First thermochemical property of Seaborgium determined
Energy Technology Data Exchange (ETDEWEB)
Tuerler, A. for a LBNL Berkeley - Univ. Bern - FLNR Dubna -GSI Darmstadt - TU Dresden - Chalmers Univ. of Technology Goeteborg - GH Kassel - ITS and LLNL Livermore - Univ. Mainz - Univ. Oslo - FZ Rossendorf - JAERI Tokai - PSI Villigen collaboration
1997-09-01
The chemical properties of SgO{sub 2}Cl{sub 2} (element 106 = Seaborgium, Sg) were successfully studied using the On-line Gas Chromatography Apparatus (OLGA III). After chemical separation of Sg the nuclides {sup 265}Sg and {sup 266}Sg were unambiguously identified and their half-lives were determined for the first time. The Sg nuclides were produced from the {sup 248}Cm({sup 22}Ne,4,5n){sup 266,265}Sg reaction at the GSI Darmstadt UNILAC accelerator. Simultaneously, short-lived W nuclides were produced from a small admixture of {sup 152}Gd to the Cm target material. As predicted by relativistic calculations and by extrapolations of chemical properties, it was demonstrated that Sg oxychlorides are indeed less volatile than their lighter homologue Mo- and equally or less volatile than W-oxychlorides. (author) 1 fig., 1 tab., 4 refs.
International Nuclear Information System (INIS)
Schumann, D.; Andrassy, M.; Nitsche, H.; Misiak, R.; Schaedel, M.; Bruechle, W.; Schausten, B.; Kratz, J.V.
1997-08-01
In model experiments with W, Hf, Th, and U radionuclides, a chemical system was developed for the separation of seaborgium from element 104 and heavy actinides, i.e., cation exchange on DOWEX 50 x 8 from solutions containing 0.1-1.0 M HCl and 0.5-2.0 vol.% H 2 O 2 . The system should be suitable for fast on-line experiments if seaborgium exibits a non-uranium-like behaviour. Adding hydrogen peroxide to mixed HCl/HF solutions suppresses the partial sorption of W and, presumably seaborgium, on the cation exchanger. This way, the elution volume can be minimized. Prospects for anion exchange separations of group 6 from 4 elements are also briefly discussed. (orig.)
First aqueous chemistry with Seaborgium (element 106)
International Nuclear Information System (INIS)
Schaedel, M.; Bruechle, W.; Schausten, B.; Schimpf, E.; Jaeger, E.; Wirth, G.; Guenther, R.; Gregorich, K.E.; Hoffman, D.C.; Lee, D.M.; Sylwester, E.R.; Nagame, Y.; Oura, Y.
1996-11-01
For the first time, chemical separations of element 106 (Seaborgium, Sg) were performed in aqueous solutions. The isotopes 265 Sg and 266 Sg were produced in the 248 Cm+ 22 Ne reaction at a beam energy of 121 MeV. The reaction products were continuously transported by a He(KCl)-jet to the computer-controlled liquid chromatography system ARCA. In 0.1 M HNO 3 /5 x 10 -4 M HF, Sg was found to be eluted within 10 s from 1.6 x 8 mm cation-exchange columns (Aminex A6, 17.5±2 μm) together with the hexavalent Mo- and W-ions, while hexavalent U-ions and tetravalent Zr-, Hf-, and element 104 ions were strongly retained on the column. Element 106 was detected by measuring correlated α-decays of the daughter isotopes 78-s 261 104 and 26-s 257 102. For the isotope 266 Sg, we have evidence for a spontaneous fission branch. It yields a partial spontaneous-fission half-life which is in agreement with recent theoretical predictions. The chemical results show that the most stable oxidation state of Sg in aqueous solution is +6, and that like its homologs Mo and W, Sg forms neutral or anionic oxo- or oxohalide-compounds under the present condition. In these first experiments, Sg exhibits properties very characteristic of group 6 elements, and does not show U-like properties. (orig.)
33 CFR 117.263 - Banana River.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Banana River. 117.263 Section 117.263 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.263 Banana River. (a) The draw of the Mathers (SR...
2010-01-01
... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Scope. 263.400 Section 263.400 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM RULES OF PRACTICE FOR HEARINGS Removal, Suspension, and Debarment of Accountants From Performing Audit Services...
12 CFR 263.405 - Petition for reinstatement.
2010-01-01
... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Petition for reinstatement. 263.405 Section 263.405 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL RESERVE... Audit Services § 263.405 Petition for reinstatement. (a) Form of petition. Unless otherwise ordered by...
12 CFR 263.99 - Petition for reinstatement.
2010-01-01
... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Petition for reinstatement. 263.99 Section 263... SYSTEM RULES OF PRACTICE FOR HEARINGS Practice Before the Board § 263.99 Petition for reinstatement. The Board may entertain a petition for reinstatement from any person debarred from practice before the Board...
12 CFR 263.10 - Filing of papers.
2010-01-01
... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Filing of papers. 263.10 Section 263.10 Banks... OF PRACTICE FOR HEARINGS Uniform Rules of Practice and Procedure § 263.10 Filing of papers. (a) Filing. Any papers required to be filed, excluding documents produced in response to a discovery request...
12 CFR 263.7 - Good faith certification.
2010-01-01
... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Good faith certification. 263.7 Section 263.7... RULES OF PRACTICE FOR HEARINGS Uniform Rules of Practice and Procedure § 263.7 Good faith certification... in fact and is warranted by existing law or a good faith argument for the extension, modification, or...
12 CFR 263.8 - Conflicts of interest.
2010-01-01
... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Conflicts of interest. 263.8 Section 263.8... RULES OF PRACTICE FOR HEARINGS Uniform Rules of Practice and Procedure § 263.8 Conflicts of interest. (a) Conflict of interest in representation. No person shall appear as counsel for another person in an...
12 CFR 263.11 - Service of papers.
2010-01-01
... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Service of papers. 263.11 Section 263.11 Banks... OF PRACTICE FOR HEARINGS Uniform Rules of Practice and Procedure § 263.11 Service of papers. (a) By the parties. Except as otherwise provided, a party filing papers shall serve a copy upon the counsel...
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHC263 (Link to dictyBase) - - - Contig-U16349-1 - (Link to Or...iginal site) - - VHC263Z 429 - - - - Show VHC263 Library VH (Link to library) Clone ID VHC263 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dictycdb.b...ATGG ACTCCCAAC sequence update 2002. 9.10 Translated Amino Acid sequence ---QLFAGIKSICT...kyfrkkmdsq Frame B: ---QLFAGIKSICTXMAMDGCEKCSGNSPTTTCDVLPVYSSLCMAMPDMSQCANWTKMCS
12 CFR 263.102 - Prevailing party.
2010-01-01
... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Prevailing party. 263.102 Section 263.102 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM RULES... Prevailing party. Only an eligible applicant that prevailed on the merits of an adversary proceeding may...
12 CFR 263.9 - Ex parte communications.
2010-01-01
.... (a) Definition—(1) Ex parte communication means any material oral or written communication relevant... oral, a memorandum stating the substance of the communication) to be placed on the record of the... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Ex parte communications. 263.9 Section 263.9...
27 CFR 26.263 - Determination of tax on beer.
2010-04-01
... beer. 26.263 Section 26.263 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE... Procedure at Port of Entry From the Virgin Islands § 26.263 Determination of tax on beer. If the certificate prescribed in § 26.205 covers beer, the beer tax will be collected on the basis of the number of barrels of...
12 CFR 263.65 - Civil penalty inflation adjustments.
2010-01-01
... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Civil penalty inflation adjustments. 263.65... Money Penalties § 263.65 Civil penalty inflation adjustments. (a) Inflation adjustments. In accordance with the Federal Civil Penalties Inflation Adjustment Act of 1990 (28 U.S.C. 2461 note), the Board has...
12 CFR 263.41 - Stays pending judicial review.
2010-01-01
... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Stays pending judicial review. 263.41 Section... SYSTEM RULES OF PRACTICE FOR HEARINGS Uniform Rules of Practice and Procedure § 263.41 Stays pending... the effectiveness of all or any part of its order pending a final decision on a petition for review of...
27 CFR 25.263 - Production of concentrate and reconstitution of beer.
2010-04-01
... and reconstitution of beer. 25.263 Section 25.263 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS BEER Beer Concentrate § 25.263 Production of concentrate and reconstitution of beer. (a) Operations at brewery. A brewer may concentrate beer...
26 CFR 1.263A-0 - Outline of regulations under section 263A.
2010-04-01
... that change a method of accounting under section 263A. (4) Effective date. (5) Definition of change in... to services. (i) In general. (ii) Definition of services. (iii) De minimis property provided incident.... (2) Otherwise deductible. (3) Capitalize. (4) Recovery of capitalized costs. (d) Definitions. (1...
47 CFR 25.263 - Information sharing requirements for SDARS terrestrial repeater operators.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Information sharing requirements for SDARS terrestrial repeater operators. 25.263 Section 25.263 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Technical Standards § 25.263 Information sharing...
12 CFR 263.54 - Delegation to the Office of Financial Institution Adjudication.
2010-01-01
... Uniform Rules § 263.54 Delegation to the Office of Financial Institution Adjudication. Unless otherwise... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Delegation to the Office of Financial Institution Adjudication. 263.54 Section 263.54 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF...
7 CFR 2.63 - Deputy Under Secretary for Research, Education, and Economics.
2010-01-01
... Economics. 2.63 Section 2.63 Agriculture Office of the Secretary of Agriculture DELEGATIONS OF AUTHORITY BY... Under Secretary for Research, Education, and Economics § 2.63 Deputy Under Secretary for Research, Education, and Economics. Pursuant to § 2.21(a), subject to reservations in § 2.21(b), and subject to policy...
12 CFR 263.404 - Notice of removal, suspension, or debarment.
2010-01-01
... accountants and firms. An accountant or accounting firm that provides audit services to a banking organization... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Notice of removal, suspension, or debarment. 263.404 Section 263.404 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE...
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Availability of Environmental Impact Assessment Summaries (EIA Summaries) and Environmental Impact Assessments (EIAs). 26.3 Section 26.3 Money and... DEVELOPMENT BANDS (MDBs) § 26.3 Availability of Environmental Impact Assessment Summaries (EIA Summaries) and...
Hypolipidemic Effects and Safety of Lactobacillus Reuteri 263 in a Hamster Model of Hyperlipidemia
Directory of Open Access Journals (Sweden)
Wen-Ching Huang
2015-05-01
Full Text Available We aimed to verify the beneficial effects of probiotic strain Lactobacillus reuteri 263 (Lr263 on hypolipidemic action in hamsters with hyperlipidemia induced by a 0.2% cholesterol and 10% lard diet (i.e., high-cholesterol diet (HCD. Male Golden Syrian hamsters were randomly divided into two groups: normal (n = 8, standard diet (control, and experimental (n = 32, a HCD. After a two-week induction followed by a six-week supplementation with Lr263, the 32 hyperlipidemic hamsters were divided into four groups (n = 8 per group to receive vehicle or Lr263 by oral gavage at 2.1, 4.2, or 10.5 × 109 cells/kg/day for 6 weeks, designated the HCD, 1X, 2X and 5X groups, respectively. The efficacy and safety of Lr263 supplementation were evaluated by lipid profiles of serum, liver and feces and by clinical biochemistry and histopathology. HCD significantly increased serum levels of total cholesterol (TC, triacylglycerol (TG cholesterol, high-density lipoprotein cholesterol (HDL-C, and low-density lipoprotein cholesterol (LDL-C, LDL-C/HDL-C ratio, hepatic and fetal TC and TG levels, and degree of fatty liver as compared with controls. Lr263 supplementation dose dependently increased serum HDL-C level and decreased serum TC, TG, LDL-C levels, LDL-C/HDL-C ratio, hepatic TC and TG levels, and fecal TG level. In addition, Lr263 supplementation had few subchronic toxic effects. Lr263 could be a potential agent with a hypolipidemic pharmacological effect.
29 CFR 779.263 - Excise taxes not at the retail level.
2010-07-01
... ACT AS APPLIED TO RETAILERS OF GOODS OR SERVICES Employment to Which the Act May Apply; Enterprise Coverage Excise Taxes § 779.263 Excise taxes not at the retail level. There are also a wide variety of... 29 Labor 3 2010-07-01 2010-07-01 false Excise taxes not at the retail level. 779.263 Section 779...
29 CFR 500.263 - Authority of the Secretary.
2010-07-01
... Administrative Law Judge § 500.263 Authority of the Secretary. The Secretary may modify or vacate the Decision... inconsistent with a policy or precedent established by the Department of Labor, (b) Encompasses determinations...
12 CFR 263.4 - Authority of the Board.
2010-01-01
... RULES OF PRACTICE FOR HEARINGS Uniform Rules of Practice and Procedure § 263.4 Authority of the Board... waive performance of, any act which could be done or ordered by the administrative law judge. ...
Single gene microdeletions and microduplication of 3p26.3 in three unrelated families
DEFF Research Database (Denmark)
Kashevarova, Anna A; Nazarenko, Lyudmila P; Schultz-Pedersen, Soren
2014-01-01
contain several protein-coding genes and regulatory elements, complicating the understanding of genotype-phenotype correlations. We report two siblings with ID and an unrelated patient with atypical autism who had 3p26.3 microdeletions and one intellectually disabled patient with a 3p26.3 microduplication...
26 CFR 1.263(a)-0 - Table of contents.
2010-04-01
...) adjustment. § 1.263(a)-5Amounts paid or incurred to facilitate an acquisition of a trade or business, a... costs. (5) Stock issuance costs of open-end regulated investment companies. (6) Integration costs. (7...
2012-07-17
... DEPARTMENT OF LABOR Employment and Training Administration TA-W-81,263, Chartis Global Services..., Houston, TX; TA-W-81,263A, Chartis Global Services, Inc., a Subsidiary of Chartis, Inc., Regional... is amending the certification (TA-W-81,263) to add ``Regional Processing Organization'' and to add...
12 CFR 263.402 - Removal, suspension, or debarment.
2010-01-01
... accountant from performing audit services for banking organizations that are subject to section 36 of the..., immediately suspend such accountant or firm from performing audit services for banking organizations, if the... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Removal, suspension, or debarment. 263.402...
12 CFR 263.13 - Change of time limits.
2010-01-01
... RULES OF PRACTICE FOR HEARINGS Uniform Rules of Practice and Procedure § 263.13 Change of time limits. Except as otherwise provided by law, the administrative law judge may, for good cause shown, extend the time limits prescribed by the Uniform Rules or by any notice or order issued in the proceedings. After...
Architecture design of motion estimation for ITU-T H.263
Ku, Chung-Wei; Lin, Gong-Sheng; Chen, Liang-Gee; Lee, Yung-Ping
1997-01-01
Digitalized video and audio system has become the trend of the progress in multimedia, because it provides great performance in quality and feasibility of processing. However, as the huge amount of information is needed while the bandwidth is limitted, data compression plays an important role in the system. Say, for a 176 x 144 monochromic sequence with 10 frames/sec frame rate, the bandwidth is about 2Mbps. This wastes much channel resource and limits the applications. MPEG (moving picttre ezpert groip) standardizes the video codec scheme, and it performs high compression ratio while providing good quality. MPEG-i is used for the frame size about 352 x 240 and 30 frames per second, and MPEG-2 provides scalibility and can be applied on scenes with higher definition, say HDTV (high definition television). On the other hand, some applications concerns the very low bit-rate, such as videophone and video-conferencing. Because the channel bandwidth is much limitted in telephone network, a very high compression ratio must be required. ITU-T announced the H.263 video coding standards to meet the above requirements.8 According to the simulation results of TMN-5,22 it outperforms 11.263 with little overhead of complexity. Since wireless communication is the trend in the near future, low power design of the video codec is an important issue for portable visual telephone. Motion estimation is the most computation consuming parts in the whole video codec. About 60% of the computation is spent on this parts for the encoder. Several architectures were proposed for efficient processing of block matching algorithms. In this paper, in order to meet the requirements of 11.263 and the expectation of low power consumption, a modified sandwich architecture in21 is proposed. Based on the parallel processing philosophy, low power is expected and the generation of either one motion vector or four motion vectors with half-pixel accuracy is achieved concurrently. In addition, we will
Lin, Qing-Huan; Que, Fu-Chang; Gu, Chun-Ping; Zhong, De-Sheng; Zhou, Dan; Kong, Yi; Yu, Le; Liu, Shu-Wen
2017-12-01
Both the anti- and pro-apoptotic members of the Bcl-2 family are regulated by a conserved Bcl-2 homology (BH3) domain. ABT-263 (Navitoclax), a novel BH3 mimetic and orally bioavailable Bcl-2 family inhibitor with high affinity for Bcl-xL, Bcl-2 and Bcl-w has entered clinical trials for cancer treatment. But the anticancer mechanisms of ABT-263 have not been fully elucidated. In this study we investigated the effects of ABT-263 on human esophageal cancer cells in vitro and to explore its anticancer mechanisms. Treatment with ABT-263 dose-dependently suppressed the viability of 3 human esophageal cancer cells with IC 50 values of 10.7±1.4, 7.1±1.5 and 8.2±1.6 μmol/L, in EC109, HKESC-2 and CaES-17 cells, respectively. ABT-263 (5-20 μmol/L) dose-dependently induced G 1 /G 0 -phase arrest in the 3 cancer cell lines and induced apoptosis evidenced by increased the Annexin V-positive cell population and elevated levels of cleaved caspase 3, cleaved caspase 9 and PARP. We further demonstrated that ABT-263 treatment markedly increased the expression of p21 Waf1/Cip1 and decreased the expression of cyclin D1 and phospho-Rb (retinoblastoma tumor suppressor protein) (Ser780) proteins that contributed to the G 1 /G 0 -phase arrest. Knockdown of p21 Waf1/Cip1 attenuated ABT-263-induced G 1 /G 0 -phase arrest. Moreover, ABT-263 treatment enhanced pro-survival autophagy, shown as the increased LC3-II levels and decreased p62 levels, which counteracted its anticancer activity. Our results suggest that ABT-263 exerts cytostatic and cytotoxic effects on human esophageal cancer cells in vitro and enhances pro-survival autophagy, which counteracts its anticancer activity.
A case of de novo duplication of 15q24-q26.3
Directory of Open Access Journals (Sweden)
Hye Ran Kim
2011-06-01
Full Text Available Distal duplication, or trisomy 15q, is an extremely rare chromosomal disorder characterized by prenatal and postnatal overgrowth, mental retardation, and craniofacial malformations. Additional abnormalities typically include an unusually short neck, malformations of the fingers and toes, scoliosis and skeletal malformations, genital abnormalities, particularly in affected males, and, in some cases, cardiac defects. The range and severity of symptoms and physical findings may vary from case to case, depending upon the length and location of the duplicated portion of chromosome 15q. Most reported cases of duplication of the long arm of chromosome 15 frequently have more than one segmental imbalance resulting from unbalanced translocations involving chromosome 15 and deletions in another chromosome, as well as other structural chromosomal abnormalities. We report a female newborn with a de novo duplication, 15q24- q26.3, showing intrauterine overgrowth, a narrow asymmetric face with down-slanting palpebral fissures, a large, prominent nose, and micrognathia, arachnodactyly, camptodactyly, congenital heart disease, hydronephrosis, and hydroureter. Chromosomal analysis showed a 46,XX,inv(9(p12q13,dup(15(q24q26.3. Array comparative genomic hybridization analysis revealed a gain of 42 clones on 15q24-q26.3. This case represents the only reported patient with a de novo 15q24-q26.3 duplication that did not result from an unbalanced translocation and did not have a concomitant monosomic component in Korea.
Constitutional 3p26.3 terminal microdeletion in an adolescent with neuroblastoma.
Pezzolo, Annalisa; Sementa, Angela Rita; Lerone, Margherita; Morini, Martina; Ognibene, Marzia; Defferrari, Raffaella; Mazzocco, Katia; Conte, Massimo; Gigliotti, Anna Rita; Garaventa, Alberto; Pistoia, Vito; Varesio, Luigi
2017-05-04
Neuroblastoma (NB) is a common and often lethal cancer of early childhood that accounts for 10% of pediatric cancer mortality. Incidence peaks in infancy and then rapidly declines, with less than 5% of cases diagnosed in children and adolescents ≥ 10 y. There is increasing evidence that NB has unique biology and an chronic disease course in older children and adolescents, but ultimately dismal survival. We describe a rare constitutional 3p26.3 terminal microdeletion which occurred in an adolescent with NB, with apparently normal phenotype without neurocognitive defects. We evaluated the association of expression of genes involved in the microdeletion with NB patient outcomes using R2 platform. We screened NB patient's tumor cells for CHL1 protein expression using immunofluorescence. Constitutional and tumor DNA were tested by array-comparative genomic hybridization and single nucleotide-polymorphism-array analyses. Peripheral blood mononuclear cells from the patient showed a 2.54 Mb sub-microscopic constitutional terminal 3p deletion that extended to band p26.3. The microdeletion 3p disrupted the CNTN4 gene and the neighboring CNTN6 and CHL1 genes were hemizygously deleted, each of these genes encode neuronal cell adhesion molecules. Low expression of CNTN6 and CNTN4 genes did not stratify NB patients, whereas low CHL1 expression characterized 417 NB patients having worse overall survival. CHL1 protein expression on tumor cells from the patient was weaker than positive control. This is the first report of a constitutional 3p26.3 deletion in a NB patient. Since larger deletions of 3p, indicative of the presence of one or more tumor suppressor genes in this region, occur frequently in neuroblastoma, our results pave the way to the identification of one putative NB suppressor genes mapping in 3p26.3.
2010-04-01
... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Exception for qualified creative expenses incurred by certain free-lance authors, photographers, and artists. [Reserved] 1.263A-5 Section 1.263A-5... certain free-lance authors, photographers, and artists. [Reserved] ...
Ting, Wei-Jen; Kuo, Wei-Wen; Kuo, Chia-Hua; Yeh, Yu-Lan; Shen, Chia-Yao; Chen, Ya-Hui; Ho, Tsung-Jung; Viswanadha, Vijaya Padma; Chen, Yi-Hsing; Huang, Chih-Yang
2015-09-14
Obesity and hyperlipidaemia increase the risk of CVD. Some strains of probiotics have been suggested to have potential applications in cardiovascular health by lowering serum LDL-cholesterol. In this work, high-fat diet-induced hyperlipidaemia in hamsters was treated with different doses (5×108 and 2·5×109 cells/kg per d) of heat-killed Lactobacillus reuteri GMNL-263 (Lr263) by oral gavage for 8 weeks. The serum lipid profile analysis showed that LDL-cholesterol and plasma malondialdehyde (P-MDA) were reduced in the GMNL-263 5×108 cells/kg per d treatment group. Total cholesterol and P-MDA were reduced in the GMNL-263 2·5×109 cells/kg per d treatment group. In terms of heart function, the GMNL-263 2·5×109 cells/kg per d treatments improved the ejection fraction from 85·71 to 91·81 % and fractional shortening from 46·93 to 57·92 % in the high-fat diet-fed hamster hearts. Moreover, the GMNL-263-treated, high-fat diet-fed hamster hearts exhibited reduced Fas-induced myocardial apoptosis and a reactivated IGF1R/PI3K/Akt cell survival pathway. Interestingly, the GMNL-263 treatments also enhanced the heat-shock protein 27 expression in a dose-dependent manner, but the mechanism for this increase remains unclear. In conclusion, supplementary heat-killed L. reuteri GMNL-263 can slightly reduce serum cholesterol. The anti-hyperlipidaemia effects of GMNL-263 may reactivate the IGF1R/PI3K/Akt cell survival pathway and reduce Fas-induced myocardial apoptosis in high-fat diet-fed hamster hearts.
Directory of Open Access Journals (Sweden)
Wei-Jen Ting
2015-10-01
Full Text Available Obesity is one of the major risk factors for nonalcoholic fatty liver disease (NAFLD, and NAFLD is highly associated with an increased risk of cardiovascular disease (CVD. Scholars have suggested that certain probiotics may significantly impact cardiovascular health, particularly certain Lactobacillus species, such as Lactobacillus reuteri GMNL-263 (Lr263 probiotics, which have been shown to reduce obesity and arteriosclerosis in vivo. In the present study, we examined the potential of heat-killed bacteria to attenuate high fat diet (HFD-induced hepatic and cardiac damages and the possible underlying mechanism of the positive effects of heat-killed Lr263 oral supplements. Heat-killed Lr263 treatments (625 and 3125 mg/kg-hamster/day were provided as a daily supplement by oral gavage to HFD-fed hamsters for eight weeks. The results show that heat-killed Lr263 treatments reduce fatty liver syndrome. Moreover, heat-killed Lactobacillus reuteri GMNL-263 supplementation in HFD hamsters also reduced fibrosis in the liver and heart by reducing transforming growth factor β (TGF-β expression levels. In conclusion, heat-killed Lr263 can reduce lipid metabolic stress in HFD hamsters and decrease the risk of fatty liver and cardiovascular disease.
26 CFR 1.263(a)-2 - Examples of capital expenditures.
2010-04-01
...) INCOME TAX (CONTINUED) INCOME TAXES Items Not Deductible § 1.263(a)-2 Examples of capital expenditures... subsidiary and increasing the value of its stockholdings in the subsidiary shall not deduct amounts paid in... be added to the cost of its stock in the subsidiary. (h) The cost of good will in connection with the...
Hsu, Tsai-Ching; Huang, Chih-Yang; Liu, Chung-Hsien; Hsu, Kuo-Ching; Chen, Yi-Hsing; Tzang, Bor-Show
2017-04-01
Probiotics are known to regulate host immunity by interacting with systemic and mucosal immune cells as well as intestinal epithelial cells. Supplementation with certain probiotics has been reported to be effective against various disorders, including immune-related diseases. However, little is known about the effectiveness of Lactobacillus paracasei GMNL-32 (GMNL-32), Lactobacillus reuteri GMNL-89 (GMNL-89) and L. reuteri GMNL-263 (GMNL-263) in the management of autoimmune diseases, especially systemic lupus erythematosus (SLE). NZB/W F1 mice, which are a lupus-prone animal model, were orally gavaged with GMNL-32, GMNL-89 or GMNL-263 to investigate the effects of these Lactobacillus strains on liver injuries in NZB/W F1 mice. The results thus obtained reveal that supplementary GMNL-32, GMNL-89 or GMNL-263 in NZB/W F1 mice ameliorates hepatic apoptosis and inflammatory indicators, such as matrix metalloproteinase-9 activity and C-reactive protein and inducible nitric oxide synthase expressions. In addition, supplementation with GMNL-32, GMNL-89 or GMNL-263 in NZB/W F1 mice reduced the expressions of hepatic IL-1β, IL-6 and TNF-α proteins by suppressing the mitogen-activated protein kinase and NF-κB signalling pathways. These findings, presented here for the first time, reveal that GMNL-32, GMNL-89 and GMNL-263 mitigate hepatic inflammation and apoptosis in lupus-prone mice and may support an alternative remedy for liver disorders in cases of SLE.
12 CFR 263.62 - Relevant considerations for assessment of civil penalty.
2010-01-01
... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Relevant considerations for assessment of civil... Collection of Civil Money Penalties § 263.62 Relevant considerations for assessment of civil penalty. In... the penalty with respect to the financial resources and good faith of the person charged, the gravity...
International Nuclear Information System (INIS)
Kellogg, L.S.; Ulseth, J.A.; Lippincott, E.P.; Oliver, B.; Farrar, H.
1982-12-01
This document provides a complete description of dosimetry fabricated for the Maine Yankee Surveillance Capsule Number 263 and three azimuthal positions in the reactor cavity. Surveillance Capsule 263 was originally scheduled for insertion in October 1982, but will be held in reserve for future use, pending establishment of an equilibrium low leakage core burnup distribution. The cavity dosimetry is scheduled for insertion in November 1982
ANALISA OPTIMALISASI TEKNIK ESTIMASI DAN KOMPENSASI GERAK PADA ENKODER VIDEO H.263
Directory of Open Access Journals (Sweden)
Oka Widyantara
2009-05-01
Full Text Available Mode baseline encoder video H.263 menerapkan teknik estimasi dan kompensasi gerak dengan satu vector gerak untuk setiap macroblock. Prosedur area pencarian menggunakan pencarian penuh dengan akurasi setengah pixel pada bidang [16,15.5] membuat prediksi di tepian frame tidak dapat diprediksi dengan baik. Peningkatan unjuk kerja pengkodean prediksi interframe encoder video H.263 dengan optimalisasi teknik estimasi dan kompensasi gerak diimplementasikan dengan penambahan area pencarian [31.5,31.5] (unrestricted motion vector, Annex D dan 4 motion vector (advanced prediction mode, Annex F. Hasil penelitian menunjukkan bahwa advanced mode mampu meningkatkan nilai SNR sebesar 0.03 dB untuk sequence video claire, 0.2 dB untuk sequence video foreman, 0.041 dB untuk sequence video Glasgow, dan juga mampu menurunkan bit rate pengkodean sebesar 2.3 % untuk video Claire, 15.63 % untuk video Foreman, dan 9.8% untuk video Glasgow dibandingkan dengan implementasi 1 motion vector pada pengkodean baseline mode.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Does the employee pay interest when he or she makes up missed contributions or elective deferrals? 1002.263 Section 1002.263 Employees' Benefits OFFICE OF THE ASSISTANT SECRETARY FOR VETERANS' EMPLOYMENT AND TRAINING SERVICE, DEPARTMENT OF LABOR REGULATIONS UNDER THE UNIFORMED SERVICES...
Barta, Michael L.; Thomas, Keisha; Yuan, Hongling; Lovell, Scott; Battaile, Kevin P.; Schramm, Vern L.; Hefty, P. Scott
2014-01-01
The obligate intracellular human pathogen Chlamydia trachomatis is the etiological agent of blinding trachoma and sexually transmitted disease. Genomic sequencing of Chlamydia indicated this medically important bacterium was not exclusively dependent on the host cell for energy. In order for the electron transport chain to function, electron shuttling between membrane-embedded complexes requires lipid-soluble quinones (e.g. menaquionone or ubiquinone). The sources or biosynthetic pathways required to obtain these electron carriers within C. trachomatis are poorly understood. The 1.58Å crystal structure of C. trachomatis hypothetical protein CT263 presented here supports a role in quinone biosynthesis. Although CT263 lacks sequence-based functional annotation, the crystal structure of CT263 displays striking structural similarity to 5′-methylthioadenosine nucleosidase (MTAN) enzymes. Although CT263 lacks the active site-associated dimer interface found in prototypical MTANs, co-crystal structures with product (adenine) or substrate (5′-methylthioadenosine) indicate that the canonical active site residues are conserved. Enzymatic characterization of CT263 indicates that the futalosine pathway intermediate 6-amino-6-deoxyfutalosine (kcat/Km = 1.8 × 103 m−1 s−1), but not the prototypical MTAN substrates (e.g. S-adenosylhomocysteine and 5′-methylthioadenosine), is hydrolyzed. Bioinformatic analyses of the chlamydial proteome also support the futalosine pathway toward the synthesis of menaquinone in Chlamydiaceae. This report provides the first experimental support for quinone synthesis in Chlamydia. Menaquinone synthesis provides another target for agents to combat C. trachomatis infection. PMID:25253688
Deformed potential energy of $^{263}Db$ in a generalized liquid drop model
Chen Bao Qiu; Zhao Yao Lin; 10.1088/0256-307X/20/11/009
2003-01-01
The macroscopic deformed potential energy for super-heavy nuclei /sup 263/Db, which governs the entrance and alpha decay channels, is determined within a generalized liquid drop model (GLDM). A quasi- molecular shape is assumed in the GLDM, which includes volume-, surface-, and Coulomb-energies, proximity effects, mass asymmetry, and an accurate nuclear radius. The microscopic single particle energies derived from a shell model in an axially deformed Woods- Saxon potential with a quasi-molecular shape. The shell correction is calculated by the Strutinsky method. The total deformed potential energy of a nucleus can be calculated by the macro-microscopic method as the summation of the liquid-drop energy and the Strutinsky shell correction. The theory is applied to predict the deformed potential energy of the experiment /sup 22/Ne+/sup 241/Am to /sup 263/Db* to /sup 259/Db+4 n, which was performed on the Heavy Ion Accelerator in Lanzhou. It is found that the neck in the quasi-molecular shape is responsible for t...
NIMONIC 263 microstructure and surface characterization after laser shock peening
Directory of Open Access Journals (Sweden)
P. Drobnjak
2015-07-01
Full Text Available The Laser Shock Peening (LSP is applied to the surface of Nimonic 263 alloy. The changes in microstructure and surface topography are observed and analyzed by Scanning Electron Microscopy (SEM, profilometer and microhardness tester. Various laser regimes are chosen which provoke effects of both mechanical and thermo-mechanical treatments of the sample surface. The optimal process parameters, that result in the finest microstructure, smooth and clean surface, are determined. Some wanted and unwanted phases leading to the crack formation are observed.
26 CFR 1.263A-2 - Rules relating to property produced by the taxpayer.
2010-04-01
... disbursements method of accounting. (2) Definition of a contract—(i) General rule. Except as provided under... financial institutions incur to originate loans. (ii) Intellectual or creative property. For purposes of...) Introduction. This paragraph (b) provides a simplified method for determining the additional section 263A costs...
Non-LTE analysis of extremely helium-rich stars. The hot sdO stars LSE 153, 259 and 263
Husfeld, D.; Butler, K.; Heber, U.; Drilling, J. S.
