameters were measured. On the 15th day of germination, the germination rates of all the treatments are higher than that of the control, which decrease with the elongation of time. On the llst day of germination, the radical length of all the treatments is lower than that of the control. Growth height, individual nodule, fresh weight and dry weight for the 40 s irradiation treatment are higher than that of the control. Nitrogenase activity of all the treatments is lower than that of the control (P < O.05). The chlorophyll content reaches its maximum when being irradiated for 10 s, and the variation for F 0 and F v /F m of all treatments indicates that the light conversion efficiency of the leaves derived from the irradiated alfalfa seeds that stored for 2 a at room temperature is still relatively stressed. (authors)

  3. Biostimulant on faveiro (Dimorphandra mollis Benth. seeds and seedling vigor

    Directory of Open Access Journals (Sweden)

    Tathiana Elisa Masetto

    2012-06-01

    Full Text Available This work aimed to verify the effects of biostimulant doses, applied through seeds, on faveiro (Dimorphandra mollis Benth. seeds and seedlings vigor. Seeds were previously sulfuric acid scarified in two consecutive years experiments. On 2006 August (first experiment seeds were submitted on Stimulate®: 0; 3.5; 7.0; 10.5 and 14 mL.0.5 Kg-1 doses (first experiment; and seeds picked in August, 2007, were Stimulate:0; 15; 20 and 25 mL.0.5Kg-1 of seeds treated (second experiment. After the biostimulant treatment seeds were sowed in cells trays containing 1:1 (v:v distroferric red latosol + plantmax®. The effect of different Stimulate® doses on Dimorphandra mollis seeds collected in different years were evaluated on the emergency percentage, speed emergency index, root length, aerial part height and dry seedling weight. It was conducted on entirely casualized with four repetitions of 25 seeds each treatment. The 14 mL (2006 lot and 15 mL (2007 lot 0.5Kg-1 of seeds doses provided larger percentage (50% and 66%, respectively and speed emergency indexes (0.67 and 0.9 respectively. The 20 mL.0.5Kg-1 of seeds dose treatment favored the aerial part length, but it didn't influenced the other Dimorphandra mollis seedlings vigor indexes.

  4. Effect of planting dates on seed yield and seed quality of Stylosanthes guianensis CIAT 184

    Directory of Open Access Journals (Sweden)

    Chureerat Satjipanon

    2005-11-01

    Full Text Available The objective of this experiment was to investigate the effect of planting dates on seed yield and quality of Stylosanthes guianensis CIAT 184 at Khon Kaen Animal Nutrition Research and Development Center, during May 2003 to February 2004. A randomized complete block design with four replications was used. Experimental treatments consisted of four planting dates spaced at about 30-day intervals from 23 May to 23 August 2003.The results revealed that planting date had a significant effect on seed yields and pure germinable seed yields (PGSY of S. guianensis CIAT 184. Plots planted on 23 July produced the highest seed yield and PGSY of 630 and 601 kg/ha, respectively followed by plots planted on 23 June and 23 May (514 and 501; 443 and 421 kg/ha, respectively. Plots planted on 23 August produced the lowest seed yield and PGSY of 269 and 262 kg/ha, respectively. There were no significant differences in seed purity percentage, germination percentage and 1000-seed weight among planting dates. Based on this research, it was concluded that late- July was the optimum planting date for S. guianensis CIAT 184 cultivation for seed production in Northeast Thailand.

  5. Prevalence of metabolic syndrome using weight and weight indices ...

    African Journals Online (AJOL)

    Background: Notions about the metabolic syndrome (MS) emphasized the importance of obesity. This may prevent the early diagnosis of the condition in normal weight individuals. Aim: To determine variations in prevalence of MS according to different weight and weight indices. Materials and Methods: 342 apparently ...

  6. Seed vigour and crop establishment: extending performance beyond adaptation.

    Science.gov (United States)

    Finch-Savage, W E; Bassel, G W

    2016-02-01

    Seeds are central to crop production, human nutrition, and food security. A key component of the performance of crop seeds is the complex trait of seed vigour. Crop yield and resource use efficiency depend on successful plant establishment in the field, and it is the vigour of seeds that defines their ability to germinate and establish seedlings rapidly, uniformly, and robustly across diverse environmental conditions. Improving vigour to enhance the critical and yield-defining stage of crop establishment remains a primary objective of the agricultural industry and the seed/breeding companies that support it. Our knowledge of the regulation of seed germination has developed greatly in recent times, yet understanding of the basis of variation in vigour and therefore seed performance during the establishment of crops remains limited. Here we consider seed vigour at an ecophysiological, molecular, and biomechanical level. We discuss how some seed characteristics that serve as adaptive responses to the natural environment are not suitable for agriculture. Past domestication has provided incremental improvements, but further actively directed change is required to produce seeds with the characteristics required both now and in the future. We discuss ways in which basic plant science could be applied to enhance seed performance in crop production. © The Author 2015. Published by Oxford University Press on behalf of the Society for Experimental Biology. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  7. Germinant size of jack pine in relation to seed size and geographic origin

    Science.gov (United States)

    C.W. Yeatman

    1966-01-01

    The initial size of conifer seedlings is closely related to seed size (Hadders 1963), and seed size is a maternal characteristic that is highly subject to environmental modification (Mergen et al. 1964; Righter 1945). The effect of seed weight must be accounted for in critical studies of seedlings which attempt to attribute differences in growth to specific genetic or...

  8. Tolerance of Ruppia sinensis Seeds to Desiccation, Low Temperature, and High Salinity With Special Reference to Long-Term Seed Storage.

    Science.gov (United States)

    Gu, Ruiting; Zhou, Yi; Song, Xiaoyue; Xu, Shaochun; Zhang, Xiaomei; Lin, Haiying; Xu, Shuai; Yue, Shidong; Zhu, Shuyu

    2018-01-01

    Seeds are important materials for the restoration of globally-threatened marine angiosperm (seagrass) populations. In this study, we investigated the differences between different Ruppia sinensis seed types and developed two feasible long-term R. sinensis seed storage methods. The ability of R. sinensis seeds to tolerate the short-term desiccation and extreme cold had been investigated. The tolerance of R. sinensis seeds to long-term exposure of high salinity, cold temperature, and desiccation had been considered as potential methods for long-term seed storage. Also, three morphological and nine physiological indices were measured and compared between two types of seeds: Shape L and Shape S. We found that: (1) wet storage at a salinity of 30-40 psu and 0°C were the optimal long-term storage conditions, and the proportion of viable seeds reached over 90% after a storage period of 11 months since the seeds were collected from the reproductive shoots; (2) dry condition was not the optimal choice for long-term storage of R. sinensis seeds; however, storing seeds in a dry condition at 5°C and 33 ± 10% relative humidity for 9 months had a relatively high percentage (74.44 ± 2.22%) of viable seeds, consequently desiccation exposure could also be an acceptable seed storage method; (3) R. sinensis seeds would lose vigor in the interaction of extreme cold (-27°C) and desiccation; (4) there were significant differences in seed weight, seed curvature, and endocarp thickness between the two types of seeds. These findings provided fundamental physiological information for R. sinensis seeds and supported the long-term storage of its seeds. Our results may also serve as useful reference for seed storage of other threatened seagrass species and facilitate their ex situ conservation and habitat restoration.

  9. Tolerance of Ruppia sinensis Seeds to Desiccation, Low Temperature, and High Salinity With Special Reference to Long-Term Seed Storage

    Directory of Open Access Journals (Sweden)

    Ruiting Gu

    2018-03-01

    Full Text Available Seeds are important materials for the restoration of globally-threatened marine angiosperm (seagrass populations. In this study, we investigated the differences between different Ruppia sinensis seed types and developed two feasible long-term R. sinensis seed storage methods. The ability of R. sinensis seeds to tolerate the short-term desiccation and extreme cold had been investigated. The tolerance of R. sinensis seeds to long-term exposure of high salinity, cold temperature, and desiccation had been considered as potential methods for long-term seed storage. Also, three morphological and nine physiological indices were measured and compared between two types of seeds: Shape L and Shape S. We found that: (1 wet storage at a salinity of 30–40 psu and 0°C were the optimal long-term storage conditions, and the proportion of viable seeds reached over 90% after a storage period of 11 months since the seeds were collected from the reproductive shoots; (2 dry condition was not the optimal choice for long-term storage of R. sinensis seeds; however, storing seeds in a dry condition at 5°C and 33 ± 10% relative humidity for 9 months had a relatively high percentage (74.44 ± 2.22% of viable seeds, consequently desiccation exposure could also be an acceptable seed storage method; (3 R. sinensis seeds would lose vigor in the interaction of extreme cold (-27°C and desiccation; (4 there were significant differences in seed weight, seed curvature, and endocarp thickness between the two types of seeds. These findings provided fundamental physiological information for R. sinensis seeds and supported the long-term storage of its seeds. Our results may also serve as useful reference for seed storage of other threatened seagrass species and facilitate their ex situ conservation and habitat restoration.

  10. High voltage electric field effects on structure and biological characteristics of barley seeds

    Energy Technology Data Exchange (ETDEWEB)

    Khazaei, J. [Tehran Univ., Tehran (Iran, Islamic Republic of). Dept. of Agrotechnology, Univ. College of Abouraihan; Aliabadi, E. [Tehran Univ., Tehran (Iran, Islamic Republic of). Dept. of Crop Production Horticulture, Univ. College of Aburaihan; Shayegani, A.A. [Tehran Univ., Tehran (Iran, Islamic Republic of). Univ. College of Engineering

    2010-07-01

    Electric biostimulation of seeds is a pre-sowing treatment in which an electric field is applied to seeds to increase germination of non standard seeds. This paper reported on a study that examined the effects of AC electric field and exposure time on the structure and biological characteristics of barley seeds. The objective was to determine the potential to accelerate seed germination, plant growth and root development by the electric field strength and exposure time. Makooei cultivar barley seeds were used in this study. The effect of electric field strength (at 2, 4, 9, and 14 kV/m) and exposure time (at 15, 45, 80, and 150 min) on seed germination was studied along with height of seedling, length or root, height of stem, length of leaves, earliness, dry weight and wet weight of seedling. The treated seeds were stored for a month in a refrigerator at 5 degrees C prior to the germination experiments. The initial germination percent of the seed was 81 per cent. The treatment of barley seeds in an AC electric field had a positive effect on all investigated parameters. The germination percent of the treated seed increased to 94.5 per cent . The seeds exposed for long periods of time (45 to 150 min) showed better germination than the seeds exposed to lower exposure times. Dry and wet weights of seedling increased 143.4 per cent and 45.7 per cent, respectively.

  11. Improvement of sesame (Sesamum Indicum L.) using mutations induced by gamma rays and chemical mutagens. I-Study of variation in radiosensitivity of sesame as a function of seed water content

    International Nuclear Information System (INIS)

    Arabi, M.I.; Almouslem, A.B.

    2000-02-01

    Sorption curve representing the development of water content versus relative. The study of humidity in sesame seeds (cv. Zoury), shows that water is present in three different states: constitutive water at less than 2.89%, absorption between 2.89 and 5.57% an free water more than 5.57%. Along with these water states, radiosensitivity is found to be high, low and high respectively. (Author)

  12. Hot seeding using large Y-123 seeds

    International Nuclear Information System (INIS)

    Scruggs, S J; Putman, P T; Zhou, Y X; Fang, H; Salama, K

    2006-01-01

    There are several motivations for increasing the diameter of melt textured single domain discs. The maximum magnetic field produced by a trapped field magnet is proportional to the radius of the sample. Furthermore, the availability of trapped field magnets with large diameter could enable their use in applications that have traditionally been considered to require wound electromagnets, such as beam bending magnets for particle accelerators and electric propulsion. We have investigated the possibility of using large area epitaxial growth instead of the conventional point nucleation growth mechanism. This process involves the use of large Y123 seeds for the purpose of increasing the maximum achievable Y123 single domain size. The hot seeding technique using large Y-123 seeds was employed to seed Y-123 samples. Trapped field measurements indicate that single domain samples were indeed grown by this technique. Microstructural evaluation indicates that growth can be characterized by a rapid nucleation followed by the usual peritectic grain growth which occurs when large seeds are used. Critical temperature measurements show that no local T c suppression occurs in the vicinity of the seed. This work supports the suggestion of using an iterative method for increasing the size of Y-123 single domains that can be grown

  13. Oil palm seed distribution

    Directory of Open Access Journals (Sweden)

    Durand-Gasselin Tristan

    2005-03-01

    Full Text Available For a tropical plant, the oil palm commodity chain has the peculiarity of possessing a major seed production sector for reasons that are primarily genetic. This seed sector has numerous original aspects. Breeders are also propagators and usually also distribute their seeds. Oil palm seeds are semi-recalcitrant: they display pseudo-dormancy. Achieving seed germination is difficult and requires lengthy treatments and special installations. This restriction greatly influences seed distribution and the role of the different stakeholders in the commodity chain. It was only once it had been discovered how the “sh” gene functioned, which controls shell thickness, and when it became necessary to produce “tenera” seeds derived from exclusively “dura x pisifera” crosses, that a true seed market developed. In addition it is difficult to organize seed distribution to smallholders. This is partly due to difficulties that the profession, or a State-run organization, has in controlling middlemen networks, and partly to the absence of any protective systems (UPOV, plant breeder certificate, etc. that generally oblige breeders to preserve and propagate parents in their own installations. In fact there are major inequalities in the access to seeds between agroindustry and smallholders. Another peculiarity of the oil palm seed market is the virtually total absence of guarantees for buyers: the quality of the research conducted by breeders, the seed production strategies necessary for transferring genetic progress, and the technical quality of production. The only guarantee today comes from the relations of confidence established year after year between breeders/distributors and growers. In this fields, research can lead to some proposals: molecular biology offers some interesting prospects for certifying seed quality and social science develop effective communication methods.

  14. Analysis of river health variation under the background of urbanization based on entropy weight and matter-element model: A case study in Huzhou City in the Yangtze River Delta, China.

    Science.gov (United States)

    Pan, Guangbo; Xu, Youpeng; Yu, Zhihui; Song, Song; Zhang, Yuan

    2015-05-01

    Maintaining the health of the river ecosystem is an essential ecological and environmental guarantee for regional sustainable development and one of the basic objectives in water resource management. With the rapid development of urbanization, the river health situation is deteriorating, especially in urban areas. The river health evaluation is a complex process that involves various natural and social components; eight eco-hydrological indicators were selected to establish an evaluation system, and the variation of river health status under the background of urbanization was explored based on entropy weight and matter-element model. The comprehensive correlative degrees of urban river health of Huzhou City in 2001, 2006 and 2010 were then calculated. The results indicated that river health status of the study area was in the direction of pathological trend, and the impact of limiting factors (such as Shannon's diversity index and agroforestry output growth rate) played an important role in river health. The variation of maximum correlative degree could be classified into stationary status, deterioration status, deterioration-to-improvement status, and improvement-to-deterioration status. There was a severe deterioration situation of river health under the background of urbanization. Copyright © 2015 Elsevier Inc. All rights reserved.

  15. Does the informal seed system threaten cowpea seed health?

    NARCIS (Netherlands)

    Biemond, P.C.; Oguntade, O.; Lava Kumar, P.; Stomph, T.J.; Termorshuizen, A.J.; Struik, P.C.

    2013-01-01

    Most smallholder farmers in developing countries depend on an informal Seed System (SS) for their seed. The informal SS is often criticized because farmer-produced seed samples are not tested for seed health, thus accepting the risk of planting infected seeds. Here we aimed at assessing the quality

  16. Fresh and matured lamb meat quality fed with sunflower seeds and vitamin E

    OpenAIRE

    Sales,Ronaldo Oliveira; Silva Sobrinho,Américo Garcia da; Zeola,Nivea Maria Brancacci Lopes; Lima,Natália Ludmila Lins; Manzi,Gabriela Milani; Almeida,Fabiana Alves de; Endo,Viviane

    2013-01-01

    The objective of the study is to evaluate meat quality from Ile de France lamb fed diets supplemented with sunflower seeds and vitamin E. Thirty-two lamb weighing initially 15kg were housed in individual stalls and slaughtered when body weight reached 32kg. The treatments consisted of four experimental diets: D1) sugarcane + concentrate without sunflower seeds; D2) sugarcane + concentrate with sunflower seeds; D3) sugarcane + concentrate without sunflower seeds plus 1000mg vitamin E kg-1 diet...

  17. The Effect of Seed Size on Seed Vigor Indices of Different Wheat Cultivars

    Directory of Open Access Journals (Sweden)

    H Tavakoli Kakhki

    2011-01-01

    Full Text Available Abstract Germination and beneficial seedling establishment is affected by different seed vigor indices. In order to study the effect of seed size on seed vigor indices of wheat, a factorial experiment with two factors was conducted in a completely randomized design with four replications at the Agricultural Natural Resources Research Center Lab of Khorasan Razavi. The first factor was thirteen genotypes of wheat in three types of growth, containing winter, facultative and spring and the second factor was seed size in four levels including 3, 2.5, 2 and 1.5 millimeter. Germination percentage, germination rate, shoots and root length, seedling growth rate and shoot:root length ratio characteristics were investigated. Analysis of variance showed that the effect of wheat cultivars and seed size on traits was significant (p≤ 0.01 but interaction effect of seed size and wheat cultivar was significant (p≤ 0.01 only for shoot and root length, seedling growth rate and shoot:root length ratio. The highest and lowest seedling growth rate was (15.85 and 8.23 mg dry weight/germinal seedling that they were related to 3 and 1.5mm seed size, respectively. According to these observations the most and least percentage and germination rate was related to these seed size treatments. Correlation coefficient of seed size and seedling growth rate was highly significant (r=0.85 p≤ 0.01. Stepwise regression method indicated that the seed size (x1 and shoot length (x2 as independent variables could be described (r2=0.84 seedling growth rate as a dependent variable in y= -5.000955+(5.128078x1+(0.78494x2 equation. Keywords: Seedling growth rate, Germination rate, Correlation, Regression

  18. All rights reserved Variation in Body Weight, Organ Weight and ...

    African Journals Online (AJOL)

    ADOWIE PERE

    The result showed that the treated flour supported growth but had no definite effect on other parameters ... Seven (7) diets were formulated using corn starch, ... cooked kudzu and diet eight (8) was the reference diet (nutrend). The diets were formulated to provide. 16% protein. A total of forty(40) weaning albino rats of the ...

  19. Stability in and correlation between factors influencing genetic quality of seed lots in seed orchard of Pinus tabuliformis Carr. over a 12-year span.