1989-01-01
Results of a non-LTE fine analysis based mainly on high-resolution CASPEC spectra for three extremely helium-rich sdO stars are discussed in order to explain hydrogen deficiency in single stars. High temperature (Teff = 70,000 to 75,000 K) and a position in the log Teff - log g diagram were found close to the Eddington limit. Various abundance estimates are derived for hydrogen (upper limits only), carbon, nitrogen, and magnesium. Hydrogen is reduced to less than 10 percent by number in LSE 153 and LSE 263, and to less than 5 percent in LSE 259. The hydrogen deficiency is accompanied by nitrogen- and carbon-enrichment in LSE 153 and LSE 259 only. In LSE 263, carbon is depleted by about 1 dex. Stellar masses obtained by assuming that a core mass-luminosity relation holds for these stars, were found to be in the range 0.6-0.9 solar mass, yielding luminosities log L/L:solar = 3.7-4.5. Two of the program stars (LSE 153 and 259) appear to be possible successors of the R CrB and helium B stars, whereas the third star (LSE 263) displays a much lower carbon content in its photosphere making it an exceptional case among the known hydrogen deficient stars.
Rotational emission-line spectrum of Orion A between 247 and 263 GHZ
International Nuclear Information System (INIS)
Blake, G.A.; Sutton, E.C.; Masson, C.R.; Phillips, T.G.
1986-01-01
Results are presented from a molecular line survey of the core of the Orion molecular cloud between 247 and 263 GHz. The spectrum contains a total of 243 resolvable lines from 23 different chemical species. When combined with the earlier survey of Orion from 215 to 247 GHz by Sutton et al (1985), the complete data set includes over 780 emission features from 29 distinct molecules. Of the 23 molecules detected in this survey, only NO, CCH, and HCO + were identified not in the lower frequency data
25 CFR 26.3 - What is the purpose of the Job Placement and Training Program?
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false What is the purpose of the Job Placement and Training... PLACEMENT AND TRAINING PROGRAM General Applicability § 26.3 What is the purpose of the Job Placement and Training Program? The purpose of the Job Placement and Training Program is to assist eligible applicants to...
Kenneth T. Belt; William P. Stack; Richard V. Pouyat; Kimberly Burgess; Peter M. Groffman; William M. Frost; Sujay S. Kaushal; Guy. Hager
2014-01-01
We discuss the results of sampling baseflow and stormwater runoff in Watershed 263, an ultra-urban catchment in west Baltimore City that is undergoing restoration aimed at both improving water quality as well as the quality of life in its neighborhoods. We focus on urban hydrology and describe the high baseflow and stormwater nutrient, metal, bacterial and other...
A Glio-Protective Role of mir-263a by Tuning Sensitivity to Glutamate
DEFF Research Database (Denmark)
Aw, Sherry Shiying; Lim, Isaac Kok Hwee; Tang, Melissa Xue Mei
2017-01-01
of CG5621/Grik, Nmdar1, and Nmdar2. mir-263a mutants exhibit excitotoxic death of a subset of astrocyte-like and ensheathing glia in the CNS. Glial-specific normalization of glutamate receptor levels restores cell numbers and suppresses the movement defect. Therefore, microRNA-mediated regulation...... of glutamate receptor levels protects glia from excitotoxicity, ensuring CNS health. Chronic low-level glutamate receptor overexpression due to mutations affecting microRNA (miRNA) regulation might contribute to glial dysfunction and CNS impairment....
Total conversion coefficient of the 263 keV (21/sup 2//2->13/sup +//2) transition in sup(93m)Mo
Energy Technology Data Exchange (ETDEWEB)
Suryanaryana, C.; Venkateswara Rao, M.; Narayana, D.G.S.; Bhuloka Reddy, S.; Satyanarayana, G.; Sastry, D.L.; Chintalapudi, S.N.
1985-01-01
The total conversion coefficient of the 263 keV gamma transition in the decay scheme of sup(93m)Mo is measured by intensity balance method using a HP Ge spectrometer system. The experimental value of ..cap alpha..sub(T)(263 keV) is found to be 0.696 +- 0.05 which is in agreement with the theoretical values 0.72 and 0.7. The transition probability T(E4) is calculated using the present value of ..cap alpha..sub(T) and compared with the single-particle estimate. A good agreement is noted between the theory and the experiment for the value of T(E4).
Nuclear data sheets for (odd-A) A = 249 through A = 263
International Nuclear Information System (INIS)
Schmorak, M.R.
1976-01-01
The available experimental data pertaining to the nuclear structure of nuclei with odd mass numbers A = 249 through 263 are compiled (the even-A mass chains were published in March 1976). The results from various decay and reaction measurements, as available through February 1976, are compared and evaluated and alpha-hindrance factors are calculated (see Table 2); syst refers to systematics values: in the case of SF a rough order of magnitude estimate of T/sub 1/2/(SF) was made in a manner similar to that of 73Ra38, T/sub 1/2/(α) syst were obtained as in 72E1Sc, and Q-values from systematics were obtained in a manner similar to that of 71WaGo
Polarimetry diagnostic on OMEGA EP using a 10-ps, 263-nm probe beam
International Nuclear Information System (INIS)
Davies, A.; Haberberger, D.; Boni, R.; Ivancic, S.; Brown, R.; Froula, D. H.
2014-01-01
A polarimetry diagnostic was built and characterized for magnetic-field measurements in laser-plasma experiments on the OMEGA EP laser. This diagnostic was built into the existing 4ω (263-nm) probe system that employs a 10-ps laser pulse collected with an f/4 imaging system. The diagnostic measures the rotation of the probe beam's polarization. The polarimeter uses a Wollaston prism to split the probe beam into orthogonal polarization components. Spatially localized intensity variations between images indicate polarization rotation. Magnetic fields can be calculated by combining the polarimetry data with the measured plasma density profile obtained from angular filter refractometry
Polarimetry diagnostic on OMEGA EP using a 10-ps, 263-nm probe beam.
Davies, A; Haberberger, D; Boni, R; Ivancic, S; Brown, R; Froula, D H
2014-11-01
A polarimetry diagnostic was built and characterized for magnetic-field measurements in laser-plasma experiments on the OMEGA EP laser. This diagnostic was built into the existing 4ω (263-nm) probe system that employs a 10-ps laser pulse collected with an f/4 imaging system. The diagnostic measures the rotation of the probe beam's polarization. The polarimeter uses a Wollaston prism to split the probe beam into orthogonal polarization components. Spatially localized intensity variations between images indicate polarization rotation. Magnetic fields can be calculated by combining the polarimetry data with the measured plasma density profile obtained from angular filter refractometry.
Czech Academy of Sciences Publication Activity Database
Mandal, A.; Dixit, A. R.; Chattopadhyaya, S.; Paramanik, A.; Hloch, Sergej; Królczyk, G.
2017-01-01
Roč. 93, 1-4 (2017), s. 433-443 ISSN 0268-3768 Institutional support: RVO:68145535 Keywords : surface integrity * wire-EDM * Nimonic C-263 * multi-cut * recast layer Subject RIV: JQ - Machines ; Tools OBOR OECD: Mechanical engineering Impact factor: 2.209, year: 2016 https://link.springer.com/article/10.1007/s00170-017-9993-x
Czech Academy of Sciences Publication Activity Database
Mandal, A.; Dixit, A. R.; Chattopadhyaya, S.; Paramanik, A.; Hloch, Sergej; Królczyk, G.
2017-01-01
Roč. 93, 1-4 (2017), s. 433-443 ISSN 0268-3768 Institutional support: RVO:68145535 Keywords : surface integrity * wire-EDM * Nimonic C-263 * multi-cut * recast layer Subject RIV: JQ - Machines ; Tools OBOR OECD: Mechanical engineering Impact factor: 2.209, year: 2016 https://link.springer.com/ article /10.1007/s00170-017-9993-x
Polarimetry diagnostic on OMEGA EP using a 10-ps, 263-nm probe beam
Energy Technology Data Exchange (ETDEWEB)
Davies, A., E-mail: adavies@lle.rochester.edu; Haberberger, D.; Boni, R.; Ivancic, S.; Brown, R.; Froula, D. H. [Laboratory for Laser Energetics, University of Rochester, Rochester, New York 14623 (United States)
2014-11-15
A polarimetry diagnostic was built and characterized for magnetic-field measurements in laser-plasma experiments on the OMEGA EP laser. This diagnostic was built into the existing 4ω (263-nm) probe system that employs a 10-ps laser pulse collected with an f/4 imaging system. The diagnostic measures the rotation of the probe beam's polarization. The polarimeter uses a Wollaston prism to split the probe beam into orthogonal polarization components. Spatially localized intensity variations between images indicate polarization rotation. Magnetic fields can be calculated by combining the polarimetry data with the measured plasma density profile obtained from angular filter refractometry.
Froula, D. H.; Boni, R.; Bedzyk, M.; Craxton, R. S.; Ehrne, F.; Ivancic, S.; Jungquist, R.; Shoup, M. J.; Theobald, W.; Weiner, D.; Kugland, N. L.; Rushford, M. C.
2012-10-01
A 10-ps, 263-nm (4ω) laser is being built to probe plasmas produced on the OMEGA EP [J. H. Kelly, L. J. Waxer, V. Bagnoud, I. A. Begishev, J. Bromage, B. E. Kruschwitz, T. E. Kessler, S. J. Loucks, D. N. Maywar, R. L. McCrory et al., J. Phys. IV France 133, 75-80 (2006)], 10.1051/jp4:2006133015. A suite of optical diagnostics (schlieren, interferometry, and grid image refractometry) has been designed to diagnose and characterize a wide variety of plasmas. Light scattered by the probe beam is collected by an f/4 catadioptric telescope and a transport system is designed to image with a near-diffraction-limited resolution (˜1 - μm full width at half maximum) over a 5-mm field of view to a diagnostic table. The transport system provides a contrast greater than 1 : 104 with respect to all wavelengths outside of the 263 ± 2 nm measurement range.
Energy Technology Data Exchange (ETDEWEB)
Froula, D. H.; Boni, R.; Bedzyk, M.; Craxton, R. S.; Ehrne, F.; Ivancic, S.; Jungquist, R.; Shoup, M. J.; Theobald, W.; Weiner, D. [Laboratory for Laser Energetics, University of Rochester, 250 E. River Rd., Rochester, New York 14616 (United States); Kugland, N. L.; Rushford, M. C. [Lawrence Livermore National Laboratory, University of California, P. O. Box 808, Livermore, California 94551 (United States)
2012-10-15
A 10-ps, 263-nm (4{omega}) laser is being built to probe plasmas produced on the OMEGA EP [J. H. Kelly, L. J. Waxer, V. Bagnoud, I. A. Begishev, J. Bromage, B. E. Kruschwitz, T. E. Kessler, S. J. Loucks, D. N. Maywar, R. L. McCrory et al., J. Phys. IV France 133, 75-80 (2006)]. A suite of optical diagnostics (schlieren, interferometry, and grid image refractometry) has been designed to diagnose and characterize a wide variety of plasmas. Light scattered by the probe beam is collected by an f/4 catadioptric telescope and a transport system is designed to image with a near-diffraction-limited resolution ({approx}1 -{mu}m full width at half maximum) over a 5-mm field of view to a diagnostic table. The transport system provides a contrast greater than 1 : 10{sup 4} with respect to all wavelengths outside of the 263 {+-} 2 nm measurement range.
Froula, D H; Boni, R; Bedzyk, M; Craxton, R S; Ehrne, F; Ivancic, S; Jungquist, R; Shoup, M J; Theobald, W; Weiner, D; Kugland, N L; Rushford, M C
2012-10-01
A 10-ps, 263-nm (4ω) laser is being built to probe plasmas produced on the OMEGA EP [J. H. Kelly, L. J. Waxer, V. Bagnoud, I. A. Begishev, J. Bromage, B. E. Kruschwitz, T. E. Kessler, S. J. Loucks, D. N. Maywar, R. L. McCrory et al., J. Phys. IV France 133, 75-80 (2006)]. A suite of optical diagnostics (schlieren, interferometry, and grid image refractometry) has been designed to diagnose and characterize a wide variety of plasmas. Light scattered by the probe beam is collected by an f/4 catadioptric telescope and a transport system is designed to image with a near-diffraction-limited resolution (~1 - μm full width at half maximum) over a 5-mm field of view to a diagnostic table. The transport system provides a contrast greater than 1 : 10(4) with respect to all wavelengths outside of the 263 ± 2 nm measurement range.
International Nuclear Information System (INIS)
Froula, D. H.; Boni, R.; Bedzyk, M.; Craxton, R. S.; Ehrne, F.; Ivancic, S.; Jungquist, R.; Shoup, M. J.; Theobald, W.; Weiner, D.; Kugland, N. L.; Rushford, M. C.
2012-01-01
A 10-ps, 263-nm (4ω) laser is being built to probe plasmas produced on the OMEGA EP [J. H. Kelly, L. J. Waxer, V. Bagnoud, I. A. Begishev, J. Bromage, B. E. Kruschwitz, T. E. Kessler, S. J. Loucks, D. N. Maywar, R. L. McCrory et al., J. Phys. IV France 133, 75–80 (2006)]. A suite of optical diagnostics (schlieren, interferometry, and grid image refractometry) has been designed to diagnose and characterize a wide variety of plasmas. Light scattered by the probe beam is collected by an f/4 catadioptric telescope and a transport system is designed to image with a near-diffraction-limited resolution (∼1 −μm full width at half maximum) over a 5-mm field of view to a diagnostic table. The transport system provides a contrast greater than 1 : 10 4 with respect to all wavelengths outside of the 263 ± 2 nm measurement range.
45 CFR 263.1 - How much State money must a State expend annually to meet the basic MOE requirement?
2010-10-01
... 45 Public Welfare 2 2010-10-01 2010-10-01 false How much State money must a State expend annually... State's Maintenance of Effort? § 263.1 How much State money must a State expend annually to meet the... historic State expenditures. (2) However, if a State meets the minimum work participation rate requirements...
Indian Academy of Sciences (India)
the discovery of new elements using particle accelerators. He con- cludes by stating that "we might have reached the limits of the periodic table as a predictive tool". The third article is by Butera on. Glenn Seaborg who holds the record for the discovery of the largest number of elements - one of them named Seaborgium.
2010-01-01
... Department of Agriculture (Continued) GRAIN INSPECTION, PACKERS AND STOCKYARD ADMINISTRATION (FEDERAL GRAIN INSPECTION SERVICE), DEPARTMENT OF AGRICULTURE GENERAL REGULATIONS AND STANDARDS FOR CERTAIN AGRICULTURAL..., see § 868.263(c). 3 Plates should be used for southern production rice and sieves should be used for...
Generation of femtosecond laser pulses at 263 nm by K3B6O10Cl crysta*
International Nuclear Information System (INIS)
Zhang Ning-Hua; He Peng; Huang Hang-Dong; Zhu Jiang-Feng; Tian Wen-Long; Fang Shao-Bo; Teng Hao; Wei Zhi-Yi; Wu Hong-Ping; Pan Shi-Lie
2017-01-01
The third harmonic generation (THG) of a linear cavity Ti:sapphire regenerative amplifier by use of a K 3 B 6 O 10 Cl (KBOC) crystal is studied for the first time. Output power up to 5.9 mW is obtained at a central wavelength of 263 nm, corresponding to a conversion efficiency of 4.5% to the second harmonic power. Our results show a tremendous potential for nonlinear frequency conversion into the deep ultraviolet range with the new crystal and the output laser power can be further improved. (paper)
SU-E-P-22: AAPM Task Group 263 Tackling Standardization of Nomenclature for Radiation Therapy
Energy Technology Data Exchange (ETDEWEB)
Matuszak, M; Feng, M [University of Michigan, Ann Arbor, MI (United States); Moran, J [Univ Michigan Medical Center, Ann Arbor, MI (United States); Xiao, Y [Thomas Jefferson University, Philadelphia, PA (United States); Mayo, C; Miller, R [Mayo Clinic, Rochester, MN (United States); Bosch, W [Washington Univ, Saint Louis, MO (United States); Popple, R [Univ Alabama Birmingham, Birmingham, AL (United States); Marks, L [UNC School of Medicine, Chapel Hill, NC (United States); Wu, Q [Duke University Medical Center, Durham, NC (United States); Molineu, A; Martel, M [UT MD Anderson Cancer Center, Houston, TX (United States); Yock, T [Massachusetts General Hospital, Boston, MA (United States); McNutt, T [Johns Hopkins University, Severna Park, MD (United States); Brown, N [Baptist Medical Center, Jacksonville, FL (United States); Purdie, T [Princess Margaret Hospital, Toronto, ON (Canada); Yorke, E [Memorial Sloan-Kettering Cancer Center, New York, NY (United States); Santanam, L [Washington University School of Medicine, St.louis, MO (United States); Gabriel, P [University of Pennsylvania, Philadelphia, PA (United States); Michalski, J [Washington University, Saint Louis, MO (United States); and others
2015-06-15
Purpose: There is growing recognition of need for increased clarity and consistency in the nomenclatures used for body and organ structures, DVH metrics, toxicity, dose and volume units, etc. Standardization has multiple benefits; e.g. facilitating data collection for clinical trials, enabling the pooling of data between institutions, making transfers (i.e. hand-offs) between centers safer, and enabling vendors to define “default” settings. Towards this goal, the American Association of Physicists in Medicine (AAPM) formed a task group (TG263) in July of 2014, operating under the Work Group on Clinical Trials to develop consensus statements. Guiding principles derived from the investigation and example nomenclatures will be presented for public feedback. Methods: We formed a multi-institutional and multi-vendor collaborative group of 39 physicists, physicians and others involved in clinical use and electronic transfer of information. Members include individuals from IROC, NRG, IHE-RO, DICOM WG-7, ASTRO and EORTC groups with overlapping interests to maximize the quality of the consensus and increase the likelihood of adoption. Surveys of group and NRG members were used to define current nomenclatures and requirements. Technical requirements of vendor systems and the proposed DICOM standards were examined. Results: There is a marked degree of inter and intra institutional variation in current approaches, resulting from inter-vendor differences in capabilities, clinic specific conceptualizations and inconsistencies. Using a consensus approach, the group defined optimal formats for the naming of targets and normal structures. A formal objective assessment of 13 existing clinically-used software packages show that all had capabilities to accommodate these recommended nomenclatures. Conclusions: A multi-stakeholder effort is making significant steps forward in developing a standard nomenclature that will work across platforms. Our current working list includes > 550
Energy Technology Data Exchange (ETDEWEB)
Matsushima, Y. [Tokyo Inst. of Tech., Tokyo (Japan)
2000-01-01
CP-263, 114 isolated as a squalene synthetase inhibitor and the decyclization of CP-225, 917 was not only expected to be a lead chemical compound of the hypercholesterolemia medicine, but also have collected the attention of the organic synthetic chemistry researchers all over the world from the ring structure of advanced oxygen functionalization. In the CP- chemical compound, the constructive method of the bicyclo ring structure is a key of the synthesis, there are three reports to use the intramolecular Diels-Alder reaction (Fukuyama) and the siloxy-Cope rearrangement (Leighton), intramolecular Heck reaction (Danishefsky) as a result of succeeding in including the foothold to the side-chain lactol ring. Recently, Nicolaou et al. succeeded for the first time in the total synthesis racemic modification shell. They carried out the skeleton construction by the intramolecular Diels-Alder reaction, and constructed the maleic anhydride structure in taking the ketone as a foothold. (NEDO)
The role of particle ripening on the creep acceleration of Nimonic 263 superalloy
Directory of Open Access Journals (Sweden)
Angella Giuliano
2014-01-01
Full Text Available Physically based constitutive equations need to incorporate the most relevant microstructural features of materials to adequately describe their mechanical behaviour. To accurately model the creep behaviour of precipitation hardened alloys, the value and the evolution of strengthening particle size are important parameters to be taken into account. In the present work, creep tests have been run on virgin and overaged (up to 3500 h at 800 ∘C Nimonic 263, a polycrystalline nickel base superalloy used for combustion chambers of gas turbines. The experimental results suggest that the reinforcing particle evolution is not the main reason for the creep acceleration that seems to be better described by a strain correlated damage, such as the accumulation of mobile dislocations or the grain boundary cavitation. The coarsened microstructure, obtained by overageing the alloy at high temperature before creep testing, mainly influences the initial stage of the creep, resulting in a higher minimum creep rate and a corresponding reduction of the creep resistance.
Synthesis and detection of a seaborgium carbonyl complex
Even, J.; Yakushev, A.; Duellmann, Ch E.; Haba, H.; Asai, M.; Sato, T. K.; Brand, H.; Di Nitto, A.; Eichler, R.; Fan, F. L.; Hartmann, W.; Huang, M.; Jaeger, E.; Kaji, D.; Kanaya, J.; Kaneya, Y.; Khuyagbaatar, J.; Kindler, B.; Kratz, J. V.; Krier, J.; Kudou, Y.; Kurz, N.; Lommel, B.; Miyashita, S.; Morimoto, K.; Morita, K.; Murakami, M.; Nagame, Y.; Nitsche, H.; Ooe, K.; Qin, Z.; Schaedel, M.; Steiner, J.; Sumita, T.; Takeyama, M.; Tanaka, K.; Toyoshima, A.; Tsukada, K.; Tuerler, A.; Usoltsev, I.; Wakabayashi, Y.; Wang, Y.; Wiehl, N.; Yamaki, S.
2014-01-01
Experimental investigations of transactinoide elements provide benchmark results for chemical theory and probe the predictive power of trends in the periodic table. So far, in gas-phase chemical reactions, simple inorganic compounds with the transactinoide in its highest oxidation state have been
Chemistry of the heaviest elements--one atom at a time
International Nuclear Information System (INIS)
Hoffman, Darleane C.; Lee, Diana M.
2000-01-01
In keeping with the goal of the Viewpoint series of the Journal of Chemical Education, this article gives a 75-year perspective of the chemistry of the heaviest elements, including a 50-year retrospective view of past developments, a summary of current research achievements and applications, and some predictions about exciting, new developments that might be envisioned within the next 25 years. A historical perspective of the importance of chemical separations in the discoveries of the transuranium elements from neptunium (Z=93) through mendelevium (Z=101) is given. The development of techniques for studying the chemical properties of mendelevium and still heavier elements on the basis of measuring the radioactive decay of a single atom (''atom-at-a-time'' chemistry) and combining the results of many separate experiments is reviewed. The influence of relativistic effects (expected to increase as Z 2 ) on chemical properties is discussed. The results from recent atom-at-a-time studies of the chemistry of the heaviest elements through seaborgium (Z=106) are summarized and show that their properties cannot be readily predicted based on simple extrapolation from the properties of their lighter homologues in the periodic table. The prospects for extending chemical studies to still heavier elements than seaborgium are considered and appear promising
Directory of Open Access Journals (Sweden)
Carolina Paola García
Full Text Available Human embryonic stem cells (hESCs are hypersensitive to genotoxic stress and display lower survival ability relative to their differentiated progeny. Herein, we attempted to investigate the source of this difference by comparing the DNA damage responses triggered by the topoisomerase I inhibitor camptothecin, in hESCs, human induced pluripotent stem cells (hiPSCs and hESCs-derived neuroprogenitors (NP. We observed that upon camptothecin exposure pluripotent stem cells underwent apoptosis more swiftly and at a higher rate than differentiated cells. However, the cellular response encompassing ataxia-telangiectasia mutated kinase activation and p53 phosphorylation both on serine 15 as well as on serine 46 resulted very similar among the aforementioned cell types. Importantly, we observed that hESCs and hiPSCs express lower levels of the anti-apoptotic protein Bcl-2 than NP. To assess whether Bcl-2 abundance could account for this differential response we treated cells with ABT-263, WEHI-539 and ABT-199, small molecules that preferentially target the BH3-binding pocket of Bcl-xL and/or Bcl-2 and reduce their ability to sequester pro-apoptotic factors. We found that in the absence of stress stimuli, NP exhibited a higher sensitivity to ABT- 263 and WEHI-539 than hESCs and hiPSCs. Conversely, all tested cell types appeared to be highly resistant to the Bcl-2 specific inhibitor, ABT-199. However, in all cases we determined that ABT-263 or WEHI-539 treatment exacerbated camptothecin-induced apoptosis. Importantly, similar responses were observed after siRNA-mediated down-regulation of Bcl-xL or Bcl-2. Taken together, our results suggest that Bcl-xL contrary to Bcl-2 contributes to ensure cell survival and also functions as a primary suppressor of DNA double-strand brake induced apoptosis both in pluripotent and derived NP cells. The emerging knowledge of the relative dependence of pluripotent and progenitor cells on Bcl-2 and Bcl-xL activities may help
Directory of Open Access Journals (Sweden)
Chih-Ping Chen
2011-09-01
Conclusion: The present case provides evidence for prenatal overgrowth, craniosynostosis, and characteristic facial dysmorphism in association with a duplication of 15q26.2→q26.3 and a duplication of the IGF1R gene. Prenatal diagnosis of fetal overgrowth should include a differential diagnosis of the chromosome 15q overgrowth syndrome.
McLeod, Neil P; Nugent, Philip; Dixon, Douglas; Dennis, Mike; Cornwall, Mark; Mallinson, Gary; Watkins, Nicholas; Thomas, Stephen; Sutton, J Mark
2015-10-01
The P-Capt prion reduction filter (MacoPharma) removes prion infectivity in model systems. This independent evaluation assesses prion removal from endogenously infected animal blood, using CE-marked P-Capt filters, and replicates the proposed use of the filter within the UK Blood Services. Two units of blood, generated from 263K scrapie-infected hamsters, were processed using leukoreduction filters (LXT-quadruple, MacoPharma). Approximately 100 mL of the removed plasma was added back to the red blood cells (RBCs) and the blood was filtered through a P-Capt filter. Samples of unfiltered whole blood, the prion filter input (RBCs plus plasma and SAGM [RBCPS]), and prion-filtered leukoreduced blood (PFB) were injected intracranially into hamsters. Clinical symptoms were monitored for 500 ± 1 day, and brains were assessed for spongiosis and prion protein deposit. In Filtration Run 1, none of the 50 challenged animals were diagnosed with scrapie after inoculation with the RBCPS fraction, while two of 190 hamsters injected with PFB were infected. In Filtration Run 2, one of 49 animals injected with RBCPS and two of 193 hamsters injected with PFB were infected. Run 1 reduced the infectious dose (ID) by 1.467 log (>1.187 log and <0.280 log for leukoreduction and prion filtration, respectively). Run 2 reduced prion infectivity by 1.424 log (1.127 and 0.297 log, respectively). Residual infectivity was estimated at 0.212 ± 0.149 IDs/mL (Run 1) and 0.208 ± 0.147 IDs/mL (Run 2). Leukoreduction removed the majority of infectivity from 263K scrapie hamster blood. The P-Capt filter removed a proportion of the remaining infectivity, but residual infectivity was observed in two independent processes. © 2015 AABB.
Nuclear structure studies in the seaborgium region at SHIP
Energy Technology Data Exchange (ETDEWEB)
Antalic, S., E-mail: Stanislav.Antalic@fmph.uniba.sk; Andel, B. [Comenius University in Bratislava, 84248 Bratislava (Slovakia); Heßberger, F. P.; Khuyagbaatar, J. [GSI - Helmhotzzentrum für Schwerionenforschung GmbH, 64291 Darmstadt (Germany); Helmholtz Institute in Mainz, 55099 Mainz (Germany); Ackermann, D. [GSI - Helmhotzzentrum für Schwerionenforschung GmbH, 64291 Darmstadt (Germany); GANIL, 14074 Caen (France); Heinz, S.; Hofmann, S.; Kindler, B.; Laatiaoui, M.; Lommel, B. [GSI - Helmhotzzentrum für Schwerionenforschung GmbH, 64291 Darmstadt (Germany); Kalaninová, Z. [Comenius University in Bratislava, 84248 Bratislava (Slovakia); Laboratory of Nuclear Problems, JINR, 141980 Dubna (Russian Federation); Piot, J.; Vostinar, M. [GANIL, 14074 Caen (France)
2015-10-15
New decay data for the isotopes {sup 259}Sg and {sup 255}Rf were obtained at the velocity filter SHIP using an α-decay spectroscopy measurement. Both isotopes were produced and studied via a one neutron evaporation channel in the compound fusion reaction {sup 54}Cr+{sup 208}Pb. New isomeric states were observed and the single-particle level systematics for isotones with 151 and 153 neutrons were extended. A change of the ground-state configuration for the heaviest N = 151 isotones was observed. Detailed Monte-Carlo simulation for the α decay of {sup 259}Sg applying the GEANT4 toolkit was performed and compared with experimental data.
Directory of Open Access Journals (Sweden)
Maier G.
2014-01-01
Full Text Available The present work deals with the thermomechanical fatigue and low-cycle fatigue behavior of C-263 in two different material conditions. Microstructural characteristics and fracture modes are investigated with light and electron microscopy. The experimental results indicate that viscoplastic deformations depend on the heat treatment or rather on the current state of the microstructure. The measured data are used to adjust the parameters of a Chaboche type model and a fracture-mechanics based model for fatigue lifetime prediction. The Chaboche model is able to describe the essential phenomena of time and temperature dependent cyclic plasticity including the complex cyclic hardening during thermo-cyclic loading of both material conditions with a unique set of material parameters. This could be achieved by including an additional internal variable into the Chaboche model which accounts for changes in the precipitation microstructure during high temperature loading. Furthermore, the proposed lifetime model is well suited for a common fatigue life prediction of both investigated heats. The deformation and lifetime models are implemented into a user defined material routine. In this work, the material routine is applied for the lifetime prediction of a critical power plant component using the finite element method.
Alpha-1 antitrypsin deficiency caused by a novel mutation (p.Leu263Pro: Pi*ZQ0gaia â Q0gaia allele
Directory of Open Access Journals (Sweden)
M.J. Oliveira
2015-11-01
Full Text Available Severe alpha-1 antitrypsin deficiency (AATD is generally associated with PI*ZZ genotype and less often with combinations of PI*Z, PI*S, and other rarer deficiency or null (Q0 alleles. Severe AATD predisposes patients to various diseases, including pulmonary emphysema. Presented here is a case report of a young man with COPD and AATD. The investigation of the AATD showed a novel mutation p.Leu263Pro (c.860T>C, which was named Q0gaia (Pi*ZQ0gaia. Q0gaia is associated with very low or no detectable serum concentrations of AAT. Keywords: Alpha-1 antitrypsin deficiency, Null allele, COPD
Asmeda, R; Noorlaila, A; Norziah, M H
2016-01-15
This research was conducted to investigate the effects of different grinding techniques (dry, semi-wet and wet) of milled rice grains on the damaged starch and particle size distribution of flour produced from a new variety, MR263, specifically related to the pasting and thermal profiles. The results indicated that grinding techniques significantly (price flour. Wet grinding process yields flour with lowest percentage of starch damage (7.37%) and finest average particle size (8.52μm). Pasting and gelatinization temperature was found in the range of 84.45-89.63°C and 59.86-75.31°C, respectively. Dry ground flour attained the lowest pasting and gelatinization temperature as shown by the thermal and pasting profiles. Correlation analysis revealed that percentage of damaged starch granules had a significant, negative relationship with pasting temperature while average particle size distribution had a significant, strong negative relationship with gelatinization temperature. Copyright © 2015 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Wang, Chuji; Pan, Yong-Le; James, Deryck; Wetmore, Alan E.; Redding, Brandon
2014-01-01
Highlights: • A dual wavelength UV-LIF spectra-rotating drum impactor (RDI) technique was developed. • The technique was demonstrated by direct on-strip analysis of size- and time-resolved LIF spectra of atmospheric aerosol particles. • More than 2000 LIF spectra of atmospheric aerosol particles collected over three weeks in Djibouti were obtained and assigned to various fluorescence clusters. • The LIF spectra showed size- and time-sensitivity behavior with a time resolution of 3.6 h. - Abstract: We report a novel atmospheric aerosol characterization technique, in which dual wavelength UV laser induced fluorescence (LIF) spectrometry marries an eight-stage rotating drum impactor (RDI), namely UV-LIF-RDI, to achieve size- and time-resolved analysis of aerosol particles on-strip. The UV-LIF-RDI technique measured LIF spectra via direct laser beam illumination onto the particles that were impacted on a RDI strip with a spatial resolution of 1.2 mm, equivalent to an averaged time resolution in the aerosol sampling of 3.6 h. Excited by a 263 nm or 351 nm laser, more than 2000 LIF spectra within a 3-week aerosol collection time period were obtained from the eight individual RDI strips that collected particles in eight different sizes ranging from 0.09 to 10 μm in Djibouti. Based on the known fluorescence database from atmospheric aerosols in the US, the LIF spectra obtained from the Djibouti aerosol samples were found to be dominated by fluorescence clusters 2, 5, and 8 (peaked at 330, 370, and 475 nm) when excited at 263 nm and by fluorescence clusters 1, 2, 5, and 6 (peaked at 390 and 460 nm) when excited at 351 nm. Size- and time-dependent variations of the fluorescence spectra revealed some size and time evolution behavior of organic and biological aerosols from the atmosphere in Djibouti. Moreover, this analytical technique could locate the possible sources and chemical compositions contributing to these fluorescence clusters. Advantages, limitations, and
Energy Technology Data Exchange (ETDEWEB)
Wang, Chuji [U.S. Army Research Laboratory, Adelphi, MD 20783 (United States); Mississippi State University, Starkville, MS, 39759 (United States); Pan, Yong-Le, E-mail: yongle.pan.civ@mail.mil [U.S. Army Research Laboratory, Adelphi, MD 20783 (United States); James, Deryck; Wetmore, Alan E. [U.S. Army Research Laboratory, Adelphi, MD 20783 (United States); Redding, Brandon [Yale University, New Haven, CT 06510 (United States)
2014-04-01
Highlights: • A dual wavelength UV-LIF spectra-rotating drum impactor (RDI) technique was developed. • The technique was demonstrated by direct on-strip analysis of size- and time-resolved LIF spectra of atmospheric aerosol particles. • More than 2000 LIF spectra of atmospheric aerosol particles collected over three weeks in Djibouti were obtained and assigned to various fluorescence clusters. • The LIF spectra showed size- and time-sensitivity behavior with a time resolution of 3.6 h. - Abstract: We report a novel atmospheric aerosol characterization technique, in which dual wavelength UV laser induced fluorescence (LIF) spectrometry marries an eight-stage rotating drum impactor (RDI), namely UV-LIF-RDI, to achieve size- and time-resolved analysis of aerosol particles on-strip. The UV-LIF-RDI technique measured LIF spectra via direct laser beam illumination onto the particles that were impacted on a RDI strip with a spatial resolution of 1.2 mm, equivalent to an averaged time resolution in the aerosol sampling of 3.6 h. Excited by a 263 nm or 351 nm laser, more than 2000 LIF spectra within a 3-week aerosol collection time period were obtained from the eight individual RDI strips that collected particles in eight different sizes ranging from 0.09 to 10 μm in Djibouti. Based on the known fluorescence database from atmospheric aerosols in the US, the LIF spectra obtained from the Djibouti aerosol samples were found to be dominated by fluorescence clusters 2, 5, and 8 (peaked at 330, 370, and 475 nm) when excited at 263 nm and by fluorescence clusters 1, 2, 5, and 6 (peaked at 390 and 460 nm) when excited at 351 nm. Size- and time-dependent variations of the fluorescence spectra revealed some size and time evolution behavior of organic and biological aerosols from the atmosphere in Djibouti. Moreover, this analytical technique could locate the possible sources and chemical compositions contributing to these fluorescence clusters. Advantages, limitations, and
Lacaria, Melanie; Srour, Myriam; Michaud, Jacques L; Doja, Asif; Miller, Elka; Schwartzentruber, Jeremy; Goldsmith, Claire; Majewski, Jacek; Boycott, Kym M
2017-06-01
Distal deletion of the long arm of chromosome 10 is associated with a dysmorphic craniofacial appearance, microcephaly, behavioral issues, developmental delay, intellectual disability, and ocular, urogenital, and limb abnormalities. Herein, we present clinical, molecular, and cytogenetic investigations of four patients, including two siblings, with nearly identical terminal deletions of 10q26.3, all of whom have an atypical presentation of this syndrome. Their prominent features include ataxia, mild-to-moderate intellectual disability, and hyperemia of the hands and feet, and they do not display many of the other features commonly associated with deletions of this region. These results point to a novel gene locus associated with ataxia and highlight the variability of the clinical presentation of patients with deletions of this region. © 2017 Wiley Periodicals, Inc.
Mayo, Charles S; Moran, Jean M; Bosch, Walter; Xiao, Ying; McNutt, Todd; Popple, Richard; Michalski, Jeff; Feng, Mary; Marks, Lawrence B; Fuller, Clifton D; Yorke, Ellen; Palta, Jatinder; Gabriel, Peter E; Molineu, Andrea; Matuszak, Martha M; Covington, Elizabeth; Masi, Kathryn; Richardson, Susan L; Ritter, Timothy; Morgas, Tomasz; Flampouri, Stella; Santanam, Lakshmi; Moore, Joseph A; Purdie, Thomas G; Miller, Robert C; Hurkmans, Coen; Adams, Judy; Jackie Wu, Qing-Rong; Fox, Colleen J; Siochi, Ramon Alfredo; Brown, Norman L; Verbakel, Wilko; Archambault, Yves; Chmura, Steven J; Dekker, Andre L; Eagle, Don G; Fitzgerald, Thomas J; Hong, Theodore; Kapoor, Rishabh; Lansing, Beth; Jolly, Shruti; Napolitano, Mary E; Percy, James; Rose, Mark S; Siddiqui, Salim; Schadt, Christof; Simon, William E; Straube, William L; St James, Sara T; Ulin, Kenneth; Yom, Sue S; Yock, Torunn I
2018-03-15
A substantial barrier to the single- and multi-institutional aggregation of data to supporting clinical trials, practice quality improvement efforts, and development of big data analytics resource systems is the lack of standardized nomenclatures for expressing dosimetric data. To address this issue, the American Association of Physicists in Medicine (AAPM) Task Group 263 was charged with providing nomenclature guidelines and values in radiation oncology for use in clinical trials, data-pooling initiatives, population-based studies, and routine clinical care by standardizing: (1) structure names across image processing and treatment planning system platforms; (2) nomenclature for dosimetric data (eg, dose-volume histogram [DVH]-based metrics); (3) templates for clinical trial groups and users of an initial subset of software platforms to facilitate adoption of the standards; (4) formalism for nomenclature schema, which can accommodate the addition of other structures defined in the future. A multisociety, multidisciplinary, multinational group of 57 members representing stake holders ranging from large academic centers to community clinics and vendors was assembled, including physicists, physicians, dosimetrists, and vendors. The stakeholder groups represented in the membership included the AAPM, American Society for Radiation Oncology (ASTRO), NRG Oncology, European Society for Radiation Oncology (ESTRO), Radiation Therapy Oncology Group (RTOG), Children's Oncology Group (COG), Integrating Healthcare Enterprise in Radiation Oncology (IHE-RO), and Digital Imaging and Communications in Medicine working group (DICOM WG); A nomenclature system for target and organ at risk volumes and DVH nomenclature was developed and piloted to demonstrate viability across a range of clinics and within the framework of clinical trials. The final report was approved by AAPM in October 2017. The approval process included review by 8 AAPM committees, with additional review by ASTRO
Energy Technology Data Exchange (ETDEWEB)
Chesnaud, A.; Dezanneau, G.; Bogicevic, C.; Karolak, F.; Geneste, G. [Laboratoire Structure Proprietes et Modelisation des Solides, Ecole Centrale Paris, Grande Voie des Vignes, 92295, Chatenay-Malabry Cedex (France); Estournes, C. [CIRIMAT et Plateforme Nationale de Frittage Flash du CNRS (PNF2-MHT-UPS), Universite Paul-Sabatier, 118 Route de Narbonne, 31062, Toulouse (France); Geiger, S. [Laboratoire Structure Proprietes et Modelisation des Solides, Ecole Centrale Paris, Grande Voie des Vignes, 92295, Chatenay-Malabry Cedex (France)]|[Faculte de Pharmacie, Universite Paris-Sud, 5 Rue J-B Clement, 92296, Chatenay-Malabry (France)
2008-10-15
Oxy-apatite materials La{sub 9.33+x}Si{sub 6}O{sub 26+3x/2} are thought as zirconia-substitutes in Solid Oxide Fuel Cells due to their fast ionic conduction. However, the well-known difficulties related to their densification prevent them from being used as such. This paper presents strategies to obtain oxy-apatite dense materials. First, freeze-drying has been optimized to obtain ultrafine and very homogeneous La{sub 9.33+x}Si{sub 6}O{sub 26+3x/2} (0{<=}x{<=}0.67) nanopowders. From these powders, conventional and Spark Plasma Sintering (SPS) have been used leading to very dense samples obtained at temperatures rather lower than those previously reported. For instance, SPS has allowed to prepare fully dense and transparent ceramics from 1200 C under 100 MPa. The microstructure and transport properties of such samples have been then evaluated as a function of sintering conditions and lanthanum content. It will be show that for lanthanum content higher than 9.60 per unit formula, the parasitic phase La{sub 2}SiO{sub 5} appears leading to a degradation of conduction properties. We also show that grain boundaries and porosity (for conventionally-sintered materials) seem to have blocking effects on oxygen transport. The highest overall conductivity values at 700 C, i.e. {sigma}{sub 700{sub C}} = 7.33.10{sup -3} S cm{sup -1}, were measured for La{sub 9.33}Si{sub 6}O{sub 26} material conventionally-sintered at 1500 C which contains bigger grains' size by comparison with {sigma}{sub 700{sub C}} = 4.77.10{sup -3} S cm{sup -1} for SPS-sintered materials at the same temperature but for few minutes. These values are associated with activation energies close to 0.83-0.91 eV, regardless of sintering condition, which are commonly encountered for anionic conductivity into such materials. (author)
African Journals Online (AJOL)
Osondu
management staff include provision of residential accommodation, company car with free fuel allocation, pension ... Olomolaiye and Price (1989) argued that construction work .... exceed its budget, by measuring the quantity of work done in ...
Directory of Open Access Journals (Sweden)
Chii-Ruey Lin
2013-01-01
Full Text Available This study intends to deposit high transmittance diamond-like carbon (DLC thin films on D263T glass substrate at room temperature via a diamond powder target using the radio frequency (RF magnetron sputtering technique. Moreover, various process parameters were used to tune the properties of the thin films by using the Taguchi method. Experimental results show that the content of sp3 bonded carbon decreases in accordance with the effect of the substrate temperature. In addition, the hardness of all as-deposited single-layer DLC films ranges from 13.2 to 22.5 GPa, and the RMS surface roughness was improved significantly with the decrease in sputtering pressure. The water repellent of the deposited DLC films improved significantly with the increase of the sp3 content, and its contact angle was larger than that of the noncoated one by 1.45 times. Furthermore, the refraction index (n of all as-deposited DLC films ranges from 1.95 to 2.1 at λ = 600 nm. These results demonstrate that the thickness increased as the reflectance increased. DLC film under an RF power of 150 W possesses high transmissive ability (>81% and low average reflectance ability (<9.5% in the visible wavelengths (at λ = 400–700 nm.
Lowther, Chelsea; Speevak, Marsha; Armour, Christine M.; Goh, Elaine S.; Graham, Gail E.; Li, Chumei; Zeesman, Susan; Nowaczyk, Malgorzata J.M.; Schultz, Lee-Anne; Morra, Antonella; Nicolson, Rob; Bikangaga, Peter; Samdup, Dawa; Zaazou, Mostafa; Boyd, Kerry; Jung, Jack H.; Siu, Victoria; Rajguru, Manjulata; Goobie, Sharan; Tarnopolsky, Mark A.; Prasad, Chitra; Dick, Paul T.; Hussain, Asmaa S.; Walinga, Margreet; Reijenga, Renske G.; Gazzellone, Matthew; Lionel, Anath C.; Marshall, Christian R.; Scherer, Stephen W.; Stavropoulos, Dimitri J.; McCready, Elizabeth; Bassett, Anne S.
2016-01-01
Purpose The purpose of the current study was to assess the penetrance of NRXN1 deletions. Methods We compared the prevalence and genomic extent of NRXN1 deletions identified among 19,263 clinically referred cases to that of 15,264 controls. The burden of additional clinically relevant CNVs was used as a proxy to estimate the relative penetrance of NRXN1 deletions. Results We identified 41 (0.21%) previously unreported exonic NRXN1 deletions ascertained for developmental delay/intellectual disability, significantly greater than in controls [OR=8.14 (95% CI 2.91–22.72), p< 0.0001)]. Ten (22.7%) of these had a second clinically relevant CNV. Subjects with a deletion near the 3′ end of NRXN1 were significantly more likely to have a second rare CNV than subjects with a 5′ NRXN1 deletion [OR=7.47 (95% CI 2.36–23.61), p=0.0006]. The prevalence of intronic NRXN1 deletions was not statistically different between cases and controls (p=0.618). The majority (63.2%) of intronic NRXN1 deletion cases had a second rare CNV, a two-fold greater prevalence than for exonic NRXN1 deletion cases (p=0.0035). Conclusions The results support the importance of exons near the 5′ end of NRXN1 in the expression of neurodevelopmental disorders. Intronic NRXN1 deletions do not appear to substantially increase the risk for clinical phenotypes. PMID:27195815
Desempeño del modelo rothc-26.3 a nivel de parcela en México
Directory of Open Access Journals (Sweden)
Lucila González Molina
2016-07-01
Full Text Available De acuerdo con el Panel Intergubernamental sobre el Cambio Climático (PICC, deben reportarse los almacenes y cambios del carbono orgánico del suelo (COS en el tiempo. El modelo RothC-26.3 (RothC es uno de los más usados en el mundo para estudiar la dinámica del C en diferentes sistemas. Se evaluó el desempeño del RothC en la simulación de los cambios del COS, a nivel de parcela, en experimentos de corta duración. Se evaluaron nueve sitios y los sistemas: agrícola con residuos vegetales (A+R, agrícola sin residuos (A-R, forestales (F, praderas (PR y agostaderos (AGOS. Las parcelas experimentales se ubicaron en los estados de México, Tlaxcala, Michoacán, Guanajuato, Oaxaca, Jalisco y Nuevo León. El RothC se ejecutó (i con el COSinicial, medido en cada punto de muestreo (*CIPUN en parcelas de la Sierra Norte de Oaxaca y, (ii con el COSinicial promedio medido por parcela (*CIPAR en el resto de los sitios. Se midieron y estimaron los parámetros de entrada al modelo, como residuos vegetales y abonos orgánicos. El grado de asociación entre el COS medido y el simulado fue de 0.76 y hasta 1.0 en todos los sitios. La eficiencia del modelo (EF varió entre 0.53 y 0.93, excepto en el Batán, donde se evaluaron sistemas de labranza (EF= −0.60. La r, en ambas formas de simulación, varió entre 0.63 y 0.97, excepto en AGOS; EF en los agrícolas fue de 0.48 a 0.84 y de 0.81 en F *CIPAR. La EF fue insatisfactoria obtenida para los AGOS (*CIPAR y forestales y praderas (*CPUN. Considerando los resultados de los sitios y sistemas y, la forma de simulación *CIPAR, el modelo RothC se puede usar con buena aceptación para simular los cambios de COS a nivel de parcela en los sistemas agrícolas y forestales, mediana en praderas y baja en agostaderos.
Energy Technology Data Exchange (ETDEWEB)
Ankamma, Kandula; Chandra Mohan Reddy, Gangireddy [Mahatma Ghandi Institute of Technology, Hyderabad (India). Mechanical Engineering Dept.; Singh, Ashok Kumar; Prasad, Konduri Satya [Defence Research and Development Organisation (DRDO), Hyderabad (India). Defence Metallurgical Research Lab.; Komaraiah, Methuku [Malla Reddy College of Engineering and Technology, Secunderabad (India); Eswara Prasad, Namburi [Regional Centre for Military Airworthiness (Materials), Hyderabad (India)
2011-10-15
The deformation behavior under uni-axial tensile loading is investigated and reported in the case of cold rolled Nimonic C-263 alloy sheet products of different thicknesses (0.5 mm and 1 mm) in the solution treated and aged conditions. The studies conducted include (i) Microstructure, (ii) X-ray diffraction, (iii) Texture and (iv) Tensile properties and inplane anisotropy in the yield behavior (both tensile yield strength and ultimate tensile strength as well as ductility). The results of the present study showed that despite the presence of weak crystallographic texture in this crystal symmetric material, the degrees of in-plane anisotropy in strength as well as plastic deformation properties are found to be significant in both solution treated and aged conditions, thus having significant technological relevance for both further processing and design purposes. Further, the influence of aging and sheet thickness on the tensile deformation behaviour is also found to be considerable. A brief discussion on the technological implications of these results is also included. (orig.)
Glenn Seaborg's Contributions to Heavy Element Science and the Periodic Table
International Nuclear Information System (INIS)
Hobart, David E.
2012-01-01
In celebrating the centennial anniversary of the birth of Glenn T. Seaborg it is fitting that we recount and pay tribute to his legacy. Many know of the scientific accomplishments of this man who became a legend and anyone who has attended his lectures can attest to how informative, educational, and entertaining he was. He had a beguiling and whimsical sense of humor and used this to drive home his points and share his passion and quest for discovery. The periodic table is a fundamental cornerstone of science and remains a central unifying principal. Seaborg was the architect of the actinide series of elements and their proper placement in the periodic table and co-discoverer of ten transuranium elements - one of which bears his name, element 106, seaborgium. The work and achievements of this Nobel laureate have touched the lives of many and his legacy will continue for generations to come.
Glann Seaborg's Contributions to Heavy Element Science and the Periodic Table
Energy Technology Data Exchange (ETDEWEB)
Hobart, David E. [Los Alamos National Laboratory
2012-08-17
In celebrating the centennial anniversary of the birth of Glenn T. Seaborg it is fitting that we recount and pay tribute to his legacy. Many know of the scientific accomplishments of this man who became a legend and anyone who has attended his lectures can attest to how informative, educational, and entertaining he was. He had a beguiling and whimsical sense of humor and used this to drive home his points and share his passion and quest for discovery. The periodic table is a fundamental cornerstone of science and remains a central unifying principal. Seaborg was the architect of the actinide series of elements and their proper placement in the periodic table and co-discoverer of ten transuranium elements - one of which bears his name, element 106, seaborgium. The work and achievements of this Nobel laureate have touched the lives of many and his legacy will continue for generations to come.
Gabel, Charles Philip; Cuesta-Vargas, Antonio; Qian, Meihua; Vengust, Rok; Berlemann, Ulrich; Aghayev, Emin; Melloh, Markus
2017-08-01
To analyze the factor structure of the Oswestry Disability Index (ODI) in a large symptomatic low back pain (LBP) population using exploratory (EFA) and confirmatory factor analysis (CFA). Analysis of pooled baseline ODI LBP patient data from the international Spine Tango registry of EUROSPINE, the Spine Society of Europe. The sample, with n = 35,263 (55.2% female; age 15-99, median 59 years), included 76.1% of patients with a degenerative disease, and 23.9% of the patients with various other spinal conditions. The initial EFA provided a hypothetical construct for consideration. Subsequent CFA was considered in three scenarios: the full sample and separate genders. Models were compared empirically for best fit. The EFA indicated a one-factor solution accounting for 54% of the total variance. The CFA analysis based on the full sample confirmed this one-factor structure. Sub-group analyses by gender achieved good model fit for configural and partial metric invariance, but not scalar invariance. A possible two-construct model solution as outlined by previous researchers: dynamic-activities (personal care, lifting, walking, sex and social) and static-activities (pain, sleep, standing, travelling and sitting) was not preferred. The ODI demonstrated a one-factor structure in a large LBP sample. A potential two-factor model was considered, but not found appropriate for constructs of dynamic and static activity. The use of the single summary score for the ODI is psychometrically supported. However, practicality limitations were reported for use in the clinical and research settings. Researchers are encouraged to consider a shift towards newer, more sensitive and robustly developed instruments.
Czech Academy of Sciences Publication Activity Database
Lecocq, T.; Dellicour, S.; Michez, D.; Lhomme, P.; Vanderplanck, M.; Valterová, Irena; Rasplus, J. Y.; Rasmont, P.
2013-01-01
Roč. 13, č. 263 (2013), 263/1-263/17 ISSN 1471-2148 Grant - others:Seventh Framework Programme(XE) FP7-244090 Institutional support: RVO:61388963 Keywords : phylogeography * reproductive traits * genetic differentiation * bumblebees Subject RIV: CC - Organic Chemistry Impact factor: 3.407, year: 2013 http://www.biomedcentral.com/1471-2148/13/263
Pershina, V; Anton, J
2013-05-07
Fully relativistic, four-component density functional theory electronic structure calculations were performed for M(CO)6 of group-6 elements Cr, Mo, W, and element 106, Sg, with an aim to predict their adsorption behaviour in the gas-phase chromatography experiments. It was shown that seaborgium hexacarbonyl has a longer M-CO bond, smaller ionization potential, and larger polarizability than the other group-6 molecules. This is explained by the increasing relativistic expansion and destabilization of the (n - 1)d AOs with increasing Z in the group. Using results of the calculations, adsorption enthalpies of the group-6 hexacarbonyls on a quartz surface were predicted via a model of physisorption. According to the results, -ΔHads should decrease from Mo to W, while it should be almost equal--within the experimental error bars--for W and Sg. Thus, we expect that in the future gas-phase chromatography experiments it will be almost impossible--what concerns ΔHads--to distinguish between the W and Sg hexacarbonyls by their deposition on quartz.
Chemistry of superheavy elements
International Nuclear Information System (INIS)
Schaedel, M.
2012-01-01
The chemistry of superheavy elements - or transactinides from their position in the Periodic Table - is summarized. After giving an overview over historical developments, nuclear aspects about synthesis of neutron-rich isotopes of these elements, produced in hot-fusion reactions, and their nuclear decay properties are briefly mentioned. Specific requirements to cope with the one-atom-at-a-time situation in automated chemical separations and recent developments in aqueous-phase and gas-phase chemistry are presented. Exciting, current developments, first applications, and future prospects of chemical separations behind physical recoil separators ('pre-separator') are discussed in detail. The status of our current knowledge about the chemistry of rutherfordium (Rf, element 104), dubnium (Db, element 105), seaborgium (Sg, element 106), bohrium (Bh, element 107), hassium (Hs, element 108), copernicium (Cn, element 112), and element 114 is discussed from an experimental point of view. Recent results are emphasized and compared with empirical extrapolations and with fully-relativistic theoretical calculations, especially also under the aspect of the architecture of the Periodic Table. (orig.)
2010-01-01
... be performed by an independent public accountant by section 36 of the FDIA and 12 CFR part 363... insured subsidiary bank of that holding company. (d) Independent public accountant (accountant) means any... PRACTICE FOR HEARINGS Removal, Suspension, and Debarment of Accountants From Performing Audit Services...
2010-01-01
... Columbia. (d) Accountant means any individual who is duly qualified to practice as a certified public accountant or a public accountant in any state, possession, territory, commonwealth, or the District of..., opinion or other paper or document by an attorney, accountant, or other licensed professional which is...
2010-01-01
... corporation, firm, partnership, limited liability company, association, or other organization who obtains a... a limited work authorization under § 50.10(e), if the limited work authorization authorizes the... structures, systems, and components (SSCs) under the limited work authorization; (2) Combined license holders...
26 CFR 1.263A-7 - Changing a method of accounting under section 263A.
2010-04-01
... multiple changes in method of accounting occur in the year of change—(A) In general. A change in method of... decrement in an inventory pool occurs, layers accumulated in more recent years must be viewed as invaded...
Transuranium elements: Past, present, and future
International Nuclear Information System (INIS)
Seaborg, G.T.
1995-01-01
In this illustrative Account the authors shall concentrate on four of these elements, chosen for their current interest or pivotal role. The story of plutonium is one of the most dramatic in the history of science, and today, plutonium is at the focus of an extraordinary dilemma. Mendelevium (element 101) has played a pivotal role in blazing the trail for the discovery of the heaviest elements on the basis of open-quotes one atom at a timeclose quotes production. Seaborgium (element 106) was recently named in my honor by the discoverers and may be the last element, at least for some time, for which it will be possible to determine many chemical properties. And element 110 represents recent evidence, after a lapse of 10 years, for the discovery of a chemical element. Recent (1994) recommendations of the IUPAC Commission on the Nomenclature of Inorganic Chemistry for the renaming of elements 104-108 have met with widespread rejection. The author is using the names proposed by the acknowledged discoverers (elements 106-109) or, in the case of the disputed elements 104 and 105, the most logical names. 21 refs., 5 figs
Aqueous chemistry of transactinides
International Nuclear Information System (INIS)
Schaedel, M.
2001-01-01
The aqueous chemistry of the first three transactinide elements is briefly reviewed with special emphasis given to recent experimental results. Short introductory remarks are discussing the atom-at-a-time situation of transactinide chemistry as a result of low production cross-sections and short half-lives. In general, on-line experimental techniques and, more specifically, the automated rapid chemistry apparatus, ARCA, are presented. Present and future developments of experimental techniques and resulting perspectives are outlined at the end. The central part is mainly focussing on hydrolysis and complex formation aspects of the superheavy group 4, 5, and 6 transition metals with F - and Cl - anions. Experimental results are compared with the behaviour of lighter homologous elements and with relativistic calculations. It will be shown that the chemical behaviour of the first superheavy elements is already strongly influenced by relativistic effects. While it is justified to place rutherfordium, dubnium and seaborgium in the Periodic Table of the Elements into group 4, 5 and 6, respectively, it is no more possible to deduce from this position in detail the chemical properties of these transactinide or superheavy elements. (orig.)
Directory of Open Access Journals (Sweden)
Shuyu Guo
Full Text Available Risk factors for cardiovascular disease (CVD, such as obesity, diabetes, hypertension and physical inactivity, are common in Australia, but the prevalence varies according to cultural background. We examined the relationship between region of birth, measures of acculturation, and CVD risk profiles in immigrant, compared to Australian-born, older Australians. Cross-sectional data from 263,356 participants aged 45 and over joining the population-based 45 and Up Study cohort from 2006-2008 were used. Prevalence ratios for CVD risk factors in Australian- versus overseas-born participants were calculated using modified Poisson regression, adjusting for age, sex and socioeconomic factors and focusing on Asian migrants. The association between time resident in Australia and age at migration and CVD risk factors in Asian migrants was also examined. Migrants from Northeast (n = 3,213 and Southeast Asia (n = 3,942 had lower levels of overweight/obesity, physical activity and female smoking than Australian-born participants (n = 199,356, although differences in prevalence of overweight/obesity were sensitive to body-mass-index cut-offs used. Compared to Australian-born participants, migrants from Northeast Asia were 20-30% less likely, and from Southeast Asia 10-20% more likely, to report being treated for hypertension and/or hypercholesterolaemia; Southeast Asian migrants were 40-60% more likely to report diabetes. Northeast Asian-born individuals were less likely than Australian-born to have 3 or more CVD risk factors. Diabetes, treated hypertension and hypercholesterolaemia occurred at relatively low average body-mass-index in Southeast Asian migrants. The CVD risk factor profiles of migrants tended to approximate those of Australian-born with increasing acculturation, in both favourable (e.g., increased physical activity and unfavourable directions (e.g., increased female smoking. Minimizing CVD risk in migrant populations may be achieved through
Publications | Page 263 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
In Conversation: Celia Reyes on the importance of timely economic information. Asia is the largest developing region in the world both in terms of land mass and population. More than 70 % of the people in the developing world live in Asia. Over the past three decades the region has created.
29 CFR 1910.263 - Bakery equipment.
2010-07-01
... all delivery ends of conveyors, wherever manual removal of the product carried is practiced. (iii... section, and (ii) for venting products of combustion from the combustion chamber used to heat the fat. (23... Hazards of Sugar and Cocoa) and NFPA 656—1959 (Standard for Dust Hazards in Spice Grinding Plants), which...
33 CFR 263.15 - Program policies.
2010-07-01
... personal attention of the Chief of Engineers, the Director of Civil Works is authorized to approve or... accomplished by the Director of Civil Works, for the Chief of Engineers. ... costs of investigations, planning, design and construction, to include those incurred prior to...
Publications | Page 263 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. ... Francisco Manyanga Secondary School in Maputo, Mozambique, she is responsible for the 7000 students, 210 teachers, and 64 support staff who walk through the front doors of her.
DEFF Research Database (Denmark)
Kirkegaard, Marina M; Rasmussen, Peter K; Coupland, Sarah E
2016-01-01
IMPORTANCE: To date, the clinical features of the various subtypes of conjunctival lymphoma (CL) have not been previously evaluated in a large cohort. OBJECTIVE: To characterize subtype-specific clinical features of CL and their effect on patient outcome. DESIGN, SETTING, AND PARTICIPANTS...... age was 61.3 years, and 55.1% (145 of 263) were female. All lymphomas were of B-cell type. The most frequent subtype was extranodal marginal zone lymphoma (EMZL) (68.4% [180 of 263]), followed by follicular lymphoma (FL) (16.3% [43 of 263]), mantle cell lymphoma (MCL) (6.8% [18 of 263]), and diffuse...... large B-cell lymphoma (DLBCL) (4.6% [12 of 263). Conjunctival lymphoma commonly manifested in elderly individuals (age range, 60-70 years old), with EMZL having a female predilection (57.8% [104 of 180]) and MCL having a marked male predominance (77.8% [14 of 18]). Unlike EMZL and FL, DLBCL and MCL were...
Gclust Server: 85848 [Gclust Server
Lifescience Database Archive (English)
Full Text Available 85848 CEL_C08H9.5_17535345 Cluster Sequences Related Sequences(263) 502 old-1: Overexpression...ences Related Sequences(263) Sequence length 502 Representative annotation old-1: Overexpression
Gclust Server: 120676 [Gclust Server
Lifescience Database Archive (English)
Full Text Available 120676 ATH_AT3G61450_18412010 Cluster Sequences Related Sequences(21) 263 SYP73 (SYNTAXIN OF PLANTS...equence length 263 Representative annotation SYP73 (SYNTAXIN OF PLANTS 73) Number
Development of an Atmospheric Dispersion Model for Heavier-Than-Air Gas Mixtures. Volume 1.
1985-05-01
aspirated concentration sensor used a balanced Wheatstone bridge to measure the heat loss from a sensing element placed in the sample stream. Shaded...a semipermeable membrane and electrochemical cell. A fast response sensor (10 Hz) basically aspirated a sample past the cell membrane. Reported...ramp function around the freezing point of water by X11., X= vap for T 273.15 K vap fus 263.15 for 263.15 <T < 273.15 Xvap +x fus for T < 263.15 (A-4
Effect of radiation-induced substrate defects on microstrip gas chamber gain behaviour
International Nuclear Information System (INIS)
Pallares, A.; Brom, J.M.; Bergdolt, A.M.; Coffin, J.; Eberle, H.; Sigward, M.H.; Fontaine, J.C.; Barthe, S.; Schunck, J.P.
1998-01-01
The aim of this work was to quantify the influence of radiation-induced substrate defects on microstrip gas chamber (MSGC) gain behaviour. The first part of this paper focuses on radiation effects on a typical MSGC substrate: Desag D263 glass. Defect generation was studied for Desag D263 with pure silica (Suprasil 1) as a reference. We studied the evolution of defect concentration with respect to accumulated doses up to 480 kGy. Annealing studies of defects in Desag D263 were also performed. In the second part, the radiation sensitivity of Desag D263 glass has been linked to the behaviour of the detector under irradiation. Comparative gain measurements were taken before and after substrate irradiation at 10 and 80 kGy the minimal dose received during LHC operation and the dose for which defect density is maximum (respectively). (orig.)
BKR 26(3) pp. 76-84 (Adeyanju)
African Journals Online (AJOL)
Femi Olorunniji
2014-09-30
Sep 30, 2014 ... protein source had been established by various researchers. [(Stafford & Tacon, 1988 ... rhodanese enzyme is defined as the amount of enzyme which produces an optical ... levels of purification were determined by Biuret method. (Gornall et al., 1949) using bovine serum albumin as standard. Enzyme ...
BKR 26(3) pp. 85-87 (Osadolor)
African Journals Online (AJOL)
Femi Olorunniji
2014-09-30
Sep 30, 2014 ... pancreatic beta cells in culture (Bayazit, 2004). While extensive ... toxicity to the animals. However ... be used for the treatment of chronic diabetes since it effect takes a longer time. ... Metabolism 22: 1289–1290. Gamaneil KS ...
12 CFR 263.93 - Eligibility to practice.
2010-01-01
... debarment pursuant to this subpart may practice before the Board. (b) Accountants. Any accountant who is qualified to practice as a certified public accountant or public accountant and is not currently under...
12 CFR 263.35 - Conduct of hearings.
2010-01-01
...) General rules. (1) Hearings shall be conducted so as to provide a fair and expeditious presentation of the..., respondents may agree among themselves as to their order of presentation of their cases, but if they do not...
BKR 26(3) pp. 88-93 (Akachukwu)
African Journals Online (AJOL)
Femi Olorunniji
2014-09-30
Sep 30, 2014 ... urea concentrations were also significantly (p<0.05) increased in the test group. Histological .... synthesis of prostaglandins that regulate the contraction and .... Taussky HH (1961) Creatinine and creatinine in urine and serum.
No. 263-Maternity Leave in Normal Pregnancy.
Leduc, Dean
2017-10-01
To assist maternity care providers in recognizing and discussing health- and illness-related issues in pregnancy and their relationship to maternity benefits. Published literature was retrieved through searches of PubMed or Medline, CINAHL, and The Cochrane Library in 2009 using appropriate controlled vocabulary (e.g., maternity benefits) and key words (e.g., maternity, benefits, pregnancy). Results were restricted to systematic reviews, randomized controlled trials/controlled clinical trials, and observational studies. There were no date or language restrictions. Searches were updated on a regular basis and incorporated in the guideline to December 2009. Grey (unpublished) literature was identified through searching the web sites of health technology assessment and health technology assessment-related agencies, clinical practice guideline collections, clinical trial registries, and national and international medical specialty societies. Copyright © 2017. Published by Elsevier Inc.
African Journals Online (AJOL)
Femi Olorunniji
2014-09-30
Sep 30, 2014 ... Microbial Populations and Serum Parameters in Sheep ... A locally synthesized transition metal complex, cobalt-lumefantrine was assessed through laboratory .... Data were analyzed by General Linear Model of SAS using.