    Directory of Open Access Journals (Sweden)

    Wei Li

    Full Text Available Coniferous seed orchards require a long period from initial seed harvest to stable seed production. Differential reproductive success and asynchrony are among the main factors for orchard crops year-to-year variation in terms of parental gametic contribution and ultimately the genetic gain. It is fundamental in both making predictions about the genetic composition of the seed crop and decisions about orchard roguing and improved seed orchard establishment. In this paper, a primary Chinese pine seed orchard with 49 clones is investigated for stability, variation and correlation analysis of factors which influence genetic quality of the seed lots from initial seed harvest to the stable seed production over a 12 years span. Results indicated that the reproductive synchrony index of pollen shedding has shown to be higher than that of the strobili receptivity, and both can be drastically influenced by the ambient climate factors. Reproductive synchrony index of the clones has certain relative stability and it could be used as an indication of the seed orchard status during maturity stage; clones in the studied orchard have shown extreme differences in terms of the gametic and genetic contribution to the seed crop at the orchard's early production phase specifically when they severe as either female or male parents. Those differences are closely related to clonal sex tendency at the time of orchard's initial reproduction. Clonal gamete contribution as male and female parent often has a negative correlation. Clone utilization as pollen, seed or both pollen and seed donors should consider the role it would play in the seed crop; due to numerous factors influencing on the mating system in seed orchards, clonal genetic contribution as male parent is uncertain, and it has major influence on the genetic composition in the seed orchard during the initial reproductive and seed production phase.

  20. Yield and Quality of Mung Bean (Vigna radiata (l. R. Wilczek Seeds Produced in Poland

    Directory of Open Access Journals (Sweden)

    Kamil MISIAK

    2017-11-01

    Full Text Available The aim of the experiment was to do field and laboratory assessments of yield and quality of mung bean (Vigna radiata (L. R. Wilczek seeds cultivated in Western Poland. Mean yield of seeds per plant was higher for common bean (Phaseolus vulgaris L. than for mung one: 13.1 g and 2.58 g, respectively. The mean 1000 mung seeds weight was 50.9 g and their germination – 78 %. Germination capacities of seeds of both beans in the field were similar. Mung beans, compared to common bean, had much smaller seeds, started to bloom later and produced mature seeds later than the latter. Mung bean seeds had more total proteins and Magnesium and Copper than common bean seeds. In Western Poland, production of high quality mung bean seeds was possible.

  1. FRUIT AND SEED BIOMETRY AND DETERMINATION OF THE WATER ABSORPTION CURVE OF SESBANIA VIRGATA (CAV. PERS.

    Directory of Open Access Journals (Sweden)

    S Acchile

    2017-10-01

    Full Text Available The species Sesbania virgata (Cav. Pers., Fabaceae popularly known as Sesbania or Feijão do Mato, presents potential in the use in areas of afforestation and reforestation forests riparian and degraded areas. The aim of this study was to characterize the biometric of fruits and seeds and determine the germination pattern of the sesbânia seeds. The biometry of the seeds and fruits were established through the characterization of 250 fruits and 500 seeds, which were distributed in frequency classes through position, dispersion and normality measurements. The weight of one thousand seeds (PMS was determined using eight sub samples of the 100 seeds. For to study of the water absorption curve of the seeds were used two replicates of 100 seeds, it weighed in 32 intervals. In this sense, the biometric fruits aspects of S. virgata presented average values for length, width, thickness, weight and number of seeds per fruit of 5.87 cm, 0.78 cm, 0.58 cm, 0.85 g and 5 units, respectively. In relation to the seeds, the average length, width, thickness and seed weight were 0.623 cm; 0.439 cm; 0.316 cm and 0.075 g, respectively. The water absorption of S. virgata seed imbibition presented triphasic pattern, resembling several species of the same family.

  2. Dry pea seed quality depending on seed moisture at harvest and cultivar

    Directory of Open Access Journals (Sweden)

    Milošević Branko

    2010-01-01

    Full Text Available The effect of seed moisture content at harvest on the most important parameters of dry pea was examined. The seed moisture content, germination energy, germination, proportion of abnormal seedlings and 1000-seed weight were analyzed in three dry pea cultivars (Jezero, Javor and NS-Junior and at eight harvest stages. At the first harvest stage, seed moisture content was 20.44%, while at the eighth stage it was 11.26%. The best seed quality, with germination energy of 81.70% and germination of 90.11%, was at the sixth harvest time when seed moisture content was 12.92%. The poorest seed quality one was at the first harvest stage, with germination energy of 68.55% and germination of 78.56%. Cultivar Jezero, with shorter growing season, determinant stem growth and uniform maturity, had the highest germination energy (82.00%, germination (92.21% and percent of abnormal seedlings (1.96%. Cultivar NS Junior, with the longest growing season, indeterminant stem growth and non-uniform maturity, had the lowest germination energy (70.39% and germination (76.54%, and the highest percent of abnormal seedlings (3.58%.

  3. Producing the target seed: Seed collection, treatment, and storage

    Science.gov (United States)

    Robert P. Karrfalt

    2011-01-01

    The role of high quality seeds in producing target seedlings is reviewed. Basic seed handling and upgrading techniques are summarized. Current advances in seed science and technology as well as those on the horizon are discussed.

  4. Harvest time of Cryptomeria japonica seeds depending on climate factors

    Science.gov (United States)

    Son, Seog-Gu; Kim, Hyo-Jeong; Kim, Chang-Soo; Byun, Kwang-Ok

    2010-05-01

    Sound seeds should have good germination rates and seed germination can be influenced by several factors. Seed picking time is regarded as one of the necessary elements to obtain sound seeds. From a clonal seed orchard of Cryptomeria japonica located in southern part of Korean peninsular, cones were picked about every 10 days from 30th of July 2005 to 30th of October in both 2005 and 2006. We have also analyzed the effects of climatic factors about two consecutive years on seed productivity. From the picked cones, seeds were collected and these germination ability, seed size and embryo shapes were investigated according to cone picking time. The 1,000-seed weight picked on 18th of August was 3.3 g and 5.3 g on 30th of September 2005and 2006. The size of seeds picked from 18th of August to 30th of September increased from 19.3 mm to 21.3 mm in length and from 15.8 mm to 18.5 mm in width. Depending on picking time, various shapes of embryos, including embryos with liquid material, jellied material and fully matured ones were observed. Germination aspects also varied throughout the test days. About two weeks after seeding in a glass petri-dish, germinal apparatuses appeared from each test seed sets which had been picked from after 10 August 2005 and 10 August 2006. The germination rates started from 10.7% from seeds picked 20 August 2006. Average germination rate in 2005 was 18.3 and 19.6 in 2006. In 2005, the highest germination rate was 34.3% from seeds picked on the 30th of September. In 2006, the highest germination rate was 31.7% for seeds picked at the same date as the 2005 seeds. After September, the highest germination rate for picked seeds decreased in both 2005 and 2006. Among the climatic factors, monthly sum of temperature and of precipitation were the main factors for maturation of C. japonica seeds. The results implied that the best cone picking time for the Korean C. japonica seed orchard to be around the end of September.

  5. Relationship Between Seed Yield And Some of Fruit Traits in Iranian Squash (Cucurbita pepo L. Accissions

    Directory of Open Access Journals (Sweden)

    R. Barzegar

    2016-02-01

    Full Text Available In order to evaluation of squash (Cucurbita pepo seed yield per fruit and its relations with other characteristics of fruit include: length, diameter, length: diameter ratio (fruit shape, flesh thickness, thousand seed weight and fruit weight, an experiment was conducted using 24 accessions of squash as a randomized complete-block design with three replications. Morphological traits were evaluated according to UPOV descriptor and UPGMA clustering algorithm clustered the accessions in 4 groups (predominantly on the basis of fruit shape. Correlation, regression and path analysis were done for mentioned characteristics in 4 type-fruit groups. There was negative correlation between seed yield of individual fruit and its length and fruit length: diameter ratio. But fruit weight, fruit diameter, and thousand seeds weight had positive correlation with seed yield. Seed weight: fruit weight ratio had negative relationship with fruit weight. Therefore small size fruit is more suitable for seed yield per area. Path analysis was showed fruit weight had the most positive direct effect on seed yield per fruit in all groups.

  6. A Reliable Methodology for Determining Seed Viability by Using Hyperspectral Data from Two Sides of Wheat Seeds.

    Science.gov (United States)

    Zhang, Tingting; Wei, Wensong; Zhao, Bin; Wang, Ranran; Li, Mingliu; Yang, Liming; Wang, Jianhua; Sun, Qun

    2018-03-08

    This study investigated the possibility of using visible and near-infrared (VIS/NIR) hyperspectral imaging techniques to discriminate viable and non-viable wheat seeds. Both sides of individual seeds were subjected to hyperspectral imaging (400-1000 nm) to acquire reflectance spectral data. Four spectral datasets, including the ventral groove side, reverse side, mean (the mean of two sides' spectra of every seed), and mixture datasets (two sides' spectra of every seed), were used to construct the models. Classification models, partial least squares discriminant analysis (PLS-DA), and support vector machines (SVM), coupled with some pre-processing methods and successive projections algorithm (SPA), were built for the identification of viable and non-viable seeds. Our results showed that the standard normal variate (SNV)-SPA-PLS-DA model had high classification accuracy for whole seeds (>85.2%) and for viable seeds (>89.5%), and that the prediction set was based on a mixed spectral dataset by only using 16 wavebands. After screening with this model, the final germination of the seed lot could be higher than 89.5%. Here, we develop a reliable methodology for predicting the viability of wheat seeds, showing that the VIS/NIR hyperspectral imaging is an accurate technique for the classification of viable and non-viable wheat seeds in a non-destructive manner.

  7. Efficiency of alfalfa seed processing with different seed purity

    OpenAIRE

    Đokić, Dragoslav; Stanisavljević, Rade; Terzić, Dragan; Milenković, Jasmina; Radivojević, Gordana; Koprivica, Ranko; Štrbanović, Ratibor

    2015-01-01

    The work was carried out analysis of the impact of the initial purity of raw alfalfa seed on the resulting amount of processed seed in the processing. Alfalfa is very important perennial forage legume which is used for fodder and seed production. Alfalfa seed is possible to achieve high yields and very good financial effects. To obtain the seed material with good characteristics complex machines for cleaning and sorting seeds are used. In the processing center of the Institute for forage crop...

  8. Paper (essay on seed

    Directory of Open Access Journals (Sweden)

    Mirić Mladen

    2013-01-01

    Full Text Available Based on detailed studies of the past of the agrarian thought of the world (evolution of agro-innovation, and within it, the relationship of man and seed, the author has selected key data for Table 1. In addition, more or less known folk sayings, proverbs, curses and allegories in which the seed is the key word have been collected. Then, religious books, folk art and literature works (sayings of prominent individuals and experts and observations of the author himself have been studied. According to the collected opus, it can be concluded that the vast importance of seed meaningfully entwined into all spheres of folk life and cultural heritage. Seed is directly tied to the following eight key (revolutionary milestones in the food and economic life of mankind: 1. the first and for the longest time, the seed used to be the main food of the people and the first food reserve; 2. Neolithic Revolution was simply caused by the sowing of seeds; 3. for the sake of sowing man began to develop more complex processing techniques; 4. everywhere and forever, especially since the late 15th century, the seed has been a carrier of (rescuing plants between Europe and the New World, that is, between continents; 5. seed was the first product that has been chemically treated since the mid-18th century; 6. standard operation procedures and quality are promoted on seed by which it became the first product to have prescribed (compulsory methods, but it also became a good whose quality has to be tested before sale; 7. hybrid seed is a 'perpetrator' of the green revolution in the mid-20th century and at last there is disputable seed of genetically modified organisms that are spreading with certain reactions. The author proposes that the United Nations Standard International Trade Classification includes a special section (division which would classify the seed for sowing, while beyond this Classification terms such as seed, plant seed should be replaced with non-seed

  9. Seed dormancy and germination.

    Science.gov (United States)

    Penfield, Steven

    2017-09-11

    Reproduction is a critical time in plant life history. Therefore, genes affecting seed dormancy and germination are among those under strongest selection in natural plant populations. Germination terminates seed dispersal and thus influences the location and timing of plant growth. After seed shedding, germination can be prevented by a property known as seed dormancy. In practise, seeds are rarely either dormant or non-dormant, but seeds whose dormancy-inducing pathways are activated to higher levels will germinate in an ever-narrower range of environments. Thus, measurements of dormancy must always be accompanied by analysis of environmental contexts in which phenotypes or behaviours are described. At its simplest, dormancy can be imposed by the formation of a simple physical barrier around the seed through which gas exchange and the passage of water are prevented. Seeds featuring this so-called 'physical dormancy' often require either scarification or passage through an animal gut (replete with its associated digestive enzymes) to disrupt the barrier and permit germination. In other types of seeds with 'morphological dormancy' the embryo remains under-developed at maturity and a dormant phase exists as the embryo continues its growth post-shedding, eventually breaking through the surrounding tissues. By far, the majority of seeds exhibit 'physiological dormancy' - a quiescence program initiated by either the embryo or the surrounding endosperm tissues. Physiological dormancy uses germination-inhibiting hormones to prevent germination in the absence of the specific environmental triggers that promote germination. During and after germination, early seedling growth is supported by catabolism of stored reserves of protein, oil or starch accumulated during seed maturation. These reserves support cell expansion, chloroplast development and root growth until photoauxotrophic growth can be resumed. Crown Copyright © 2017. Published by Elsevier Ltd. All rights reserved.

  10. Weighted Clustering

    DEFF Research Database (Denmark)

    Ackerman, Margareta; Ben-David, Shai; Branzei, Simina

    2012-01-01

    We investigate a natural generalization of the classical clustering problem, considering clustering tasks in which different instances may have different weights.We conduct the first extensive theoretical analysis on the influence of weighted data on standard clustering algorithms in both...... the partitional and hierarchical settings, characterizing the conditions under which algorithms react to weights. Extending a recent framework for clustering algorithm selection, we propose intuitive properties that would allow users to choose between clustering algorithms in the weighted setting and classify...

  11. Genetic dissection of seed vigour traits in maize (Zea mays L.) under ...

    Indian Academy of Sciences (India)

    YONG SHI

    measurements, the seeds of each genotype were divided into three portions, each consisting of 50 seeds, ... ance (ANOVA) using the general linear model procedure of the statistical software SPSS 12.0. Descriptive ... the phenotypic variation, with five QTL accounting for more than 10% of the total phenotypic variation.

  12. Pollen- and seed-mediated transgene flow in commercial cotton seed production fields.

    Directory of Open Access Journals (Sweden)

    Shannon Heuberger

    Full Text Available BACKGROUND: Characterizing the spatial patterns of gene flow from transgenic crops is challenging, making it difficult to design containment strategies for markets that regulate the adventitious presence of transgenes. Insecticidal Bacillus thuringiensis (Bt cotton is planted on millions of hectares annually and is a potential source of transgene flow. METHODOLOGY/PRINCIPAL FINDINGS: Here we monitored 15 non-Bt cotton (Gossypium hirsutum, L. seed production fields (some transgenic for herbicide resistance, some not for gene flow of the Bt cotton cry1Ac transgene. We investigated seed-mediated gene flow, which yields adventitious Bt cotton plants, and pollen-mediated gene flow, which generates outcrossed seeds. A spatially-explicit statistical analysis was used to quantify the effects of nearby Bt and non-Bt cotton fields at various spatial scales, along with the effects of pollinator abundance and adventitious Bt plants in fields, on pollen-mediated gene flow. Adventitious Bt cotton plants, resulting from seed bags and planting error, comprised over 15% of plants sampled from the edges of three seed production fields. In contrast, pollen-mediated gene flow affected less than 1% of the seed sampled from field edges. Variation in outcrossing was better explained by the area of Bt cotton fields within 750 m of the seed production fields than by the area of Bt cotton within larger or smaller spatial scales. Variation in outcrossing was also positively associated with the abundance of honey bees. CONCLUSIONS/SIGNIFICANCE: A comparison of statistical methods showed that our spatially-explicit analysis was more powerful for understanding the effects of surrounding fields than customary models based on distance. Given the low rates of pollen-mediated gene flow observed in this study, we conclude that careful planting and screening of seeds could be more important than field spacing for limiting gene flow.

  13. Artificial Seeds and their Applications

    Indian Academy of Sciences (India)

    currently working on ... heterozygosity of seed, minute seed size, presence of reduced ... Advantages of Artificial or Synthetic Seeds over Somatic Embryos for Propagation .... hour gives optimum bead hardness and rigidity for the produc-.

  14. The effect of fertilizer level and foliar-applied calcium on seed production and germination of Gerbera hybrida

    DEFF Research Database (Denmark)

    Andreasen, Christian; Kemezys, Andrius Hansen; Müller, Renate

    2014-01-01

    an additional foliar calcium application influenced the same parameters. Subsequently, the effect of the various treatments on the germination of the obtained seeds was explored. Two identical experiments (A and B) were carried out with five concentrations of nutrient solutions corresponding to an electrical...... and seed number, but seed weight and plant biomass were significantly reduced at the highest fertilizer concentration. In both experiments, the seeds germinated slower and less seeds germinated when plants had received the largest amount of fertilizer (6.25 mS·cm-1). In none of the experiments did applied......Gerbera hybrida is an ornamental plant of great commercial interest, which is primarily propagated by seeds. We investigated whether increasing fertilizer concentrations during seed set enhanced plant biomass, number of flower heads, seed set, and seed weight. Furthermore, we studied whether...

  15. Seed thioredoxin h

    DEFF Research Database (Denmark)

    Hägglund, Per; Finnie, Christine; Yano, Hiroyuki

    2016-01-01

    , for example chloroplastic f- and m-type thioredoxins involved in regulation of the Calvin-Benson cycle. The cytosolic h-type thioredoxins act as key regulators of seed germination and are recycled by NADPH-dependent thioredoxin reductase. The present review on thioredoxin h systems in plant seeds focuses...

  16. Saving Seed Microbiomes

    NARCIS (Netherlands)

    Berg, Gabriele; Raaijmakers, J.M.

    2018-01-01

    Plant seeds are home to diverse microbial communities whose composition is determined by plant genotype, environment, and management practices. Plant domestication is now recognized as an important driver of plant-associated microbial diversity. To what extent and how domestication affects seed

  17. Genetic diversity in radish germplasm for morphological traits and seed storage proteins

    International Nuclear Information System (INIS)

    Jatoi, S.A.; Siddiqui, S.U.; Masood, M.S.; Javaid, A.; Iqbal, M.; Sayal, O.U.