40 CFR 263.20 - The manifest system.
2010-07-01
... person if he knows the shipment does not conform to the EPA Acknowledgment of Consent; and unless, in... without a tracking document that includes all information required by 40 CFR 262.84. (3) Compliance Date... designated facility on either the manifest or the shipping paper; and (4) The person delivering the hazardous...
12 CFR 263.103 - Eligibility of applicants.
2010-01-01
... will be presumed to have been made for this purpose. (3) The net worth of a financial institution shall... guidelines on the financial institution's financial report to its supervisory agency for the last reporting....103 Eligibility of applicants. (a) General rule. To be eligible for an award under this subpart, an...
40 CFR 98.263 - Calculating GHG emissions.
2010-07-01
... this part (General Stationary Fuel Combustion Sources). (b) Calculate and report under this subpart the... phosphate rock by origin i obtained during month n, from the carbon analysis results (percent by weight, expressed as a decimal fraction). Pn,i = Mass of phosphate rock by origin i consumed in month n by wet...
Effect of radiation-induced substrate defects on microstrip gas chamber gain behaviour
Energy Technology Data Exchange (ETDEWEB)
Pallares, A.; Brom, J.M.; Bergdolt, A.M.; Coffin, J.; Eberle, H.; Sigward, M.H. [Institute de Recherches Subatomiques, 67 - Strasbourg (France); Fontaine, J.C. [Universite de Haute Alsace, GRPHE, 61 rue Albert Camus, 68093 Mulhouse Cedex (France); Barthe, S.; Schunck, J.P. [Laboratoire PHASE (UPR 292 du CNRS), 23 rue du Loess, BP 28, 67037 Strasbourg Cedex 2 (France)
1998-08-01
The aim of this work was to quantify the influence of radiation-induced substrate defects on microstrip gas chamber (MSGC) gain behaviour. The first part of this paper focuses on radiation effects on a typical MSGC substrate: Desag D263 glass. Defect generation was studied for Desag D263 with pure silica (Suprasil 1) as a reference. We studied the evolution of defect concentration with respect to accumulated doses up to 480 kGy. Annealing studies of defects in Desag D263 were also performed. In the second part, the radiation sensitivity of Desag D263 glass has been linked to the behaviour of the detector under irradiation. Comparative gain measurements were taken before and after substrate irradiation at 10 and 80 kGy the minimal dose received during LHC operation and the dose for which defect density is maximum (respectively). (orig.) 26 refs.
Local predators attack exotic aphid Brachycaudus divaricatae in Lithuania
Czech Academy of Sciences Publication Activity Database
Danilov, J.; Rakauskas, R.; Havelka, Jan; Starý, Petr
2016-01-01
Roč. 69, č. 2 (2016), s. 263-269 ISSN 1721-8861 Institutional support: RVO:60077344 Keywords : Prunus * Aphids * Brachycaudus divaricatae Subject RIV: EH - Ecology, Behaviour Impact factor: 1.051, year: 2016 http://www.bulletinofinsectology.org/pdfarticles/vol69-2016-263-269danilov.pdf
Journal of Genetics | Indian Academy of Sciences
Indian Academy of Sciences (India)
Department of Molecular Biology and Genetic Engineering, G. B. Pant University of Agriculture and Technology, Pantnagar 263 145, India; Department of Molecular Biology and Genetic Engineering, College of Basic Science and Humanities, G. B. Pant University of Agriculture and Technology, Pantnagar 263 145, India ...
Pareja, Fresia; Macleod, David; Shu, Chang; Crary, John F; Canoll, Peter D; Ross, Alonzo H; Siegelin, Markus D
2014-07-01
Glioblastoma multiforme (GBM) is a highly malignant human brain neoplasm with limited therapeutic options. GBMs display a deregulated apoptotic pathway with high levels of the antiapoptotic Bcl-2 family of proteins and overt activity of the phosphatidylinositol 3-kinase (PI3K) signaling pathway. Therefore, combined interference of the PI3K pathway and the Bcl-2 family of proteins is a reasonable therapeutic strategy. ABT-263 (Navitoclax), an orally available small-molecule Bcl-2 inhibitor, and GDC-0941, a PI3K inhibitor, were used to treat established glioblastoma and glioblastoma neurosphere cells, alone or in combination. Although GDC-0941 alone had a modest effect on cell viability, treatment with ABT-263 displayed a marked reduction of cell viability and induction of apoptotic cell death. Moreover, combinatorial therapy using ABT-263 and GDC-0941 showed an enhanced effect, with a further decrease in cellular viability. Furthermore, combination treatment abrogated the ability of stem cell-like glioma cells to form neurospheres. ABT-263 and GDC-0941, in combination, resulted in a consistent and significant increase of Annexin V positive cells and loss of mitochondrial membrane potential compared with either monotherapy. The combination treatment led to enhanced cleavage of both initiator and effector caspases. Mechanistically, GDC-0941 depleted pAKT (Serine 473) levels and suppressed Mcl-1 protein levels, lowering the threshold for the cytotoxic actions of ABT-263. GDC-0941 decreased Mcl-1 in a posttranslational manner and significantly decreased the half-life of Mcl-1 protein. Ectopic expression of human Mcl-1 mitigated apoptotic cell death induced by the drug combination. Furthermore, GDC-0941 modulated the phosphorylation status of BAD, thereby further enhancing ABT-263-mediated cell death. Combination therapy with ABT-263 and GDC-0941 has novel therapeutic potential by specifically targeting aberrantly active, deregulated pathways in GBM, overcoming
African Journals Online (AJOL)
Items 251 - 263 of 263 ... Vol 16, No 2 (2015), Training accountants in developing countries: The relevance of information and communication technology, Abstract PDF. Godson Okwuchukwu Okafor, Okenwa CY Ogbodo. Vol 17, No 3 (2017), Transition and the Problems of Modern Nigerian Poetry: An Overview of Selected ...
Indian Academy of Sciences (India)
Cheon Taksu. 311. Datta Animesh. 425. Dattagupta Sushanta. 203. Deepak P N. 175. Edamatsu Keiichi. 165. Ganesh Pradeep. 263. Ghose Partha. 417,425. Ghosh Rupamanjari. 189. Gillies G T. 369. Gisin Nicolas. 181. Goswami Debabrata. 235. Hara Koh'ichiro. 405. Hari Dass N D. 263,303. Home Dipankar. 229,289,321.
Journal of Astrophysics and Astronomy | Indian Academy of Sciences
Indian Academy of Sciences (India)
2016-01-27
Jan 27, 2016 ... Home; Journals; Journal of Astrophysics and Astronomy; Volume 22; Issue 4. Volume 22, Issue 4. December 2001, pages 263-349. pp 263-282. Variability of Extragalactic Objects in Relation to Redshift, Color, Radio Spectral Index and Absorption Lines · D. Basu · More Details Abstract Fulltext PDF.
Tzang, Bor-Show; Liu, Chung-Hsien; Hsu, Kuo-Ching; Chen, Yi-Hsing; Huang, Chih-Yang; Hsu, Tsai-Ching
2017-09-01
Systemic lupus erythematosus (SLE) is an autoimmune disease that is characterised by a dysregulation of the immune system, which causes inflammation responses, excessive oxidative stress and a reduction in the number of cluster of differentiation (CD)4+CD25+forkhead box P3 (FoxP3)+ T cells. Supplementation with certain Lactobacillus strains has been suggested to be beneficial in the comprehensive treatment of SLE. However, little is known about the effect and mechanism of certain Lactobacillus strains on SLE. To investigate the effects of Lactobacillus on SLE, NZB/W F1 mice were orally gavaged with Lactobacillus paracasei GMNL-32 (GMNL-32), Lactobacillus reuteri GMNL-89 (GMNL-89) and L. reuteri GMNL-263 (GMNL-263). Supplementation with GMNL-32, GMNL-89 and GMNL-263 significantly increased antioxidant activity, reduced IL-6 and TNF-α levels and significantly decreased the toll-like receptors/myeloid differentiation primary response gene 88 signalling in NZB/W F1 mice. Notably, supplementation with GMNL-263, but not GMNL-32 and GMNL-89, in NZB/W F1 mice significantly increased the differentiation of CD4+CD25+FoxP3+ T cells. These findings reveal beneficial effects of GMNL-32, GMNL-89 and GMNL-263 on NZB/W F1 mice and suggest that these specific Lactobacillus strains can be used as part of a comprehensive treatment of SLE patients.
Chemistry of the superheavy elements.
Schädel, Matthias
2015-03-13
The quest for superheavy elements (SHEs) is driven by the desire to find and explore one of the extreme limits of existence of matter. These elements exist solely due to their nuclear shell stabilization. All 15 presently 'known' SHEs (11 are officially 'discovered' and named) up to element 118 are short-lived and are man-made atom-at-a-time in heavy ion induced nuclear reactions. They are identical to the transactinide elements located in the seventh period of the periodic table beginning with rutherfordium (element 104), dubnium (element 105) and seaborgium (element 106) in groups 4, 5 and 6, respectively. Their chemical properties are often surprising and unexpected from simple extrapolations. After hassium (element 108), chemistry has now reached copernicium (element 112) and flerovium (element 114). For the later ones, the focus is on questions of their metallic or possibly noble gas-like character originating from interplay of most pronounced relativistic effects and electron-shell effects. SHEs provide unique opportunities to get insights into the influence of strong relativistic effects on the atomic electrons and to probe 'relativistically' influenced chemical properties and the architecture of the periodic table at its farthest reach. In addition, they establish a test bench to challenge the validity and predictive power of modern fully relativistic quantum chemical models. © 2015 The Author(s) Published by the Royal Society. All rights reserved.
Institute of Scientific and Technical Information of China (English)
Hong-Jing Li; Xiang-Hua Li; Jing-Hua Xiao; Rod A. Wing; Shi-Ping Wang
2012-01-01
The rice disease resistance (R) gene Xa3/Xa26 (having also been named Xa3 and Xa26) against Xanthomonas oryzae pv.oryzae (Xoo),which causes bacterial blight disease,belongs to a multiple gene family clustered in chromosome 11 and is from an AA genome rice cultivar (Oryza sativa L.).This family encodes leucine-rich repeat (LRR) receptor kinasetype proteins.Here,we show that the orthologs (alleles) of Xa3/Xa26,Xa3/Xa26-2,and Xa3/Xa26-3,from wild Oryza species O.officinalis (CC genome) and O.minuta (BBCC genome),respectively,were also R genes against Xoo.Xa3/Xa26-2 and Xa3/Xa26-3 conferred resistance to 16 of the 18 Xoo strains examined.Comparative sequence analysis of the Xa3/Xa26 families in the two wild Oryza species showed that Xa3/Xa26-3 appeared to have originated from the CC genome of O.minuta.The predicted proteins encoded by Xa3/Xa26,Xa3/Xa26-2,and Xa3/Xa26-3 share 91-99% sequence identity and 94-99% sequence similarity.Transgenic plants carrying a single copy of Xa3/Xa26,Xa3/Xa26-2,or Xa3/Xa26-3,in the same genetic background,showed a similar resistance spectrum to a set of Xoo strains,although plants carrying Xa3/Xa26-2 or Xa3/Xa26-3 showed lower resistance levels than the plants carrying Xa3/Xa26.These results suggest that the Xa3/Xa26 locus predates the speciation of A and C genome,which is approximately 7.5 million years ago.Thus,the resistance specificity of this locus has been conserved for a long time.
Fibrin nanostructures for biomedical applications
Czech Academy of Sciences Publication Activity Database
Riedelová-Reicheltová, Zuzana; Brynda, Eduard; Riedel, Tomáš
2016-01-01
Roč. 65, Suppl. 2 (2016), S263-S272 ISSN 0862-8408 R&D Projects: GA MŠk(CZ) LQ1604 Institutional support: RVO:61389013 Keywords : fibrinogen * fibrin-bound thrombin * nanostructures Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.461, year: 2016 http://www.biomed.cas.cz/physiolres/pdf/65%20Suppl%202/65_S263.pdf
Czech Academy of Sciences Publication Activity Database
Podgorná, Eliška; Diallo, I.; Vangenot, Ch.; Sanchez-Mazas, A.; Sabbagh, A.; Černý, Viktor; Poloni, E. S.
2015-01-01
Roč. 15, č. 263 (2015) ISSN 1471-2148 R&D Projects: GA ČR GA13-37998S Institutional support: RVO:67985912 Keywords : NAT2 * acetylation polymorphism * African Sahel * pastoral nomads * subsistence mode * ecoregion * natural selection Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 3.406, year: 2015 http://www.biomedcentral.com/1471-2148/15/263
Lifescience Database Archive (English)
Full Text Available kd*snnlvagsfrsfpqdswssilvpsckdnd*qfrgrnals*fsnservgiilihligf *n*iahvq*kigalsgpflvsrtgdvg*tkywdktsnih**ipqkvlvh*dsrtvamevg ir*gvcnns...swssilvpsckdnd*qfrgrnals*fsnservgiilihligf *n*iahvq*kigalsgpflvsrtgdvg*tkywdktsnih**ipqkvlvh*dsrtvamevg ir*gvcnns
GCK-MODY diabetes associated with protein misfolding, cellular self-association and degradation.
Negahdar, Maria; Aukrust, Ingvild; Johansson, Bente B; Molnes, Janne; Molven, Anders; Matschinsky, Franz M; Søvik, Oddmund; Kulkarni, Rohit N; Flatmark, Torgeir; Njølstad, Pål Rasmus; Bjørkhaug, Lise
2012-11-01
GCK-MODY, dominantly inherited mild fasting hyperglycemia, has been associated with >600 different mutations in the glucokinase (GK)-encoding gene (GCK). When expressed as recombinant pancreatic proteins, some mutations result in enzymes with normal/near-normal catalytic properties. The molecular mechanism(s) of GCK-MODY due to these mutations has remained elusive. Here, we aimed to explore the molecular mechanisms for two such catalytically 'normal' GCK mutations (S263P and G264S) in the F260-L270 loop of GK. When stably overexpressed in HEK293 cells and MIN6 β-cells, the S263P- and G264S-encoded mutations generated misfolded proteins with an increased rate of degradation (S263P>G264S) by the protein quality control machinery, and a propensity to self-associate (G264S>S263P) and form dimers (SDS resistant) and aggregates (partly Triton X-100 insoluble), as determined by pulse-chase experiments and subcellular fractionation. Thus, the GCK-MODY mutations S263P and G264S lead to protein misfolding causing destabilization, cellular dimerization/aggregation and enhanced rate of degradation. In silico predicted conformational changes of the F260-L270 loop structure are considered to mediate the dimerization of both mutant proteins by a domain swapping mechanism. Thus, similar properties may represent the molecular mechanisms for additional unexplained GCK-MODY mutations, and may also contribute to the disease mechanism in other previously characterized GCK-MODY inactivating mutations. Copyright © 2012 Elsevier B.V. All rights reserved.
The Moral Challenge of Dangerous Climate Change: Values, Poverty, and Policy
DEFF Research Database (Denmark)
Crabtree, Andrew
2016-01-01
Book review of: The Moral Challenge of Dangerous Climate Change: Values, Poverty, and Policy by Darrel Moellendorf. New York: Cambridge University Press, 2014, pp. 263 (paperback), ISBN 978-1-107-67850-7......Book review of: The Moral Challenge of Dangerous Climate Change: Values, Poverty, and Policy by Darrel Moellendorf. New York: Cambridge University Press, 2014, pp. 263 (paperback), ISBN 978-1-107-67850-7...
Czech Academy of Sciences Publication Activity Database
Bubeníková-Valešová, V.; Svoboda, Jan; Stuchlík, Aleš; Valeš, Karel
2008-01-01
Roč. 11, Suppl.1 (2008), s. 263-263 ISSN 1461-1457. [CINP Congress /26./. 13.07.2008-17.07.2008, Munich] R&D Projects: GA MŠk(CZ) 1M0517; GA MZd(CZ) NR9178; GA ČR(CZ) GA309/07/0341 Institutional research plan: CEZ:AV0Z50110509 Keywords : cpo1 * D1 receptor * schizophrenia * cognitive function Subject RIV: FH - Neurology
Superheavy element chemistry. Achievements and perspectives
International Nuclear Information System (INIS)
Schaedel, M.
2007-01-01
Superheavy elements have been synthesized and chemically characterized one-atom-at-a-time up to element 108. Presently, the quest for element 112 is one of the hottest topics in this field. The transactinide elements 104 to 108 are members of group 4 to 8 of the Periodic Table and element 112 belongs into group 12. Chemical properties of some of these elements, like elements 104 and 105, show stunning deviations from simple extrapolations within their respective group while others exhibit great similarities with their lighter homologues elements. First experiments to investigate seaborgium (Sg, element 106) in aqueous solution were performed. Again, in large international collaborations at the GSI, several gas-phase chemistry experiments were performed with hassium (Hs, element 108). Recently, the highly efficient and very clean separation of Hs was applied for nuclear studies of various Hs nuclides investigating their cross section and their nuclear decay properties in the region of the doubly-magic 270 Hs (Z=108, N=162). To overcome certain limitations of the presently used on-line chemical separations the new TransActinide Separation and Chemistry Apparatus (TASCA) - with a gas-filled recoil separator as a front-end tool - was designed and built at the GSI in a collaborative effort. Presently in its commissioning phase, TASCA shall be a key instrument for a big leap into quantitatively and qualitatively new experiments in the region of superheavy elements. (author)
A suitable material for the substrate of micro-strip gas chamber
International Nuclear Information System (INIS)
Zhang Minglong; Xia Yiben; Wang Linjun; Zhang Weili
2004-01-01
Micro-strip Gas Chamber (MSGC) used as a position sensitive detector has perfect performances in the detection of nuclear irradiations. However, it encounters a severe problem, that is, positive charge accumulation which can be avoided by reducing the surface resistivity of insulating substrate. So, diamond-like carbon (DLC) film is coated on D263 glass to modify its electrical properties as substrate for MSGC. Raman spectroscopy demonstrates that DLC film is of sp 3 (σ bounding) and sp 2 bonding (π bonding), and therefore it is a type of electronically conducting material. It also reveals that the film deposited on D263 glass possesses very large of sp 3 content and consequently is a high quality DLC film. I-V plots indicate that samples with DLC film enjoy very steady and suitable resistivities in the range of 10 9 -10 12 Ω·cm. C-F characteristics also show that samples coated by DLC film have low and stable capacitance with frequency. These excellent performances of the new material, DLC film/D263 glass, meet the optimum requirements of MSGC. DLC film/D263 glass used as the substrate of MSGC should effectively avoid the charge pile-up effect and substrate instability and then improve its performances
RLE (Research Laboratory of Electronics) Progress Report Number 126.
1984-01-01
Loudness 184 26.3 Binaural Hearing 186 S.26.4 Hearing Aid Research 188 26.5 Discrimination of Spectral Shape 191 26.6 Tactile Perception of Speech... beating in the pulse. It is these high intensities which are responsible for large A.C. Stark shifts and ionization RLE P.R. No. 126 12 * . . . Atomic...Department of Aeronautics and Astronautics, Massachusetts Institute of Technology, 1984. 26.3 Binaural Hearing National Institutes of Health (Grant
Archeological Excavations at Two Prehistoric Campsites Near Keystone Dam, El Paso, Texas.
1985-07-19
Flotacion Microdebitate Analysis 246 Groundstone Artifacts 253 Slab Metates 253 Manos 253 PesLIes 253 Groundstone Fragments 263 Anvils 263 Polishing...important new information to our understanding of local prehistory. The bulk ot O’LaugnliLn’s (1980) work in the area was directed toward the excavation...contains or summarizes the bulk of L111 ptiiaisiitd( iaci on iitnic artiract frequenCies irom El Paso ’Ir’Ia Sites. fhese data, along with those from the
17 CFR 230.263 - Consent to Service of Process.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Consent to Service of Process... Consent to Service of Process. (a) If the issuer is not organized under the laws of any of the states of... [§ 239.42 of this chapter]. (b) Any change to the name or address of the agent for service of the issuer...
12 CFR 263.17 - Collateral attacks on adjudicatory proceeding.
2010-01-01
... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Collateral attacks on adjudicatory proceeding... Collateral attacks on adjudicatory proceeding. If an interlocutory appeal or collateral attack is brought in... shall be excused based on the pendency before any court of any interlocutory appeal or collateral attack. ...
12 CFR 263.403 - Automatic removal, suspension, and debarment.
2010-01-01
... independent public accountant or accounting firm may not perform audit services for banking organizations if... permission to such accountant or firm to perform audit services for banking organizations. The request shall... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Automatic removal, suspension, and debarment...
38 CFR 3.263 - Corpus of estate; net worth.
2010-07-01
... outlined in § 3.262(l) for the claimant and his or her dependents. (e) Agent Orange settlement payments... Agent Orange Settlement Fund or any other fund established pursuant to the settlement in the In re Agent Orange product liability litigation, M.D.L. No. 381 (E.D.N.Y.). (January 1, 1989) (Authority: Pub. L. 101...
34 CFR 263.8 - What are the payback requirements?
2010-07-01
... participant performs. (Approved by the Office of Management and Budget under control number 1810-0580... for which training was actually received under the Professional Development program. (c) The cash...
33 CFR 263.17 - Planning, design and construction procedures.
2010-07-01
... accounting of expenditure of study funds, and the amount of funds to be returned to OCE. Release of... feasibility study, and as such, will provide reporting offices with appropriate guidance on submission of a..., requirements of local cooperation are to be stated in the agreement verbatim from the approved project document...
All projects related to | Page 263 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Criminality and Violence in Latin America: a Comparative Perspective between Mexico, Colombia and Brazil. Project. This project will examine the dynamics of crime, violence and drug trafficking in urban centres in three Latin American countries: Brazil (Rio de Janeiro); Colombia (Medellín and Bogotá); and Mexico ...
X-linked Acrogigantism (X-LAG) Syndrome: Clinical Profile and Therapeutic Responses
Beckers, Albert; Lodish, Maya Beth; Trivellin, Giampaolo; Rostomyan, Liliya; Lee, Misu; Faucz, Fabio R; Yuan, Bo; Choong, Catherine S; Caberg, Jean-Hubert; Verrua, Elisa; Naves, Luciana Ansaneli; Cheetham, Tim D; Young, Jacques; Lysy, Philippe A; Petrossians, Patrick
2015-01-01
X-linked acro-gigantism (X-LAG) is a new syndrome of pituitary gigantism, caused by microduplications on chromosome Xq26.3, encompassing the gene GPR101, which is highly upregulated in pituitary tumors. We conducted this study to explore the clinical, radiological and hormonal phenotype and responses to therapy in patients with X-LAG syndrome. The study included 18 patients (13 sporadic) with X-LAG and a microduplication in chromosome Xq26.3. All sporadic cases had unique duplications and the...
Aggressive tumor growth and clinical evolution in a patient with X-linked acro-gigantism syndrome.
Naves, Luciana A.; Daly, Adrian Francis; Dias, Luiz Augusto; Yuan, Bo; Zakir, Juliano Coelho Oliveira; Barra, Gustavo Barcellos; Palmeira, Leonor; Villa, Chiara; Trivellin, Giampaolo; Junior, Armindo Jreige; Neto, Florencio Figueiredo Cavalcante; Liu, Pengfei; Pellegata, Natalia S.; Stratakis, Constantine A.; Lupski, James R.
2016-01-01
X-linked acro-gigantism (X-LAG) syndrome is a newly described disease caused by microduplications on chromosome Xq26.3 leading to copy number gain of GPR101. We describe the clinical progress of a sporadic male X-LAG syndrome patient with an Xq26.3 microduplication, highlighting the aggressive natural history of pituitary tumor growth in the absence of treatment. The patient first presented elsewhere aged 5 years 8 months with a history of excessive growth for >2 years. His height was 163 cm,...
ORF Alignment: NC_003318 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NKIALIDMTLPAQGDLTP 180 ... Query: 263 IYVGTEWEPYTEASEANADWIKTMDKAGLAKTAFSQGGYLAAKVMIDTISGIDGEVTREA 322 ... IYVGTEWEPYTEASEAN...ADWIKTMDKAGLAKTAFSQGGYLAAKVMIDTISGIDGEVTREA Sbjct: 241 IYVGTEWEPYTEASEANADWIKTMDKAGLAKTAFSQGGYLAAKVMIDTISGIDGEVTREA 300 ...
26 CFR 1.263A-9 - The avoided cost method.
2010-04-01
... calculating averages, and for determining measurement dates within the computation period. Special rules are... purposes, regardless of the extent to which the taxpayer's applicable financial accounting or other... measurement period (as defined in paragraph (f)(2)(ii) of this section) that ends on a measurement date...
49 CFR 26.3 - To whom does this part apply?
2010-10-01
... Transportation Office of the Secretary of Transportation PARTICIPATION BY DISADVANTAGED BUSINESS ENTERPRISES IN... funds authorized by Titles I, III, V and VI of ISTEA, Pub. L. 102-240 or by Federal transit laws in... authorized by 49 U.S.C. 47101, et seq. (b) [Reserved] (c) If you are letting a contract, and that contract is...
263 The Decalogue and Igbo Traditional Ethics: Essential Values for ...
African Journals Online (AJOL)
Decalogue and Igbo traditional morality provide a sense of direction for the Jews and the ... its owners, and this explains the principle of cultural interactions. Cultures therefore .... A religious concept that is very important in Igbo morality is Ala. (The Earth ... individual self-seeking relativism in ethical considerations. As long.
26 CFR 1.263A-8 - Requirement to capitalize interest.
2010-04-01
...) Timber and evergreen trees that are more than 6 years old when severed from the roots, or (ii) Property..., fences, inherently permanent advertising displays, inherently permanent outdoor lighting facilities...
People and things. CERN Courier, Apr 1986, v. 26(3)
International Nuclear Information System (INIS)
Anon.
1986-01-01
The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. A Summer Study to be held in Snowmass, Colorado, from 23 June to 11 July will allow the US particle physics community to critically evaluate all aspects of the proposed US Superconducting Super Collider (SSC) in the light of conceptual design, progress in accelerator technology, new developments in collider physics, and innovations in instrumentation. Organized jointly by the European Committee for Future Accelerators (ECFA) and the Rheinisch-Westfälische Technische Hochschule in Aachen, a 'LEP 200' Workshop is being arranged from 29 September to 1 October to work out the physics objectives and experimental requirements for running LEP at around 100 GeV per beam. A four-day practical course on microelectronics is being hosted by CERN and the International School of Geneva
People and things. CERN Courier, Apr 1986, v. 26(3)
Energy Technology Data Exchange (ETDEWEB)
Anon.
1986-04-15
The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. A Summer Study to be held in Snowmass, Colorado, from 23 June to 11 July will allow the US particle physics community to critically evaluate all aspects of the proposed US Superconducting Super Collider (SSC) in the light of conceptual design, progress in accelerator technology, new developments in collider physics, and innovations in instrumentation. Organized jointly by the European Committee for Future Accelerators (ECFA) and the Rheinisch-Westfälische Technische Hochschule in Aachen, a 'LEP 200' Workshop is being arranged from 29 September to 1 October to work out the physics objectives and experimental requirements for running LEP at around 100 GeV per beam. A four-day practical course on microelectronics is being hosted by CERN and the International School of Geneva.
26 CFR 1.263A-1 - Uniform capitalization of costs.
2010-04-01
... costs include costs attributable to processing, assembling, repackaging and transporting goods, and... automation or changes in operation or prices, is not a change in method of accounting under section 446(e). A... standard costs that merely reflects current operating conditions, such as increases in automation or...
45 CFR 263.0 - What definitions apply to this part?
2010-10-01
... projects; (v) Fraud and abuse units; (vi) Procurement activities; (vii) Public relations; (viii) Services related to accounting, litigation, audits, management of property, payroll, and personnel; (ix) Costs for...
34 CFR 263.10 - What are the payback reporting requirements?
2010-07-01
... for payments. (Approved by the Office of Management and Budget under control number 1810-0580... notice of intent to complete a work-related or cash payback, or to continue in a degree program as a full..., but cannot complete, a work-related payback, the payback reverts to a cash payback that is prorated...
Proton capture by magnetic monopoles
International Nuclear Information System (INIS)
Olaussen, K.; Olsen, H.A.; Oeverboe, I.; Osland, P.
1983-09-01
In the Kazama-Yang approximation, the lowest monopole-proton bound states have binding energies of 938 MeV, 263 keV, 105 eV, and 0.04 eV. The cross section for radiative capture to these states is for velocities β = 10 -5 - 10 -3 found to be of the order of 10 -28 - 10 -26 cm 2 . For the state that has a binding energy of 263 keV, the capture length in water is 171 x (β/10 -4 )sup(0.48) m. Observation of photons from the capture process would indicate the presence of monopoles. (orig.)
Toth, Csaba; Funke, Sarah; Nitsche, Vanessa; Liverts, Anna; Zlachevska, Viktoriya; Gasis, Marcia; Wiek, Constanze; Hanenberg, Helmut; Mahotka, Csaba; Schirmacher, Peter; Heikaus, Sebastian
2017-05-02
Renal cell carcinomas (RCCs) display broad resistance against conventional radio- and chemotherapies, which is due at least in part to impairments in both extrinsic and intrinsic apoptotic pathways. One important anti-apoptotic factor that is strongly overexpressed in RCCs and known to inhibit both apoptotic pathways is ARC (apoptosis repressor with a CARD domain). Expression and subcellular distribution of ARC in RCC tissue samples and RCC cell lines were determined by immunohistochemistry and fluorescent immunohistochemistry, respectively. Extrinsic and intrinsic apoptosis signalling were induced by TRAIL (TNF-related apoptosis-inducing ligand), ABT-263 or topotecan. ARC knock-down was performed in clearCa-12 cells using lentiviral transduction of pGIPZ. shRNAmir constructs. Extrinsic respectively intrinsic apoptosis were induced by TRAIL (TNF-related apoptosis-inducing ligand), ABT263 or topotecan. Potential synergistic effects were tested by pre-treatment with topotecan and subsequent treatment with ABT263. Activation of different caspases and mitochondrial depolarisation (JC-1 staining) were analysed by flow cytometry. Protein expression of Bcl-2 family members and ARC in RCC cell lines was measured by Western blotting. Statistical analysis was performed by Student's t-test. Regarding the extrinsic pathway, ARC knockdown strongly enhanced TRAIL-induced apoptosis by increasing the activation level of caspase-8. Regarding the intrinsic pathway, ARC, which was only weakly expressed in the nuclei of RCCs in vivo, exerted its anti-apoptotic effect by impairing mitochondrial activation rather than inhibiting p53. Topotecan- and ABT-263-induced apoptosis was strongly enhanced following ARC knockdown in RCC cell lines. In addition, topotecan pre-treatment enhanced ABT-263-induced apoptosis and this effect was amplified in ARC-knockdown cells. Taken together, our results are the first to demonstrate the importance of ARC protein in the inhibition of both the extrinsic
Karpel-Massler, Georg; Bâ, Maïmouna; Shu, Chang; Halatsch, Marc-Eric; Westhoff, Mike-Andrew; Bruce, Jeffrey N; Canoll, Peter; Siegelin, Markus D
2015-11-03
Glioblastoma is the most frequent primary brain tumor in adults. Current therapeutic options are sparse and the prognosis of patients suffering from this disease is grim. Abundance in intratumoral heterogeneity among different deregulated signaling pathways is a hallmark of glioblastoma and likely accounts for its recurrence and resistance to treatment. Glioblastomas harbor a plethora of deregulated pathways driving tumor formation and growth. In this study, we show that TIC10/ONC201, a promising compound that is currently in planned clinical development, along with Bcl-2/Bcl-xL inhibition by ABT263 yields a strong synergistic antiproliferative effect on pediatric, adult, proneural glioblastoma and glioma stem-like cells. On the molecular level, treatment with TIC10/ONC201 results in a posttranslational decrease of the anti-apoptotic Bcl-2 family member, myeloid cell leukemia 1 (Mcl-1), through modulation of the chaperone Bag3 and the deubiquitinase Usp9X. Consistently, the combination treatment of TIC10/ONC201 and ABT263 required the presence of functional BAX and BAK to drive intrinsic apoptosis, but is surprisingly independent of the extrinsic apoptotic pathway. Moreover, the expression of Noxa protein was required for efficient apoptosis induction by TIC10/ONC201 and ABT263. Importantly, the drug combination of TIC10/ONC201 and the BH3-mimetic, ABT263, led to a regression of tumors in vivo, without any notable toxicity and side effects. Overall, TIC10/ONC201 along with Bcl-2/Bcl-xL inhibition holds significant promise as a novel potential approach for the treatment of recalcitrant tumors such as glioblastoma.
Analysis of digitalis genin receptor site in Na,K-ATPase
International Nuclear Information System (INIS)
Ahmed, K.; McParland, R.; Becker, R.; From, A.; Fullerton, D.S.
1987-01-01
Na,K-ATPase is believed to be the receptor for digitalis glycosides, with binding site located in the α-subunit. To identify this binding site, the enzyme was covalently labeled with a photoactive probe localized in C17 side group of the cardenolide ([ 3 H]24-azidodigitoxoside). 3 H-labeled α-subunit was purified, and subjected to trypsin digestion. Fractions containing 3 H-labeled material were pooled. Amino acid sequence analysis of this material suggested the presence of two peptides (residues 68-146; residues 263-342). Additional studies have employed purification of the 3 H-labeled material by chromatography on Sepharose-6B, and CNBr cleavage followed by chromatography on hydroxylapatite. Amino acid sequence analysis of the purified 3 H-labeled peptide thus isolated indicated sequence containing amino acid residues 263-342. These data suggest that this is the peptide containing the digitalis genin binding site, and rule out such a role for the other peptide (amino acids 68 - 146). Preliminary data also hint that binding of the 3 H-probe occurs at the leu residue in the sequence glu tyr thr try leu glu .. present in the peptide containing residues 263 - 342
Nuclear Science Division 1994 annual report
International Nuclear Information System (INIS)
Myers, W.D.