    2011-01-01

    Genetic variation of forty-nine local and exotic radish genotypes including two checks was studied for morphological traits and seed storage protein electrophoresis using sodium dodecyl sulphate polyacrylamide gel electrophoresis (SDS-PAGE) markers. A high variation in germplasm for root shape, root length, root colour (internal and external), flesh texture and root type was observed. Among these genotypes, the genetic variation was apparent for most of the characters like plant biomass, root weight, leaf length, root length and root diameter that indicated the potential for crop improvement in these traits through simple selection. Exotic germplasm exhibited higher variation for plant biomass, root weight and root length which could be utilized through breeding programme. Cluster analysis on the basis of genetic diversity for seven quantitative traits resulted into four clusters. No clustering was found on the basis of origin. Low level of variance was observed for SDS-PAGE electrophoresis that suggested acquisition of more germplasm. On the basis of high yield and crispy root texture some genotypes (10076, 10362, 10429, 10658, 10662 and 10667) were identified for further testing under wide range of agro-ecological conditions. (author)

  18. How the food supply harvestable by waders in the Wadden Sea depends on the variation in energy density, body weight, biomass, burying depth and behaviour of tidal-flat invertebrates

    Science.gov (United States)

    Zwarts, Leo; Wanink, Jan H.

    For several reasons, waders in the Wadden Sea face a large seasonal and annual variation in their food supply. Observations on a tidal flat in the Dutch Wadden Sea have shown that: - (1) The average energy density of ten invertebrate prey species varies between 21 and 23 kJ·g -1 AFDW. In Scrobicularia plana and Mya arenaria, but not in Macoma balthica, the energy density is 10% lower in winter than in summer. - (2) Depending on the species, body weights of prey of similar size are 30 to 60% lower in winter than in summer. - (3) The year-to-year fluctuation in standing-crop biomass is larger in some species than in others, the difference depending mainly on the frequency of successful recruitment. The overall biomass of the macrobenthos in winter is half of that in summer, but the timing of the peak biomass differs per species. - (4) The burying depth varies per species: Cerastoderma edule live just beneath the surface, while M. balthica, S. plana, M. arenaria, Arenicola marina and Nereis diversicolor bury more deeply and the majority of these prey live out of reach of the bird's bill. In all six species, burying depth increases with size. There is no seasonal variation in depth of C. edule and M. arenaria, but the four other species live at most shallow depth in early summer and most deeply in midwinter. Burying depths in winter vary from year to year, but are unrelated to temperature. Neither has temperature any effect on depth within months. For knot Calidris canutus feeding on M. balthica, the fluctuation in the accessible fraction was the main source of variation in the biomass of prey that is actually harvestable, i.e. the biomass of prey of suitable size that is accessible. Accordingly, the paper reviews the available data on the temporal variations in accessibility, detectability, ingestibility, digestibility and profitability of prey for waders. Only a small part of the prey is harvestable since many accessible prey are ignored because of their low

  19. The perspective effects of various seed coating substances on rice seed variety Khao DAWK Mali 105 storability I: the case study of physiological properties.

    Science.gov (United States)

    Thobunluepop, P; Pawelzik, E; Vearasilp, S

    2008-10-01

    This study aimed to evaluate the perspective changes of several physiological performances of rice seeds cv. KDML 105 which were coated with various seed coating substances [chemical fungicide, captan (CA) and biological coating polymers; chitosan-lignosulphonate polymer (CL) and eugenol incorporated into chitosan-lignosulphonate polymer (E + CL)] during storage (12 months). CA significantly increased seed moisture content and seed water activity through out the storage period. The qualities and viability of the seeds were seriously declined by this treatment. Moreover, CA inhibited the shoot and root development, seedling dry weight accumulation, delayed the seed germination and seedling growth rate. CA treated seeds were susceptible to stress conditions that declined the seed germination potential under cold, high moisture and temperature stress conditions. Nevertheless, CL and E + CL coating polymer could maintain seed storability, which significantly improved seed germination and seedling performances. These improvements were attributed to maintain the nutritive reserve and dehydrogenase activity in seeds. Moreover, the biological seed treatment stimulated the embryo growth and so speeding up the seedling emergence when compared untreated seeds.

  20. Tissue-specific and minor inter-individual variation in imprinting of IGF2R is a common feature of Bos taurus Concepti and not correlated with fetal weight.

    Directory of Open Access Journals (Sweden)

    Daniela Bebbere

    Full Text Available The insulin-like growth factor 2 receptor (IGF2R is essential for prenatal growth regulation and shows gene dosage effects on fetal weight that can be affected by in-vitro embryo culture. Imprinted maternal expression of murine Igf2r is well documented for all fetal tissues excluding brain, but polymorphic imprinting and biallelic expression were reported for IGF2R in human. These differences have been attributed to evolutionary changes correlated with specific reproductive strategies. However, data from species suitable for testing this hypothesis are lacking. The domestic cow (Bos taurus carries a single conceptus with a similar gestation length as human. We identified 12 heterozygous concepti informative for imprinting studies among 68 Bos taurus fetuses at Day 80 of gestation (28% term and found predominantly maternal IGF2R expression in all fetal tissues but brain, which escapes imprinting. Inter-individual variation in allelic expression bias, i.e. expression of the repressed paternal allele relative to the maternal allele, ranged from 4.6-8.9% in heart, 4.3-10.2% in kidney, 6.1-11.2% in liver, 4.6-15.8% in lung and 3.2-12.2% in skeletal muscle. Allelic bias for mesodermal tissues (heart, skeletal muscle differed significantly (P<0.05 from endodermal tissues (liver, lung. The placenta showed partial imprinting with allelic bias of 22.9-34.7% and differed significantly (P<0.001 from all other tissues. Four informative fetuses were generated by in-vitro fertilization (IVF with embryo culture and two individuals displayed fetal overgrowth. However, there was no evidence for changes in imprinting or DNA methylation after IVF, or correlations between allelic bias and fetal weight. In conclusion, imprinting of Bos taurus IGF2R is similar to mouse except in placenta, which could indicate an effect of reproductive strategy. Common minor inter-individual variation in allelic bias and absence of imprinting abnormalities in IVF fetuses suggest

  1. Seeds of Puerto Rican Trees and Shrubs: Second Installment

    Science.gov (United States)

    John K. Francis; Alberto Rodríguez

    1993-01-01

    Seed weights and germination information were obtained for 119 native Puerto Rican and naturalized exotic trees and shrubs. Fruit was collected from 34 of these species, and the weights were recorded. The data are presented in tables that list the species alphabetically by scientific names.

  2. Effect of seeding rate on grain quality of winter wheat

    Directory of Open Access Journals (Sweden)

    Veselinka Zecevic

    2014-03-01

    Full Text Available Planting density is important factor which influence yield and quality of wheat (Triticum aestivum L. For this reason, in scientific investigations is constantly investigated optimization of plant number per unit area. The objective of this study was to determine the influence of seeding rate in grain quality of winter wheat cultivars. The experiment was conducted with four winter wheat genotypes ('Ana Morava', 'Vizija', 'L-3027', and 'Perla' at the Small Grains Research Centre of Kragujevac, Serbia, in 3 yr at two seeding rates (SR1 = 500 and SR2 = 650 germinating seeds m-2. The 1000-kernel weight, Zeleny sedimentation, and wet gluten content in divergent wheat genotypes were investigated depending on the seeding rate and ecological factors. Significant differences in quality components were established between investigated seeding rates. The highest values of all investigated quality traits were established in SR2 variant when applied 650 seeds m-2. Genotypes reacted differently to seeding rate. 'Perla' in average had the highest mean sedimentation value (42.2 mL and wet gluten content (33.76% in SR2 variant and this cultivar responded the best to seeding rate. Significant differences for sedimentation value and wet gluten content were found among cultivars, years, seeding rate, and for all their interactions. Also, ANOVA for 1000-kernel weight showed highly significant differences among investigated varieties, seeding rate and growing seasons, but all their interactions were not significant. In all investigated genotypes, better quality was established in SR2 variant when applied 650 seeds m-2.

  3. Milla biflora Cav.-seeds, harvest and germination

    Directory of Open Access Journals (Sweden)

    Michał W. Borys

    2013-12-01

    Full Text Available Milla biflora Cav. is one of six species of this genus reported to be present in Mexico. To determine the present and potential seed production of this plant, the following characteristics were studied: the number of flowers per scape, the frequencies of scape with defined number of flower per scape, the conversion of flowers into capsules, the capsule size, seed numbers, average seed size per capsule. Samplings were taken from the natural stands and evaluation of the respective attributes was done in plants growing in germplasm colIection belonging to the University UPAEP. The number of flowers ranged from 1 to 10 per scape, with 90,6% of scapes giving from 1 to 6 flowers. The capsules were formed from flowers in the following proportions: in scapes with one flower - 13,64%, in scapes with 3 flowers - 48,21%, in scapes with four or more flowers - 60%; 67,80 of capsules gave from 60 to 140 seeds; 45% of seeds had the average size from 1,81 to 2,20 mg. The mean weight of 1000 seeds was 1937.2 mg. The seeds germinated during 7 days in water, in 88 to 100%. The plant emergence from soil sown seeds ranged from 41,4 to lOO %. The seeds have not lost the germination ability after 2 years of storage at room conditions.

  4. Ethylene synthesis in lettuce seeds: its physiological significance.

    Science.gov (United States)

    Burdett, A N

    1972-12-01

    The germination and pregermination ethylene production of Grand Rapids lettuce seeds (Lactuca sativa L.) incubated at 20 C after a red light treatment are inhibited if the seeds are first imbibed at 30 C for 36 hours. In this study, low concentrations of ethylene were found to enhance the germination of seeds pretreated at 30 C more than that of untreated controls. In the presence of high concentrations of ethylene, pretreated seeds and controls germinated at a similar rate. These results are consistent with the view that a prolonged imbibition at 30 C inhibits germination at a lower temperature through its effect on the ethylene production of the seeds. As a further test of the hypothesis, estimates were made of the pregermination ethylene content of untreated seeds and pretreated seeds incubated in the presence of sufficient ethylene to make them germinate as rapidly as untreated seeds. The values obtained were 0.65 and 0.74 nanoliter of ethylene per gram (dry weight) of seeds, respectively.

  5. Rate and duration of seed filling and yield of soybean affected by water and radiation deficits

    Directory of Open Access Journals (Sweden)

    Kazem GHASSEMI-GOLEZANI

    2015-11-01

    Full Text Available Seed filling and yield of soybean under water and radiation deficits were investigated during 2011 and 2012. Treatments were irrigations (I1, I2, I3 and I4 for irrigation after 60, 90, 120 and 150 mm evaporation from class A pan, respectively in main plots and light interceptions (L1: 100 %, L2: 65 % and L3: 25 % sunlight in sub-plots. Seeds per plant under I1 and I2 decreased, but under I3 and I4 increasedas a result of radiation deficit. Maximum seed weight and seed filling duration of plants under 25 % light interception (L3 were higher than those under full sunlight (L1 and 65 % light interception (L2. In contrast, plants under full sunlight had the highest seed filling rate, particularly under water stress. Seed filling duration under severe light deficit (L3 was about 9 days longer than that under full sunlight (L1, leading to 15.8 % enhancement in maximum seed weight. Decreasing seed yield of soybean under well watering and mild water stress and improving it under moderate and severe water deficit due to low solar radiation are directly related with changes in seed filling duration and consequently in seed weight and number of seeds per plant under these conditions.

  6. Seed distribution of four co-occurring grasses around Artemisia halodendron shrubs in a sandy habitat

    Science.gov (United States)

    Li, Feng-Rui; Zhao, Wen-Zhi; Kang, Ling-Fen; Liu, Ji-Liang; Huang, Zhi-Gang; Wang, Qi

    2009-05-01

    In a natural population of the perennial semi-shrub Artemisia halodendron in a shifting sandy habitat in the Horqin Desert of eastern Inner Mongolia, six isolated adult A. halodendron individuals of similar canopy size were chosen as target plants. The density of seeds in the top 5 cm soil depth around shrubs was measured using transects aligned to the four main wind directions and at different distances from the shrub base on both the windward and leeward sides. The effects of shrub presence on seed distribution of four co-occurring grasses were examined by linking seed distribution to seed traits. Of the four species, Setaris viridis and Eragrostis pilosa had small but similar seed mass, while Chloris virgata and Aristida adscensionis had large but similar seed mass. The species were grouped into two cohorts: small-seeded vs. large-seeded cohorts, and shrub presence effects on seed distribution of both cohorts were examined. We found marked difference in the seed distribution pattern among species, especially between the small-seeded and large-seeded cohorts. The small-seeded cohort had significantly higher seed accumulation on the windward than the leeward sides in the most and least prevailing wind directions and much higher seed accumulation on the leeward than the windward sides in the second and third most prevailing wind directions, while opposite patterns occurred in the large-seeded cohort. Four species also showed marked variation in the seed distribution pattern among transects and between windward and leeward sides of each transect. This study provided further evidence that shrubs embedded in a matrix of herbaceous plants is a key cause of spatial heterogeneity in seed availability of herbaceous species. However, seed distribution responses to the presence of shrubs will vary with species as well as with wind direction, sampling position (windward vs. leeward sides of the shrub) and distance from the shrub.

  7. No Evidence for Differential Biomass and Mineral Content in Adult Plants Grown from Dimorphic Suaeda Aralocaspica Seeds

    International Nuclear Information System (INIS)

    Wang, L.; Wang, H. L.; Tian, C. Y.; Huang, Z. Y.

    2016-01-01

    The production of two or more seed types by a single plant is known as seed heteromorphism. There have been many comparisons of seed traits or growth between plants grown from heteromorphic seeds. However, information is scarce regarding the mineral contents of adult plants from heteromorphic seeds. We herein present biomass and mineral profiles of adult plants grown from dimorphic seeds (non-dormant brown seeds and black seeds with non-deep physiological dormancy) of the annual desert halophyte Suaeda aralocaspica at different nutrient and salinity levels. Although nutrient and salinity treatments affected dry weight and mineral content, there were no significant differences among S. aralocaspica seed-dimorphic plants under the same experimental conditions. This study is one of the few to compare the physiological responses between seed-heteromorphic plants, and reveals that mineral status corresponds with growth performance in these plants. (author)

  8. Novel Insights into the Influence of Seed Sarcotesta Photosynthesis on Accumulation of Seed Dry Matter and Oil Content in Torreya grandis cv. “Merrillii”

    Directory of Open Access Journals (Sweden)

    Yuanyuan Hu

    2018-01-01

    Full Text Available Seed oil content is an important trait of nut seeds, and it is affected by the import of carbon from photosynthetic sources. Although green leaves are the main photosynthetic organs, seed sarcotesta photosynthesis also supplies assimilates to seed development. Understanding the relationship between seed photosynthesis and seed development has theoretical and practical significance in the cultivation of Torreya grandis cv. “Merrillii.” To assess the role of seed sarcotesta photosynthesis on the seed development, anatomical and physiological traits of sarcotesta were measured during two growing seasons in the field. Compared with the attached current-year leaves, the sarcotesta had higher gross photosynthetic rate at the first stage of seed development. At the late second stage of seed development, sarcotesta showed down-regulation of PSII activity, as indicated by significant decrease in the following chlorophyll fluorescence parameters: the maximum PSII efficiency (Fv/Fm, the PSII quantum yield (ΦPSII, and the photosynthetic quenching coefficient (qP. The ribulose 1, 5—bisphosphate carboxylase (Rubisco activity, the total chlorophyll content (Chl(a+b and nitrogen content in the sarcotesta were also significantly decreased during that period. Treatment with DCMU [3-(3,4-dichlorophenyl-1,1-dimethylurea] preventing seed photosynthesis decreased the seed dry weight and the oil content by 25.4 and 25.5%, respectively. We conclude that seed photosynthesis plays an important role in the dry matter accumulation at the first growth stage. Our results also suggest that down-regulation of seed photosynthesis is a plant response to re-balance the source-sink ratio at the second growth stage. These results suggest that seed photosynthesis is important for biomass accumulation and oil synthesis of the Torreya seeds. The results will facilitate achieving higher yields and oil contents in nut trees by selection for higher seed photosynthesis cultivars.

  9. Novel Insights into the Influence of Seed Sarcotesta Photosynthesis on Accumulation of Seed Dry Matter and Oil Content in Torreya grandis cv. “Merrillii”

    Science.gov (United States)

    Hu, Yuanyuan; Zhang, Yongling; Yu, Weiwu; Hänninen, Heikki; Song, Lili; Du, Xuhua; Zhang, Rui; Wu, Jiasheng

    2018-01-01

    Seed oil content is an important trait of nut seeds, and it is affected by the import of carbon from photosynthetic sources. Although green leaves are the main photosynthetic organs, seed sarcotesta photosynthesis also supplies assimilates to seed development. Understanding the relationship between seed photosynthesis and seed development has theoretical and practical significance in the cultivation of Torreya grandis cv. “Merrillii.” To assess the role of seed sarcotesta photosynthesis on the seed development, anatomical and physiological traits of sarcotesta were measured during two growing seasons in the field. Compared with the attached current-year leaves, the sarcotesta had higher gross photosynthetic rate at the first stage of seed development. At the late second stage of seed development, sarcotesta showed down-regulation of PSII activity, as indicated by significant decrease in the following chlorophyll fluorescence parameters: the maximum PSII efficiency (Fv/Fm), the PSII quantum yield (ΦPSII), and the photosynthetic quenching coefficient (qP). The ribulose 1, 5—bisphosphate carboxylase (Rubisco) activity, the total chlorophyll content (Chl(a+b)) and nitrogen content in the sarcotesta were also significantly decreased during that period. Treatment with DCMU [3-(3,4-dichlorophenyl)-1,1-dimethylurea] preventing seed photosynthesis decreased the seed dry weight and the oil content by 25.4 and 25.5%, respectively. We conclude that seed photosynthesis plays an important role in the dry matter accumulation at the first growth stage. Our results also suggest that down-regulation of seed photosynthesis is a plant response to re-balance the source-sink ratio at the second growth stage. These results suggest that seed photosynthesis is important for biomass accumulation and oil synthesis of the Torreya seeds. The results will facilitate achieving higher yields and oil contents in nut trees by selection for higher seed photosynthesis cultivars. PMID:29375592

  10. Glioblastoma with spinal seeding

    International Nuclear Information System (INIS)

    Fakhrai, N.; Fazeny-Doerner, B.; Marosi, C.; Czech, T.; Diekmann, K.; Birner, P.; Hainfellner, J.A.; Prayer, D.

    2004-01-01

    Background: extracranial seeding of glioblastoma multiforme (GBM) is very rare and its development depends on several factors. This case report describes two patients suffering from GBM with spinal seeding. In both cases, the anatomic localization of the primary tumor close to the cerebrospinal fluid (CSF) was the main factor for spinal seeding. Case reports: two patients with GBM and spinal seeding are presented. After diagnosis of spinal seeding, both patients were highly symptomatic from their spinal lesions. Case 1 experienced severe pain requiring opiates, and case 2 had paresis of lower limbs as well as urinary retention/incontinence. Both patients were treated with spinal radiation therapy. Nevertheless, they died 3 months after diagnosis of spinal seeding. Results: in both patients the diagnosis of spinal seeding was made at the time of cranial recurrence. Both tumors showed close contact to the CSF initially. Even though the patients underwent intensive treatment, it was not possible to keep them in a symptom-free state. Conclusion: because of short survival periods, patients deserve optimal pain management and dedicated palliative care. (orig.)

  11. Glioblastoma with spinal seeding

    Energy Technology Data Exchange (ETDEWEB)

    Fakhrai, N.; Fazeny-Doerner, B.; Marosi, C. [Clinical Div. of Oncology, Dept. of Medicine I, Univ. of Vienna (Austria); Czech, T. [Dept. of Neurosurgery, Univ. of Vienna (Austria); Diekmann, K. [Dept. of Radiooncology, Univ. of Vienna (Austria); Birner, P.; Hainfellner, J.A. [Clinical Inst. for Neurology, Univ. of Vienna (Austria); Prayer, D. [Dept. of Neuroradiology, Univ. of Vienna (Austria)

    2004-07-01

    Background: extracranial seeding of glioblastoma multiforme (GBM) is very rare and its development depends on several factors. This case report describes two patients suffering from GBM with spinal seeding. In both cases, the anatomic localization of the primary tumor close to the cerebrospinal fluid (CSF) was the main factor for spinal seeding. Case reports: two patients with GBM and spinal seeding are presented. After diagnosis of spinal seeding, both patients were highly symptomatic from their spinal lesions. Case 1 experienced severe pain requiring opiates, and case 2 had paresis of lower limbs as well as urinary retention/incontinence. Both patients were treated with spinal radiation therapy. Nevertheless, they died 3 months after diagnosis of spinal seeding. Results: in both patients the diagnosis of spinal seeding was made at the time of cranial recurrence. Both tumors showed close contact to the CSF initially. Even though the patients underwent intensive treatment, it was not possible to keep them in a symptom-free state. Conclusion: because of short survival periods, patients deserve optimal pain management and dedicated palliative care. (orig.)

  12. Physalis peruviana seed storage

    Directory of Open Access Journals (Sweden)

    Cíntia L. M. de Souza

    2016-03-01

    Full Text Available ABSTRACT Physalis peruviana belongs to Solanaceae family and has a high nutritional and nutraceutical potential. The production is intended for fruit consumption and the propagation is mainly by seeds. This study aimed to evaluate the influence of priming on the kinetics of germination of P. peruviana seeds stored at different temperatures. The seeds were stored at 5 and 25 °C in a chamber saturated with zinc chloride solution and in liquid nitrogen (-196 °C. Every 4 months, the seeds were removed from storage for evaluation of germination and moisture content in the laboratory and emergence and development of seedlings in greenhouse. During the last evaluation at 16 months, the seeds under the same conditions were subjected to salt stress. The moisture content varied during the storage period, but was always higher for seeds kept at -196 ºC. These seeds kept high germination percentage in water until 16 months, regardless of the tested temperature; however, in salt solution the germination percentage was significantly reduced.

  13. Effects of seed fermentation method on seed germination and vigor ...

    African Journals Online (AJOL)

    The present study was conducted to examine the influence of Lagenaria siceraria seed fermentation method on seed germination and vigor. Three seed fermentation methods (fermented in ambient air, plastic bag stored in ambient or in plastic bag buried) were tested on two cultivars during two years. Seed germination and ...

  14. Effect of dates of closing cut on seed yield and seed quality of Stylosanthes guianensis CIAT 184

    Directory of Open Access Journals (Sweden)

    Ramphrai Namsilee

    2005-09-01

    Full Text Available The aim of this field research was to investigate the effect of dates of closing cut on seed yield and seed quality of Stylosanthes guianensis CIAT 184 at Khon Kaen Animal Nutrition Research and Development Center, during May 2003 to February 2004. A randomized complete block design with four replications was used. Experimental treatments consisted of five dates of closing cut spaced at about 14-day intervals (27 August, 10 September, 24 September, 8 October 2003 and uncut.The results showed that date of closing cut had a significant effect on seed yields and pure germinable seed yields (PGSY of S. guianensis CIAT 184. Plots closed on 10 September produced the highest seed yield and PGSY (P<0.05 of 564 and 553 kg/ha, followed by plots closed on 24 September and 27 August (422 and 406; 405 and 391 kg/ha. Uncut plots produced low yield and plots closed on 8 October produced the lowest seed yield and PGSY (401 and 388; 365 and 356 kg/ha. There were no significant differences in seed purity percentage, germination percentage and 1000-seed weight among treatments. Among the dates of closing cut studied, forage DM yield and CP yield were subsequently increased as date of closing cut was delayed. Based on this research, it was concluded that early-September was the optimum date of closing cut for S. guianensis CIAT 184 cultivation for seed production in Northeast Thailand.

  15. A legume biofortification quandary: variability and genetic control of seed coat micronutrient accumulation in common beans

    Science.gov (United States)

    Blair, Matthew W.; Izquierdo, Paulo; Astudillo, Carolina; Grusak, Michael A.

    2013-01-01

    Common beans (Phaseolus vulgaris L.), like many legumes, are rich in iron, zinc, and certain other microelements that are generally found to be in low concentrations in cereals, other seed crops, and root or tubers and therefore are good candidates for biofortification. But a quandary exists in common bean biofortification: namely that the distribution of iron has been found to be variable between the principal parts of seed; namely the cotyledonary tissue, embryo axis and seed coat. The seed coat represents ten or more percent of the seed weight and must be considered specifically as it accumulates much of the anti-nutrients such as tannins that effect mineral bioavailability. Meanwhile the cotyledons accumulate starch and phosphorus in the form of phytates. The goal of this study was to evaluate a population of progeny derived from an advanced backcross of a wild bean and a cultivated Andean bean for seed coat versus cotyledonary minerals to identify variability and predict inheritance of the minerals. We used wild common beans because of their higher seed mineral concentration compared to cultivars and greater proportion of seed coat to total seed weight. Results showed the most important gene for seed coat iron was on linkage group B04 but also identified other QTL for seed coat and cotyledonary iron and zinc on other linkage groups, including B11 which has been important in studies of whole seed. The importance of these results in terms of physiology, candidate genes and plant breeding are discussed. PMID:23908660

  16. [Study on seed quality test and quality standard of Lonicera macranthoides].

    Science.gov (United States)

    Zhang, Ying; Xu, Jin; Li, Long-Yun; Cui, Guang-Lin; She, Yue-Hui

    2016-04-01

    Referring to the rules for agricultural seed testing (GB/T 3543-1995) issued by China, the test of sampling, purity, thousand seed weight, moisture, viability, relative conductivity and germination rate had been studied for seed quality test methods of Lonicera macranthoides. The seed quality from 38 different collection areas was measured to establish quality classification standard by K-means clustering. The results showed that at least 7.5 g seeds should be sampled, and passed 20-mesh sieve for purity analysis.The 500-seed method used to measure thousand seed weight. The moisture was determined by crushed seeds dried in high temperature (130±2) ℃ for 3 h.The viability determined by 25 ℃ 0.1% TTC stained 5h in dark. 1.0 g seeds soaked in 50 ml ultra pure water in 25 ℃ for 12 hours to determine the relative conductivity. The seed by 4 ℃stratification for 80 days were cultured on paper at 15 ℃. Quality of the seeds from different areas was divided into three grades. The primary seed quality classification standard was established.The I grade and II grade were recommend use in production. Copyright© by the Chinese Pharmaceutical Association.

  17. Toxicity of dietary Heliotropium dolosum seed to broiler chickens.

    Science.gov (United States)

    Eröksüz, Y; Eröksüz, H; Ozer, H; Canatan, H; Yaman, I; Cevik, A

    2001-12-01

    Five groups of 20 female broiler chicks were fed different levels of dehulled Heliotropium dolosum seed (w/w%; 0.0, 1.0, 3.0, 5.0 or 10.0%) from 10 to 52 d of age. In all doses the seed caused decreases in daily feed intake, weight gain, and feed efficiency, and biochemical findings, severity of pathologic changes, and mortality rate increased in a dose-dependent manner. Acute toxicity was observed in livers of chicks fed 10% seed. Other test groups had chronic changes. Livers had massive to submassive necrosis, hepatic megalocytosis, bile duct proliferation, fatty change, and periportal fibrosis. Biochemical evaluations revealed hypoalbuminemia, hypoprotienemia and increased ALP activity and billuribin. The seed of Heliotropium dolosum produced biochemical and specific pathologic changes in broiler chicks, as well as decreased food intake and feed efficiency. Higher seed levels induced more pronounced changes.

  18. Nutraceutical potential of hemp (Cannabis sativa L.) seeds and sprouts.

    Science.gov (United States)

    Frassinetti, Stefania; Moccia, Eleonora; Caltavuturo, Leonardo; Gabriele, Morena; Longo, Vincenzo; Bellani, Lorenza; Giorgi, Gianluca; Giorgetti, Lucia

    2018-10-01

    In this study the antioxidant effect of Cannabis sativa L. seeds and sprouts (3 and 5 days of germination) was evaluated. Total polyphenols, flavonoids and flavonols content, when expressed on dry weight basis, were highest in sprouts; ORAC and DPPH (in vitro assays), CAA-RBC (cellular antioxidant activity in red blood cells) and hemolysis test (ex vivo assays) evidenced a good antioxidant activity higher in sprouts than in seeds. Untargeted analysis by high resolution mass spectrometry in negative ion mode allowed the identification of main polyphenols (caffeoyltyramine, cannabisin A, B, C) in seeds and of ω-6 (linoleic acid) in sprouts. Antimutagenic effect of seeds and sprouts extracts evidenced a significant decrease of mutagenesis induced by hydrogen peroxide in Saccharomyces cerevisiae D7 strain. In conclusion our results show that C. sativa seeds and sprouts exert beneficial effects on yeast and human cells and should be further investigated as a potential functional food. Copyright © 2018. Published by Elsevier Ltd.

  19. Effect of seeding rate on lentil (lens culinaris medik) seed yield under rainfed conditions

    International Nuclear Information System (INIS)

    Saleem, A.; Zahid, M.A.; Javed, H.I.; Ansar, A.; Saleem, N.

    2012-01-01

    The objective of this study was to investigate the effect of various sowing rates on seed yield of lentil. Field experiments were conducted for three consecutive years (2001-02 to 2003-04) at the National Agricultural Research Centre (NARC), Islamabad, Pakistan during the lentil growing season. An improved medium-grain size (1000-grain weight. around 25 g) variety Masoor 93 (18-12 x ILLP 4400) was used in these experiments. Eleven seeding rates i.e., 14.0, 21.25, 28.50, 35.75, 43.0, 50.25, 57.50, 64.75, 72.0, 79.25 and 86.50 kgha were evaluated in the study. Results of the three-year study showed that grain yield kept on increasing up to a seed rate of 43 kgha and remained static thereafter with a non-significant difference for any further increase in seed sown. The existing seed rate of 20 kgha in lentil is seemingly not sufficient to obtain optimum yield. On average, about 2-2.5-fold increase in seed rate of lentil under rainfed conditions can be safely recommended. (author)

  20. Are post-dispersed seeds of Eucalyptus globulus predated in the introduced range? Evidence from an experiment in Portugal

    Directory of Open Access Journals (Sweden)

    E. Deus

    2018-04-01

    Full Text Available Plantations of Eucalyptus globulus Labill. have been expanding rapidly worldwide. The species is considered invasive in several regions. While in the native range, post-dispersal seed predation is known to severely limit eucalypt recruitment, there is no experimental evidence of seed predation in the introduced range. We hypothesised that E. globulus seeds largely escape predation in Portugal, which may explain its prolific recruitment in some locations. We tested this hypothesis in central Portugal by exposing E. globulus seeds to the local fauna. For comparison purposes, we also used seeds from locally common species: Acacia dealbata Link (alien, larger, elaiosome-bearing seeds and Cistus salviifolius L. (native, similarly sized seeds. We installed 30 feeding stations across three study sites, each one dominated by one study species. Each feeding station featured four feeders with different animal-access treatments: invertebrates; vertebrates; full access; no access (control. We placed five seeds of each plant species every day in each feeder and registered the number of seeds missing, eaten and elaiosome detached over 9 summer days. Eucalyptus globulus seeds were highly attractive to fauna in the three sites. Nearly half of E. globulus seeds were predated or removed, thus contradicting our hypothesis. Surprisingly, E. globulus and A. dealbata seeds were used by animals in similar proportions and C. salviifolius seeds were the least preferred. Vertebrates were the predominant seed predators and preferred the alien seeds. Invertebrates used all seed species in similar proportions. We found spatial variation regarding the predominant type of seed predators and the levels of seed predation according to the following patterns: predominance of vertebrates; predominance of invertebrates; negligible seed predator activity. Locations with negligible seed predation were abundant and scattered across the study area. Such spatial variation may

  1. Genetic characterisation of seed yield and fertility traits in perennial ryegrass (Lolium perenne L.)

    DEFF Research Database (Denmark)

    Studer, Bruno; Jensen, Louise Bach; Hentrup, Stephan

    2008-01-01

    A population. Path analysis partitioned the direct and indirect effects of seed yield components on seed yield per plant. Seed yield per panicle showed the highest effect on total seed yield. The adjusted mean values of each trait and a genetic linkage map consisting of 97 anonymous and 85 gene associated DNA......Seed yield is a trait of major interest for the key grassland species Lolium perenne L. An F2 mapping population of perennial ryegrass (VrnA), recently characterised for vernalisation response, was assessed in a glasshouse for traits related to seed yield based on a lattice design with four...... replications over 2 years. The traits heading date, plant height, length of panicles, number of panicles per plant, seed yield per panicle, flag leaf length, flag leaf width and seed yield per plant revealed repeatabilities ranging from 41 to 76% and a considerable amount of genetic variation in the Vrn...

  2. Prosopis Africana SEEDS (OKPEYE)

    African Journals Online (AJOL)

    User

    Keywords: Prosopis africana, okpeye seeds, thermal heat conductivity, specific heat capacity, thermal heat diffusivity, .... 2.3 Determination of Thermal Properties of Prosopis. Africana .... and the guard ring was filled with fiber glass at both the.

  3. Oil seed marketing prospects

    International Nuclear Information System (INIS)

    Ceroni, G.

    1992-01-01

    With its 100 million tonnes annual production, the American continent is by far the world's biggest producer of oil seed, followed by Asia - 52 million, and Europe - 27 million tonnes. The Italian and European Communities have the farming capacity to double their production, but international agreements currently prohibit such initiatives. After first providing a panorama of the world oil seed market, this paper discusses new reforms in European Communities internal agricultural policies which currently limit production. These reforms, intended to encourage the production of oil seed for use as an ecological automotive fuel alternative, call for an obligatory set-aside of 15% of producing farm-land in exchange for the compensatory removal of oil seed production limits

  4. Mycelial growth rate and toxin production in the seed pathogen Pyrenophora semeniperda: Resource trade-offs and temporally varying selection

    Science.gov (United States)

    S. E. Meyer; M. Masi; S. Clement; T. L. Davis; J. Beckstead

    2015-01-01

    Pyrenophora semeniperda, an important pathogen in Bromus tectorum seed banks in semi-arid western North America, exhibits >4-fold variation in mycelial growth rate. Host seeds exhibit seasonal changes in dormancy that affect the risk of pathogen-caused mortality. The hypothesis tested is that contrasting seed dormancy phenotypes select for contrasting strategies...

  5. Genetic variability for phenotype, seed production, oil content, and fatty acid composition among 17 Roselle (Hibiscus sabdariffa) accessions

    Science.gov (United States)

    Seed oil and fatty acids in plants have human health implications. Oil from roselle (Hibiscus sabdariffa L.) seeds are used in Taiwan as a diuretic, laxative, and tonic. The objectives of this study were to evaluate seeds from 17 roselle accessions for oil and fatty acid variation in a greenhouse. S...

  6. Morphological and anatomical analyses of the seed coats of sweet granadilla (Passiflora ligularis Juss. seeds

    Directory of Open Access Journals (Sweden)

    Cárdenas Hernández Julián

    2011-12-01

    Full Text Available

    The study of histology and morphology of seeds of genus Passiflora has been of high utility for the classification of species. In seeds of sweet granadilla, the histological characteristics and methodologies for their study are unknown. This study was aimed to know the tissue and morphological characteristics of the seed coats of seeds of sweet granadilla and to be able to determine its value in the differentiation of accessions. Five accessions collected in producing zones of the Province of Huila, Colombia, were analyzed. In morphological analysis, all accessions presented falsifoveate ornamentation and entire margin. The seeds presented high change in weight and size for every accession; there stood out the seeds of the accession PmN for presenting major size (7.42 mm long, weight (35.62 mg, homogeneity in these variables and a typical orange color. For the histological analysis, a protocol was adapted to realize sections of seed coats in parafin, by means of which one managed to obtain sections (7 μ that in the optical microscope show clearly three well differentiated layers, belonging, possibly, to exotegmen (internal layer, mesotesta (medium layer and exotesta (external layer. Every layer presented differences in the form of the cells, color and thickness, between the sections of the basal and medium parts of the seeds, but the differences between the analyzed accessions

  7. Seeds of impurity

    Directory of Open Access Journals (Sweden)

    Andrea Pavoni

    2015-06-01

    Full Text Available Ai Weiwei’s art installation Kui Hua Zi [Sunflower Seeds] took place between 2010 and 2011 in the gigantic Turbine Hall of the Tate Modern Gallery, in London. It consisted of 100 millions hand-crafted porcelain seeds made in Jingdezhen, China.1 An uneven surface to dive into, a haptic space of undulating vision, rustling steps, unusual horizontality, a meaningless quicksand where the separation between artwork and spectator is engulfed, the immunity of distant contemplation denied.

  8. Optimal sample size for predicting viability of cabbage and radish seeds based on near infrared spectra of single seeds

    DEFF Research Database (Denmark)

    Shetty, Nisha; Min, Tai-Gi; Gislum, René

    2011-01-01

    The effects of the number of seeds in a training sample set on the ability to predict the viability of cabbage or radish seeds are presented and discussed. The supervised classification method extended canonical variates analysis (ECVA) was used to develop a classification model. Calibration sub......-sets of different sizes were chosen randomly with several iterations and using the spectral-based sample selection algorithms DUPLEX and CADEX. An independent test set was used to validate the developed classification models. The results showed that 200 seeds were optimal in a calibration set for both cabbage...... using all 600 seeds in the calibration set. Thus, the number of seeds in the calibration set can be reduced by up to 67% without significant loss of classification accuracy, which will effectively enhance the cost-effectiveness of NIR spectral analysis. Wavelength regions important...