1995-06-01
This report describes the activities of the Nuclear Science Division for the period of January 1, 1994, to December 31, 1994. This was a time of significant accomplishment for all of the programs in the Division. Assembly of the solar neutrino detector at the Sudbury Neutrino Observatory is well under way. All of the components fabricated by LBL were shipped to Sudbury early in the year and our efforts are now divided between assisting the assembly of the detector and preparing software for data analysis once the detector is operational in 1996. Much of the activity at the 88-Inch Cyclotron centered on Gammasphere. The open-quotes early implementationclose quotes phase of the detector ended in September. This phase was extremely successful, involving over 60 experiments with nearly 200 users from 37 institutions worldwide. The mechanical structure was installed and the final electronic system is expected to operate in March 1995. The Division concurrently hosted a conference on physics for large γ-ray detector arrays at the Clark Kerr Campus at UC Berkeley in August. This was a very successful meeting, reflecting the enthusiasm for this field worldwide. Also at the Cyclotron, the progress toward weak interaction experiments using ultra-thin sources passed a major milestone with the trapping of radioactive 21 Na atoms. We are now engaged in a major upgrade of the experimental area and the outlook is very promising for these novel experiments. Another highlight of research at the Cyclotron was the confirmation of element 106. This development allowed the original LLNL/LBL discovery team to move forward with their proposal to name this element seaborgium
Nuclear Science Division 1994 annual report
Energy Technology Data Exchange (ETDEWEB)
Myers, W.D. [ed.
1995-06-01
This report describes the activities of the Nuclear Science Division for the period of January 1, 1994, to December 31, 1994. This was a time of significant accomplishment for all of the programs in the Division. Assembly of the solar neutrino detector at the Sudbury Neutrino Observatory is well under way. All of the components fabricated by LBL were shipped to Sudbury early in the year and our efforts are now divided between assisting the assembly of the detector and preparing software for data analysis once the detector is operational in 1996. Much of the activity at the 88-Inch Cyclotron centered on Gammasphere. The {open_quotes}early implementation{close_quotes} phase of the detector ended in September. This phase was extremely successful, involving over 60 experiments with nearly 200 users from 37 institutions worldwide. The mechanical structure was installed and the final electronic system is expected to operate in March 1995. The Division concurrently hosted a conference on physics for large {gamma}-ray detector arrays at the Clark Kerr Campus at UC Berkeley in August. This was a very successful meeting, reflecting the enthusiasm for this field worldwide. Also at the Cyclotron, the progress toward weak interaction experiments using ultra-thin sources passed a major milestone with the trapping of radioactive {sup 21}Na atoms. We are now engaged in a major upgrade of the experimental area and the outlook is very promising for these novel experiments. Another highlight of research at the Cyclotron was the confirmation of element 106. This development allowed the original LLNL/LBL discovery team to move forward with their proposal to name this element seaborgium.
ORF Alignment: NC_005126 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available FRAQQNLGKLARRI 60 ... Query: 500 MAAEVIAGHLGVDLIKVDLSTVVNKYIGETEKNIARIFDLAESDSGVLFFDEADALFGKR 559 ... MA...AEVIAGHLGVDLIKVDLSTVVNKYIGETEKNIARIFDLAESDSGVLFFDEADALFGKR Sbjct: 121 MAAEVIAGHLG...VDLIKVDLSTVVNKYIGETEKNIARIFDLAESDSGVLFFDEADALFGKR 180 ... Query: 620 RKKMWQTIWPEQLKLSGEIDFAH 642 ... RKKMWQTIWPEQLKLSGEIDFAH Sbjct: 241 RKKMWQTIWPEQLKLSGEIDFAH 263
Somatic mosaicism underlies X-linked acrogigantism syndrome in sporadic male subjects.
Daly, Adrian F; Yuan, Bo; Fina, Frederic; Caberg, Jean-Hubert; Trivellin, Giampaolo; Rostomyan, Liliya; de Herder, Wouter W; Naves, Luciana A; Metzger, Daniel; Cuny, Thomas; Rabl, Wolfgang; Shah, Nalini; Jaffrain-Rea, Marie-Lise; Zatelli, Maria Chiara; Faucz, Fabio R; Castermans, Emilie; Nanni-Metellus, Isabelle; Lodish, Maya; Muhammad, Ammar; Palmeira, Leonor; Potorac, Iulia; Mantovani, Giovanna; Neggers, Sebastian J; Klein, Marc; Barlier, Anne; Liu, Pengfei; Ouafik, L'Houcine; Bours, Vincent; Lupski, James R; Stratakis, Constantine A; Beckers, Albert
2016-04-01
Somatic mosaicism has been implicated as a causative mechanism in a number of genetic and genomic disorders. X-linked acrogigantism (XLAG) syndrome is a recently characterized genomic form of pediatric gigantism due to aggressive pituitary tumors that is caused by submicroscopic chromosome Xq26.3 duplications that include GPR101 We studied XLAG syndrome patients (n= 18) to determine if somatic mosaicism contributed to the genomic pathophysiology. Eighteen subjects with XLAG syndrome caused by Xq26.3 duplications were identified using high-definition array comparative genomic hybridization (HD-aCGH). We noted that males with XLAG had a decreased log2ratio (LR) compared with expected values, suggesting potential mosaicism, whereas females showed no such decrease. Compared with familial male XLAG cases, sporadic males had more marked evidence for mosaicism, with levels of Xq26.3 duplication between 16.1 and 53.8%. These characteristics were replicated using a novel, personalized breakpoint junction-specific quantification droplet digital polymerase chain reaction (ddPCR) technique. Using a separate ddPCR technique, we studied the feasibility of identifying XLAG syndrome cases in a distinct patient population of 64 unrelated subjects with acromegaly/gigantism, and identified one female gigantism patient who had had increased copy number variation (CNV) threshold for GPR101 that was subsequently diagnosed as having XLAG syndrome on HD-aCGH. Employing a combination of HD-aCGH and novel ddPCR approaches, we have demonstrated, for the first time, that XLAG syndrome can be caused by variable degrees of somatic mosaicism for duplications at chromosome Xq26.3. Somatic mosaicism was shown to occur in sporadic males but not in females with XLAG syndrome, although the clinical characteristics of the disease were similarly severe in both sexes. © 2016 Society for Endocrinology.
Gigantism and acromegaly due to Xq26 microduplications and GPR101 mutation.
Trivellin, Giampaolo; Daly, Adrian F; Faucz, Fabio R; Yuan, Bo; Rostomyan, Liliya; Larco, Darwin O; Schernthaner-Reiter, Marie Helene; Szarek, Eva; Leal, Letícia F; Caberg, Jean-Hubert; Castermans, Emilie; Villa, Chiara; Dimopoulos, Aggeliki; Chittiboina, Prashant; Xekouki, Paraskevi; Shah, Nalini; Metzger, Daniel; Lysy, Philippe A; Ferrante, Emanuele; Strebkova, Natalia; Mazerkina, Nadia; Zatelli, Maria Chiara; Lodish, Maya; Horvath, Anelia; de Alexandre, Rodrigo Bertollo; Manning, Allison D; Levy, Isaac; Keil, Margaret F; Sierra, Maria de la Luz; Palmeira, Leonor; Coppieters, Wouter; Georges, Michel; Naves, Luciana A; Jamar, Mauricette; Bours, Vincent; Wu, T John; Choong, Catherine S; Bertherat, Jerome; Chanson, Philippe; Kamenický, Peter; Farrell, William E; Barlier, Anne; Quezado, Martha; Bjelobaba, Ivana; Stojilkovic, Stanko S; Wess, Jurgen; Costanzi, Stefano; Liu, Pengfei; Lupski, James R; Beckers, Albert; Stratakis, Constantine A
2014-12-18
Increased secretion of growth hormone leads to gigantism in children and acromegaly in adults; the genetic causes of gigantism and acromegaly are poorly understood. We performed clinical and genetic studies of samples obtained from 43 patients with gigantism and then sequenced an implicated gene in samples from 248 patients with acromegaly. We observed microduplication on chromosome Xq26.3 in samples from 13 patients with gigantism; of these samples, 4 were obtained from members of two unrelated kindreds, and 9 were from patients with sporadic cases. All the patients had disease onset during early childhood. Of the patients with gigantism who did not carry an Xq26.3 microduplication, none presented before the age of 5 years. Genomic characterization of the Xq26.3 region suggests that the microduplications are generated during chromosome replication and that they contain four protein-coding genes. Only one of these genes, GPR101, which encodes a G-protein-coupled receptor, was overexpressed in patients' pituitary lesions. We identified a recurrent GPR101 mutation (p.E308D) in 11 of 248 patients with acromegaly, with the mutation found mostly in tumors. When the mutation was transfected into rat GH3 cells, it led to increased release of growth hormone and proliferation of growth hormone-producing cells. We describe a pediatric disorder (which we have termed X-linked acrogigantism [X-LAG]) that is caused by an Xq26.3 genomic duplication and is characterized by early-onset gigantism resulting from an excess of growth hormone. Duplication of GPR101 probably causes X-LAG. We also found a recurrent mutation in GPR101 in some adults with acromegaly. (Funded by the Eunice Kennedy Shriver National Institute of Child Health and Human Development and others.).
Somatic Mosaicism Underlies X-linked Acrogigantism (XLAG) Syndrome in Sporadic Male Subjects
Daly, Adrian F.; Yuan, Bo; Fina, Frederic; Caberg, Jean-Hubert; Trivellin, Giampaolo; Rostomyan, Liliya; de Herder, Wouter W.; Naves, Luciana A.; Metzger, Daniel; Cuny, Thomas; Rabl, Wolfgang; Shah, Nalini; Jaffrain-Rea, Marie-Lise; Zatelli, Maria Chiara; Faucz, Fabio R; Castermans, Emilie; Nanni-Metellus, Isabelle; Lodish, Maya; Muhammad, Ammar; Palmeira, Leonor; Potorac, Iulia; Mantovani, Giovanna; Neggers, Sebastian J.; Klein, Marc; Barlier, Anne; Liu, Pengfei; Ouafik, L'Houcine; Bours, Vincent; Lupski, James R.; Stratakis, Constantine A.; Beckers., Albert
2016-01-01
Somatic mosaicism has been implicated as a causative mechanism in a number of genetic and genomic disorders. X-linked acrogigantism (XLAG) syndrome is a recently characterized genomic form of pediatric gigantism due to aggressive pituitary tumors that is caused by submicroscopic chromosome Xq26.3 duplications that include GPR101. We studied XLAG syndrome patients (N=18) to determine if somatic mosaicism contributed to the genomic pathophysiology. Eighteen subjects with XLAG syndrome were identified with Xq26.3 duplications using high definition array comparative genome hybridization (HD-aCGH). We noted males with XLAG had a decreased log2 ratio compared with expected values, suggesting potential mosaicism, while females showed no such decrease. As compared with familial male XLAG cases, sporadic males had more marked evidence for mosaicism, with levels of Xq26.3 duplication between 16.1-53.8%. These characteristics were replicated using a novel, personalized breakpoint-junction specific quantification droplet digital PCR (ddPCR) technique. Using a separate ddPCR technique we studied the feasibility of identifying XLAG syndrome cases in a distinct patient population of 64 unrelated subjects with acromegaly/gigantism and identified one female gigantism patient that had increased copy number variation (CNV) threshold for GPR101 that was subsequently diagnosed as having XLAG syndrome on HD-aCGH. Employing a combination of HD-aCGH and novel ddPCR approaches, we have demonstrated, for the first time, that XLAG syndrome can be caused by variable degrees of somatic mosaicism for duplications at chromosome Xq26.3. Somatic mosaicism was shown to occur in sporadic males but not in females with XLAG syndrome, although the clinical characteristics of the disease were similarly severe in both sexes. PMID:26935837
Sootak, Jaan, 1948-
2008-01-01
Kommentaar Riigikohtu lahendile 3-1-1-36-07 (Ivailo Siimani kaitsja vandeadvokaadi vanemabi Andres Veski ja Margo Küti kaitsja vandeadvokaat Anu Pärteli kassatsioonid Tartu Ringkonnakohtu 13. veebruari 2007. a kohtuotsuse peale kriminaalasjas Ivailo Siimani süüdistuses KarS § 199 lg 2 p-de 4, 7 ja 8; § 263 p-de 1 ja 4 järgi ning Margo Küti süüdistuses KarS § 200 lg 2 p 7, § 199 lg 2 p-de 4, 7, 8, § 263 p-de 1, 2, 3 ja § 25 lg-te 1 ja 2 ning § 209 lg 2 p 1 järgi)
E331 Behavior TP HF RW O3 SHC2.63
U.S. Environmental Protection Agency — Human and animal studies indicate that maternal obesity can negatively impact aspects of metabolism and neurodevelopment in the offspring. Not known, however, is...
12 CFR 263.303 - Filing of safety and soundness compliance plan.
2010-01-01
... member bank will take to correct the deficiency and the time within which those steps will be taken. (c... FEDERAL RESERVE SYSTEM RULES OF PRACTICE FOR HEARINGS Submission and Review of Safety and Soundness... safety and soundness compliance plan. (a) Schedule for filing compliance plan—(1) In general. A State...
: tous les projets | Page 263 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
End Date: 28 avril 2015. Sujet: RELIGIOUS DISCRIMINATION, RELIGIOUS MINORITIES, ETHNIC MINORITIES, HUMAN RIGHTS, VIOLENCE, ADMINISTRATION OF JUSTICE, COMPENSATION. Région: India, Central Asia, Far East Asia, South Asia. Programme: Gouvernance et justice. Financement total : CA$ 320,000.00.
75 FR 16204 - Reporting and Recordkeeping Requirements Under OMB Review
2010-03-31
..., Office of Management and Budget, New Executive Office Building, Washington, DC 20503. FOR FURTHER... Burden: 263. Title: Federal Cash Transaction Report, Financial Status Report, Program Income Report...
ORF Alignment: NC_005786 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ssypii ATCC 10895] ref|NP_984597.1| AEL263Cp ... [Eremothecium gossypii] ... Length = 128 ... Query: 4 ... KDIRT...GDRVLCKVGDFPPWPAVVVPQRFLSKLVYSGKRSKSYVCVAFFNDDSYYWKEPRH 63 ... KDIRTGDRVLCKVGDFPPWPAVVVP...QRFLSKLVYSGKRSKSYVCVAFFNDDSYYWKEPRH Sbjct: 1 ... KDIRTGDRVLCKVGDFPPWPAVVVPQRFLSKLVY
A Rare Chromosome 3 Imbalance and Its Clinical Implications
Directory of Open Access Journals (Sweden)
Karen Sims
2012-01-01
Full Text Available The duplication of chromosome 3q is a rare disorder with varying chromosomal breakpoints and consequently symptoms. Even rarer is the unbalanced outcome from a parental inv(3 resulting in duplicated 3q and a deletion of 3p. Molecular karyotyping should aid in precisely determining the length and breakpoints of the 3q+/3p− so as to better understand a child’s future development and needs. We report a case of an infant male with a 57.5 Mb duplication from 3q23-qter. This patient also has an accompanying 1.7 Mb deletion of 3p26.3. The duplicated segment in this patient encompasses the known critical region of 3q26.3-q27, which is implicated in the previously reported 3q dup syndrome; however, the accompanying 3p26.3 deletion is smaller than the previously reported cases. The clinical phenotype of this patient relates to previously reported cases of 3q+ that may suggest that the accompanying 1.7 Mb heterozygous deletion is not clinically relevant. Taken together, our data has refined the location and extent of the chromosome 3 imbalance, which will aid in better understanding the molecular underpinning of the 3q syndrome.
Analysis of digitalis genin receptor site in Na,K-ATPase
Energy Technology Data Exchange (ETDEWEB)
Ahmed, K.; McParland, R.; Becker, R.; From, A.; Fullerton, D.S.
1987-05-01
Na,K-ATPase is believed to be the receptor for digitalis glycosides, with binding site located in the ..cap alpha..-subunit. To identify this binding site, the enzyme was covalently labeled with a photoactive probe localized in C17 side group of the cardenolide ((/sup 3/H)24-azidodigitoxoside). /sup 3/H-labeled ..cap alpha..-subunit was purified, and subjected to trypsin digestion. Fractions containing /sup 3/H-labeled material were pooled. Amino acid sequence analysis of this material suggested the presence of two peptides (residues 68-146; residues 263-342). Additional studies have employed purification of the /sup 3/H-labeled material by chromatography on Sepharose-6B, and CNBr cleavage followed by chromatography on hydroxylapatite. Amino acid sequence analysis of the purified /sup 3/H-labeled peptide thus isolated indicated sequence containing amino acid residues 263-342. These data suggest that this is the peptide containing the digitalis genin binding site, and rule out such a role for the other peptide (amino acids 68 - 146). Preliminary data also hint that binding of the /sup 3/H-probe occurs at the leu residue in the sequence glu tyr thr try leu glu .. present in the peptide containing residues 263 - 342.
2012-07-19
... submitting comments. Mail: Rich Malinowski, Southeast Regional Office, NMFS, 263 13th Avenue South, St...: Rich Malinowski, Southeast Regional Office, telephone 727-824-5305, email rich.malinowski@noaa.gov...
2013-12-19
... submitting comments. Mail: Rich Malinowski, Southeast Regional Office, NMFS, 263 13th Avenue South, St... CONTACT: Rich Malinowski, Southeast Regional Office, NMFS, telephone 727-824-5305; email: rich.malinowski...
Nález zásobnic ze střední doby hradištní u závrtu ZMF (Tetín, okr. Beroun)
Czech Academy of Sciences Publication Activity Database
Vencl, Slavomil
2015-01-01
Roč. 19, č. 1 (2015), s. 263-269 ISSN 1214-3553 Institutional support: RVO:67985912 Keywords : Middle Hillfort Period * storage jars * Bohemian Karst Subject RIV: AC - Archeology, Anthropology, Ethnology
2011-03-10
... Malinowski, Southeast Regional Office, NMFS, 263 13th Avenue, South, St. Petersburg, FL 33701. Instructions... INFORMATION CONTACT: Rich Malinowski, 727-824-5305; fax: 727-824-5308. SUPPLEMENTARY INFORMATION: The reef...
75 FR 5925 - Proposed Flood Elevation Determinations
2010-02-05
... Spring County. Martin Luther King Boulevard. Approximately 1,300 None +263 feet downstream of Martin Luther King Boulevard. Town Creek Approximately 2,300 None +253 Unincorporated Areas of feet downstream...
2008-09-01
Map 6) is comprised of sixteen magnetic anomalies, designated Ml08, Ml46, Ml69, Ml86, M205, M250 , M263, M265, M280, M284, M289, M300, M305, M318...high amplitudes that range from 133.6 to 4211.1 nT, except Ml69, Ml86. M205, M250 , M263, and M265 that have amplitudes ranging from 24.1 to 56.8 nT...3845173.32 20 M248 B 32 01:10.1 167.8 -M 320372.02 3846568.45 N/A M249 B 32 01:46.2 84.5 D 319642.84 3848381.28 22 M250 B 33 01:11.2 34.9 D 318099.83
Energy Technology Data Exchange (ETDEWEB)
Kemmler-Sack, S; Treiber, U [Tuebingen Univ. (Germany, F.R.). Lehrstuhl fuer Anorganische Chemie 2
1981-07-01
According to the intensity calculations for Ba/sub 3/Wsub(4/3)Nbsub(2/3)vacantOsub(26/3)vacantsub(1/3) and Ba/sub 3/Nb/sub 2/vacantO/sub 8/vacant(II) these rhombohedral 9 L compounds crystallize in the space group R-3m, sequence (hhc)/sub 3/. The refined, intensity related R' values are 6.9% (Ba/sub 3/Wsub(4/3)Nbsub(2/3)vacantOsub(26/3)vacantsub(1/3)) and 7.2% (Ba/sub 3/Nb/sub 2/vacantO/sub 8/vacant(II)). The relations between the rhombohedral 9 L structure (A/sub 3/M/sub 2/vacantO/sub 9/) and the palmierite type (A/sub 3/M/sub 2/vacantO/sub 8/vacant) are discussed.
Migrace v české etnologii: náměty k obohacení migrační teorie
Czech Academy of Sciences Publication Activity Database
Uherek, Zdeněk
2016-01-01
Roč. 26, č. 4 (2016), s. 263-270 ISSN 0862-8351 Institutional support: RVO:68378076 Keywords : ethnology * social and cultural anthropology * migration * Czech Republic Subject RIV: AC - Archeology, Anthropology, Ethnology
Dibutyryl c-AMP as an inducer of sporidia formation: Biochemical ...
Indian Academy of Sciences (India)
Unknown
and Technology, Pantnagar 263 145, India. *Corresponding author ... on growth and morphological differentiation of Tilletia indica. Exponential growth was .... developmentally related markers on fungal population. Number of these markers is ...
Czech Academy of Sciences Publication Activity Database
Holec, J.; Kolařík, Miroslav; Borgarino, D.; Bidaud, A.; Moreau, P.A.
2016-01-01
Roč. 103, 1-2 (2016), s. 251-263 ISSN 0029-5035 Institutional support: RVO:61388971 Keywords : Basidiomycota * Strophariaceae * phylogeny Subject RIV: EE - Microbiology, Virology Impact factor: 0.941, year: 2016
Lifescience Database Archive (English)
Full Text Available psychiatric agent ... DG01905 ... Phenothiazine antipsychotics ... Phenothiazine derivative ... CAS: 3819-00-9 PubChem: 17396848 ChEMBL: CHEMBL1584 LigandBox: D02679 NIKKAJI: J8.263E ...
75 FR 78617 - Final Flood Elevation Determinations
2010-12-16
.... Rockport Creek Approximately 2,300 feet +260 Unincorporated Areas of downstream of Martin Hot Spring County. Luther King Boulevard. Approximately 1,300 feet +263 downstream of Martin Luther King Boulevard. Town...
Brand-Gruwel, Saskia; Wopereis, Iwan
2008-01-01
Brand-Gruwel, S., & Wopereis, I. (2006). Integration of the information problem-solving skill in an educational programme: The effects of learning with authentic tasks. Technology, Instruction, Cognition, and Learning, 4, 243-263.
Czech Academy of Sciences Publication Activity Database
Cárdenas, M. Q.; Moravec, František; Kohn, A.
2009-01-01
Roč. 9, č. 2 (2009), s. 263-266 ISSN 1676-0611 Institutional research plan: CEZ:AV0Z60220518 Keywords : Philometra * Katsuwonus * Brazil Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine
National Research Council Canada - National Science Library
Rohwer, Robert G; Gregori, Luisa L
2005-01-01
.... The assay is been developed with test material from two animal models: the hamster infected with the 263K strain of scrapie and the sheep either naturally or experimentally infected with scrapie...
Pacific region influenza surveillance for oseltamivir resistance.
Miller, Heather B; Gose, Remedios B; Nagata, Mark T; Sciulli, Rebecca H; Whelen, A Christian
2012-05-01
Hawaii and the United States-affiliated Pacific islands (USAPI) host over 8 million travelers annually, most of whom originate in Asia, Australia, and the Americas where prevalence of oseltamivir resistance in 2009 pandemic influenza A (H1N1) has been reported to be 2.5-3.5%. To survey a collection of samples from Hawaii and the USAPI that had tested positive for the 2009 pandemic influenza A (H1N1) virus by RTI-PCR to assess whether antiviral resistance emerged in these island communities during the 2009 H1N1 pandemic. We examined RNA extracted from Hawaiian and USAPI cases for the neuraminidase H275Y mutation associated with oseltamivir resistance by pyrosequencing. Two hundred and sixty-three (263) 2009 pandemic influenza A (H1N1) positive specimens were tested and 263/263 (100%) were shown to lack the mutation most commonly associated with oseltamivir resistance. There was no evidence of oseltamivir resistant A(H1N1)pdm09 virus during the 2009 pandemic in the Pacific islands despite considerable travel exposure. Geographic isolation, the lack of a "second wave" of pandemic influenza, judicious antiviral use, aggressive vaccination, and below average tourism due to the global economic crisis may have been contributing factors. Continued surveillance and vigilance is necessary to monitor unpredictable influenza activity. Copyright © 2012 Elsevier B.V. All rights reserved.
Leye, A; Pouye, A; Fall, S; Ndongo, S; Ould Isselmou, El B; Ka, M M; Moreira-Diop, T
2004-01-01
The authors report 19 cases of non iatrogenic primary hypothyroidism in adults at Le Dantec Hospital of Dakar. Those cases had been found during a period of 6 years and half in the internal medicine service. The aim was to study clinical features, diagnosis and outcome of patients after treatment. The mean age of patients was 42.2 years with a sex-ratio of 0.33 M/F. The diagnosis delay was around 6,1 years. All patients presented clinical signs of hypometabolism: physical asthenia (63.15%), frilosity (26.3%), bradycardia (47.3%), constipation (36.8%). The cutaneomucal syndrom was composed by myxoedema (73.6%), macroglossia (26.3%), raucousness of voice (26.3%), alopecia (57.9%). Muscle weakness was found in 2 cases and genital troubles in 3 cases. Five patients presented goiter and 9 others had spontaneous thyroid atrophy. All patients presented a high level of TSH associated with decreased level of T4. Anemia was found in 7 cases and hypercholesterolemia in 13 cases. Treatment was based on substitutive hormonotherapy with L-Thyroxin (75 to 250 microg/day). Evolution was favorable after 10 month mean duration of processing. More alertness is necessary on behalf of the practitioners in front of any sign suggesting hypometabolism to reduce the diagnostic delay and prevent complete form of hypothyroidism that might be complicated, by cardiac involvement in particular.
Experimental study of surface dielectric barrier discharge in air and its ozone production
International Nuclear Information System (INIS)
Pekárek, Stanislav
2012-01-01
For surface dielectric barrier discharge in air we studied the effects of frequency of the driving voltage on dissipated power, asymmetry of amplitudes of the discharge voltage, discharge UV emission, ozone production, ozone production of the discharge with TiO 2 and of the discharge in magnetic field. We found that for a particular voltage the dissipated power is higher for the frequency of the driving voltage of 26.3 kHz than for the frequency of 10.9 kHz; peak values of the positive half-periods of the discharge voltage are higher than peak values of the negative half-periods; intensity of the discharge UV emissions for wavelengths of 320-420 nm is for both frequencies a linear function of power; maximum ozone concentration for the frequency of the driving voltage of 26.3 kHz is obtained with smaller power than for the frequency of 10.9 kHz; placement of TiO 2 particles into the discharge chamber increases for both frequencies of the driving voltage maximum ozone concentration produced by the discharge and for the frequency of the driving voltage of 26.3 kHz increases ozone production yield. Finally, there is no observable effect of magnetic field on concentration of ozone produced by the discharge as well as on production yield. (paper)
What to Expect During a Colonoscopy
Full Text Available ... ACG welcomes inquiries about digestive health from the media and can make experts available for interviews upon request. Please call the Communications Team at 301-263-9000 or e-mail ...
African Journals Online (AJOL)
AUNTY TEE
EJOTMAS: EKPOMA JOURNAL OF THEATRE AND MEDIA ARTS. 263. INDIGENOUS .... science and all their social institutions, including their system of belief .... Nigerian Tourism Development Corporation has been working with the states to ...
African Journals Online (AJOL)
Items 1 - 50 of 263 ... Vol 6, No 1 (2007), A review of Chest Pain in Nigerian Hypertensive ... Acute Toxicity, Analgesic Potential and Preliminary Antimocrobial ... Antihypertensive Drug combinations in Lagos University Teaching Hospital, Abstract.
Nucleotide diversity and phylogenetic relationships among ...
Indian Academy of Sciences (India)
2017-03-03
Mar 3, 2017 ... 2Department of Botany, D. S. B. Campus, Kumaun University, Nainital 263 001, India ... Rana T. S. 2017 Nucleotide diversity and phylogenetic relationships ... Anderson and Park 1989). ..... Edgewood Press, Edgewood, USA.
Journal of Chemical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Author Affiliations. Abraham F Jalbout1 Md Abul Haider Shipar2. Instituto de Quimica, Universidad Nacional Autonoma de Mexico, Mexico City, Mexico; Faculty of Engineering, Chiba University, Inage-ku, Chiba 263-8522, Japan ...
DEFF Research Database (Denmark)
Radha, V; Ek, J; Anuradha, S
2009-01-01
. There are very few data on MODY mutations from India. OBJECTIVE: The objective was to screen coding and promoter regions of HNF1A gene for mutations in unrelated South Indian subjects in whom a clinical diagnosis of MODY was made. DESIGN: This was an observational cross-sectional study. SETTING: The study...... studies revealed reduced transcriptional activity of the HNF1A promoter for two promoter variants. We also observed cosegregation with diabetes of the Arg263His coding region mutation in eight members of one MODY family, whereas it was absent in nondiabetic subjects of this family. CONCLUSION: This study...... suggests that mutations in the HNF1A gene comprise about 9% of clinically diagnosed MODY subjects in southern India and a novel Arg263His mutation cosegregates with MODY in one family....
Effect of epoxide equivalent on microstructure of epoxy/rectorite nanocomposite studied by positrons
International Nuclear Information System (INIS)
Liu, L.M.; Fang, P.F.; Zhang, S.P.; Wang, S.J.
2005-01-01
The epoxy/rectorite nanocomposites with different epoxide equivalent ranging from 188 to 1110 were prepared and the effects of epoxide equivalent on microstructure of materials were studied by X-ray diffraction (XRD) and positron annihilation lifetime spectroscope (PALS). In nanocomposites, the formation of exfoliated structure was observed from XRD pattern at epoxide equivalent >263. The PALS measurements reveal that the fractional free volume in nanocomposites was strongly affected by epoxide equivalent, in particular, the free-volume concentration was dramatically decreased with the increasing epoxide equivalent from 188 to 263, and the S parameter indicates the rectorite structure change and the high sensitivity of positron annihilation to the entry of rectorite into epoxy. These results indicate that positron annihilation characteristics are useful for study the microstructure of epoxy/rectorite nanocomposites
Sur, a former late-glacial and Holocene lake at the westernmost margin of the Carpathians
Czech Academy of Sciences Publication Activity Database
Petr, L.; Žáčková, P.; Matys Grygar, Tomáš; Píšková, Anna; Křížek, M.; Treml, V.
2013-01-01
Roč. 85, č. 3 (2013), s. 239-263 ISSN 0032-7786 Institutional support: RVO:61388980 Keywords : Geochemistry * Geomorphology * Multi-proxy reconstruction * Palaeobotany * Palaeolimnology * Pannonia Subject RIV: DD - Geochemistry Impact factor: 2.778, year: 2013
Massenspektrometrie in der organischen Chemie
Czech Academy of Sciences Publication Activity Database
Schröder, Detlef
2009-01-01
Roč. 57, - (2009), s. 262-263 ISSN 1439-9598 Institutional research plan: CEZ:AV0Z40550506 Keywords : organic chemistry * mass spectrometry Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.133, year: 2009
Association Between the Solar Wind Speed, Interplanetary Magnetic ...
Indian Academy of Sciences (India)
Meena Pokharia
2017-11-27
Nov 27, 2017 ... Department of Physics, M. B. Government P. G. College, Haldwani, Nainital 263 139, India. ∗. Corresponding author. E-mail: meenapokharia21@gmail.com ...... service and also thankful to ARIES, Nainital for pro-.
Elementõ polititsheskoi mifologii Tjuttsheva (kommentari k state 1844 g.) / Aleksandr Ospovat
Ospovat, Aleksandr
1999-01-01
Bibl. lk. 259-263. Kokkuvõte inglise k. lk. 321. Kiri ajalehe "Allgemeine Zeitung" (Augsburg) toimetajale Gustav Kolbile (1844, prantsuse k.). Artikli venek. versioon (pealk. "Venemaa ja Saksamaa") publitseeriti ajakirjas Russki arhiv (1873, nr. 10)
Indications and Complications of Tube Thoracostomy with ...
African Journals Online (AJOL)
... surgeon and patients were followed up with serial chest X‑rays until certified cured. ... Others were trauma, 44 (26.3%), Parapneumonic effusion, 20 (12%), ... more frequent complications been empyema (5.6%) and pneumothorax (3.6%).
78 FR 263 - Safety Zones; TEMCO Grain Facilities; Columbia and Willamette Rivers
2013-01-03
...'01'' W. In essence, these boundaries extend from the shoreline of the facility 150 yards onto the...'' N/122-40'28'' W. In essence, these boundaries extend from the shoreline of the facility 150 yards... criminal laws of the United States. (2) Navigable waters of the United States means those waters defined as...
45 CFR 263.20 - What definitions apply to Individual Development Accounts (IDAs)?
2010-10-01
... Carl D. Perkins Vocational and Applied Technology Education Act (20 U.S.C. 2471(4)) that is in any... in any Federal means-tested programs. Post-secondary educational expenses means a student's tuition and fees required for the enrollment or attendance at an eligible educational institution, and...
34 CFR 263.3 - What definitions apply to the Professional Development program?
2010-07-01
... load; and (3) Is not employed for more than 20 hours a week. Good standing means a cumulative grade point average of at least 2.0 on a 4.0 grade point scale in which failing grades are computed as part of the average, or another appropriate standard established by the institution. Graduate degree means a...
a comparative study of student academic performance in on-campus
African Journals Online (AJOL)
User
demic performance (Cumulative Weighted Average Scores) between distance and on-campus students. ... one of the several programmes that is offered ... and women in the two courses in health care ..... cation for Business 77 (5):257-263.
Design and Optimization of Reverse-Transcription Quantitative PCR Experiments
Czech Academy of Sciences Publication Activity Database
Tichopád, A.; Kitchen, R.; Riedmaier, I.; Becker, Ch.; Ståhlberg, A.; Kubista, Mikael
2009-01-01
Roč. 55, č. 10 (2009), s. 1816-1823 ISSN 0009-9147 Institutional research plan: CEZ:AV0Z50520701 Keywords : Design * optimization * RT qPCR Subject RIV: EG - Zoology Impact factor: 6.263, year: 2009
Czech Academy of Sciences Publication Activity Database
Bahenská, Marie
2011-01-01
Roč. 3, č. 2 (2011), s. 248-263 ISSN 1803-9448 Institutional research plan: CEZ:AV0Z80770509 Keywords : Lengerová, Alena * history of science * Czechoslovak Academy of Science s Subject RIV: AB - History
Czech Academy of Sciences Publication Activity Database
Chýlková, J.; Fadrná, Renata
2004-01-01
Roč. 98, č. 5 (2004), s. 260-263 ISSN 0009-2770 R&D Projects: GA AV ČR KSK4040110 Keywords : thiodiglykolic acid * TDGA * isotachophores Subject RIV: CG - Electrochemistry Impact factor: 0.348, year: 2004
Czech Academy of Sciences Publication Activity Database
Prosecká, Eva; Rampichová, Michala; Litvinec, Andrej; Tonar, Z.; Králíčková, M.; Vojtová, L.; Kochová, P.; Plencner, Martin; Buzgo, Matej; Míčková, Andrea; Jančář, J.; Amler, Evžen
2015-01-01
Roč. 103, č. 2 (2015), s. 671-682 ISSN 1549-3296 Institutional support: RVO:68378041 Keywords : bone regeneration * mesenchymal stem cells * collagen/hydroxyapatite scaffold Subject RIV: EI - Biotechnology ; Bionics Impact factor: 3.263, year: 2015
Basic student nurse perceptions about clinical instructor caring
African Journals Online (AJOL)
Gerda-Marie Meyer
instructor caring. A structured self administered questionnaire using the Nursing Student .... 263). The high enthusiasm and belief in the ability to care may result in .... treatment and protection from discomfort and harm (Grove,. Burns, & Gray ...
21. Effects of Gender Based Violence on Neurocognitive functioning ...
African Journals Online (AJOL)
Esem
correlation on both psychological and sexual abuse on working memory r (263) ... to capture violence that occurs as a result of the normative role expectations .... The Working Memory and Attention Domain comprising the Paced Auditory ...
Philipp Weselsky - profesor vídeňské techniky z Českomoravské vysočiny
Czech Academy of Sciences Publication Activity Database
Jindra, Jiří
2010-01-01
Roč. 43, č. 4 (2010), s. 255-263 ISSN 0300-4414 Institutional research plan: CEZ:AV0Z80630520 Keywords : Vienna Technical University 1854-1884 * tuition of analytical chemistry * synthetic dyes Subject RIV: AB - History
Supercapacitive performance of hydrous ruthenium oxide (RuO2 ...
Indian Academy of Sciences (India)
gel method have been employed to prepare ruthenium oxide thin films. Recently ... the potentiostat (263A EG&G, Princeton Applied Research. Potentiostat). .... is a mixed conductor that conducts protons and electrons in acidic solution (as ...
Czech Academy of Sciences Publication Activity Database
Lhomme, P.; Ayasse, M.; Valterová, Irena; Lecocq, T.; Rasmont, P.
2015-01-01
Roč. 157, č. 3 (2015), s. 263-270 ISSN 0013-8703 Institutional support: RVO:61388963 Keywords : Hymenoptera * Apidae * Psithyrus * social parasitism * repellent * GC-EAD * chemical camouflage Subject RIV: EG - Zoology Impact factor: 1.442, year: 2015
The Johannesburg cardiac rehabilitation programme
African Journals Online (AJOL)
1991-02-16
Feb 16, 1991 ... sion 72,9% of patients were smokers, 26,3% had hypertension and 34,3% had ... Cardiac rehabilitation, including supervised exercise therapy, has become a .... sions on risk factor modification, diet, aspects of heart disease,.
Czech Academy of Sciences Publication Activity Database
Petrusková, T.; Diblíková, L.; Pipek, P.; Frauendorf, E.; Procházka, Petr; Petrusek, A.
2015-01-01
Roč. 156, č. 1 (2015), s. 263-273 ISSN 0021-8375 Institutional support: RVO:68081766 Keywords : Emberiza citrinella * Song variation * Dialect nomenclature * Online sources * Macrogeographic patterns Subject RIV: EG - Zoology Impact factor: 1.419, year: 2015
African Journals Online (AJOL)
Items 51 - 100 of 263 ... ... Social Stability: A Case of Umuada Burial Performance, Abstract PDF ... Learning, Cultural Education and Social Advocacy: An Appraisal, Abstract PDF ... Vol 18, No 2 (2017): Special Edition, Gender Inequality and its ...
Nová zjištění z prostoru zaniklé tvrze v Bernarticích na Písecku
Czech Academy of Sciences Publication Activity Database
Dohnal, Martin; Fröhlich, J.; Kovář, D.
2015-01-01
Roč. 28, [1] (2015), s. 263-280 ISSN 0231-8237 R&D Projects: GA ČR(CZ) GAP410/11/1287 Keywords : Bernartice * fortified house * archeological finds * mezza majolica * Jesuits Subject RIV: AC - Archeology, Anthropology, Ethnology
short communication infrared and ultraviolet spectrophotometric
African Journals Online (AJOL)
a
petroleum distillate into acid, base, neutral, saturate and aromatic fractions while Hirsh et al. [9] ... 100% n-hexane 5% Benzene + 15% benzene + benzene, ether and .... Model compounds: toluene 254 nm, o-xylene 263 nm, aniline 230 nm, ...
Research Facilities for Solar Astronomy at ARIES P. Pant
Indian Academy of Sciences (India)
Aryabhatta Research Institute of Observational Sciences (ARIES), Manora Peak,. Nainital 263 129 .... station-20 computer, a GPS clock for accurate timing, etc. The various CCD ... circulation unit is used for cooling the camera head up to −25.
OPTICAL CONSTANTS AND LAB SPECTRA OF WATER ICE V1.0
National Aeronautics and Space Administration — Transmission spectra of amorphous and crystalline H2O-ice at temperatures from 20-150 K for a wavelength range from 1.11 to 2.63 microns. These spectra have not been...
OPTICAL CONSTANTS AND LAB SPECTRA OF WATER ICE V1.1
National Aeronautics and Space Administration — Transmission spectra of amorphous and crystalline H2O-ice at temperatures from 20-150 K for a wavelength range from 1.11 to 2.63 microns. These spectra have not been...
Czech Academy of Sciences Publication Activity Database
Vajtr, D.; Benada, Oldřich; Kukačka, J.; Průša, R.; Houšťava, L.; Toupalík, P.; Kizek, R.
2009-01-01
Roč. 58, č. 2 (2009), s. 263-268 ISSN 0862-8408 Institutional research plan: CEZ:AV0Z50200510 Keywords : Blood brain barrier * Expansive contusion * Metalloproteinases Subject RIV: EE - Microbiology, Virology Impact factor: 1.430, year: 2009
Cyclotron targets and production technologies used for radiopharmaceuticals in NPI
Czech Academy of Sciences Publication Activity Database
Fišer, Miroslav; Kopička, Karel; Hradilek, Pavel; Hanč, Petr; Lebeda, Ondřej; Panek, T.; Vognar, M.
2003-01-01
Roč. 53, č. 2 (2003), s. A737-A743 ISSN 0011-4626 R&D Projects: GA AV ČR KSK4055109 Keywords : cyclotron * radiopharmaceuticals Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 0.263, year: 2003
Research Article Special Issue
African Journals Online (AJOL)
pc
2018-02-24
Feb 24, 2018 ... college students of Surigao del Sur State University in Cantilan, the northernmost municipality in ... their children. It is therefore critical that young individuals begin to learn about ..... I watch movies or entertainment shows. 2.63.
Alternative strategy for converting an inverting glycoside hydrolase into a glycosynthase.
Honda, Yuji; Fushinobu, Shinya; Hidaka, Masafumi; Wakagi, Takayoshi; Shoun, Hirofumi; Taniguchi, Hajime; Kitaoka, Motomitsu
2008-04-01
The tyrosine residue Y198 is known to support a nucleophilic water molecule with the general base residue, D263, in the reducing-end xylose-releasing exo-oligoxylanase (Rex). A mutation in the tyrosine residue changing it into phenylalanine caused a drastic decrease in the hydrolytic activity and a small increase in the F(-) releasing activity from alpha-xylobiosyl fluoride in the presence of xylose. In contrast, mutations at D263 resulted in the decreased F(-) releasing activity. As a result of the high F(-) releasing activity and low hydrolytic activity, Y198F of Rex accumulates a large amount of product during the glycosynthase reaction. We propose a novel method for producing a glycosynthase from an inverting glycoside hydrolase by mutating a residue that holds the nucleophilic water molecule with the general base residue while keeping the general base residue intact.
Shah, O Jameel; Lin, Xiaoyu; Li, Leiming; Huang, Xiaoli; Li, Junling; Anderson, Mark G; Tang, Hua; Rodriguez, Luis E; Warder, Scott E; McLoughlin, Shaun; Chen, Jun; Palma, Joann; Glaser, Keith B; Donawho, Cherrie K; Fesik, Stephen W; Shen, Yu
2010-07-13
Aurora kinase B inhibitors induce apoptosis secondary to polyploidization and have entered clinical trials as an emerging class of neocytotoxic chemotherapeutics. We demonstrate here that polyploidization neutralizes Mcl-1 function, rendering cancer cells exquisitely dependent on Bcl-XL/-2. This "addiction" can be exploited therapeutically by combining aurora kinase inhibitors and the orally bioavailable BH3 mimetic, ABT-263, which inhibits Bcl-XL, Bcl-2, and Bcl-w. The combination of ABT-263 with aurora B inhibitors produces a synergistic loss of viability in a range of cell lines of divergent tumor origin and exhibits more sustained tumor growth inhibition in vivo compared with aurora B inhibitor monotherapy. These data demonstrate that Bcl-XL/-2 is necessary to support viability during polyploidization in a variety of tumor models and represents a druggable molecular vulnerability with potential therapeutic utility.
Renal and perirenal non-Hodgkin's lymphoma: CT findings
International Nuclear Information System (INIS)
Lee, Seon Kyu; Kim, Seung Hyup; Lee, Goo; Choi, Byeung In; Han, Man Chung
1992-01-01
CT findings of 19 kidneys in 12 patients with renal and perirenal non-Hodgkin's lymphoma were retrospectively reviewed to determine distinguishing characteristic and specific findings. CT manifestation of the renal and perirenal lymphoma included multiple nodules in five kidneys(26.3%), trans-capsular infiltration in three kidneys(15.8%), trans-sinus infiltration in nine kidneys(47.4%) and diffuse infiltration in two kidneys(10.5%). Perirenal changes were thickening of the renal fascia in ten kidneys(52.6%) and crescent lesion of low attenuation in the subcapsular area in five kidneys(26.3%) Retroperitoneal lymphadenopathy was evident in eleven patient(57.9%). Renal calyceal dilatation without renal pelvic dilatation(selective calycelal dilatation) was noted in three kidneys. Familiarity with these CT findings of renal and perirenal lymphoma may be helpful in the diagnosis and management of patient with non-Hodgkin's lymphoma
Czech Academy of Sciences Publication Activity Database
McCullough, L. E.; Eng, S. M.; Bradshaw, P. T.; Cleveland, R. J.; Steck, S. E.; Terry, M. B.; Shen, J.; Crew, K.D.; Rössner ml., Pavel; Ahn, J.; Ambrosone, Ch.B.; Teitelbaum, S. L.; Neugut, A. I.; Santella, R. M.; Gammon, M. D.
2015-01-01
Roč. 25, č. 4 (2015), s. 263-269 ISSN 1047-2797 Institutional support: RVO:68378041 Keywords : breast cancer * body mass index * oxidative stress * DNA repair * Epidemiology Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.335, year: 2015
12 CFR 225.6 - Penalties for violations.
2010-01-01
... Act or any regulation or order issued under it, or for making a false entry in any book, report, or... be made in accordance with subpart C of the Board's Rules of Practice for Hearings (12 CFR part 263...
29 CFR 1910.6 - Incorporation by reference.
2010-07-01
... Test for Distillation of Petroleum Products, IBR approved for §§ 1910.106(a)(5) and 1910.119(b... of Pulverized Sugar and Cocoa, IBR approved for § 1910.263(k)(2)(i). (15) NFPA 68-1954 Guide for...
Knowledge and attitude of primary health care staff screening and ...
African Journals Online (AJOL)
Husniyah D. Qasem
2012-08-23
Aug 23, 2012 ... Attitude and knowledge of the primary health care ... ference was the psychological sub-domain (78.4 ± 20.3 compared with 69.4 ± 26.3%, P = 0.004). ... depression, posttraumatic stress disorder, and substance abuse.
What to Expect During a Colonoscopy
Full Text Available ... available for interviews upon request. Please call the Communications Team at 301-263-9000 or e-mail ... Media Patients Patient Resource Center GI Health and Disease Recursos en Español What is a Gastroenterologist? Video ...
Should one be a left or a right Sellarsian? (And is there really such a choice?)
Czech Academy of Sciences Publication Activity Database
Peregrin, Jaroslav
2016-01-01
Roč. 47, č. 2 (2016), s. 251-263 ISSN 0026-1068 R&D Projects: GA ČR GA13-20785S Institutional support: RVO:67985955 Keywords : Sellars * normativity * ontology * translation * first-person perspective Subject RIV: AA - Philosophy ; Religion
Molecular and biochemical toxicology
National Research Council Canada - National Science Library
Smart, Robert C; Hodgson, Ernest
2008-01-01
... Expression and Regulation 2.6.1 Northern Analysis 2.6.2 Nuclear Run-On 2.6.3 Promoter Deletion Analysis/Reporter Gene Assays 2.6.4 Microarrays 2.6.5 Reverse Transcriptase-PCR (RT-PCR) and Real-Time P...
disaster preparedness in secondary schools in ruiru division ...
African Journals Online (AJOL)
2014-11-11
Nov 11, 2014 ... EAsT AFRICAN MEDICAL JOURNAL. November 2014 ... Results: The respondents did not know how to use the first aid kit elements ( = 835.263, p = 0.000, df =1). ... A good disaster and emergency response is merely an ...
Kruhatka Matthiolova (Cortusa matthioli) v Sudetech aneb anti-Hendrych
Czech Academy of Sciences Publication Activity Database
Danihelka, Jiří
2012-01-01
Roč. 46, č. 2 (2012), s. 251-263 ISSN 1211-5258 R&D Projects: GA MŠk LC06073 Institutional research plan: CEZ:AV0Z60050516 Keywords : Central Europe * C. Schwenckfelt * history of botany Subject RIV: EF - Botanics
Effect of enzyme/substrate ratio on the antioxidant properties of ...
African Journals Online (AJOL)
Dr (Mrs) O.Fasasi
2012-06-21
Jun 21, 2012 ... Department of Food Science and Technology, P. M. B. 704, Federal University of Technology, ... of East Africa and it is cultivated for both its seeds and ..... inhibit lipid oxidation in cooked pork patties, Meat Sci., 64: 259-263.
Landscape level analysis of disturbance regimes in protected areas ...
Indian Academy of Sciences (India)
G B Pant Institute of Himalayan Environment and Development, Almora 263 643, Uttarakhand, India. ... level assessment of fragmentation and disturbance index in protected areas of Rajasthan using remote ..... anthropogenic/natural forces on the landscape was ..... Environmental Research, Engineering and Management.
Optical replication techniques for image slicers
Czech Academy of Sciences Publication Activity Database
Schmoll, J.; Robertson, D.J.; Dubbeldam, C.M.; Bortoletto, F.; Pína, L.; Hudec, René; Prieto, E.; Norrie, C.; Ramsay- Howat, S.
2006-01-01
Roč. 50, 4-5 (2006), s. 263-266 ISSN 1387-6473 Institutional research plan: CEZ:AV0Z10030501 Keywords : smart focal planes * image slicers * replication Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 1.914, year: 2006
Blood parasites in northern goshawk (Accipiter gentilis) with an emphasis to Leucocytozoon toddi
Czech Academy of Sciences Publication Activity Database
Hanel, J.; Doležalová, J.; Stehlíková, Š.; Modrý, David; Chudoba, J.; Synek, P.; Votýpka, Jan
2016-01-01
Roč. 115, č. 1 (2016), s. 263-270 ISSN 0932-0113 Institutional support: RVO:60077344 Keywords : avian blood parasites * Haemosporida * Trypanosoma * PCR detection * birds of prey * raptors * mixed infection Subject RIV: EG - Zoology Impact factor: 2.329, year: 2016
Tropical Journal of Pharmaceutical Research - Vol 16, No 2 (2017)
African Journals Online (AJOL)
Biosynthesis of lovastatin using agro-industrial wastes as carrier substrates · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Sadia Javed, Munazzah Meraj, Saqib Mahmood, Arruje Hameed, Farah Naz, Sameera Hassan, Rao Irfan, 263-269.
Fen Bilimlerinde ve Beşeri bilimlerde öykülerin rolü
Czech Academy of Sciences Publication Activity Database
Sládek, Ondřej; Dervişcemaloğlu, B.
2011-01-01
Roč. 2011, č. 20 (2011), s. 263-272 ISSN 1300-5715 R&D Projects: GA ČR GAP406/10/1911 Institutional research plan: CEZ:AV0Z90560517 Keywords : narrative * science * humanities Subject RIV: AJ - Letters, Mass-media, Audiovision
Czech Academy of Sciences Publication Activity Database
Aremu, A.O.; Masondo, N.A.; Sunmonu, T.O.; Kulkarni, M. G.; Zatloukal, Marek; Spíchal, Lukáš; Doležal, Karel; van Staden, J.
2014-01-01
Roč. 240, č. 4 (2014), s. 877-889 ISSN 0032-0935 R&D Projects: GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : Antioxidant * Cytokinins * Chlorophyll Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.263, year: 2014
Nuclear Structures Surrounding Internal Lamin Invaginations
Czech Academy of Sciences Publication Activity Database
Legartová, Soňa; Stixová, Lenka; Laur, O.; Kozubek, Stanislav; Sehnalová, Petra; Bártová, Eva
2014-01-01
Roč. 115, č. 3 (2014), s. 476-487 ISSN 0730-2312 R&D Projects: GA MŠk(CZ) LD11020 Institutional support: RVO:68081707 Keywords : LAMINS * NUCLEAR PORES * CHROMATIN Subject RIV: BO - Biophysics Impact factor: 3.263, year: 2014
Industrial-scale process control by means of electrostatics probes
Czech Academy of Sciences Publication Activity Database
Špatenka, P.; Brunnhofer, Václav; Krumeich, J.; Blažek, J.; Šerý, M.; Endres, H. J.; Cook, R.
2001-01-01
Roč. 5, - (2001), s. 255-263 ISSN 1084-0184 R&D Projects: GA ČR GA202/00/1592; GA MŠk OC 527.60 Institutional research plan: CEZ:AV0Z5007907 Subject RIV: CI - Industrial Chemistry, Chemical Engineering
Indian Academy of Sciences (India)
systems. 855 see Sethia Gautam C. 905. Avar Baris see Gö˘gebakan Musa. 735 ... Berijani I M see Bahrami B Salim. 263 ... isochronous systems. 917 ... tallization of ZnO nanoparticles. 679 .... ing on the hole and electron injection materials.
Champagne for the cryogenics teams
2005-01-01
Christmas has come early for the LHC as a complete sector of the cryogenic distribution line has been operating at 10 degrees Kelvin (-263°C) for the past two weeks, just a few degrees above the machine's nominal operating temperature.
Directory of Open Access Journals (Sweden)
Karen Amaral do Vabo
2004-06-01
Full Text Available OBJETIVO: Apresentar os achados ultra-sonográficos abdominais em pacientes com dengue e compará-los aos descritos na literatura. MATERIAIS E MÉTODOS: Foram realizados exames ultra-sonográficos abdominais de 38 pacientes, 25 do sexo feminino e 13 do sexo masculino, com idade média de 35 anos, com diagnóstico de dengue sorologicamente confirmado. Os achados foram comparados com os descritos na literatura. RESULTADOS: Os achados ultra-sonográficos mais relevantes foram espessamento difuso da parede da vesícula biliar em 18 casos (47,4%, líquido livre na cavidade abdominal e/ou pélvica em 12 (31,6%, esplenomegalia em 11 (28,9%, hepatomegalia em 10 (26,3% e líquido pericolecístico em 10 (26,3%. Vinte e seis por cento dos pacientes apresentaram exames ultra-sonográficos normais. CONCLUSÃO: Os achados ultra-sonográficos abdominais são uma ferramenta adicional útil na confirmação de casos suspeitos de dengue hemorrágica e na detecção precoce da gravidade e da progressão da doença, sendo de extrema importância para o radiologista o conhecimento destes possíveis achados.OBJECTIVE: To review the abdominal ultrasound findings in patients with serologically proven dengue fever and to compare the results with data from the literature. MATERIALS AND METHODS: Thirty-eight patients with serologically proven dengue fever, 25 female and 13 male, mean age of 35 years, were submitted to abdominal ultrasound. The ultrasound findings were compared with data from the literature. RESULTS: The most relevant ultrasound findings were diffuse gallbladder wall thickening in 18 cases (47.4%, abdominal and/or pelvic free fluid in 12 (31.6%, splenomegaly in 11 (28.9%, hepatomegaly in 10 (26.3% and perivesicular fluid in 10 (26.3%. Twenty-six percent of the patients had normal abdominal ultrasound. CONCLUSION: Abdominal sonography is a useful additional diagnostic tool for the confirmation of suspected cases of dengue hemorrhagic fever and for the
Fish diversity in the Niokolo Koba National Park, middle Gambia River basin, Senegal
Czech Academy of Sciences Publication Activity Database
Blažek, Radim; Ondračková, Markéta; Vošlajerová Bímová, Barbora; Vetešník, Lukáš; Petrášová, Ivona; Reichard, Martin
2012-01-01
Roč. 23, č. 3 (2012), s. 263-272 ISSN 0936-9902 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:68081766 Keywords : West Africa * estuary * assemblages Subject RIV: EH - Ecology, Behaviour Impact factor: 1.648, year: 2012
South African Neurosurgical Patient Management Survey
African Journals Online (AJOL)
Adele
cluding subarachnoid haemorrhage (SAH), traumatic brain injuries (TBI) ... Number. Percentage. <1960. 1. 2.6%. 1960-69. 3. 7.9%. 1970-79. 10. 26.3%. 1980-89. 7. 18.4% ... to Aneurysm surgery with particular reference to the use of early and ...
2007-08-01
individual players to take: Productions Meaning of predicates DIRECTIVE → (do PLAYER ACTION) PLAYER should take ACTION. DIRECTIVE → ( dont PLAYER...Computational Lin- guistics (COLING-ACL-2006), Poster Sessions, pp. 263–270. Sydney, Australia. 170 Daniel Gildea and Daniel Jurafsky (2002
DEFF Research Database (Denmark)
Westh, Lena; Mogensen, Trine Hyrup; Dalgaard, Lars Skov
2017-01-01
infections were seen in 92.7% of the patients. The prevalence of non-infectious complications was similar to that of previously reported cohorts: bronchiectasis (35.8%), splenomegaly (22.4%), lymphadenopathy (26.3%), granulomatous inflammation (3.9%) and idiopathic thrombocytopenic purpura (14.5%). Non...
Structural study of a novel antimicrobial peptide isolated from the venom of bee Anthophora plumipes
Czech Academy of Sciences Publication Activity Database
Čujová, Sabína; Veverka, Václav; Buděšínský, Miloš; Bednárová, Lucie; Čeřovský, Václav
2014-01-01
Roč. 20, Suppl S1 (2014), S263-S264 ISSN 1075-2617. [European Peptide Symposium /33./. 31.08.2014-05.09.2014, Sofia] Institutional support: RVO:61388963 Keywords : antimicrobial peptides * membranes * CD-spectroscopy * NMR spectroscopy Subject RIV: CC - Organic Chemistry
Journal of Astrophysics and Astronomy | Indian Academy of Sciences
Indian Academy of Sciences (India)
2016-01-27
Jan 27, 2016 ... Author Affiliations. B. Rani1 Alok C. Gupta1 Paul J. Wiita2. Aryabhatta Research Institute of Observational Sciences (ARIES), Nainital 263 129, India. Department of Physics, The College of New Jersey, P.O. Box 7718, Ewing, NJ 08628, USA.
alpha-Tocopheryl succinate inhibits angiogenesis by disrupting paracrine FGF2 signalling
Czech Academy of Sciences Publication Activity Database
Neužil, Jiří; Swettenham, E.; Wang, X.F.; Dong, L.F.; Stapelberg, M.
2007-01-01
Roč. 581, č. 24 (2007), s. 4611-4615 ISSN 0014-5793 Institutional research plan: CEZ:AV0Z50520514; CEZ:AV0Z50520701 Keywords : mitocans * proliferating endothelial cells * apoptosis Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.263, year: 2007
Geofyzikální výzkum tvaru vulkanických těles v oblasti mezi Jičínem a Turnovem (Český ráj)
Czech Academy of Sciences Publication Activity Database
Rapprich, V.; Skácelová, Z.; Valenta, Jan
2011-01-01
Roč. 44, - (2011), s. 263-266 ISSN 0514-8057 Institutional research plan: CEZ:AV0Z30460519 Keywords : magnetic survey * gravity survey * basanite Subject RIV: DC - Siesmology, Volcanology, Earth Structure http://www.geology.cz/zpravy/obsah/2010/zpravy-2010-56.pdf
Discovery of SM Higgs Boson in ATLAS Experiment
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 18; Issue 3. Discovery of SM Higgs Boson in ATLAS Experiment. Prafulla Kumar Behera. General Article Volume 18 Issue 3 March 2013 pp 248-263. Fulltext. Click here to view fulltext PDF. Permanent link:
ORF Alignment: NC_003318 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003318 gi|17988654 >1v7zA 9 254 21 263 2e-44 ... ref|NP_541287.1| creatininase [Br...ucella melitensis 16M] gb|AAL53551.1| creatininase ... [Brucella melitensis 16M] pir||AD3548 creatini
Malakostratigrafie pěnitcového převisu V Balnom v Národním parku Nízké Tatry
Czech Academy of Sciences Publication Activity Database
Ložek, Vojen
2013-01-01
Roč. 2012, Prosinec (2013), s. 263-265 ISSN 0514-8057 Institutional support: RVO:67985831 Keywords : Holocene * rock shelter * foam sinter * molluscan succession * Low Tatra Mts. Subject RIV: DB - Geology ; Mineralogy http://www.geology.cz/zpravy/obsah/2012/Zpravy_2012-53.pdf
Czech Academy of Sciences Publication Activity Database
Horský, Jiří; Walterová, Zuzana
2016-01-01
Roč. 74, January (2016), s. 256-263 ISSN 0014-3057 Grant - others:OPPK(XE) CZ.2.16/3.1.00/24504 Institutional support: RVO:61389013 Keywords : polypseudorotaxanes * reverse pluronics * cyclodextrin Subject RIV: CD - Macromolecular Chemistry Impact factor: 3.531, year: 2016
Quo vadis plant hormone analysis?
Czech Academy of Sciences Publication Activity Database
Tarkowská, Danuše; Novák, Ondřej; Floková, Kristýna; Tarkowski, P.; Turečková, Veronika; Grúz, Jiří; Rolčík, Jakub; Strnad, Miroslav
2014-01-01
Roč. 240, č. 1 (2014), s. 55-76 ISSN 0032-0935 R&D Projects: GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : Plant hormones * Extraction * Mass spectrometr Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.263, year: 2014
2014-06-01
bombers 2,263 716 Tactical bombers 1,251 723 Fighters 3,456 1,897 Transporters 849 545 Naval aviation Land-based aircraft 204...ASEAN) is comprised of ten member states: Brunei Darussalam, Cambodia, Indonesia, Lao PDR, Malaysia, Myanmar , Philippines, Singapore, Thailand, and
75 FR 80746 - Interpretation of Rest Requirements
2010-12-23
... Whitlow Letter in its interpretations of section 121.471(g). See Air Transport Ass'n of America, Inc. v. F... 121.471(g) and 135.263(d) is interpreted in two different ways. See Air Transport Ass'n, 291 F.3d at...
Contribution to the knowledge of ptyctimous mites (Acari: Oribatida) from Madagascar
Czech Academy of Sciences Publication Activity Database
Niedbala, W.; Starý, Josef
2013-01-01
Roč. 59, č. 4 (2013), s. 337-345 ISSN 1217-8837 Institutional research plan: CEZ:AV0Z60660521 Institutional support: RVO:60077344 Keywords : oribatid mites * new species * Mahunka * Phthiracaroidea * Euphthiracaroidea Subject RIV: EG - Zoology Impact factor: 0.263, year: 2013
2011-09-26
... submitting comments. Mail: Rich Malinowski, Southeast Regional Office, NMFS, 263 13th Avenue South, St... http://sero.nmfs.noaa.gov . FOR FURTHER INFORMATION CONTACT: Rich Malinowski, telephone: 727-824- 5305, or e-mail: rich.malinowski@noaa.gov . SUPPLEMENTARY INFORMATION: The Magnuson-Stevens Fishery...
Advancing the Science of Team Science
Falk‐Krzesinski, Holly J.; Börner, Katy; Contractor, Noshir; Fiore, Stephen M.; Hall, Kara L.; Keyton, Joann; Spring, Bonnie; Stokols, Daniel; Trochim, William; Uzzi, Brian
2010-01-01
Abstract The First Annual International Science of Team Science (SciTS) Conference was held in Chicago, IL April 22–24, 2010. This article presents a summary of the Conference proceedings. Clin Trans Sci 2010; Volume 3: 263–266. PMID:20973925
DEFF Research Database (Denmark)
Yao, Zhilei; Deng, Lijuan; Xu-Monette, Z Y
2018-01-01
In diffuse large B-cell lymphoma (DLBCL), the clinical and biological significance of concordant and discordant bone marrow (BM) involvement have not been well investigated. We evaluated 712 de novo DLBCL patients with front-line rituximab-containing treatment, including 263 patients with positiv...
Czech Academy of Sciences Publication Activity Database
Garsia-Sancho, J.; Verkhratsky, Alexei
2008-01-01
Roč. 192, č. 2 (2008), s. 263-271 ISSN 1748-1708 Institutional research plan: CEZ:AV0Z50390512 Keywords : Ca2+ signalling * calcium microdomains * chromaffin cells Subject RIV: JE - Non-nuclear Energetics, Energy Consumption ; Use Impact factor: 2.455, year: 2008
2011-05-31
..., supporting statements and approved collection of information instrument(s) are placed into OMB's public...). Telecommunications Device for the Deaf (TDD) users may contact (202-263-4869), Board of Governors of the Federal... notification, event-generated. Reporters: Financial institutions. Estimated annual reporting hours: Develop...
2012-11-29
... Paperwork Reduction Act Submission, supporting statements and approved collection of information instrument... (202) 452-3829. Telecommunications Device for the Deaf (TDD) users may contact (202) 263-4869, Board of...: 7100-0297), which included requiring nonbank financial companies supervised by the Federal Reserve and...
Facile Synthesis of Polyaniline Nanotubes with Square Capillary Using Urea as Template
Directory of Open Access Journals (Sweden)
Shuhua Pang
2017-10-01
Full Text Available Polyaniline nanotubes were successfully synthesized by a facile in situ chemical oxidative polymerization method using urea as soft template. When the urea/aniline molar ratio is 3:1, the as-prepared nanotubular polyaniline (PANI-3 shows regular and uniform square capillaries, which provides a high electrode/electrolyte contact, easy ion diffusion and enhanced electroactive regions during the electrochemical process, leading to weak internal resistance and improved electrochemical performance. The PANI-3 sample exhibits a high specific capacitance of 405 F/g at current density of 0.2 A/g, and PANI only has a specific capacitance of 263 F/g. At current density of 1 A/g, the capacitance of PANI-3 is still 263 F/g (64.9% of the capacitance at 0.2 A/g. Such a PANI-3 nanotube, with regular and uniform capillary, is a promising electrode material for high-performance supercapacitors.
Directory of Open Access Journals (Sweden)
Florinda O. BOBBIO
2000-12-01
Full Text Available Do extrato aquoso, congelado e liofilizado dos frutos do açaizeiro, foram extraídas as antocianinas e após purificação e separação das duas principais frações as mesmas foram identificadas usando métodos químicos, espectroscópicos e CLAE. As antocianinas foram identificadas como cianidina-3- arabinosídeo e cianidina-3-arabinosil-arabinosídeo. O teor de antocianinas totais no caso do fruto do açaizeiro foi determinado e o valor encontrado foi de 263mg/100g casca.From the liophylized commercialy frozen extract of the fruit of Euterpes oleracea (açaí two anthocyanins were isolated and identified as cianidin-3-arabinoside and cyanidin-3-arabinosylarabinoside. The percentage of total anthocyanins in the peels of the fruits was 263 mg/100g peel.