  9. Seed Size And Physiological Quality Of Three Cultivars Of Cotton

    Directory of Open Access Journals (Sweden)

    Luiz Cesar Lopes Filho

    2018-05-01

    Full Text Available Cotton is one of the most important crops, both in the national context and worldwide. Being that, its fiber, constitutes an important raw material for the textile industry. The process of improving cottonseeds, favoured cultivars with smaller seeds. The goal of this work was to evaluate three cultivars of cottonseeds with different sizes through vigour tests. The work was developed in the seeds laboratory and the post-harvest Laboratory of plant products of the Instituto Federal Goiano – Campus Rio Verde. Cottonseeds of 3 cultivars were used (FiberMax 913 GLT, FiberMax 910 and DeltaPine 1648 B2RF, obtained in the crop of 2014 in the city of Primavera do Leste, Mato Grosso. The experimental design was entirely randomized, with eight replications of 50 seeds. Determinations of moisture content and weight of a hundred seeds, germination test and germination velocity index, emergency test, and emergency speed index, electrical conductivity and accelerated aging were conducted. The dimensions of the size of the seeds (length, width and thickness were also determined, with the aid of digital caliper, and the weight of the seeds, with the aid of a balance of precision of resolution 0, 001g. The data was subjected to analysis of variance and the averages compared to the Tukey test at 5% probability. There was no clear relationship between the size of the seed and its physiological performance in assessed cultivars/batches, making it necessary more studies that can prove that type of association.

  10. Seed dispersal in fens

    Science.gov (United States)

    Middleton, B.; Van Diggelen, R.; Jensen, K.

    2006-01-01

    Question: How does seed dispersal reduce fen isolation and contribute to biodiversity? Location: European and North American fens. Methods: This paper reviews the literature on seed dispersal to fens. Results: Landscape fragmentation may reduce dispersal opportunities thereby isolating fens and reducing genetic exchange. Species in fragmented wetlands may have lower reproductive success, which can lead to biodiversity loss. While fens may have always been relatively isolated from each other, they have become increasingly fragmented in modern times within agricultural and urban landscapes in both Europe and North America. Dispersal by water, animals and wind has been hampered by changes related to development in landscapes surrounding fens. Because the seeds of certain species are long-lived in the seed bank, frequent episodes of dispersal are not always necessary to maintain the biodiversity of fens. However, of particular concern to restoration is that some dominant species, such as the tussock sedge Carex stricta, may not disperse readily between fens. Conclusions: Knowledge of seed dispersal can be used to maintain and restore the biodiversity of fens in fragmented landscapes. Given that development has fragmented landscapes and that this situation is not likely to change, the dispersal of seeds might be enhanced by moving hay or cattle from fens to damaged sites, or by reestablishing lost hydrological connections. ?? IAVS; Opulus Press.

  11. Characteristics of Color Development in Seeds of Brown- and Yellow-Seeded Heading Chinese Cabbage and Molecular Analysis of Brsc, the Candidate Gene Controlling Seed Coat Color.

    Science.gov (United States)

    Ren, Yanjing; He, Qiong; Ma, Xiaomin; Zhang, Lugang

    2017-01-01

    The proanthocyanidin (PA) is the main flavonoids which affect the seed coat color in Brassica species. In this paper, characteristics of color development and accumulation of flavonoids were analyzed in the seeds of brown-seeded (B147) and yellow-seeded (B80) heading Chinese cabbage ( Brassica rapa L. ssp. Pekinensis ). It is found that the content of phenolic compounds in B147 were significantly more than that of B80 by using dimethylaminocinnamaldehyde (DMACA) staining and toluidine blue O (TBO) staining. In previous studies, the locus associated with seed coat color has been mapped. The results of whole genome re-sequencing showed that there are large fragment deletions variation in the mapping region between the brown-seeded parent '92S105' and the yellow-seeded parent '91-125.' Based on the B. rapa genome annotation information, the TRANSPARENT TESTA GLABRA 1 ( TTG1 ), is likely to be the candidate gene controlling seed coat color. A 94-base deletion was found in the 96th base downstream of the initiation codon in the TTG1 of yellow seed, thus, the termination codon TGA was occurred in the 297th base which makes the full length of TTG1 of yellow seed is 300 bp. Based on the differential sequences of TTG1 of brown and yellow seed, a functional marker, Brsc-yettg1, was developed to detect the variation of TTG1 . Quantitative real-time PCR analysis of BrTTG1 in different tissues showed that expression levels of BrTTG1 was not tissue-specific. During the whole seed development period, the expression of BrTTG1 in B147 was higher than that of B80. The expression levels of four structural genes, BrDFR, BrANS, BrANR1 , and BrANR2 in B147 were also higher than those in B80. The co-segregation molecular markers obtained in this report and TTG1 related information provide a basis for further understanding of the molecular mechanism of seed coat color in heading Chinese cabbage.

  12. The Biological Effect of Extremely Low Frequency Electromagnetic Fields and Vibrations on Barley Seed Hydration and Germination

    Directory of Open Access Journals (Sweden)

    Armine Amyan

    2004-01-01

    Full Text Available The changes of wet and dry weights and germination of barley seed in different periods of its swelling in nontreated (control, extremely low frequency electromagnetic fields (ELF EMF –treated, and extremely low frequency vibrations (ELFV–treated cold (4°C and warm (20°C distilled water (DW were studied. The metabolic-dependent seed hydration, dry weight dissolving, germination, and water binding in seed were modulated by preliminary EMF- and ELFV-treated DW. Frequency “windows” for the effect of EMF and ELFV on seed hydration, solubility, water binding in seed, and germination were discovered. These “windows” were different for EMF and ELFV, as well as in various phases of seed swelling. It is suggested that EMF-induced water structure modification has a different biological effect on the process of seed hydration, solubility, water binding in seed, and germination compared to ELFV.

  13. Short communication. Evaluation of castor (Ricinus communis L.) induced mutants for possible selection in the improvement of seed yield

    Energy Technology Data Exchange (ETDEWEB)

    Sarwar, G.; Boota Chaudhry, M.

    2008-07-01

    The aim of the present work was to determine selection criteria suitable for developing castor ideotypes with high yield potentials. Nineteen M4 generation castor mutants were obtained by gamma irradiation (100 to 1000 Gy) of DS30 castor seeds, and evaluated alongside this reference variety over 2006-07 for their possible use in the improvement of castor seed yield. Days to ripening, plant height, number of spikes/plant, length of main spike, number of main spike capsules, capsule weight, 100-seed weight and seed yield per plant were recorded for each mutant. Correlation coefficients were calculated, path analyses performed, and the genetic features of the different traits were determined. A significant, positive correlation was seen between capsule weight and seed yield. The 100-seed weight showed a positive but non-significant phenotypic relationship plus a significant genotypic relationship with seed yield. Capsule weight also showed a strong direct effect on seed yield, plus a strong positive and significant genotypic correlation with this variable. More than 50% heritability was observed for all the traits studied except the 100-seed weight and capsule weight. The number of main spike capsules showed the greatest genetic advance, followed by spike length and number of spikes. Traits such as the number of capsules, spike length and number of spikes showed strong heritability and good genetic advance. These traits are therefore governed by additive genes, and for the improvement of seed yield selection may be based directly on these attributes. In conclusion, for the improvement of seed yield the main emphasis should be placed on the number of spikes and capsule weight, via the selection of the highest yielding mutants among those tested. However, spike length and 100-seed weight should also be taken into account. (Author) 18 refs.

  14. Behavioral, Performance, Carcass Traits and Hormonal Changes of Heat Stressed Broilers Feeding Black and Coriander Seeds

    Directory of Open Access Journals (Sweden)

    Ramadan D.M. EL-Shoukary

    2014-07-01

    Full Text Available The experiment was done to determine the effects of feeding heat stressed broilers (Ross308 diets contain Nigella Sativa seeds or coriander seeds on Ingestive, panting behaviors, feed consumption, weight gain, and feed conversion ratio, live body weight, slaughter weight, carcass weight and dressing percentage, corticosterone, triiodothyronine (T3 and tetraiodothyronine (T4. Three groups were used; the first one is the control group, which fed on basal diet only and the second fed diet contains 1% Nigella Sativa seeds (black seed while the third group fed diet contain 2% coriander seeds. The previous parameters were recorded daily or weekly during the experiment or after slaughtering to collecting blood parameters. The results explained that, there was a significant increase in feeding behavior, feed consumption, weight gain and dressing percentage while there was a significant decrease in panting behavior, water to feed ratio, T3 level and corticosterone level. Moreover, there was no significance difference in drinking behavior live body weight, slaughter weight, feed conversion rate and T4 level (P<0.05. It could be concluded that, black seeds and coriander seeds can be used to alleviate the negative effect of heat stress in broiler during summer seasons in Egypt.

  15. Effect of drought stress on growth, yield and seed quality of tomato (lycopersicon esculentum L.)

    International Nuclear Information System (INIS)

    Pervez, M.A.; Ayub, C.M.

    2009-01-01

    Plant growth is seriously affected by abiotic stresses such as drought, salinity or temperature. Drought is one of the most important limiting factors for agricultural crops and vegetable production in particular all around the world. Drought stress during vegetative or early reproductive growth usually reduces yield by reducing the number of seeds, seed size and seed quality. To assess the effect of drought stress on seed yield, seed quality and growth of tomato, the experiment was conducted in green house in plastic pots at Pen-y-Fridd field station, University of Wales, Bangor, U.K. during 2003-2004. Tomato cv. Moneymaker was used as a test crop. There were four treatments i.e. early stress (when first truss has set the fruits), middle stress (when fruits in first truss were fully matured and started changing their colour), late stress (when fruits on first truss were ripened fully), whereas in control no stress was imposed. Analysis of data regarding various attributes (fruit weight and shoot dry weight per plant, number of seeds per fruit, total number of seeds and seed weight per plant and vigour of seed) showed that drought stress had non-significant effect on vigour, quality and yield of tomato seed. Plant height, number of leaves and number of fruits per plant showed significant results toward drought stress signifying drought effects on growth of tomato. (author)

  16. Mechanism of fluridone-induced seed germination of cistanche tubulosa

    International Nuclear Information System (INIS)

    Chen, Q.L.; Tu, P.

    2016-01-01

    Our previous study disclosed that fluridone, a synthesis inhibitor of abscisic acid (ABA), could stimulate seed germination in the holoparasitic plant Cistanche tubulosa . Nonetheless, the underlying mechanisms have not been thoroughly elucidated. In the present study, an attempt was made to reveal the mechanism of fluridone breaking seed dormancy in C. tubulosa and to determine the contribution of hormones in this process. The ABA level in seeds initially decreased following fluridone treatment and was subsequently maintained at a concentration of 31 ng g/sup -1/ DW (dry weight) three days later. The contents of gibberellins (GAs) initially in creased and subsequently were maintained at a level of 40 ng g-1 DW after ten days. However, the increment of seed germination induced by fluridone was inhibited after the introduction of exogenous ABA or paclobutrazol (a synthesis inhibitor of GAs). Furthermore, inhibition from paclobutrazol was reversed by an additional treatment with exogenous GA3. When the ratio of endogenous GAs to ABA reached 4:3, C. tubulosa seeds initiated germination. By contrast, although the ratio of endogenous GAs to ABA content reached 2:1 by cold stratification, C. tubulosa seeds could not germinate unless exogenous GA3 was added. In summary, our current study revealed that (i) GAs and ABA play key roles for the seed germination of C. tubulosa , (ii) fluridone inhibited ABA biosynthesis but increased the concentration of GAs in seeds, and (iii) fluridone might initiate other processes associated with germination. (author)

  17. Physiological quality of rice seed submitted to gamma radiation

    International Nuclear Information System (INIS)

    Miranda, Helen Lucia da Cruz; Tillmann, Maria Angela Andre; Meneghello, Geri Eduardo

    2009-01-01

    The objective of this research was to evaluate the effects of the gamma radiation ( 60 Co) on the physiological quality of rice seeds. The research was carried out through three tests; in the first test rice seeds were irradiated at dosages of 0; 1; 2.5 and 5Gy, while for the second and third tests the seeds were subjected to accelerated aging before being irradiated. For the second test the seeds were divided into wet and dry and both groups subjected to accelerated aging previous to irradiation at dosages of 0; 1; 2.5 and 5Gy. For the third test the seeds were dried after being subjected to accelerated aging, and then irradiated at dosages of 0, 10, 25 and 50Gy. To assess the physiological effects of the gamma radiation, all seeds were tested for germination and their germination speed index recorded. Seedling growth was graded through the measurement of the lengths of the first leaf and seminal root system and total seedling dry weight, across all tests. The enzymatic activity of acid phosphatase and alpha-amylase was measured on dry seeds from the second test. The results from all tests indicate that the applied gamma radiation dosages did not cause any changes to the physiological quality of rice seeds. (author)

  18. Seed-borne pathogens and electrical conductivity of soybean seeds

    Directory of Open Access Journals (Sweden)

    Adriana Luiza Wain-Tassi

    2012-02-01

    Full Text Available Adequate procedures to evaluate seed vigor are important. Regarding the electrical conductivity test (EC, the interference in the test results caused by seed-borne pathogens has not been clarified. This research was carried out to study the influence of Phomopsis sojae (Leh. and Colletotrichum dematium (Pers. ex Fr. Grove var. truncata (Schw. Arx. fungi on EC results. Soybean seeds (Glycine max L. were inoculated with those fungi using potato, agar and dextrose (PDA medium with manitol (-1.0 MPa and incubated for 20 h at 25 °C. The colony diameter, index of mycelial growth, seed water content, occurrence of seed-borne pathogens, physiological potential of the seeds, measured by germination and vigor tests (seed germination index, cold test, accelerated aging and electrical conductivity, and seedling field emergence were determined. The contents of K+, Ca2+, and Mg2+ in the seed and in the soaking solution were also determined. A complete 2 × 4 factorial design with two seed sizes (5.5 and 6.5 mm and four treatments (control, seeds incubated without fungi, seeds incubated with Phomopsis and seeds incubated with Colletotrichum were used with eight (5.5 mm large seeds and six (6.5 mm large seeds replications. All seeds submitted to PDA medium had their germination reduced in comparison to the control seeds. This reduction was also observed when seed vigor and leached ions were considered. The presence of Phomopsis sojae fungus in soybean seed samples submitted to the EC test may be the cause of misleading results.

  19. Seed dispersal anachronisms: rethinking the fruits extinct megafauna ate.

    Directory of Open Access Journals (Sweden)

    Paulo R Guimarães

    Full Text Available BACKGROUND: Some neotropical, fleshy-fruited plants have fruits structurally similar to paleotropical fruits dispersed by megafauna (mammals > 10(3 kg, yet these dispersers were extinct in South America 10-15 Kyr BP. Anachronic dispersal systems are best explained by interactions with extinct animals and show impaired dispersal resulting in altered seed dispersal dynamics. METHODOLOGY/PRINCIPAL FINDINGS: We introduce an operational definition of megafaunal fruits and perform a comparative analysis of 103 Neotropical fruit species fitting this dispersal mode. We define two megafaunal fruit types based on previous analyses of elephant fruits: fruits 4-10 cm in diameter with up to five large seeds, and fruits > 10 cm diameter with numerous small seeds. Megafaunal fruits are well represented in unrelated families such as Sapotaceae, Fabaceae, Solanaceae, Apocynaceae, Malvaceae, Caryocaraceae, and Arecaceae and combine an overbuilt design (large fruit mass and size with either a single or few ( 100 seeds. Within-family and within-genus contrasts between megafaunal and non-megafaunal groups of species indicate a marked difference in fruit diameter and fruit mass but less so for individual seed mass, with a significant trend for megafaunal fruits to have larger seeds and seediness. CONCLUSIONS/SIGNIFICANCE: Megafaunal fruits allow plants to circumvent the trade-off between seed size and dispersal by relying on frugivores able to disperse enormous seed loads over long-distances. Present-day seed dispersal by scatter-hoarding rodents, introduced livestock, runoff, flooding, gravity, and human-mediated dispersal allowed survival of megafauna-dependent fruit species after extinction of the major seed dispersers. Megafauna extinction had several potential consequences, such as a scale shift reducing the seed dispersal distances, increasingly clumped spatial patterns, reduced geographic ranges and limited genetic variation and increased among

  20. Developing fruit and shoot borer (FSB) resistant lines from eggplant cv. Dumaguete Long Purple (DLP) through seed irradiation

    International Nuclear Information System (INIS)

    Suratos, S.C.M.; Resamero, N.V.; Angeles, A.T.; Sandoval, F.R.

    2011-01-01

    Seeds of eggplant cv. DLP were irradiated with 10,20,30,40,50,60,70,80 gy gamma-rays from sup60Co to induce variation for resistance for FSB, a major pest in eggplant. The M1 populations was observed for germination seven days after sowing and plant survival was recorded 14,21 and 28 days from sowing. The seed germination of treated seeds ranged from 80-83% which is comparable to the untreated seed germination of 81%. A total of 8,529 M2 plants across irradiation dose were screened through natural infestation for field resistance to FSB. Plants without infestation up to 120 days after transplanting were considered as putatively resistant to FSB of the total M2 plants evaluated, 66 (0.8%)were identified to be putatively resistant. The highest number of resistant plants, 22 (1.6%) was generated from 70 gy, and the least, 3(0.3%), was from 40 to 50 gy. The m3 generation of the identified putative FSB resistant m2 plants is currently being evaluated further for stability of field resistance to FSB. The horticultural traits of the putative mutants, were also evaluated using 22 descriptors, where the mutants varied in 11 traits as compared with the wild type or progenitor, the original DLP. The degree of variation varied with traits as follows: leaf blade length and width, 7.6% and 47%, respectively; days to flowering and fruiting, 33.3% and 30.3%, respectively; numbers of flowers per inflorescence, 83.4%; fruit length/breadth ratio, 51.5%; curvature, 81.8%, number of seeds per fruit, 51.5%;seed color and size, 9.1% and 4.5%, respectively and 100 seed weight, 4.5%. This study targets to generate mutants with resistance to FSB and at the same time with acceptable horticultural traits. Among the selected mutants, a total of 55 lines (83.3%) manifested acceptable horticultural traits

  1. Weight Loss

    Science.gov (United States)

    ... Rights Employment Discrimination Health Care Professionals Law Enforcement Driver's License For Lawyers Food & Fitness Home Food MyFoodAdvisor ... Fit Types of Activity Weight Loss Assess Your Lifestyle Getting Started Food Choices In My Community Home ...

  2. Selection criteria for the improvement of seed yield and its components in advances generations of lentil (lens culinaris medik)

    International Nuclear Information System (INIS)

    Ashraf, S.; Hanif, M.; Sadiq, S.; Abbas, G.; Asghar, M.J.