X-linked Acrogigantism (X-LAG) Syndrome: Clinical Profile and Therapeutic Responses
Beckers, Albert; Lodish, Maya Beth; Trivellin, Giampaolo; Rostomyan, Liliya; Lee, Misu; Faucz, Fabio R; Yuan, Bo; Choong, Catherine S; Caberg, Jean-Hubert; Verrua, Elisa; Naves, Luciana Ansaneli; Cheetham, Tim D; Young, Jacques; Lysy, Philippe A; Petrossians, Patrick; Cotterill, Andrew; Shah, Nalini Samir; Metzger, Daniel; Castermans, Emilie; Ambrosio, Maria Rosaria; Villa, Chiara; Strebkova, Natalia; Mazerkina, Nadia; Gaillard, Stéphan; Barra, Gustavo Barcelos; Casulari, Luis Augusto; Neggers, Sebastian J.; Salvatori, Roberto; Jaffrain-Rea, Marie-Lise; Zacharin, Margaret; Santamaria, Beatriz Lecumberri; Zacharieva, Sabina; Lim, Ee Mun; Mantovani, Giovanna; Zatelli, Maria Chaira; Collins, Michael T; Bonneville, Jean-François; Quezado, Martha; Chittiboina, Prashant; Oldfield, Edward H.; Bours, Vincent; Liu, Pengfei; De Herder, Wouter; Pellegata, Natalia; Lupski, James R.; Daly, Adrian F.; Stratakis, Constantine A.
2015-01-01
X-linked acro-gigantism (X-LAG) is a new syndrome of pituitary gigantism, caused by microduplications on chromosome Xq26.3, encompassing the gene GPR101, which is highly upregulated in pituitary tumors. We conducted this study to explore the clinical, radiological and hormonal phenotype and responses to therapy in patients with X-LAG syndrome. The study included 18 patients (13 sporadic) with X-LAG and a microduplication in chromosome Xq26.3. All sporadic cases had unique duplications and the inheritance pattern in 2 families was dominant with all Xq26.3 duplication carriers being affected. Patients began to grow rapidly as early as 2–3 months of age (median 12 months). At diagnosis (median delay 27 months), patients had a median height and weight SDS score of >+3.9 SDS. Apart from the increased overall body size, the children had acromegalic symptoms including acral enlargement and facial coarsening. More than a third of cases had increased appetite. Patients had marked hypersecretion of GH/IGF-1 and prolactin, usually due to a pituitary macroadenoma or hyperplasia. Primary neurosurgical control was achieved with extensive anterior pituitary resection but postoperative hypopituitarism was frequent. Control with somatostatin analogs was not readily achieved despite moderate to high somatostatin receptor subtype-2 expression in tumor tissue. Postoperative adjuvant pegvisomant achieved control of IGF-1 all 5 cases in which it was employed. X-LAG is a new infant-onset gigantism syndrome that has a severe clinical phenotype leading to challenging disease management. PMID:25712922
Directory of Open Access Journals (Sweden)
Matthew L Faron
Full Text Available The prompt and accurate identification of bacterial pathogens is fundamental to patient health and outcome. Recent advances in matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOF MS have revolutionized bacterial identification in the clinical laboratory, but uniform incorporation of this technology in the U.S. market has been delayed by a lack of FDA-cleared systems. In this study, we conducted a multicenter evaluation of the MALDI Biotyper CA (MBT-CA System (Bruker Daltonics Inc, Billerica, MA for the identification of aerobic gram-negative bacteria as part of a 510(k submission to the FDA. A total of 2,263 aerobic gram negative bacterial isolates were tested representing 23 genera and 61 species. Isolates were collected from various clinical sources and results obtained from the MBT-CA System were compared to DNA sequencing and/or biochemical testing. Isolates that failed to report as a "high confidence species ID" [log(score ≥2.00] were re-tested using an extraction method. The MBT-CA System identified 96.8% and 3.1% of isolates with either a "high confidence" or a "low confidence" [log(score value between 1.70 and <2.00] species ID, respectively. Two isolates did not produce acceptable confidence scores after extraction. The MBT-CA System correctly identified 99.8% (2,258/2,263 to genus and 98.2% (2,222/2,263 to species level. These data demonstrate that the MBT-CA System provides accurate results for the identification of aerobic gram-negative bacteria.
Faron, Matthew L; Buchan, Blake W; Hyke, Josh; Madisen, Neil; Lillie, Jennifer L; Granato, Paul A; Wilson, Deborah A; Procop, Gary W; Novak-Weekley, Susan; Marlowe, Elizabeth; Cumpio, Joven; Griego-Fullbright, Christen; Kindig, Sandra; Timm, Karen; Young, Stephen; Ledeboer, Nathan A
2015-01-01
The prompt and accurate identification of bacterial pathogens is fundamental to patient health and outcome. Recent advances in matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOF MS) have revolutionized bacterial identification in the clinical laboratory, but uniform incorporation of this technology in the U.S. market has been delayed by a lack of FDA-cleared systems. In this study, we conducted a multicenter evaluation of the MALDI Biotyper CA (MBT-CA) System (Bruker Daltonics Inc, Billerica, MA) for the identification of aerobic gram-negative bacteria as part of a 510(k) submission to the FDA. A total of 2,263 aerobic gram negative bacterial isolates were tested representing 23 genera and 61 species. Isolates were collected from various clinical sources and results obtained from the MBT-CA System were compared to DNA sequencing and/or biochemical testing. Isolates that failed to report as a "high confidence species ID" [log(score) ≥2.00] were re-tested using an extraction method. The MBT-CA System identified 96.8% and 3.1% of isolates with either a "high confidence" or a "low confidence" [log(score) value between 1.70 and <2.00] species ID, respectively. Two isolates did not produce acceptable confidence scores after extraction. The MBT-CA System correctly identified 99.8% (2,258/2,263) to genus and 98.2% (2,222/2,263) to species level. These data demonstrate that the MBT-CA System provides accurate results for the identification of aerobic gram-negative bacteria.
X-linked acrogigantism syndrome: clinical profile and therapeutic responses.
Beckers, Albert; Lodish, Maya Beth; Trivellin, Giampaolo; Rostomyan, Liliya; Lee, Misu; Faucz, Fabio R; Yuan, Bo; Choong, Catherine S; Caberg, Jean-Hubert; Verrua, Elisa; Naves, Luciana Ansaneli; Cheetham, Tim D; Young, Jacques; Lysy, Philippe A; Petrossians, Patrick; Cotterill, Andrew; Shah, Nalini Samir; Metzger, Daniel; Castermans, Emilie; Ambrosio, Maria Rosaria; Villa, Chiara; Strebkova, Natalia; Mazerkina, Nadia; Gaillard, Stéphan; Barra, Gustavo Barcelos; Casulari, Luis Augusto; Neggers, Sebastian J; Salvatori, Roberto; Jaffrain-Rea, Marie-Lise; Zacharin, Margaret; Santamaria, Beatriz Lecumberri; Zacharieva, Sabina; Lim, Ee Mun; Mantovani, Giovanna; Zatelli, Maria Chaira; Collins, Michael T; Bonneville, Jean-François; Quezado, Martha; Chittiboina, Prashant; Oldfield, Edward H; Bours, Vincent; Liu, Pengfei; W de Herder, Wouter; Pellegata, Natalia; Lupski, James R; Daly, Adrian F; Stratakis, Constantine A
2015-06-01
X-linked acrogigantism (X-LAG) is a new syndrome of pituitary gigantism, caused by microduplications on chromosome Xq26.3, encompassing the gene GPR101, which is highly upregulated in pituitary tumors. We conducted this study to explore the clinical, radiological, and hormonal phenotype and responses to therapy in patients with X-LAG syndrome. The study included 18 patients (13 sporadic) with X-LAG and microduplication of chromosome Xq26.3. All sporadic cases had unique duplications and the inheritance pattern in two families was dominant, with all Xq26.3 duplication carriers being affected. Patients began to grow rapidly as early as 2-3 months of age (median 12 months). At diagnosis (median delay 27 months), patients had a median height and weight standard deviation scores (SDS) of >+3.9 SDS. Apart from the increased overall body size, the children had acromegalic symptoms including acral enlargement and facial coarsening. More than a third of cases had increased appetite. Patients had marked hypersecretion of GH/IGF1 and usually prolactin, due to a pituitary macroadenoma or hyperplasia. Primary neurosurgical control was achieved with extensive anterior pituitary resection, but postoperative hypopituitarism was frequent. Control with somatostatin analogs was not readily achieved despite moderate to high levels of expression of somatostatin receptor subtype-2 in tumor tissue. Postoperative use of adjuvant pegvisomant resulted in control of IGF1 in all five cases where it was employed. X-LAG is a new infant-onset gigantism syndrome that has a severe clinical phenotype leading to challenging disease management. © 2015 Society for Endocrinology.
Czech Academy of Sciences Publication Activity Database
Schwarzerová, K.; Pokorná, J.; Petrášek, Jan; Zelenková, S.; Čapková, Věra; Janotová, I.; Opatrný, Z.
2003-01-01
Roč. 27, - (2003), 263ů265 ISSN 1065-6995 R&D Projects: GA AV ČR IAA5038207 Institutional research plan: CEZ:AV0Z5038910 Keywords : cytoskeletal polymers * tobacco * endomembrane system Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.092, year: 2003
van het Goor, Layo; van Duijnen, Piet Th.; Koper, Carola; Jenneskens, Leonardus W.; Havenith, Remco W. A.; Hartl, Frantisek
2011-01-01
One-electron oxidation of the non-alternant polycyclic aromatic hydrocarbon pleiadiene and related cyclohepta[c,d]pyrene and cyclohepta[c,d]fluoranthene in THF produces corresponding radical cations detectable in the temperature range of 293-263 K only on the subsecond time scale of cyclic
Primary productivity and nitrogen fixation by Trichodesmium spp. in the Arabian Sea
Digital Repository Service at National Institute of Oceanography (India)
Parab, S.G.; Matondkar, S.G.P.
was around 28 degrees C and nitrate content was as low as 0.34 mu M. After the northeast monsoon, Trichodesmium erythraeum developed in the offshore area and then spread to coastal waters. Both species of Trichodesmium together produced a total of 0.263 Tg...
Journal of Biosciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Biosciences. MOSAMI GALVANKAR. Articles written in Journal of Biosciences. Volume 42 Issue 2 June 2017 pp 251-263 Article. Estrogen is essential but not sufficient to induce endometriosis · MOSAMI GALVANKAR NEHA SINGH MODI DEEPAK · More Details Abstract Fulltext PDF.
Czech Academy of Sciences Publication Activity Database
Dimzoski, Bojan; Fortelný, Ivan; Šlouf, Miroslav; Sikora, Antonín; Michálková, Danuše
2013-01-01
Roč. 70, č. 1 (2013), s. 263-275 ISSN 0170-0839 R&D Projects: GA AV ČR IAA200500903 Institutional research plan: CEZ:AV0Z40500505 Keywords : polymer blends * coalescence * morphology evolution Subject RIV: BJ - Thermodynamics Impact factor: 1.491, year: 2013
41 CFR 101-26.301-2 - Issue of used, repaired, and rehabilitated items in serviceable condition.
2010-07-01
... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Issue of used, repaired... and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 26-PROCUREMENT SOURCES AND PROGRAM 26.3-Procurement of GSA Stock Items...
Digital Repository Service at National Institute of Oceanography (India)
Quadros, G.; Sukumaran, S.; Athalye, R.P.
of Bombay, India. Part I: quantification of heavy metal pollution of aquatic sediments and recogni- tion of environmental discriminants. Chem Geol 90:263– 283. doi:10.1016/0009-2541(91)90104-Y Sanders HL, Grassle JF, Hampson GR, Morse LS, Garner Price S...
Czech Academy of Sciences Publication Activity Database
Moravec, František; Taraschewski, H.; Weyl, O.L.F.
2013-01-01
Roč. 85, č. 3 (2013), s. 263-269 ISSN 0165-5752 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Parasitic nematode * Heliconema * South Africa Subject RIV: EA - Cell Biology Impact factor: 1.035, year: 2013
A New Point of View on the Relationship Between Global Solar Irradiation and Sunshine Quantifiers
Czech Academy of Sciences Publication Activity Database
Brabec, Marek; Badescu, V.; Dumitrescu, A.; Paulescu, M.
2016-01-01
Roč. 126, March (2016), s. 252-263 ISSN 0038-092X Institutional support: RVO:67985807 Keywords : global solar irradiation * sunshine quantifiers * sunshine number * Angstrom equation * statistical modeling * regression analysis Subject RIV: BB - Applied Statistics, Operation al Research Impact factor: 4.018, year: 2016
Greater Focus Needed on Alien Plant Impacts in Protected Areas
Czech Academy of Sciences Publication Activity Database
Hulme, P. E.; Pyšek, Petr; Pergl, Jan; Jarošík, Vojtěch; Schaffner, U.; Vila, M.
2014-01-01
Roč. 7, č. 5 (2014), s. 459-466 ISSN 1755-263X R&D Projects: GA ČR(CZ) GAP504/11/1028 Institutional support: RVO:67985939 Keywords : plant invasions * impact * protected areas Subject RIV: EF - Botanics Impact factor: 7.241, year: 2014
Czech Academy of Sciences Publication Activity Database
Plánka, L.; Nečas, A.; Gál, P.; Kecová, H.; Filová, Eva; Křen, L.; Kroupa, P.
2007-01-01
Roč. 76, - (2007), s. 253-263 ISSN 0001-7213 R&D Projects: GA MŠk 2B06130 Institutional research plan: CEZ:AV0Z50390512 Keywords : Growth plate injury * Physis * Growth arrest Subject RIV: FI - Traumatology, Orthopedics Impact factor: 0.687, year: 2007
Separation of Azeotropic Mixture Acetone + Hexane by Using Polydimethylsiloxane Membrane.
Czech Academy of Sciences Publication Activity Database
Randová, A.; Bartovská, L.; Kačírková, Marie; Ledesma, Oscar Iván Hernández; Červenková Šťastná, Lucie; Izák, Pavel; Žitková, Andrea; Friess, K.
2016-01-01
Roč. 170, OCT 1 (2016), s. 256-263 ISSN 1383-5866 R&D Projects: GA MŠk(CZ) LD14094 Institutional support: RVO:67985858 Keywords : azeotropic mixture * PDMS membrane * pervaporation Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 3.359, year: 2016
Czech Academy of Sciences Publication Activity Database
Mihulka, Stanislav; Pyšek, Petr; Pyšek, A.
2003-01-01
Roč. 75, - (2003), s. 263-270 ISSN 0032-7786 R&D Projects: GA AV ČR KSK6005114; GA ČR GA206/99/1239 Institutional research plan: CEZ:AV0Z6005908 Keywords : alien plants * casual occurrence * Oenothera Subject RIV: EF - Botanics
The Best and the Rest: Revisiting the Norm of Normality of Individual Performance
O'Boyle, Ernest, Jr.; Aguinis, Herman
2012-01-01
We revisit a long-held assumption in human resource management, organizational behavior, and industrial and organizational psychology that individual performance follows a Gaussian (normal) distribution. We conducted 5 studies involving 198 samples including 633,263 researchers, entertainers, politicians, and amateur and professional athletes.…
Isotope exchange study of the dissociation of metal - humic substance complexes
Czech Academy of Sciences Publication Activity Database
Mizera, J.; Jansová, A.; Hvoždová, I.; Beneš, P.; Novák, František
2003-01-01
Roč. 53, A (2003), s. A97-A101 ISSN 0011-4626 Institutional research plan: CEZ:AV0Z6066911; CEZ:MSM 210000019 Keywords : isotope exchange * dissociation of metal * humic substance complexes Subject RIV: EH - Ecology, Behaviour Impact factor: 0.263, year: 2003
Collagen-lactoferrin fibrillar coatings enhance osteoblast proliferation and differentiation
Czech Academy of Sciences Publication Activity Database
Vandrovcová, Marta; Douglas, T.E.L.; Heinemann, S.; Scharnweber, D.; Dubruel, P.; Bačáková, Lucie
2015-01-01
Roč. 103, č. 2 (2015), s. 525-533 ISSN 1549-3296 R&D Projects: GA ČR(CZ) GBP108/12/G108 Institutional support: RVO:67985823 Keywords : lactoferin * collagen * bone cells Subject RIV: EI - Biotechnology ; Bionics Impact factor: 3.263, year: 2015
The Implications of ISO 9000 and the European Community on the U.S. Construction Industry.
1992-08-01
G.D. Aurbach. 1983. Binding of radioiodinated bovine parathyroid hormone-(1-84) to canine renal cortical membranes. Endocrinology, =1:1303-1312... osteosarcoma cells. J. Biol. Chem., 263:3864-3868. Shurtz-Swirski, R., D. Lewinson, P. Shenzer, H. Mayer, M. Silbermann. 1990. Effects of parathyroid
Simple Calculation Programs for Biology Immunological Methods
Indian Academy of Sciences (India)
First page Back Continue Last page Overview Graphics. Simple Calculation Programs for Biology Immunological Methods. Computation of Ab/Ag Concentration from EISA data. Graphical Method; Raghava et al., 1992, J. Immuno. Methods 153: 263. Determination of affinity of Monoclonal Antibody. Using non-competitive ...
Environmental Assessment for Selected Regions in the Mediterranean Sea
1992-01-01
7-23. Finetti, I. and C. Morelli (1972). Wide scale digital seismic exploration of the Mediterranean Sea. Bollettino Di Geofisica Teorica Applicata 14...291-342. Finetti, I. and C. Morelli (1973). Geophysical exploration of the Mediterranean. Bollettino Di Geofisica Teorica Applicata 15: 263-341
Westhoff, M.H.; Hopman-Rock, M.
2002-01-01
The article describes the dissemination and implementation of the Aging Well and Healthily (AWH) program in the Netherlands. In the period 1997-1999 this process was monitored by means of telephone interviews with 263 participants, 28 peer educators, and 13 organizers. The program participants were
Intertextualita a její podíl na vyjednávání pozic účastníků talk show
Czech Academy of Sciences Publication Activity Database
Čmejrková, Světla; Hoffmannová, Jana
2012-01-01
Roč. 73, č. 4 (2012), s. 263-284 ISSN 0037-7031 R&D Projects: GA ČR GAP406/12/1829 Institutional support: RVO:68378092 Keywords : political discourse * intertextuality * talk shaw * polyphony * irony * parody Subject RIV: AI - Linguistics Impact factor: 0.233, year: 2012
Czech Academy of Sciences Publication Activity Database
Linhartová, Irena; Basler, Marek; Ichikawa, J.; Pelicic, V.; Osička, Radim; Lory, S.; Nassif, X.; Šebo, Peter
2006-01-01
Roč. 263, - (2006), s. 109-118 ISSN 0378-1097 R&D Projects: GA ČR GA310/06/0720 Institutional research plan: CEZ:AV0Z50200510 Keywords : neisseria meningitidis * adherence * signaling Subject RIV: EE - Microbiology, Virology Impact factor: 2.068, year: 2006
Czech Academy of Sciences Publication Activity Database
Kuneš, Jaroslav; Zicha, Josef
2006-01-01
Roč. 111, č. 5 (2006), s. 295-305 ISSN 0143-5221 R&D Projects: GA MZd(CZ) NR7786 Institutional research plan: CEZ:AV0Z50110509 Keywords : developmental window * genetic determinants * environmental stimuli Subject RIV: ED - Physiology Impact factor: 3.263, year: 2006
Czech Academy of Sciences Publication Activity Database
Zavadil, V.; Piálek, Jaroslav
2000-01-01
Roč. 49, č. 3 (2000), s. 263-273 ISSN 0323-0627 R&D Projects: GA MŽP MR/610/1/96; GA MŠk VS97102 Institutional research plan: CEZ:AV0Z6093917 Keywords : genus Triturus * morphological traits Subject RIV: EG - Zoology
2013-10-25
... Rich Malinowski, Southeast Regional Office, NMFS, 263 13th Avenue South, St. Petersburg, FL 33701... [email protected] , or by fax to 202-395-7285. FOR FURTHER INFORMATION CONTACT: Rich Malinowski, Southeast Regional Office, NMFS, telephone 727-824-5305; email: Rich.Malinowski@noaa.gov . SUPPLEMENTARY...
2011-08-19
... be obtained from Rich Malinowski, NMFS, Southeast Regional Office, 263 13th Avenue South, St. Petersburg, FL 33701; telephone: 727-824-5305. FOR FURTHER INFORMATION CONTACT: Rich Malinowski, telephone: 727-824- 5305, e-mail Rich.Malinowski@noaa.gov . SUPPLEMENTARY INFORMATION: The reef fish fishery of...
2011-10-25
.... Mail: Rich Malinowski, Southeast Regional Office, NMFS, 263 13th Avenue South, St. Petersburg, FL 33701... http://sero.nmfs.noaa.gov . FOR FURTHER INFORMATION CONTACT: Rich Malinowski, Southeast Regional Office, NMFS, telephone 727-824-5305; e-mail: Rich.Malinowski@noaa.gov . SUPPLEMENTARY INFORMATION: The...
2013-01-25
... Malinowski, Southeast Regional Office, NMFS, 263 13th Avenue South, St. Petersburg, FL 33701. Instructions... . FOR FURTHER INFORMATION CONTACT: Rich Malinowski, Southeast Regional Office, NMFS, telephone 727-824-5305; email: rich.malinowski@noaa.gov . SUPPLEMENTARY INFORMATION: The reef fish fishery of the Gulf of...
75 FR 12748 - Ocean Transportation Intermediary License Applicants
2010-03-17
... Shipping & Logistics, LLC, 10651 SW. 108 Avenue, 3A, Miami, FL 33176, Officers: Lorenzo A. Macias... Castleton Street, 263, City of Industry, CA 91748, Officers: Hua Yang, Vice President, (Qualifying Individual), Zhenfen Wu, Chairman. Qingfeng Wang dba Global Intertrans Logistics, 200 East Norwood Place, San...
75 FR 29316 - Marine Mammals; File No. 13599
2010-05-25
...; fax (301) 713-0376; and Southeast Region, NMFS, 263 13th Avenue South, Saint Petersburg, Florida 33701... the Chief, Permits, Conservation and Education Division, at the address listed above. Comments may... black abalone (Haliotis cracherodii). In compliance with the National Environmental Policy Act of 1969...
Fatigue evaluation of the increased weight limit on transit railway bridges.
2014-09-01
The recent increase of freight railcar weight limits from 263,000 lbs. to 286,000 lbs. raises concerns for the safety of bridges : on transit passenger rail systems, since they were not designed for this weight increase. Thus, there is a need to asse...
Activity and mechanism of action of insect oostatic peptides in flesh fly
Czech Academy of Sciences Publication Activity Database
Slaninová, Jiřina; Bennettová, Blanka; Nazarov, Elšan; Šimek, Petr; Holík, Josef; Vlasáková, Věra; Hlaváček, Jan; Černý, B.; Tykva, Richard
2004-01-01
Roč. 32, - (2004), s. 263-273 ISSN 0045-2068 R&D Projects: GA ČR GA203/02/0247 Institutional research plan: CEZ:AV0Z4055905 Keywords : oostatic activity * binding experiments * degradation Subject RIV: CC - Organic Chemistry Impact factor: 1.240, year: 2004
Ecological restoration of central European mining sites: a summary of a multi-site analysis
Czech Academy of Sciences Publication Activity Database
Prach, Karel; Řehounková, Klára; Řehounek, J.; Konvalinková, Petra
2011-01-01
Roč. 36, č. 2 (2011), 263-268 ISSN 0142-6397 R&D Projects: GA AV ČR IAA600050702 Institutional research plan: CEZ:AV0Z60050516 Keywords : ecological restoration * mining * succession Subject RIV: EH - Ecology, Behaviour Impact factor: 0.677, year: 2011
26 CFR 1.263(a)-4 - Amounts paid to acquire or create intangibles.
2010-04-01
... walls, elevators, power generation and transmission facilities, and pollution control facilities. (iv... providing wireless telecommunications services to customers. To induce customer B to enter into a 3-year non-cancelable telecommunications contract, X provides B with a free wireless telephone. The fair market value of...
34 CFR 263.5 - What priority is given to certain projects and applicants?
2010-07-01
... enables these individuals to meet the requirements for full State certification or licensure as a teacher... for full State certification or licensure as a teacher. (2) Pre-service administrator training. This... eligible applicants that includes a tribal college or university and that designates that tribal college or...
E331 TP HF RW O3 SHC2.63 SCID: A-bvqk
U.S. Environmental Protection Agency — Data for differing physiological measures of dams on high fat or control diet with/without exercise and physiological effects on male and female offspring. This...
26 CFR 1.263A-3 - Rules relating to property acquired for resale.
2010-04-01
... activities is based upon the activities performed by that person and not upon the person's title or job classification. Thus, for example, although an employee's job function may be described in such a way as to... routinely shop to select specific items of merchandise; and (iv) Which are adjacent to or in immediate...
34 CFR 263.21 - What priority is given to certain projects and applicants?
2010-07-01
... notice published in the Federal Register. (1) School readiness projects that provide age appropriate educational programs and language skills to three- and four-year-old Indian students to prepare them for..., including family-based preschool programs, emphasizing school readiness and parental skills. (3) College...
40 CFR 52.263 - Priority treatment for buses and carpools-Los Angeles Region.
2010-07-01
... converted from existing lanes. (3) “Preferential treatment” for any class of vehicles, means either the.../carpool lanes: (1) Contraflow lane on the Golden State Freeway (I-5) from junction of Ventura Freeway...” means a vehicle containing three or more persons. (2) “Bus/carpool lane” means a lane on a street or...
2012-07-24
...) establishes National Average Payments for free, reduced price and paid afterschool snacks as part of the...--free lunch-- 303 cents, reduced price lunch--263 cents. Afterschool Snacks in Afterschool Care Programs--The payments are: Contiguous States--free snack--78 cents, reduced price snack--39 cents, paid snack...
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Earth System Science; Volume 121; Issue 2. Impact of continental meteorology and atmospheric circulation in the modulation of Aerosol Optical Depth over the Arabian Sea. Sandhya K Nair S Sijikumar S S Prijith. Volume 121 Issue 2 April 2012 pp 263-272 ...
Goris, J.A.; Denessen, E.J.P.G.; Verhoeven, L.T.W.
2013-01-01
This study investigates the effects of English-medium CLIL on EFL proficiency in three European countries. Seven mainstream grammar schools spread across The Netherlands, Germany, and Italy participated with a total of 263 pupils aged 12 to 16. Several language skills were measured by means of
An insight into the sequential, structural and phylogenetic properties ...
Indian Academy of Sciences (India)
Prakash
composition bias between sequences. Plant name. Musa acuminate. Diospyros kaki. 0.463. Malus domestica. 0.333. Momordica charantia. 0.383. Medicago truncatula. 0.263. Glycine max. 0.223. Populas canadensis. 0.450. Pyrus communis. 0.223. Cucumis melo. 0.497. Lycopersicon esculentum. 0.327. Persea americana.
Czech Academy of Sciences Publication Activity Database
Zicha, Josef; Dobešová, Zdenka; Zídek, Václav; Šilhavý, Jan; Šimáková, Miroslava; Mlejnek, Petr; Vaněčková, Ivana; Kuneš, Jaroslav; Pravenec, Michal
2014-01-01
Roč. 63, č. 2 (2014), s. 263-265 ISSN 0862-8408 R&D Projects: GA MŠk(CZ) LH11049 Institutional support: RVO:67985823 Keywords : captopril * blood pressure * QTL * Ednrb gene * spontaneously hypertensive rat Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.293, year: 2014
DEFF Research Database (Denmark)
Bjørndal, Kristine; Krogdahl, Annelise; Therkildsen, Marianne Hamilton
2011-01-01
years. The parotid gland was the most common site (52.5%) followed by the minor salivary glands of the oral cavity (26.3%). The most frequent histological subtypes were adenoid cystic carcinoma (25.2%), mucoepidermoid carcinoma (16.9%), adenocarcinoma NOS (12.2%) and acinic cell carcinoma (10...
41 CFR 101-26.301 - Applicability.
2010-07-01
... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Applicability. 101-26.301 Section 101-26.301 Public Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 26-PROCUREMENT SOURCES AND PROGRAM 26.3...
The Prevalence of Kidney Dysfunction and Associated Risk Factors ...
African Journals Online (AJOL)
Journal Home > Vol 44, No 3 (2017) > ... use of a kidney disease screening algorithm to guide choice of a cART regimen in the absence of serum creatinine. Despite ... Hypertension OR=2.63, (95% CI 1.11, 6.12) was the only factor found to be ...
1991-01-01
Titlebaum, 1988. Stoyva, 1977; Vines, 1988; Wood & Pesut, 1981; Zahourek , 1988). However, any behavior an individual uses to consciously modify a...Journal of Nursing Research, 3, 263-271. Zahourek , K. (1987). Clinical hypnosis in holistic healing. Holistic Nursing Practice, 2(1), 15-24. 76 APPENDIX A
Czech Academy of Sciences Publication Activity Database
Bujalský, L.; Jirka, V.; Zemek, František; Frouz, J.
2018-01-01
Roč. 32, č. 4 (2018), s. 254-263 ISSN 1748-0930 R&D Projects: GA MŠk(CZ) LO1415 Institutional support: RVO:67179843 Keywords : temperature * normalised difference * vegetation index (NDVI) * vegetation cover * remote sensing Subject RIV: DF - Soil Science Impact factor: 1.078, year: 2016
Journal of Astrophysics and Astronomy | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Astrophysics and Astronomy. K. M. Hiremath. Articles written in Journal of Astrophysics and Astronomy. Volume 21 Issue 3-4 September-December 2000 pp 263-264 Session V – Vector Magnetic Fields, Prominences, CMEs & Flares. Emergence of Twisted Magnetic Flux Related Sigmoidal ...
Kaufman, Alan S.; McLean, James E.
1994-01-01
Four typologies assessed by the Murphy-Meisgeier Type Indicator for Children (C. Meisgeier and M. Murphy, 1987) (Extraversion-Introversion, Sensing-Intuition, Thinking-Feeling, Judging-Perceiving) were related to sex, race/ethnic group, intelligence level, and fluid/crystallized IQ discrepancy for 263 adolescents. The Thinking/Feeling index…
The cestode community in northern fur seals (Callorhinus ursinus) on St. Paul Island, Alaska
Czech Academy of Sciences Publication Activity Database
Kuzmina, T.A.; Hernández-Orts, Jesús S.; Lyons, E.T.; Spraker, T.R.; Kornyushyn, V.V.; Kuchta, Roman
2015-01-01
Roč. 4, č. 2 (2015), s. 256-263 ISSN 2213-2244 R&D Projects: GA ČR GAP506/12/1632 Institutional support: RVO:60077344 Keywords : Adenocephalus pacificus (Diphyllobothrium pacificum) * Anophryocephalus cf. ochotensis * Cestoda * Diphyllobothridea * Diplogonoporus tetrapterus * Otariidae, North Pacific * Tapeworms * Tetrabothriidea Subject RIV: EG - Zoology
Alien Pathogens on the Horizon: Opportunities for Predicting their Threat to Wildlife
Czech Academy of Sciences Publication Activity Database
Roy, H. E.; Hesketh, H.; Purse, B. V.; Eilenberg, J.; Santini, A.; Sclarea, R.; Stentiford, G. D.; Adriaens, T.; Bacela-Spychalska, K.; Bass, D.; Beckmann, K. M.; Bessell, P.; Bojko, J.; Booy, O.; Cardoso, A.-C.; Essl, F.; Groom, Q.; Harrower, C.; Kleespies, R. G.; Martinou, A. F.; van Oers, M. M.; Peeler, E. J.; Pergl, Jan; Rabitsch, W.; Roques, A.; Schaffner, F.; Schindler, S.; Schmidt, B. R.; Schönrogge, K.; Smith, J.; Solarz, W.; Stewart, A.; Stroo, A.; Tricarico, E.; Turvey, K. M. A.; Vannini, A.; Vila, M.; Woodward, S.; Wynns, A. A.; Dunn, A. M.
2017-01-01
Roč. 10, č. 4 (2017), s. 477-484 ISSN 1755-263X Grant - others:COST(XE) TD1209 Program:FA Institutional support: RVO:67985939 Keywords : horizon scanning * invasions * legislation * wildlife diseases Subject RIV: EH - Ecology, Behaviour OBOR OECD: Biodiversity conservation Impact factor: 7.020, year: 2016
21 CFR 640.71 - Manufacturing responsibility.
2010-04-01
... the Public Health Service Act, or by a clinical laboratory that meets the standards of the Clinical Laboratories Improvement Amendments of 1988 (CLIA) (42 U.S.C. 263a): Provided, The establishment or clinical... collection, plasmapheresis, laboratory testing, labeling, storage, and issuing shall be performed by...
Czech Academy of Sciences Publication Activity Database
Svoboda, Vladimír; Peregrin, Jaroslav
2016-01-01
Roč. 30, č. 3 (2016), s. 263-287 ISSN 0920-427X R&D Projects: GA ČR(CZ) GA13-21076S Institutional support: RVO:67985955 Keywords : argumentation * logical form * incorrect argument * correct arguments Subject RIV: AA - Philosophy ; Religion Impact factor: 0.689, year: 2016
Molecular characterization of rainbow trout, Oncorhynchus mykiss ...