    2008-01-01

    Present study was conducted at Nuclear Institute for Agriculture and Biology (NIAB), Faisalabad during the years 2006 and 2007 with the objectives; to study the inheritance of seed yield and related traits in both hybridized (F6) and mutated (M6) populations of lentil and to determine the best selection criterion for the improvement of seed yield. Different genetic parameters (variances, heritabilities, genetic gains and correlations) were computed to study the inheritance pattern and interrelationships of different traits. High heritability was observed for days to flower (97.40%), plant height (90.80%), pods per plant (86.20%), hundred seed weight (83.50%) and seed yield per plant (91.80%) in F6 and for days to flower (96.9%), days to mature (91.8%), hundred seed weight (89.0%) and seed yield per plant (94.0%) in M6 generation. High heritability coupled with moderate to high genetic advance was noted for plant height (90.8%, 16.29) pods per plant (86.20%, 25.53) hundred seed weight (83.50%, 35.67) and seed yield per plant (91.80%, 35.84) in F6 generation and for days to flower (96.9%, 25.08), hundred seed weight (89.0%, 25.56) and seed yield per plant (94.0%, 37.01) in M6 generation. The traits mentioned were found to be under the control of additive genes. Seed yield had positive and significant correlation with pods per plant in M6 and with seed weight in both generations. It was concluded that seed weight and pods per plant may be used as selection criterion in both hybridized and mutated populations for the improvement of seed yield. (author)

  3. The importance of using certified seed

    OpenAIRE

    Bogdanović Sandra; Mladenov Velimir; Balešević-Tubić Svetlana

    2015-01-01

    Certified seed is produced from the seed of known genetic origin and genetic purity with controlled and tested production, processed and declared in accordance with the Law on Seeds. Production of certified seed is carried out under the supervision of the Ministry of Agriculture and Environmental Protection, by seed producers formally listed in the Seed Register. Seed is processed in registered seed processing centres and quality is tested in laboratories accredited for seed testing. The orga...

  4. Seed priming improves salinity tolerance of wheat varieties

    International Nuclear Information System (INIS)

    Jamal, Y.; Shafi, M.; Arif, M.

    2011-01-01

    To evaluate the response of wheat varieties to seed priming and salinity, an experiment was conducted in completely randomized design (CRD) with three replications at Institute of Biotechnology and Genetic Engineering (IBGE), KPK Agricultural University, Peshawar, Pakistan. The performance of 6 wheat varieties (Tatara-96, Ghaznavi-98, Fakhri Sarhad, Bakhtawar-92, Pirsabaq-2004 and Auqab-2000) at two seed conditions (primed with 30 mM NaCl and un primed) under four salinity levels (0, 40, 80 and 120 mM) was studied. Statistical analysis of the data revealed that salinity, seed priming and varieties had significantly (P= 0.05) affected shoot fresh weight plant/sup -1/ shoot dry weight plant/sup -1/, shoot Na/sup +/ contents (mg g/sup -1/ dry weight), shoot K/sup +/ contents (mg g/sup -1/ dry weight) and shoot K/sup +/Na/sup +/ ratio. Maximum shoot fresh weight plant/sup -1/ (7.71 g), shoot dry weight plant/sup -1/ (1.68 g), shoot K/sup +/ contents (1.39 mg g/sup -1/ dry weight) and shoot K/sup +/ Na/sup +/ratio (1.45) were recorded from Bakhtawar-92 as compared with other varieties. Highest shoot Na/sup +/ contents (1.43 mg g/sup -1/ dry weight) were recorded from Auqab-2000 when compared with other varieties. All parameters were enhanced with seed priming except shoot Na/sup +/ contents, which reduced significantly (p= 0.05) with seed priming. (author)

  5. Magnetic-seeding filtration

    International Nuclear Information System (INIS)

    Ying, T.Y.; Chin, C.J.; Lu, S.C.; Yiacoumi, S.

    1997-10-01

    Magnetic-seeding filtration consists of two steps: heterogeneous particle flocculation of magnetic and nonmagnetic particles in a stirred tank and high-gradient magnetic filtration (HGMF). The effects of various parameters affecting magnetic-seeding filtration (HGMF). The effects of various parameters affecting magnetic seeding filtration are theoretically and experimentally investigated. A trajectory model that includes hydrodynamic resistance, van der Waals, and electrostatic forces is developed to calculate the flocculation frequency in a turbulent-shear regime. Fractal dimension is introduced to simulate the open structure of aggregates. A magnetic-filtration model that consists of trajectory analysis, a particle build-up model, a breakthrough model, and a bivariate population-balance model is developed to predict the breakthrough curve of magnetic-seeding filtration. A good agreement between modeling results and experimental data is obtained. The results show that the model developed in this study can be used to predict the performance of magnetic-seeding filtration without using empirical coefficients or fitting parameters. 35 refs., 7 figs., 1 tab

  6. Molecular physiology of seeds

    International Nuclear Information System (INIS)

    Hajduch, M.

    2014-05-01

    Plant development is well described. However, full understanding of the regulation of processes associated with plant development is still missing. Present Dr.Sc. thesis advances our understanding of the regulation of plant development by quantitative proteomics analyses of seed development of soybean, canola, castor, flax, and model plant arabidopsis in control and environmentally challenged environments. The analysis of greenhouse-grown soybean, canola, castor, and arabidospis provided complex characterization of metabolic processes during seed development, for instance, of carbon assimilation into fatty acids. Furthermore, the analyses of soybean and flax grown in Chernobyl area provided in-depth characterization of seed development in radio-contaminated environment. Soybean and flax were altered by radio-contaminated environment in different way. However, these alterations resulted into modifications in seed oil content. Further analyses showed that soybean and flax possess alterations of carbon metabolism in cytoplasm and plastids along with increased activity of photosynthetic apparatus. Our present experiments are focused on further characterization of molecular bases that might be responsible for alterations of seed oil content in Chernobyl grown plants. (author)

  7. 7 CFR 201.33 - Seed in bulk or large quantities; seed for cleaning or processing.

    Science.gov (United States)

    2010-01-01

    ... quantities; seed for cleaning or processing. (a) In the case of seed in bulk, the information required under... seeds. (b) Seed consigned to a seed cleaning or processing establishment, for cleaning or processing for... pertaining to such seed show that it is “Seed for processing,” or, if the seed is in containers and in...

  8. Study of Sowing Date and Seed Priming Effect on Seed Yield, Its Components and Some of Agronomic and Qualitative Properties of Two Spring Canola Cultivars in Hamedan

    Directory of Open Access Journals (Sweden)

    A. Mohagheghi

    2014-12-01

    Full Text Available To determine the effect of planting date, cultivar and seed priming on yield, yield components, oil and protein content of seeds of two spring canola cultivars a field experiment was conducted in Bu-Ali Sina University in 2012. The experiment was factorial in a randomized complete block design with three replications. Factors consisted of sowing dates (14 and 24th March and 3rd April, seed priming treatments (no-primed, primed with water and zinc sulfate solution and two canola cultivars (Hayola401 and RGS003. The evaluated traits were number of pod per plant, number of seed per pod, 1000 seeds weight, plant height, oil and protein percentage, yields of seed, oil and biologic and harvest index. The results showed that delay in sowing, except of seed protein percentage, decreased all traits. Seed priming could increase traits of plant height, 1000 seed weight, number of seed per pod, oil percentage and yield and protein percentage in all sowing dates. Seed priming with zinc sulfate solution and water increased the number of pod per plant 16.1 and 10.5 percent, respectively compared to no-primed treatment. The highest seed number per pod was achieved through the priming with water and zinc sulfate solution with an average of 14.3, in the first sowing date for Hayola401 cultivar. Priming with water, especially in the third sowing date increased oil yield by 56 percent in RGS003 cultivar in comparison with its no-primed treatment. Also priming with zinc sulfate and water, increased the harvest index 5.04 and 3.7% respectively compared to no-primed treatment. In general in the case of delay in sowing date in spring rapeseed cultivars especially for RGS003, primed seed preferably with zinc sulfate improves the quantitative and qualitative characteristics of the production.

  9. Effect of dietary supplementation of herbal seeds on carcass traits of turkey poults

    Directory of Open Access Journals (Sweden)

    Darshana B. Bhaisare

    2014-11-01

    Full Text Available Aim: The present study was conducted to find the effect of four herbal seeds on carcass traits of turkey poults. Materials and Methods: A biological study using Nandanam turkey poults (Meleagris gallapavo for 8 weeks duration was carried out to evaluate the effect of phytobiotics-containing four herbal seeds influence on production performances like biweekly body weight and on carcass traits. 150 poults were randomly subjected to five dietary treatments in a completely randomized design with basal diet (T1, 0.5% (5 g/kg level of each seeds thyme (Thymus vulgaris (T2, fenugreek (Trigonella foenum graecum (T3, fennel (Foeniculum vulgare (T4 and cumin (Cuminum cyminum (T5. Carcass traits like blood loss, feather loss, dressed weight, New York dressed weight, ready to cook yield and cut-up parts yield were studied. Results: The body weight at 8th week was higher (p<0.05 in poults fed with thyme; whereas at 6th week, fennel and cumin fed birds had better (p<0.05 body weight. Inclusion of herbal seeds did not affect the blood loss, dressed weight and ready to cook yield but it significantly (p<0.05 affected the feathered loss, New York dressed weight and giblet percentages. Feeding of fenugreek has improved New York dressed weight of poults. Feeding of fennel had depressive (p<0.05 effect on liver and gizzard weights. All the four phytobiotic seeds in feed had significant (p<0.05 reduction in breast weight with a compensatory improvement in drumstick and neck weights. Conclusion: The present study revealed that supplementation of phytobiotic herbal seeds has resulted in numerical improvement of body weight of poults throughout the study period whereas these seeds had negative effect on the yield of breast, with increased proportion of drumstick and neck.

  10. Trace metal contents of selected seeds and vegetables from oil producing areas of Nigeria.

    Science.gov (United States)

    Wegwu, Matthew O; Omeodu, Stephen I

    2010-07-01

    The concentrations of accumulated trace metals in selected seeds and vegetables collected in the oil producing Rivers State of Nigeria were investigated. The values were compared with those of seeds and vegetables cultivated in Owerri, a less industrialized area in Nigeria. The lead (Pb) and cadmium (Cd) contents of the seeds obtained from Rivers State ranged between 0.10 and 0.23 microg/g dry weight, while those of the seeds cultivated in Owerri fell below the detection limit of 0.01 microg/g dry weight. The highest manganese (Mn) level (902 microg/g dry weight) was found in Irvingia garbonesis seeds cultivated in Rivers State. Similarly, the highest nickel (Ni) value (199 microg/g dry weight) was also obtained in I. garbonesis, however, in the seeds sampled in Owerri. The highest copper (Cu), zinc (Zn), and iron (Fe) levels (16.8, 5.27, and 26.2 microg/g dry weight, resp.) were detected in seeds collected in Rivers State. With the exception of Talinum triangulae, Ocinum gratissimum, and Piper guineese, with Pb levels of 0.09, 0.10, and 0.11 microg/g dry weight, respectively, the Pb and Cd levels in the vegetables grown in Owerri fell below the detection limit of 0.01 microg/g dry weight. The trace metal with the highest levels in all the vegetables studied was Mn, followed by Fe. The highest concentrations of Ni and Cu occurred in vegetables collected from Rivers State, while the highest level of Zn was observed in Piper guineese collected in Owerri, with a value of 21.4 microg/g dry weight. Although the trace metal concentrations of the seeds and vegetables collected in Rivers State tended to be higher than those of the seeds and vegetables grown in Owerri, the average levels of trace metals obtained in this study fell far below the WHO specifications for metals in foods.

  11. Improving Soil Seed Bank Management.

    Science.gov (United States)

    Haring, Steven C; Flessner, Michael L

    2018-05-08

    Problems associated with simplified weed management motivate efforts for diversification. Integrated weed management uses fundamentals of weed biology and applied ecology to provide a framework for diversified weed management programs; the soil seed bank comprises a necessary part of this framework. By targeting seeds, growers can inhibit the propagule pressure on which annual weeds depend for agricultural invasion. Some current management practices affect weed seed banks, such as crop rotation and tillage, but these tools are often used without specific intention to manage weed seeds. Difficulties quantifying the weed seed bank, understanding seed bank phenology, and linking seed banks to emerged weed communities challenge existing soil seed bank management practices. Improved seed bank quantification methods could include DNA profiling of the soil seed bank, mark and recapture, or 3D LIDAR mapping. Successful and sustainable soil seed bank management must constrain functionally diverse and changing weed communities. Harvest weed seed controls represent a step forward, but over-reliance on this singular technique could make it short-lived. Researchers must explore tools inspired by other pest management disciplines, such as gene drives or habitat modification for predatory organisms. Future weed seed bank management will combine multiple complementary practices that enhance diverse agroecosystems. This article is protected by copyright. All rights reserved.

  12. Seeds of confusion : the impact of policies on seed systems

    OpenAIRE

    Louwaars, N.P.

    2007-01-01

    Seed is basic to crop production. Next to its importance in production, food security and rural development, seed is a key element in many debates about technology development and transfer, biodiversity, globalisation and equity. The sustainable availability of good quality seed is thus an important development issue. This study deals with the impact different types of regulation have on how farmers access seed. I have analysed current regulatory frameworks in terms of their impact on differe...

  13. Magnetic-seeding filtration

    International Nuclear Information System (INIS)

    Depaoli, D.

    1996-01-01

    This task will investigate the capabilities of magnetic-seeding filtration for the enhanced removal of magnetic and nonmagnetic particulates from liquids. This technology appies to a wide range of liquid wastes, including groundwater, process waters, and tank supernatant. Magnetic-seeding filtration can be used in several aspects of treatment, such as (1) removal of solids, particularly those in the colloidal-size range that are difficult to remove by conventional means; (2) removal of contaminants by precipitation processes; and (3) removal of contaminants by sorption processes

  14. Engineering properties of sunflower seed: Effect of dehulling and moisture content

    Directory of Open Access Journals (Sweden)

    Mudasir Ahmad Malik

    2016-12-01

    Full Text Available The study diagnosed engineering properties on varying moisture content of sunflower seed and kernel from 7.6 to 25% (wet basis. On increasing moisture, dimensional values increased for both seed and kernel. Bulk density, true density and porosity were found higher for kernel as compared to seed at each moisture content. On increasing the moisture content from 7.6 to 25%, true density, porosity and thousand kernel weight increased. Coefficient of static friction on plywood was found maximum for kernel at 25% moisture content, while it was minimum for seed on glass at 7.6% moisture content. The angle of repose was maximum for kernel as compared to seed. Initial cracking force, average rupture force and average rupture energy for seed and kernel decreased with an increase in the moisture content. The kernel was found to be more resistant to initial cracking than seed.

  15. genetics and inheritance of seed dormancy inflicted by seed

    African Journals Online (AJOL)

    Mgina

    ABSTRACT. The study was undertaken to investigate the genetic mode of inheritance of dormancy imposed by the hull (seed coat) in rice seeds. Freshly harvested seeds of parents, F1 and F2 populations of a cross between a dormant cultivar Kisegese and non-dormant strain K2004 were used. Germination test of the ...

  16. Seeds of confusion : the impact of policies on seed systems

    NARCIS (Netherlands)

    Louwaars, N.P.

    2007-01-01

    Seed is basic to crop production. Next to its importance in production, food security and rural development, seed is a key element in many debates about technology development and transfer, biodiversity, globalisation and equity. The sustainable availability of good quality seed is thus an important

  17. Effects of seed collecting date and storage duration on seed ...

    African Journals Online (AJOL)

    The objective of this study was to determine the effect of seed collecting dates (5 to 6 times from mid-November to early January, 10 days intervals) and seed storage duration (4, 8, and 12 months) at room temperature on seed germination of four Artemisia species (Artemisia sieberi, A. diffusa, A. kupetdaghensis, and A.

  18. Cone and seed yields in white spruce seed production areas

    Science.gov (United States)

    John A. Pitcher

    1966-01-01

    The source of seed is an important consideration in the reforestation program on the National Forests in the North Central Region. Thirty-five seed production areas have been set up in the Region, along the lines proposed by the North Central Forest Experiment Station, to provide control of seed source. Red pine, white pine, shortleaf and loblolly pine, and white...

  19. Automated treatment planning engine for prostate seed implant brachytherapy

    International Nuclear Information System (INIS)

    Yu Yan; Zhang, J.B.Y.; Brasacchio, Ralph A.; Okunieff, Paul G.; Rubens, Deborah J.; Strang, John G.; Soni, Arvind; Messing, Edward M.

    1999-01-01

    Purpose: To develop a computer-intelligent planning engine for automated treatment planning and optimization of ultrasound- and template-guided prostate seed implants. Methods and Materials: The genetic algorithm was modified to reflect the 2D nature of the implantation template. A multi-objective decision scheme was used to rank competing solutions, taking into account dose uniformity and conformity to the planning target volume (PTV), dose-sparing of the urethra and the rectum, and the sensitivity of the resulting dosimetry to seed misplacement. Optimized treatment plans were evaluated using selected dosimetric quantifiers, dose-volume histogram (DVH), and sensitivity analysis based on simulated seed placement errors. These dosimetric planning components were integrated into the Prostate Implant Planning Engine for Radiotherapy (PIPER). Results: PIPER has been used to produce a variety of plans for prostate seed implants. In general, maximization of the minimum peripheral dose (mPD) for given implanted total source strength tended to produce peripherally weighted seed patterns. Minimization of the urethral dose further reduced the loading in the central region of the PTV. Isodose conformity to the PTV was achieved when the set of objectives did not reflect seed positioning uncertainties; the corresponding optimal plan generally required fewer seeds and higher source strength per seed compared to the manual planning experience. When seed placement uncertainties were introduced into the set of treatment planning objectives, the optimal plan tended to reach a compromise between the preplanned outcome and the likelihood of retaining the preferred outcome after implantation. The reduction in the volatility of such seed configurations optimized under uncertainty was verified by sensitivity studies. Conclusion: An automated treatment planning engine incorporating real-time sensitivity analysis was found to be a useful tool in dosimetric planning for prostate

  20. Investigation of fruit seeds of Cucurbita maxima Duch., in relation to the pre-sowing γ-irradiation and postirradiation temperature effect

    International Nuclear Information System (INIS)

    Goranov, A.I.

    1974-01-01

    Investigations have been made of the seeds (weight, number, and colour) of the fruit of Cucurbita maxima Duch. White Big variety 48/4, obtained from seeds, treated before sowing with γ-rays - 4000 R and 50000 R with dose efficiency 504-630 R min and after irradiation with 80 0 C and 90 0 C/30 min. The colour of the seeds has been determined by the Bondartsev scale (1954). It has been established that the post-irradiation temperature effect of 80 0 and 90 0 C for a period of 3 min probably stimulates the weight of the seeds and the number of the empty seeds and doses have any substantial effect on the process of seed formation. An irradiation dose of 4000 R γ-rays stimulates the weight of the seeds and causes a probable stimulation of the total number of seeds (among them the full seeds) and decreases the percent of the empty seeds. The post-irradiation pre-sowing temperature effect demonstrates a tendency of taking off the stimulation and inhibition effects of the seeds (weight, number and full and empty seeds included). Basic seeds colours are: 06-Atro cremeus, K 3 -Pallido arenicolour, 3 3 -Pallido ochraceus and K 1 -Isabellimus, which include about 75% of the colours. The basic colours are being affected by the temperature and post-irradiation temperature impact and without disappearing, change their percent ratio. (M.Ts.)

  1. MODELING POLLINATION FACTORS THAT INFLUENCE ALFALFA SEED YIELD IN NORTH-CENTRAL NEVADA

    OpenAIRE

    BREAZEALE, Don; FERNANDEZ, George; NARAYANAN, Rangesan

    2008-01-01

    The relative importance of both environmental and management factors on alfalfa seed yield was investigated on North–Central Nevada farms. Multiple linear regression models using 2002-2003 data revealed that cumulative tripped fl owers increased seed yield in both years. Field location does not appear to make a difference in the observed variation in tripped fl ower production. The results suggest that seed yield can be increased by (a) by placing bee shelters closer and (b) cultural practice...

  2. The effects of temperature on the dormancy and germination of Cirsium arvense (L. Scop. seeds

    Directory of Open Access Journals (Sweden)

    Anna Bochenek

    2011-01-01

    Full Text Available The ecophysiological regulation of seed dormancy in perennial species and those with a varied life cycle has not been studied in detail yet. That is why an attempt has been made to determine the Cirsium arvense seed water relations during stratification and afterripening at different temperatures and germination at constant or fluctuating temperatures on the basis of the hydrotime model. The obtained results showed that breaking of the primary dormancy of achenes took place only during the first stratification month at moderate temperatures, mainly due to an increase in the average water-stress tolerance in a seed population. The induction of secondary seed dormancy during after-ripening at all temperatures resulted mostly from a substantial loss of the seeds' ability to tolerate water stress. Fluctuating temperatures affected neither seed germination nor the hydrotime model parameters. The analysis of the variations of hydrotime model parameters allows a better understanding of the physiological basis of seed dormancy relief and induction.

  3. Effect of Seed Priming Treatments on Germination Traits of Two Mustard Cultivars (Brassica compestris var. parkland and Goldrash

    Directory of Open Access Journals (Sweden)

    M. Goldani

    2016-02-01

    Full Text Available Introduction: B. campestris is an old plant that commonly grows in arid and semi-arid areas. It has mucilage in the epidermal cells of canola seeds, a considerable variation in growth form and characteristics across the many cultivars. These species have in general, a flat root without an elongated crown, with stems that typically grow 30 to 120 cm tall. The leaves are large, soft, smooth or soft-hairy. The yellow flowers are small, usually less than 2 cm long (24. Seed priming is a procedure in which seed is soaked and then dried back to its original water content. Hydropriming uses only water in the process of controlled imbibitions, but osmopriming simply means soaking seeds in an osmotic solution. Seed priming is a technique of controlled hydration and drying that results in more rapid germination when the seed is reimbibed. Priming can be a valuable process for improving germination and uniformity of heterogeneously matured seed lots. Seed priming has been successfully demonstrated to improve germination and emergence in seeds of many crops, particularly vegetables and small seeded grasses. Seed priming is a presowing strategy for influencing seedling development by modulating pregermination metabolic activity prior to emergence of the radicle and generally enhances germination rate and plant performance. Fast germination and uniform emergence assist the farmer to “catch up” on the time lost to drought (17, 18. This research aimed to study the effect of the best treatments of osmopriming and hydropriming on varieties of mustard seed germination traits was conducted. Materials and Methods: The present research was conducted under laboratory conditions of the Ferdowsi University of Mashhad, Iran, during 2012 to determine the seed priming effects on germination traits of two cultivars of mustard. The experiment was in completely randomized design with six treatments. Seeds of two mustard cultivars including Goldrash and Parkland (Brassica

  4. seed germination and seedlings growth

    African Journals Online (AJOL)

    STORAGESEVER

    2007-12-17

    Dec 17, 2007 ... The role of 20E in plant physiology including seed germination is not studied. ..... GA3, ABA and CKs on lettuce Lactuca sativa seed germination are ..... Practical uses for ecdysteroids in mammals and humans: an update. J.

  5. Healthy Weight

    Science.gov (United States)

    ... such diets limit your nutritional intake, can be unhealthy, and tend to fail in the long run. The key to achieving and maintaining a healthy weight isn't about short-term dietary changes. It's about a lifestyle that includes healthy eating, regular physical activity, and ...

  6. Seed research for improved technologies

    OpenAIRE

    Bino,R.J.; Jalink,H.; Oluoch,M.O.; Groot,S.P.C.

    1998-01-01

    The production of high-quality seed is the basis for a durable a profitable agriculture. After production, seed is processed, conditioned, stored, shipped and germinated. For quality assurance, seed quality has to be controlled at all steps of the production chain. Seed functioning is accompanied by programmed transitions from cell proliferation to quiescence upon maturation and from quiescence to reinitiation of cellular metabolism upon imbibition. Despite the obvious importance of these con...

  7. The novel approach to enhance seed security: dual anti-counterfeiting methods applied on tobacco pelleted seeds.

    Science.gov (United States)

    Guan, Yajing; Wang, Jianchen; Tian, Yixin; Hu, Weimin; Zhu, Liwei; Zhu, Shuijin; Hu, Jin

    2013-01-01

    Seed security is of prime importance for agriculture. To protect true seeds from being faked, more secure dual anti-counterfeiting technologies for tobacco (Nicotiana tabacum L.) pelleted seed were developed in this paper. Fluorescein (FR), rhodamine B (RB), and magnetic powder (MP) were used as anti-counterfeiting labels. According to their different properties and the special seed pelleting process, four dual-labeling treatments were conducted for two tobacco varieties, MS Yunyan85 (MSYY85) and Honghua Dajinyuan (HHDJY). Then the seed germination and seedling growth status were investigated, and the fluorescence in cracked pellets and developing seedlings was observed under different excitation lights. The results showed that FR, RB, and MP had no negative effects on the germination, seedling growth, and MDA content of the pelleted seeds, and even some treatments significantly enhanced seedling dry weight, vigor index, and shoot height in MS YY85, and increased SOD activity and chlorophyll content in HHDJY as compared to the control. In addition, the cotyledon tip of seedlings treated with FR and MP together represented bright green fluorescence under illumination of blue light (478 nm). And the seedling cotyledon vein treated with RB and MP together showed red fluorescence under green light (546 nm). All seeds pelleted with magnetic powder of proper concentration could be attracted by a magnet. Thus, it indicated that those new dual-labeling methods that fluorescent compound and magnetic powder simultaneously applied in the same seed pellets definitely improved anti-counterfeiting technology and enhanced the seed security. This technology will ensure that high quality seed will be used in the crop production.

  8. The novel approach to enhance seed security: dual anti-counterfeiting methods applied on tobacco pelleted seeds.

    Directory of Open Access Journals (Sweden)

    Yajing Guan

    Full Text Available Seed security is of prime importance for agriculture. To protect true seeds from being faked, more secure dual anti-counterfeiting technologies for tobacco (Nicotiana tabacum L. pelleted seed were developed in this paper. Fluorescein (FR, rhodamine B (RB, and magnetic powder (MP were used as anti-counterfeiting labels. According to their different properties and the special seed pelleting process, four dual-labeling treatments were conducted for two tobacco varieties, MS Yunyan85 (MSYY85 and Honghua Dajinyuan (HHDJY. Then the seed germination and seedling growth status were investigated, and the fluorescence in cracked pellets and developing seedlings was observed under different excitation lights. The results showed that FR, RB, and MP had no negative effects on the germination, seedling growth, and MDA content of the pelleted seeds, and even some treatments significantly enhanced seedling dry weight, vigor index, and shoot height in MS YY85, and increased SOD activity and chlorophyll content in HHDJY as compared to the control. In addition, the cotyledon tip of seedlings treated with FR and MP together represented bright green fluorescence under illumination of blue light (478 nm. And the seedling cotyledon vein treated with RB and MP together showed red fluorescence under green light (546 nm. All seeds pelleted with magnetic powder of proper concentration could be attracted by a magnet. Thus, it indicated that those new dual-labeling methods that fluorescent compound and magnetic powder simultaneously applied in the same seed pellets definitely improved anti-counterfeiting technology and enhanced the seed security. This technology will ensure that high quality seed will be used in the crop production.

  9. Protein-free cress seed (Lepidium sativum) gum: Physicochemical characterization and rheological properties

    DEFF Research Database (Denmark)

    Razmkhah, Somayeh; Razavi, Seyed Mohammad Ali; Mohammadifar, Mohammad Amin

    2016-01-01

    Protein-free cress seed gum (PFCSG) was obtained by precipitation of crude cress seed gum (CSG) withethanol followed by treatment with protease. Molecular weight, moisture, ash and uronic acids contentdecreased after elimination of protein. Elimination of protein improved significantly rheologica...

  10. Hypoglycemic effect of Mucuna pruriens seed extract on normal and streptozotocin-diabetic rats.

    Science.gov (United States)

    Bhaskar, Anusha; Vidhya, V G; Ramya, M

    2008-12-01

    The hypoglycemic effect of the aqueous extract of the seeds of Mucuna pruriens was investigated in normal, glucose load conditions and streptozotocin (STZ)-induced diabetic rats. In normal rats, the aqueous extract of the seeds of Mucuna pririens (100 and 200 mg/kg body weight) significantly (Ppruriens has an anti-hyperglycemic action and it could be a source of hypoglycemic compounds.

  11. Effects of cobalt-60 low doses radiation on beam, rice and radish seeds

    International Nuclear Information System (INIS)

    Kikuchi, O.K.

    1987-01-01

    The effects of cobalt-60 gamma radiation on seeds of bean (Phaseolus vulgaris L.), rice (Oryza sativa L.) and radish (Raphanus sativus L.) were studied. Bean and rice seeds were irradiated with 3.5 and 7.7 Gy (32 Gy/h). There was an apparent acceleration on rice seed germination with 3.5 Gy when they were stored for 6 days after irradiation, but the same dose caused a delay when the store time was 1 day. Bean seeds germination was not modified by 3.5 and 7.7 Gy, but the fresh and dry weight of young plants showed an increase, mainly due the major quantity of water in the embryonic axis. Bean seeds were irradiated with 0.5 and 2.0 Gy (30 Gy/h). Seeds germination showed a slight delay irradiating with 0.5 Gy, while height, fresh and dry weight and primary leaves area of the young plants as well as number of nodes, leaves, flowers, beans and seeds were not modified after irradiation with 0.5 and 2.0 Gy. Radish seeds irradiated with 10 and 30 Gy at dose rates of 4.5, 22.5 and 45.0 Gy/h showed a germination delay and fresh and dry weight values for young plants leaves lower than control. Roots of totally developed plants showed no modifications in weight, volume, mean diameter, lenght and in the amount of soluble reducing sugar. (author)

  12. Modelling of seed yield and its components in tall fescue (Festuca ...

    African Journals Online (AJOL)

    AJL

    2011-10-03

    Oct 3, 2011 ... number spikelet -1 (Y4), seed weight (Y5), and the seed yield (Z) of tall fescue were determined in field experiments from 2003 to .... the time of fertilisation (X1), the quantity of irrigation (X2), the amount of N applied (X3), the ...... certain agronomical traits in soybean [Glycine max (L.) Merr.]. Afr. J. Biotechnol.

  13. Effect of Salinity and Silicon on Seed Yield and Yield Components of Purslane Portulaca oleracea L.(

    Directory of Open Access Journals (Sweden)

    Z Rahimi

    2011-01-01

    Full Text Available Abstract In order to study the effects on salinity and silicon application on yield and yield components of purslane (Portulaca oleracea L., an experiment was conducted in a completely randomized desgin with three replications and two factors consisted of four different levels of salinity using NaCl (0, 7, 14, 21dS/m and two levels of silicon (application of one mMol sodium silicate and not application. Increasing salinity concentration significantly caused a negative effect on seed yield. But yield components such as number and weight of seed were more sensitive than number of capsul in main stem in final seed yield. Application of silicon increased seed yield in control but was not significant in salinity levels and leaves and stem biomass. Seed yield and total seed weight in branches was significantly decresed. Weight of 1000 seed in main stem and branches was not significantly different in salinity levels. As a result, purslane could be extremely tolerated to saline conditions, so it seems that it can be cultivated in saline soils and arid regions. Also applied silicon can be increase yield and plant tolerance to environmental stress. Keywords: 1000 seed, Branches, Capsul, Dry weight

  14. Weighted approximation with varying weight

    CERN Document Server

    Totik, Vilmos

    1994-01-01

    A new construction is given for approximating a logarithmic potential by a discrete one. This yields a new approach to approximation with weighted polynomials of the form w"n"(" "= uppercase)P"n"(" "= uppercase). The new technique settles several open problems, and it leads to a simple proof for the strong asymptotics on some L p(uppercase) extremal problems on the real line with exponential weights, which, for the case p=2, are equivalent to power- type asymptotics for the leading coefficients of the corresponding orthogonal polynomials. The method is also modified toyield (in a sense) uniformly good approximation on the whole support. This allows one to deduce strong asymptotics in some L p(uppercase) extremal problems with varying weights. Applications are given, relating to fast decreasing polynomials, asymptotic behavior of orthogonal polynomials and multipoint Pade approximation. The approach is potential-theoretic, but the text is self-contained.

  15. Thermal Changes of Maize Seed by Laser Irradiation

    Science.gov (United States)

    Hernandez-Aguilar, C.; Dominguez-Pacheco, A.; Cruz-Orea, A.

    2015-09-01

    In this research, the thermal evolution in maize seeds ( Zea mays L.) was studied when low-intensity laser irradiation was applied during 60 s. The seeds were irradiated in three different conditions: suspended in air, placed on an aluminum surface, and finally placed on a cardboard; the evolution of the seed temperature was measured by an infrared camera. Photoacoustic spectroscopy and the Rosencwaig and Gersho model were used to determine the optical absorption coefficient (β ) of the seeds. The results indicate that using 650 nm laser light and 27.4 mW, it is possible to produce temperature changes (up to 9.06°C after 1 min) on the seeds. Comparing the mean temperature of the seeds, during and after the incidence of light from a laser, it was found that there were statistically significant differences (P≤ 0.05) from time t1 to time t_{16} (t1 to t_{16}) and t3 to t_{16}, for the laser turned on and off, respectively. The seed condition that had the highest temperature variation, relative to the initial temperature (during the irradiation laser exposure), involved the seeds suspended in air. With regard to the stage of decay of the temperature, it was found that the seed condition that decays more slowly was the seed placed on the cardboard. It was also found that black-dyed maize seeds are optically opaque in the 300 nm to 700 nm range Also, the thermal diffusion length is smaller than the optical penetration length. In the present investigation, it was shown that there is a thermal component associated with the mechanisms of laser biostimulation, which is also a function of the container materials of the seed. In this way, the effects of laser treatment on maize seeds involve at least a temperature effect. It is important to know the temperature changes in the seeds that have been irradiated with a laser beam since they could have substantial practical and theoretical importance.

  16. (Lupinus albus) SEEDS

    African Journals Online (AJOL)

    user

    2010-08-08

    Aug 8, 2010 ... lupin samples indicated that lupins can be used as a raw material for various food ... lupin seeds can be utilized for milk and meat imitation products. ... estimated by multiplying the percentage of crude protein, crude fat and ...

  17. Seed for change

    NARCIS (Netherlands)

    Hassena Beko, Mohammed

    2017-01-01

    Ethiopia is an agrarian country where agriculture dominates the economy, and thus agriculture is considered as an engine of growth by the government. Seed as one of the agricultural technologies, in fact, a carrier of many technologies, is critical to increasing production, but the use of quality

  18. Managing Stress. Project Seed.

    Science.gov (United States)

    Muto, Donna; Wilk, Jan

    One of eight papers from Project Seed, this paper describes a stress management project undertaken with high school sophomores. Managing Stress is described as an interactive workshop that offers young people an opportunity to examine specific areas of stress in their lives and to learn effective ways to deal with them. The program described…

  19. Grape Seed Extract

    Science.gov (United States)

    ... Greece people have used grapes, grape leaves, and sap for health purposes. Grape seed extract was developed ... sharing research results, and educating the public. Its resources include publications (such as Dietary ... Department of Health & Human Services, National Institutes of Health, National Center for ...

  20. The SEED Initiative

    Science.gov (United States)

    Teich, Carolyn R.

    2011-01-01

    Committed to fulfilling the promise of the green economy, the American Association of Community Colleges (AACC) launched the Sustainability Education and Economic Development (SEED) initiative (www.theseedcenter.org) in October 2010. The project advances sustainability and clean energy workforce development practices at community colleges by…

  1. Dormancy in Plant Seeds

    NARCIS (Netherlands)

    Hilhorst, H.W.M.; Finch-Savage, W.E.; Buitink, J.; Bolingue, W.; Leubner-Metzger, G.

    2010-01-01

    Seed dormancy has been studied intensely over the past decades and, at present, knowledge of this plant trait is at the forefront of plant biology. The main model species is Arabidopsis thaliana, an annual weed, possessing nondeep physiological dormancy. This overview presents the state-of-the-art

  2. Magnetic-seeding filtration

    Energy Technology Data Exchange (ETDEWEB)

    DePaoli, D.W.; Tsouris, C. [Oak Ridge National Lab., TN (United States); Yiacoumi, Sotira

    1997-10-01

    Magnetic-seeding filtration is a technology under development for the enhanced removal of magnetic and non-magnetic particulates from liquids. This process involves the addition of a small amount of magnetic seed particles (such as naturally occurring iron oxide) to a waste suspension, followed by treatment with a magnetic filter. Non-magnetic and weakly magnetic particles are made to undergo nonhomogeneous flocculation with the seed particles, forming flocs of high magnetic susceptibility that are readily removed by a conventional high-gradient magnetic filter. This technology is applicable to a wide range of liquid wastes, including groundwater, process waters, and tank supernatants. Magnetic-seeding filtration may be used in several aspects of treatment, such as (1) removal of solids, particularly those in the colloidal size range that are difficult to remove by conventional means; (2) removal of contaminants by precipitation processes; and (3) removal of contaminants by sorption processes. Waste stream characteristics for which the technology may be applicable include (1) particle sizes ranging from relatively coarse (several microns) to colloidal particles, (2) high or low radiation levels, (3) broad-ranging flow rates, (4) low to moderate solids concentration, (5) cases requiring high decontamination factors, and (6) aqueous or non-aqueous liquids. At this point, the technology is at the bench-scale stage of development; laboratory studies and fundamental modeling are currently being employed to determine the capabilities of the process.

  3. Magnetic-seeding filtration

    International Nuclear Information System (INIS)

    DePaoli, D.W.; Tsouris, C.; Yiacoumi, Sotira.

    1997-01-01

    Magnetic-seeding filtration is a technology under development for the enhanced removal of magnetic and non-magnetic particulates from liquids. This process involves the addition of a small amount of magnetic seed particles (such as naturally occurring iron oxide) to a waste suspension, followed by treatment with a magnetic filter. Non-magnetic and weakly magnetic particles are made to undergo nonhomogeneous flocculation with the seed particles, forming flocs of high magnetic susceptibility that are readily removed by a conventional high-gradient magnetic filter. This technology is applicable to a wide range of liquid wastes, including groundwater, process waters, and tank supernatants. Magnetic-seeding filtration may be used in several aspects of treatment, such as (1) removal of solids, particularly those in the colloidal size range that are difficult to remove by conventional means; (2) removal of contaminants by precipitation processes; and (3) removal of contaminants by sorption processes. Waste stream characteristics for which the technology may be applicable include (1) particle sizes ranging from relatively coarse (several microns) to colloidal particles, (2) high or low radiation levels, (3) broad-ranging flow rates, (4) low to moderate solids concentration, (5) cases requiring high decontamination factors, and (6) aqueous or non-aqueous liquids. At this point, the technology is at the bench-scale stage of development; laboratory studies and fundamental modeling are currently being employed to determine the capabilities of the process

  4. Results from irradiation of tobacco seeds

    International Nuclear Information System (INIS)

    Gyrbev, B.; Velikov, S.

    1990-01-01

    A series of experiments was carried out in the Struma river valley with tobacco seedlings in the period 1984-1987. The seeds were gamma irradiated with 1000 R and 2000 R and sowed after 2-3 days with and without fertilizers. The results from phenological observations and biometrical measurements of the seedlings showed no positive radiation effect on the sprouting and phenophase transition. No significant changes between irradiated plants and controls were detected in the total weight of the seedlings, the number, height, length and width of the leaves, the yield and quality of tobacco. In conclusion the authors do not recommend gamma irradiation of tobacco seeds as a plant growth stimulation agent. 3 tabs

  5. Germination of red alder seed.

    Science.gov (United States)

    M.A. Radwan; D.S. DeBell

    1981-01-01

    Red alder seeds were collected from six locations throughout the natural range of the species. Each seed lot was obtained from a single tree, and the seeds were used to determine germination with and without stratification treatment. Irrespective of treatment, germination varied significantly (P

  6. Nest-mediated seed dispersal

    Science.gov (United States)

    Robert J. Warren; Jason P. Love; Mark A. Bradford

    2017-01-01

    Many plant seeds travel on the wind and through animal ingestion or adhesion; however, an overlooked dispersal mode may lurk within those dispersal modes. Viable seeds may remain attached or embedded within materials birds gather for nest building. Our objective was to determine if birds inadvertently transport seeds when they forage for plant materials to...

  7. Seed systems support in Kenya

    NARCIS (Netherlands)

    Munyi, Peter; Jonge, De Bram

    2015-01-01

    The threats of climate change and rising food prices have stirred renewed attention for seed and food security in Africa, inviting new thinking on the role of seed sector development in coping with these concerns. One conceptual framework that has gained attention is the Integrated Seed Sector

  8. Seed morphology and anatomy and its utility in recognizing subfamilies and tribes of Zingiberaceae

    Energy Technology Data Exchange (ETDEWEB)

    Benedict, John C.; Smith, Selena Y.; Collinson, Margaret E.; Leong-Skornickova, Jana; Specht, Chelsea D.; Marone, Federica; Xiao, Xianghui; Parkinson, Dilworth Y.

    2015-11-01

    PREMISE OF THE STUDY: Recent phylogenetic analyses based on molecular data suggested that the monocot family Zingiberaceae be separated into four subfamilies and four tribes. Robust morphological characters to support these clades are lacking. Seeds were analyzed in a phylogenetic context to test independently the circumscription of clades and to better understand evolution of seed characters within Zingiberaceae. METHODS: Seventy-five species from three of the four subfamilies were analyzed using synchrotron based x-ray tomographic microscopy (SRXTM) and scored for 39 morphoanatomical characters. KEY RESULTS: Zingiberaceae seeds are some of the most structurally complex seeds in angiosperms. No single seed character was found to distinguish each subfamily, but combinations of characters were found to differentiate between the subfamilies. Recognition of the tribes based on seeds was possible for Globbeae, but not for Alpinieae, Riedelieae, or Zingibereae, due to considerable variation. CONCLUSIONS: SRXTM is an excellent, nondestructive tool to capture morphoanatomical variation of seeds and allows for the study of taxa with limited material available. Alpinioideae, Siphonochiloideae, Tamijioideae, and Zingiberoideae are well supported based on both molecular and morphological data, including multiple seed characters. Globbeae are well supported as a distinctive tribe within the Zingiberoideae, but no other tribe could be differentiated using seeds due to considerable homoplasy when compared with currently accepted relationships based on molecular data. Novel seed characters suggest tribal affinities for two currently unplaced Zingiberaceae taxa: Siliquamomum may be related to Riedelieae and Monolophus to Zingibereae, but further work is needed before formal revision of the family.

  9. Quality of Schizolobium parahyba seeds and seedlings from Rio Grande do Sul, Santa Catarina and Paraná states

    Directory of Open Access Journals (Sweden)

    Edicléia Aparecida Iensen Cherobini

    2010-09-01

    Full Text Available This research aimed to study the vigor and the quality of Schizolobium parahyba seeds from samples of three differentstates, Rio Grande do Sul (RS, Santa Catarina (SC and Paraná (PR and to evaluate the seedlings quality produced by these seeds.The seeds were submitted to evaluations of moisture content, germination, vigor and healthy. The seedlings quality was evaluated byhard seeds, dead seeds, emergence, seedling height, root length, collar diameter, fresh and dry weight of seedlings. On the seedsevaluations, the samples from SC and PR presented better results for first count of germination, dry matter and accelerate aging. Thefungi associated to the seeds were Aspergillus sp., Alternaria sp., Penicillium sp. and Trichoderma sp. About the seedlings evaluations,seeds from PR showed the bests results when the differences between tests were significant (emergence, root length and dry weight ofseedlings. Some of the labs variables had correlation with the seedlings variables.

  10. Study on Prevalence of Mycoflora in Wheat Seeds

    Directory of Open Access Journals (Sweden)

    Pratishtha Adhikari

    2016-01-01

    Full Text Available Forty seed sample of wheat (Triticum aestivum were collected from four locations viz. Chitwan, Kaski, Banke and Lalitpur and tested by blotter method at laboratory during 2013 for determining fungal pathogens associated with wheat seeds in Nepal. Eighteen species representing thirteen genera of fungi were recovered from the seed. Alternaria alternata and Bipolaris sorokiniana were predominant in all the varieties/genotypes from all the locations, where B. sorokiniana was strongly pathogenic in wheat crop. Percentage frequency and type of fungi detected varied with variety and locations. Bipolaris sorokiniana was highest (64.40% in Banke than remaining three locations. Seeds of Chitwan had lowest percentage (5.50% of seed infection as compared to other locations. Relative abundance of Alternaria alternata (55.10% was highest as it was the most prevalent component of seed borne mycoflora, followed by Bipolaris sorokiniana (34.69% and Cladosporium herbarum (7.19%. Differences in quantity of precipitation and relative humidity might be the possible reason for variation in frequency and type of fungi detected in wheat seeds of four locations.

  11. Technology seed Sebastiania membranifolia Mull Arg (Euphorbiaceae

    Directory of Open Access Journals (Sweden)

    Neidiquele Maria Silveira

    2013-12-01

    Full Text Available Sebastiania membranifolia, popularly known as sarandi, is a tree species native to Brazil, usually found in land of alluvial floodplains and river banks, suitable for restoration of degraded areas. Despite the commercial importance of this species, little is known about its mechanisms of propagation. This research evaluated the germinating seeds under different conditions of temperature, substrate and light, and determined methods of scarification in order to establish a suitable protocol for sexual propagation. The study was conducted in chambers with BOD and thermal control photoperiod, testing the following treatments: temperatures of 25, 30 and alternating 20/30º C; substrates (sand-EA, on paper-SP and from paper -EP, four solutions gibberellin (50, 100, 200, 400 mgL-1; potassium nitrate (0.1, 0.2, 0.3 and 0.4% in the presence (12 h photoperiod and absence of light. The experimental design was completely randomized with four replications of 50 seeds each. We found that the average degree of seed moisture was 10.4% and the weight of a thousand seeds (PMS of 3.16 g. The highest percentage of germination was obtained with photoperiod at 25 º C, on paper (SP and between role (EP. The concentrations of 100 mg L-1 gibberellin and 0.1% potassium nitrate showed higher germination and vigor. Seed treatment with a gibberellin solution of 100 mgL-1 favored the growth of seedlings, unlike potassium nitrate that inhibit the growth even at low concentration.

  12. 7 CFR 201.15 - Weed seeds.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Weed seeds. 201.15 Section 201.15 Agriculture... REGULATIONS Labeling Agricultural Seeds § 201.15 Weed seeds. The percentage of weed seeds shall include seeds of plants considered weeds in the State into which the seed is offered for transportation or...

  13. Demanda energética e eficiência da distribuição de sementes de milho sob variação de velocidade e condição de solo Seeder energetic demand and distribution efficiency of corn seeds under speed variation and soil condition

    Directory of Open Access Journals (Sweden)

    Denise Mahl

    2004-04-01

    Full Text Available O trabalho teve o objetivo de avaliar a demanda energética e a eficiência da distribuição de sementes de uma semeadora-adubadora para semeadura direta, submetida à variação de velocidade e condições de solo, na semeadura da cultura do milho. O estudo foi desenvolvido em um Nitossolo Vermelho distrófico, na Fazenda Experimental Lageado, no município de Botucatu - SP. O delineamento experimental foi em blocos casualizados, com oito repetições, combinando-se três velocidades de deslocamento (4,4; 6,1 e 8,1 km h-1 e duas condições de solo (solo manejado sob sistema de plantio direto há cinco anos e solo preparado com escarificador há 18 meses. Avaliaram-se a força de tração, a potência na barra de tração, o consumo de combustível, a capacidade de campo efetiva, a distribuição longitudinal de plantas, o coeficiente de variação, o índice de precisão e o número de plantas por hectare (estande inicial. Os resultados revelaram que, aumentando-se a velocidade de 4,4 para 8,1 km h-1, consegue-se aumentar em 86% a capacidade operacional, com incremento de 96% na demanda de potência na barra de tração e redução de 26% no consumo operacional de combustível. A maior velocidade (8,1 km h-1 proporcionou menor porcentual de espaçamentos normais e aumento no porcentual de espaçamentos múltiplos e falhos, maior coeficiente de variação e pior índice de precisão. A variação da velocidade não interferiu no número de plantas por hectare.This work evaluated the energetic demand and distribution efficiency of corn seeds in a no-till seeder when submitted to travel speed and soil condition variation. The study was developed in a soil classified as Ultissoil, at Fazenda Experimental Lageado, Botucatu Country, São Paulo State, Brazil. The experimental design was in a randomized block with eight repetitions, being the treatments a combination of three displacement speeds (4.4; 6.1 and 8.1 km h-1 and two soil conditions (soil

  14. Effects of the moisture of gamma irradiated tomato-seeds on the plant growth sensitivity

    International Nuclear Information System (INIS)

    Kumala Dewi.

    1977-01-01

    The investigation of 2 Krad gamma irradiated dry seeds fruit and tomato seedlings has been carried out. The effect was observed on the time of flowering and fruit bearing, fruits number, fruits weight and time of harvesting. (author)

  15. [Desiccation tolerance in seeds of Prosopisferox and Pterogyne nitens (Fabaceae)].

    Science.gov (United States)

    Morandini, Marcelo Nahuel; Giamminola, Eugenia Mabel; de Viana, Marta Leonor

    2013-03-01

    The high number of endemisms and species diversity together with the accelerated biodiversity loss by deforestation, especially in North Western Argentina, points out the need to work on species conservation combining ex situ and in situ strategies. The aim of this work was to study the desiccation tolerance in seeds of P ferox and P nitens for long term ex situ conservation at the Germplasm Bank of Native Species (BGEN) of the National University of Salta (Argentina). The fruits were collected from ten individuals in P ferox at the National Park Los Cardones and from two sites (Orán and Rivadavia) for P nitens. Desiccation tolerance was assessed following previous established methodologies. The moisture content (MC) of the seeds was determined by keeping them in oven at 103 degreeC and weighting the samples at different intervals till constant weight. Germination essays were carried out with two treatments (control and scarification), with different seed MC (fresh, 10-12%, 3-5%) and in desiccated seeds (3-5% MC) stored six months at -20 degreeC. The MC in P ferox seeds was 14.2% and 10% in P nitens, for both populations studied. Percentage germination in P ferox was higher in the scarification treatments (<82%). The difference between treatments increased with the reduction in MC and the storage for six months at -20 degreeC. Fresh seeds of P nitens do not need scarification treatment, but it is required with the reduction in MC and storage. Mean germination percentage of desiccated seeds stored six months at -20 degreeC was similar in both populations and greater than 82%.We concluded that both species are probably orthodox because seeds tolerated desiccation to 3-5% and storage for six months at -20 degree C.

  16. Genetic control of soybean seed oil: II. QTL and genes that increase oil concentration without decreasing protein or with increased seed yield.

    Science.gov (United States)

    Eskandari, Mehrzad; Cober, Elroy R; Rajcan, Istvan

    2013-06-01

    Soybean [Glycine max (L.) Merrill] seed oil is the primary global source of edible oil and a major renewable and sustainable feedstock for biodiesel production. Therefore, increasing the relative oil concentration in soybean is desirable; however, that goal is complex due to the quantitative nature of the oil concentration trait and possible effects on major agronomic traits such as seed yield or protein concentration. The objectives of the present study were to study the relationship between seed oil concentration and important agronomic and seed quality traits, including seed yield, 100-seed weight, protein concentration, plant height, and days to maturity, and to identify oil quantitative trait loci (QTL) that are co-localized with the traits evaluated. A population of 203 F4:6 recombinant inbred lines, derived from a cross between moderately high oil soybean genotypes OAC Wallace and OAC Glencoe, was developed and grown across multiple environments in Ontario, Canada, in 2009 and 2010. Among the 11 QTL associated with seed oil concentration in the population, which were detected using either single-factor ANOVA or multiple QTL mapping methods, the number of QTL that were co-localized with other important traits QTL were six for protein concentration, four for seed yield, two for 100-seed weight, one for days to maturity, and one for plant height. The oil-beneficial allele of the QTL tagged by marker Sat_020 was positively associated with seed protein concentration. The oil favorable alleles of markers Satt001 and GmDGAT2B were positively correlated with seed yield. In addition, significant two-way epistatic interactions, where one of the interacting markers was solely associated with seed oil concentration, were identified for the selected traits in this study. The number of significant epistatic interactions was seven for yield, four for days to maturity, two for 100-seed weight, one for protein concentration, and one for plant height. The identified molecular

  17. Carbon partitioning among leaves, fruits, and seeds during development of Phaseolus vulgaris L

    International Nuclear Information System (INIS)

    Geiger, D.R.; Shieh, Wenjang; Saluke, R.M.

    1989-01-01

    Development of vegetative and floral buds was found to be a key factor in establishing the way carbon is distributed among growing leaves and fruits in Phaseolus vulgaris L. plants. Leaves emerged principally during a period 14 to 32 days after planting while flowers were produced during a 10- to 12-day period near the end of leaf emergence. Timing of anthesis established the sigmoidal time course for dry weight accumulated by the composite of all fruits on the plant. During the first 12 days following anthesis, fruit growth mainly consisted of elongation and dry weight accumulation by the pod wall. Thereafter, seed dry weight increased for about 1 week, decreased markedly for several days, and then increased again over the next 2 weeks. Accumulation of imported carbon in individual seeds, measured by steady-state labeling, confirmed the time course for dry weight accumulation observed during seed development. Seed respiration rate initially increased rapidly along with dry weight and then remained nearly steady until seed maturation. A number of developmental events described in the literature coincided with the different phases of diauxic growth. The results demonstrated the feasibility of relating current rates of carbon import in individual seeds measured with tracer 14 C to the rates of conversion of imported sucrose and use of the products for specific developmental processes. The resulting data are useful for evaluating the roles of conversion and utilization of imported sucrose in regulating import by developing seeds

  18. Geographic variation in shortleaf pine (Pinus echinata Mill.) - cortical monoterpenes

    Science.gov (United States)

    R.C. Schmidtling; J.H. Myszewski; C.E. McDaniel

    2005-01-01

    Cortical monoterpenes were assayed in bud tissue from 16 Southwide Southern Pine Seed Source Study (SSPSS) sources and from 6 seed orchard sources fiom across the natural range of the species, to examine geogaphic variation in shortleaf pine. Spruce pine and pond pine were also sampled. The results show geographic differences in all of the major terpenes. There was no...

  19. Mechanical harvesting of pumpkin seeds

    OpenAIRE

    Sito, Stjepan; Ivančan, Stjepan; Barković, Edi; Mucalo, Ana

    2009-01-01

    One of the key problems in production technology of pumpkin seed for oil production is mechanized harvesting and losses of seed during mechanical harvesting. The losses of pumpkin seed during mechanical harvesting at peripheral velocity of 1.57 m/s (optimally adjusted machine) were 4.4% for Gleisdorf species, 5.2% for Slovenska species and 7.8% for pumpkin with husk. The higher average losses of pumpkin seed with husk were caused by tight connection of seed and pumpkin fruit.

  20. The Variability of Seed Viability and Seed Vigour of Mindi (Melia azedarachlinn. from Several Populations in The Community Forest of West Java

    Directory of Open Access Journals (Sweden)

    Yulianti Bramasto

    2016-12-01

    Full Text Available The procurement of good quality seeds for the development of mindi (Melia azedarach L. in the community forest is absolutely necessary. The purpose of this research is to investigate the diversity of the viability and seedling vigor of mindi from different populations with various treatments of dormancy breaking. The sample materials were mindi seeds that were collected from 6 locations (6 seed lots or seed sources which were located in the community forest of West Java. There are 10 treatments of dormancy breaking that were applied in this study. The experiment design was Randomized Complete Design (RAL. The breaking dormancy  was focused to the delignification of hard seed coat.  Results showed that the most effective dormancy breaking for mindi seed was soaking in consentrated Sulfuric Acid (H2SO4 as long as 30 to 45 minutes. The first count for germination of mindi was on the 16 day and the final count was on the 31 day.The average value of germination percentage (DB for all seed sources was 40 %, while the highest which is 60% was mindi from Sumedang seed source. The highest value of germination rate that is 6,543%/etmal was seed  from Sumedan