Indian Academy of Sciences (India)
Molecular Genetics Laboratory, Directorate of Coldwater Fisheries Research, Bhimtal 263 ... Mir J. I., Ali S., Patiyal R. S. and Singh A. K. 2015 Molecular characterization of rainbow trout, ..... 5 × 106 MCMC repeats for final sampling of data. .... enhancing aquaculture productivity in the coldwater regions. ... simulation study.
U.S.-India Relations: Partners in Democracy
2014-02-01
2011. (JQ 629 .A58 N53 2011) Oldenburg , Philip. India, Pakistan, and Democracy: Solving the Puzzle of Divergent Paths. New York: Routledge, 2010. (JQ...Power, Ambition, and the Ultimate Weapon. Washington: Georgetown UP, 2012. (U 263 .S773 2012) Journals Acheson, Ray . "Modernization of
Czech Academy of Sciences Publication Activity Database
Gamero, A.; Brotons, L.; Brunner, A.; Foppen, R.; Fornasari, L.; Gregory, R. D.; Herrando, S.; Hořák, D.; Jiguet, F.; Kmecl, P.; Lehikoinen, A.; Lindström, Å.; Paquet, J. Y.; Reif, J.; Sirkiä, P. M.; Škorpilová, J.; van Strien, A.; Szép, T.; Telenský, Tomáš; Teufelbauer, N.; Trautmann, S.; Van Turnhout, C. A. M.; Vermouzek, Z.; Vikstrøm, T.; Voříšek, P.
2017-01-01
Roč. 10, č. 4 (2017), s. 395-402 ISSN 1755-263X Institutional support: RVO:68081766 Keywords : Agricultural intensification * Agrienvironmental schemes * Bird monitoring * Birds directive * Common agriculture policy * Natura 2000 * SPA Subject RIV: EG - Zoology OBOR OECD: Biodiversity conservation Impact factor: 7.020, year: 2016
Clinical features of diabetes retinopathy in elderly patients with type ...
African Journals Online (AJOL)
Objective: The objective was to estimate the prevalence and clinical characteristics of diabetes retinopathy (DR) in elderly individuals with type 2 diabetes mellitus in Northern Chinese. Materials and Methods: 595 eligible subjects (263 men, 332 women) assisted by the community health service center in Beijing, China ...
Czech Academy of Sciences Publication Activity Database
Chatoutsidou, S.E.; Mašková, Ludmila; Ondráčková, Lucie; Ondráček, Jakub; Lazaridis, M.; Smolík, Jiří
2015-01-01
Roč. 89, JUL (2015), s. 253-263 ISSN 0360-1323 EU Projects: European Commission(XE) 315760 Grant - others:EEA(NO) A/CZ0046/2/001 Institutional support: RVO:67985858 Keywords : infiltration factor * penetration * deposition Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.394, year: 2015
Review of Physical and Chemical Methods for Characterization of Fuels
1981-12-01
Reversed-phase chromatography REF Refractometry CAL Calorimetry POT Potentiometry CC Coordination chromatography MSB Mossbauer spectroscopy FS Flame...petroleum distillates ......... .... ........................ . .... A-2-63 Determination of the nitrogen content of shale oil furnace oil by refractometry ... refractometry ............................................ A-2-70 SAPONIFICATION NUMBER Saponification number of petroleum products.......................A-2
Gifted Education in Preschool: Perceived Barriers and Benefits of Program Development
Kettler, Todd; Oveross, Mattie E.; Bishop, James C.
2017-01-01
Substantial evidence supports the benefits of quality preschool education for children of all levels and backgrounds. However, early childhood gifted education services rarely exist in preschool centers. This study included 263 preschool centers representing geographic diversity in a southern state in the United States. Narrative data were…
Journal of Astrophysics and Astronomy | Indian Academy of Sciences
Indian Academy of Sciences (India)
2016-01-27
Jan 27, 2016 ... Institute of Astronomy and Astrophysics, AS, Taipei 10617, Taiwan. Astronomical Observatory, Jagiellonian University, ul. Orla 171, 30244 Kraków, Poland. University of Hertfordshire, College Lane, Hatfield, UK. University of Southampton, Southampton SO17 1BJ, UK. ARIES, Manora Peak, Nainital 263 ...
2013-03-05
... documentation may be obtained from Rich Malinowski, NMFS, Southeast Regional Office, 263 13th Avenue South, St. Petersburg, FL 33701; telephone: 727-824-5305. FOR FURTHER INFORMATION CONTACT: Rich Malinowski, telephone: 727-824- 5305, or email: Rich.Malinowski@noaa.gov . SUPPLEMENTARY INFORMATION: The reef fish fishery...
Bodmer, D.; Ligtenberg, M. J. L.; van der Hout, A. H.; Gloudemans, S.; Ansink, K.; Oosterwijk, J. C.; Hoogerbrugge, N.
2006-01-01
To establish an efficient, reliable and easy to apply risk assessment tool to select families with breast and/or ovarian cancer patients for BRCA mutation testing, using available probability models. In a retrospective study of 263 families with breast and/or ovarian cancer patients, the utility of
African Journals Online (AJOL)
user
ABSTRACT. Onchocerciasis among 278 children (0-15yrs) of Ekpan village, a hyperendemic community in Uhunmwode. Local Government Area of Edo State, Nigeria was investigated using the prevalence of nodules as index. The overall prevalence of palpable nodules was 26.3%. Nodule prevalence increased with age ...
2011-12-27
... and necessary trade or business expenses) and section 263(a) (relating to the capitalization... is not deductible as a business expense. Section 1.162-11(b) of the existing regulations also... court explained that repair and maintenance expenses are incurred for the purpose of keeping property in...
Choi, Michael K.
2017-01-01
An innovative thermal design concept to maintain comet surface samples cold (for example, 263 degrees Kelvin, 243 degrees Kelvin or 223 degrees Kelvin) from Earth approach through retrieval is presented. It uses paraffin phase change material (PCM), Cryogel insulation and thermoelectric cooler (TEC), which are commercially available.
Jackson, Kelly F.; Yoo, Hyung Chol; Guevarra, Rudy, Jr.; Harrington, Blair A.
2012-01-01
This study examined relations between perceived racial discrimination, multiracial identity integration (i.e., racial distance and racial conflict), and psychological adjustment (i.e., distress symptoms, positive affect, and negative affect) of 263 multiracial adults, using an online cross-sectional survey design. As hypothesized, higher levels of…
Rocks and walls: natural versus secondary habitats
Czech Academy of Sciences Publication Activity Database
Láníková, Deana; Lososová, Z.
2009-01-01
Roč. 44, č. 3 (2009), s. 263-280 ISSN 1211-9520 R&D Projects: GA ČR GA206/09/0329 Institutional research plan: CEZ:AV0Z60050516 Keywords : alien species * chasmophytic vegetation * diversity Subject RIV: EF - Botanics Impact factor: 1.320, year: 2009
International Nuclear Information System (INIS)
Hani, Rachida; Solimando, Roland; Negadi, Latifa; Jose, Jacques; Ait Kaci, Ahmed
2012-01-01
Highlights: ► Vapor pressures of (1-hexene + methyl butyl ether) or (1-hexene + methyl tert-butyl ether) are reported between (263 and 363) K. ► The two mixtures exhibit positive G E . ► Additionally, molar excess enthalpies, H E , for the two binary systems have been measured at 303.15. - Abstract: The vapor pressures of {1-hexene + methyl butyl ether (MBE)} and {1-hexene + methyl tert-butyl ether (MTBE)} binary mixtures and of the three pure components were measured by means of a static device at temperatures between (263 and 333) K. The data were correlated with the Antoine equation. From these data, excess Gibbs functions were calculated for several constant temperatures and fitted to a third-order Redlich–Kister equation using the Barker’s method. Additionally, molar excess enthalpies, H E , for the two binary systems have been measured at 303.15 K using an isothermal flow calorimeter.
Software Optimization of Video Codecs on Pentium Processor with MMX Technology
Directory of Open Access Journals (Sweden)
Liu KJ Ray
2001-01-01
Full Text Available A key enabling technology for the proliferation of multimedia PC's is the availability of fast video codecs, which are the basic building blocks of many new multimedia applications. Since most industrial video coding standards (e.g., MPEG1, MPEG2, H.261, H.263 only specify the decoder syntax, there are a lot of rooms for optimization in a practical implementation. When considering a specific hardware platform like the PC, the algorithmic optimization must be considered in tandem with the architecture of the PC. Specifically, an algorithm that is optimal in the sense of number of operations needed may not be the fastest implementation on the PC. This is because special instructions are available which can perform several operations at once under special circumstances. In this work, we describe a fast implementation of H.263 video encoder for the Pentium processor with MMX technology. The described codec is adopted for video mail and video phone softwares used in IBM ThinkPad.
Memory-Optimized Software Synthesis from Dataflow Program Graphs with Large Size Data Samples
Directory of Open Access Journals (Sweden)
Hyunok Oh
2003-05-01
Full Text Available In multimedia and graphics applications, data samples of nonprimitive type require significant amount of buffer memory. This paper addresses the problem of minimizing the buffer memory requirement for such applications in embedded software synthesis from graphical dataflow programs based on the synchronous dataflow (SDF model with the given execution order of nodes. We propose a memory minimization technique that separates global memory buffers from local pointer buffers: the global buffers store live data samples and the local buffers store the pointers to the global buffer entries. The proposed algorithm reduces 67% memory for a JPEG encoder, 40% for an H.263 encoder compared with unshared versions, and 22% compared with the previous sharing algorithm for the H.263 encoder. Through extensive buffer sharing optimization, we believe that automatic software synthesis from dataflow program graphs achieves the comparable code quality with the manually optimized code in terms of memory requirement.
Czech Academy of Sciences Publication Activity Database
Schwarzerová, K.; Pokorná, J.; Petrášek, Jan; Zelenková, S.; Čapková, Věra; Janotová, I.; Opatrný, Z.
2003-01-01
Roč. 27, - (2003), s. 263ů265 ISSN 1065-6995 R&D Projects: GA AV ČR IAA5038207 Institutional research plan: CEZ:AV0Z5038910; CEZ:MSM 113100003 Keywords : cytoskeletal polymers * tobacco * endomembrane system Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.092, year: 2003
1995-08-01
soldiers: 43 tanks: 37 Isaacs, Betty: 336 Isherwood, Mike: 336 Ishikawa , Kaoru : 263 Isolationism: 137 Israel: 29, 229, 335 383 Israeli Air Force: 335...Deming, Juran, Ishikawa , and others—have long been practiced by the Air Force. We’ve used these principles from our beginnings as an institution—long
2013-10-01
States Depart- ment of Agriculture certificate No. 51-F-0006). All procedures were in compliance with the ARVO Statement for the Use of Animals in...exposure: pathological mechanism and poten- tial therapy. Toxicology. 2009;263:59–69. 9. Gordon MK, Desantis A, Deshmukh M, et al. Doxycycline hydrogels
Critical Review of the Heats of Formation of HNO and Some Related Species
National Research Council Canada - National Science Library
Anderson, William
1997-01-01
.... It was found that predissociation experiments, which have gone largely unnoticed for over 15 yr, lead to a significant revision in the recommended value. The new value, 25.6 + 0.6 kcal/mol and 25.6 - 0.1 kcal/mol (298 K; 26.3 kcal/mol at 0 K...
Czech Academy of Sciences Publication Activity Database
Vaškovicová, Naděžda; Skoupý, Radim; Krzyžánek, Vladislav
2017-01-01
Roč. 62, č. 10 (2017), s. 260-263 ISSN 0447-6441 R&D Projects: GA MŠk(CZ) LO1212 Institutional support: RVO:68081731 Keywords : scanning electron microscopy * cathodoluminescence * diamonds * CL spectrums * cryo-SEM * contamination Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering OBOR OECD: Electrical and electronic engineering
75 FR 78940 - Sales-Based Royalties and Vendor Allowances
2010-12-17
... acquired for resale. These costs include licensing and franchise costs incurred in securing the contractual... capitalizable licensing and franchise costs within the meaning of Sec. 1.263A-1(e)(3)(ii)(U). The proposed... produced or property acquired for resale: * * * * * (U) Licensing and franchise costs. (1) * * * These...
Czech Academy of Sciences Publication Activity Database
Pavlíková, N.; Smetana, P.; Halada, Petr; Kovář, J.
2015-01-01
Roč. 142, OCT 2015 (2015), s. 257-263 ISSN 0013-9351 Grant - others:OPPK(CZ) CZ.2.16/3.1.00/24023 Source of funding: O - operačné programy Keywords : Diabetes * DDT/E * Alpha-enolase Subject RIV: CE - Biochemistry Impact factor: 3.088, year: 2015
Clinico-hysteroscopic analysis of severe intrauterine adhesions ...
African Journals Online (AJOL)
Secondary dysmenorrhea and cyclical abdominal pain were found in 10.8% and 31.6% of the women respectively. The main aetiological events were complicated caesarean section (42.1%) and abdominal myomectomy (26.3%). The adhesions were mainly dense (52.6%) and multiple (94.7%) with complete involvement of ...
Ma, Xiaohua; Fu, Limin; Zhao, Yunfeng; Ai, Xicheng; Zhang, Jianping; Han, Yu; Guo, Zhixin
2011-01-01
the moderate static first hyperpolarizabilities (β0) for both APNA [(136 ± 5) à - 10-30 esu] and DPAPNA [(263 ± 20) à - 10-30 esu], only APNA crystal shows a powder efficiency of second harmonic generation (SHG) of 23 times that of urea. It is shown
Toxic Hazards Research Unit Annual Technical Report: 1985
1985-09-01
varnish makers’ and painters’ naphtha, Toxicol. Appl. Pharmacol., 32:263-281. Carpenter, C. P.. E. R. Kinkead, D. L. Geary, L. J. Sullivan, Jr., and J...and Pharmacology of Inorganic and Fluorine Contairnin Compounds, AMRL-TR-67-224, Aerospace Medical Research Laboiatory, Wright-Patterson Air Force Base
78 FR 23631 - Notice of Final Federal Agency Actions on Proposed Highway in California
2013-04-19
... Lake County with NEPA oversight being conducted by the State of California. The project takes place in Lake County, immediately adjacent to the town of Lakeport on South Main Street and Soda Bay Rd. Those... County: Lars Ewing, Assistant Public Works Director, telephone (707) 263-2341, email Lars.Ewing...
Biochemical properties and microbial analysis of honey from North ...
African Journals Online (AJOL)
In the present study, physicochemical properties (pH, ash, commercial glucose, starch, reducing sugars and moisture) and microbial (yeast and enterobacterial) contaminations of 263 honey samples from North-western regions of Iran were evaluated in a 2 year period in different seasons of 2010 and 2011. Levels of ...
2013-08-01
...;Prices of new books are listed in the first FEDERAL REGISTER issue of each #0;week. #0; #0; #0; #0;#0...,935 Any Country 4,392,977 2,263,334 6,656,311 DRIED SKIM MILK (NOTE 7) 5,261,000 5,261,000 5,261,000 5...
Hayes, Daniel J.; van Buuren, Stef; ter Kuile, Feiko O.; Stasinopoulos, D. Mikis; Rigby, Robert A.; Terlouw, Dianne J.
2015-01-01
Methods: A weight-for-age database was constructed from pre-existing population-based anthropometric data obtained from household surveys and research groups. It contained data collected between 1995 and 2012 on 1 263 119 individuals (909 368 female, 353 751 male) older than 14 days and younger than
Hayes, D.J.; Buuren, S. van; Kuile, F.O. ter; Stasinopoulos, D.M.; Rigby, R.A.; Terlouw, D.J.
2015-01-01
Methods: A weight-for-age database was constructed from pre-existing population-based anthropometric data obtained from household surveys and research groups. It contained data collected between 1995 and 2012 on 1 263 119 individuals (909 368 female, 353 751 male) older than 14 days and younger than
Sabogal, Fabio; And Others
1989-01-01
Finds that, among 263 Hispanic and 150 non-Hispanic White smokers, Hispanics smoked fewer cigarettes, had lower levels of perceived addiction to nicotine, and had higher perceived self-efficacy to avoid smoking, but these differences shrank with greater acculturation. Discusses implications for smoking cessation programs. Contains 27 references.…
Potgens, F.P.G.
2010-01-01
This article analyses the decisions of the Dutch Supreme Court of 20 February 2009, BNB 2009/260 through 262 and 19 June, 2009, BNB 2009/263 through 266 on the relationship between the domestic concept of preservative tax assessments and previously concluded tax treaties. The author argies that some
African Journals Online (AJOL)
Bertram and K. L. Moore. Pp. xii + 263. Illustrated. Baltimore: Williams & Wilkins. 1982. Several good atlases of the human central nervous system are available, but the present authors have concentrated on developing a three-dimensional image of the complex neuro-anatomical relationships of structures in the brain and ...
2013-05-03
... floodplain and wetland review requirements (10 CFR part 1022). DATES: DOE invites the public to comment on... commercial operations after this date. The oxy-combustion plant would be built on a 263-acre existing power... would be used for the injection facilities, associated infrastructure and buildings, and access roads...
Czech Academy of Sciences Publication Activity Database
Matoušek, Jaroslav; Kocábek, Tomáš; Patzak, J.; Bříza, Jindřich; Siglová, Kristýna; Mishra, Ajay Kumar; Duraisamy, Ganesh Selvaraj; Týcová, Anna; Ono, E.; Krofta, K.
2016-01-01
Roč. 92, č. 3 (2016), s. 263-277 ISSN 0167-4412 R&D Projects: GA ČR GA13-03037S Institutional support: RVO:60077344 Keywords : Lupulin biosynthesis * Transcription factors * 5' RNA degradome * Plant promoter activation Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.356, year: 2016
Microscopic investigation of surface layers on rails
Czech Academy of Sciences Publication Activity Database
Jirásková, Yvonna; Svoboda, Jiří; Schneeweiss, Oldřich; Daves, W.; Fischer, F. D.
2005-01-01
Roč. 239, č. 2 (2005), s. 132-141 ISSN 0169-4332 R&D Projects: GA AV ČR(CZ) IBS2041105 Institutional research plan: CEZ:AV0Z20410507 Keywords : Mössbauer phase analysis * TEM * rail Subject RIV: JO - Structural Engineering Impact factor: 1.263, year: 2005
The MIQE Guidelines: Minimum Information for Publication of Quantitative Real-Time PCR Experiments
Czech Academy of Sciences Publication Activity Database
Bustin, S.A.; Benes, V.; Garson, J.A.; Hellemans, J.; Huggett, J.; Kubista, Mikael; Mueller, R.; Nolan, T.; Pfaffl, M.V.; Shipley, G.L.; Vandesompele, J.; Wittver, C.T.
2009-01-01
Roč. 55, č. 4 (2009), s. 611-622 ISSN 0009-9147 R&D Projects: GA AV ČR IAA500520809 Institutional research plan: CEZ:AV0Z50520701 Keywords : qPCR * MIQE * publication of experiments data Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 6.263, year: 2009
Czech Academy of Sciences Publication Activity Database
Krahulcová, Anna; Krahulec, František; Rosenbaumová, R.
2011-01-01
Roč. 24, č. 1 (2011), s. 263-274 ISSN 0934-0882 R&D Projects: GA ČR GA206/08/0890 Institutional research plan: CEZ:AV0Z60050516 Keywords : inheritance of apomixis * residual sexuality * unreduced hybrids Subject RIV: EF - Botanics Impact factor: 1.869, year: 2011
76 FR 28421 - Marine Mammals; File No. 15646
2011-05-17
...- 4018; and Southeast Region, NMFS, 263 13th Avenue South, Saint Petersburg, Florida 33701; phone (727..., Permits, Conservation and Education Division, at the address listed above. Comments may also be submitted... duration of the import permit is 5 years. In compliance with the National Environmental Policy Act of 1969...
Dynamic coupling between heart rate and ventricular repolarisation
Czech Academy of Sciences Publication Activity Database
Halámek, Josef; Jurák, Pavel; Villa, M.; Souček, M.; Fráňa, P.; Nykodym, J.; Eisenberger, M.; Leinveber, P.; Vondra, Vlastimil; Somers, V. K.; Kára, T.
2007-01-01
Roč. 52, č. 3 (2007), s. 255-263 ISSN 0013-5585 R&D Projects: GA ČR(CZ) GA102/05/0402 Institutional research plan: CEZ:AV0Z20650511 Keywords : QT/RR coupling * transfer function Subject RIV: FS - Medical Facilities ; Equipment Impact factor: 0.593, year: 2007
Self-Handicapping and Irrational Beliefs about Approval in a Sample of Teacher Candidates
Kaya, Çinar; Ugur, Erol; Sar, Ali Haydar; Ercengiz, Mustafa
2017-01-01
The main objective of the current study is to examine the relationships between self-handicapping, and irrational beliefs about approval, irrational beliefs about interpersonal relationships, irrational beliefs about self and the overall level of irrational beliefs by reference to the " ABC " framework. Participants of the study were 263…
Czech Academy of Sciences Publication Activity Database
Macháček, Jiří; Seďa, Jaromír
2013-01-01
Roč. 35, č. 5 (2013), s. 1069-1079 ISSN 0142-7873 R&D Projects: GA ČR(CZ) GA206/09/1325 Institutional support: RVO:60077344 Keywords : Daphnia size * filtering screens * phenotypic plasticity * embryonic induction * temperature effect Subject RIV: DA - Hydrology ; Limnology Impact factor: 2.263, year: 2013
Journal of Biosciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Biosciences. B N Singh. Articles written in Journal of Biosciences. Volume 34 Issue 2 June 2009 pp 263-274 Articles. Variations in morphological and life-history traits under extreme temperatures in Drosophila ananassae · Seema Sisodia B N Singh · More Details Abstract Fulltext PDF.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education. Prerna Sharma. Articles written in Resonance – Journal of Science Education. Volume 23 Issue 3 March 2018 pp 263-275 General Article. Self-Assembly of Colloidal Particles · Prerna Sharma · More Details Abstract Fulltext PDF. Colloidal dispersions are ...
Tereso, Susana; Zoglauer, Kurt; Milhinhos, Ana; Miguel, Célia; Oliveira, M Margarida
2007-05-01
We compared morphogenesis and accumulation of storage proteins and starch in Pinus pinaster Ait. zygotic embryos with those in somatic embryos grown with different carbohydrate sources. The maturation medium for somatic embryos included 80 microM abscisic acid (ABA), 9 g l(-1) gellam gum and either glucose, sucrose or maltose at 44, 88, 175 or 263 mM in the presence or absence of 6% (w/v) polyethylene glycol (PEG) 4000 MW. Maturation medium containing 44 or 88 mM of a carbohydrate source produced only one or no cotyledonary somatic embryos per 0.6 g fresh mass of culture. The addition of PEG to the basal maturation medium resulted in a low yield of cotyledonary somatic embryos that generally showed incomplete development and anatomical abnormalities such as large intercellular spaces and large vacuoles. High concentrations of maltose also induced large intercellular spaces in the somatic embryonic cells, and 263 mM sucrose produced fewer and less developed cotyledonary somatic embryos compared with 175 mM sucrose, indicating that the effect of carbohydrate source is partially osmotic. Zygotic embryos had a lower dry mass than somatic embryos at the same stage of development. Starch granules followed a similar accumulation pattern in zygotic and somatic embryos. A low starch content was found in cotyledonary zygotic embryos and in somatic embryos developed in the presence of 175 mM maltose or 263 mM glucose. In zygotic embryos and in PEG-treated somatic embryos, protein bodies appeared later and were smaller and fewer than in well-developed somatic embryos grown without PEG. We propose that storage protein concentration might be a marker of embryo quality.
Di Marino, Daniele
2015-03-01
Despite the investments in malaria research, an effective vaccine has not yet been developed and the causative parasites are becoming increasingly resistant to most of the available drugs. PfATP6, the sarco/endoplasmic reticulum Ca2+ pump (SERCA) of P. falciparum, has been recently genetically validated as a potential antimalarial target and cyclopiazonic acid (CPA) has been found to be a potent inhibitor of SERCAs in several organisms, including P. falciparum. In position 263, PfATP6 displays a leucine residue, whilst the corresponding position in the mammalian SERCA is occupied by a glutamic acid. The PfATP6 L263E mutation has been studied in relation to the artemisinin inhibitory effect on P. falciparum and recent studies have provided evidence that the parasite with this mutation is more susceptible to CPA. Here, we characterized, for the first time, the interaction of CPA with PfATP6 and its mammalian counterpart to understand similarities and differences in the mode of binding of the inhibitor to the two Ca2+ pumps. We found that, even though CPA does not directly interact with the residue in position 263, the presence of a hydrophobic residue in this position in PfATP6 rather than a negatively charged one, as in the mammalian SERCA, entails a conformational arrangement of the binding pocket which, in turn, determines a relaxation of CPA leading to a different binding mode of the compound. Our findings highlight differences between the plasmodial and human SERCA CPA-binding pockets that may be exploited to design CPA derivatives more selective toward PfATP6.
Di Marino, Daniele; D'Annessa, Ilda; Coletta, Andrea; Via, Allegra; Tramontano, Anna
2015-01-01
Despite the investments in malaria research, an effective vaccine has not yet been developed and the causative parasites are becoming increasingly resistant to most of the available drugs. PfATP6, the sarco/endoplasmic reticulum Ca2+ pump (SERCA) of P. falciparum, has been recently genetically validated as a potential antimalarial target and cyclopiazonic acid (CPA) has been found to be a potent inhibitor of SERCAs in several organisms, including P. falciparum. In position 263, PfATP6 displays a leucine residue, whilst the corresponding position in the mammalian SERCA is occupied by a glutamic acid. The PfATP6 L263E mutation has been studied in relation to the artemisinin inhibitory effect on P. falciparum and recent studies have provided evidence that the parasite with this mutation is more susceptible to CPA. Here, we characterized, for the first time, the interaction of CPA with PfATP6 and its mammalian counterpart to understand similarities and differences in the mode of binding of the inhibitor to the two Ca2+ pumps. We found that, even though CPA does not directly interact with the residue in position 263, the presence of a hydrophobic residue in this position in PfATP6 rather than a negatively charged one, as in the mammalian SERCA, entails a conformational arrangement of the binding pocket which, in turn, determines a relaxation of CPA leading to a different binding mode of the compound. Our findings highlight differences between the plasmodial and human SERCA CPA-binding pockets that may be exploited to design CPA derivatives more selective toward PfATP6.
MacLennan, Calman A; Msefula, Chisomo L; Gondwe, Esther N; Gilchrist, James J; Pensulo, Paul; Mandala, Wilson L; Mwimaniwa, Grace; Banda, Meraby; Kenny, Julia; Wilson, Lorna K; Phiri, Amos; MacLennan, Jenny M; Molyneux, Elizabeth M; Molyneux, Malcolm E; Graham, Stephen M
2017-12-01
Nontyphoidal Salmonellae commonly cause invasive disease in African children that is often fatal. The clinical diagnosis of these infections is hampered by the absence of a clear clinical syndrome. Drug resistance means that empirical antibiotic therapy is often ineffective and currently no vaccine is available. The study objective was to identify risk factors for mortality among children presenting to hospital with invasive Salmonella disease in Africa. We conducted a prospective study enrolling consecutive children with microbiologically-confirmed invasive Salmonella disease admitted to Queen Elizabeth Central Hospital, Blantyre, in 2006. Data on clinical presentation, co-morbidities and outcome were used to identify children at risk of inpatient mortality through logistic-regression modeling. Over one calendar year, 263 consecutive children presented with invasive Salmonella disease. Median age was 16 months (range 0-15 years) and 52/256 children (20%; 95%CI 15-25%) died. Nontyphoidal serovars caused 248/263 (94%) of cases. 211/259 (81%) of isolates were multi-drug resistant. 251/263 children presented with bacteremia, 6 with meningitis and 6 with both. Respiratory symptoms were present in 184/240 (77%; 95%CI 71-82%), 123/240 (51%; 95%CI 45-58%) had gastrointestinal symptoms and 101/240 (42%; 95%CI 36-49%) had an overlapping clinical syndrome. Presentation at Salmonella disease in Malawi is characterized by high mortality and prevalence of multi-drug resistant isolates, along with non-specific presentation. Young infants, children with dyspnea and HIV-infected children bear a disproportionate burden of the Salmonella-associated mortality in Malawi. Strategies to improve prevention, diagnosis and management of invasive Salmonella disease should be targeted at these children.
Mathie, Robert T; Hacke, Daniela; Clausen, Jürgen; Nicolai, Ton; Riley, David S; Fisher, Peter
2013-01-01
A new programme of systematic reviews of randomised controlled trials (RCTs) in homeopathy will distinguish important attributes of RCT records, including: placebo controlled versus other-than-placebo (OTP) controlled; individualised versus non-individualised homeopathy; peer-reviewed (PR) versus non peer-reviewed (NPR) sources. (a) To outline the methods used to search and categorise the RCT literature; (b) to report details of the records retrieved; (c) to compare our retrieved records with those reported in two previous systematic reviews (Linde et al., 1997; Shang et al., 2005). Ten major electronic databases were searched for records published up to the end of 2011. A record was accepted for subsequent systematic review if it was a substantive report of a clinical trial of homeopathic treatment or prophylaxis in humans, randomised and controlled, and published in a PR or NPR journal. 489 records were potentially eligible: 226 were rejected as non-journal, minor or repeat publications, or lacking randomisation and/or controls and/or a 'homeopathic' intervention; 263 (164 PR, 99 NPR) were acceptable for systematic review. The 263 accepted records comprised 217 (137 PR, 80 NPR) placebo-controlled RCTs, of which 121 were included by, 66 were published after, and 30 were potentially eligible for, but not listed by, Linde or Shang. The 137 PR records of placebo-controlled RCTs comprise 41 on individualised homeopathy and 96 on non-individualised homeopathy. Our findings clarify the RCT literature in homeopathy. The 263 accepted journal papers will be the basis for our forthcoming programme of systematic reviews. Copyright © 2012 The Faculty of Homeopathy. Published by Elsevier Ltd. All rights reserved.
A novel spliced fusion of MLL with CT45A2 in a pediatric biphenotypic acute leukemia
International Nuclear Information System (INIS)
Cerveira, Nuno; Marschalek, Rolf; Teixeira, Manuel R; Meyer, Claus; Santos, Joana; Torres, Lurdes; Lisboa, Susana; Pinheiro, Manuela; Bizarro, Susana; Correia, Cecília; Norton, Lucília
2010-01-01
Abnormalities of 11q23 involving the MLL gene are found in approximately 10% of human leukemias. To date, nearly 100 different chromosome bands have been described in rearrangements involving 11q23 and 64 fusion genes have been cloned and characterized at the molecular level. In this work we present the identification of a novel MLL fusion partner in a pediatric patient with de novo biphenotypic acute leukemia. Cytogenetics, fluorescence in situ hybridization (FISH), molecular studies (RT-PCR and LDI-PCR), and bioinformatic sequence analysis were used to characterize the CT45A2 gene as novel MLL fusion partner in pediatric acute leukemia. Fluorescence in situ hybridization of bone marrow G-banded metaphases demonstrated a cryptic insertion of 11q23 in Xq26.3 involving the MLL gene. Breakpoint fusion analysis revealed that a DNA fragment of 653 kb from 11q23, containing MLL exons 1-9 in addition to 16 other 11q23 genes, was inserted into the upstream region of the CT45A2 gene located at Xq26.3. In addition, a deletion at Xq26.3 encompassing the 3' region of the DDX26B gene (exons 9-16) and the entire CT45A1 gene was identified. RNA analysis revealed the presence of a novel MLL-CT45A2 fusion transcript in which the first 9 exons of the MLL gene were fused in-frame to exon 2 of the CT45A2 gene, resulting in a spliced MLL fusion transcript with an intact open reading frame. The resulting chimeric transcript predicts a fusion protein where the N-terminus of MLL is fused to the entire open reading frame of CT45A2. Finally, we demonstrate that all breakpoint regions are rich in long repetitive motifs, namely LINE/L1 and SINE/Alu sequences, but all breakpoints were exclusively identified outside these repetitive DNA sequences. We have identified CT45A2 as a novel spliced MLL fusion partner in a pediatric patient with de novo biphenotypic acute leukemia, as a result of a cryptic insertion of 11q23 in Xq26.3. Since CT45A2 is the first Cancer/Testis antigen family gene
Czech Academy of Sciences Publication Activity Database
Moravec, František; Glamuzina, B.; Marino, G.; Merella, P.; Di Cave, D.
2003-01-01
Roč. 53, č. 3 (2003), s. 267-269 ISSN 0177-5103 R&D Projects: GA ČR GA524/03/0061 Institutional research plan: CEZ:AV0Z6022909 Keywords : parasitic nematode * Philometra lateolabracis * marine fish Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.263, year: 2003
2011-03-02
... Center, 3401 Cultural Center Drive, Port Arthur, TX. 10. Thursday, March 31, 2011: Texas A & M at... restoration types should be sent to: NOAA Restoration Center, Attn: DWH PEIS Comments, 263 13th Avenue South... County Government Center, County Commissioner Chambers, 840 W. 11th Street, Panama City, FL. 3. Monday...
77 FR 54482 - Allocation of Costs Under the Simplified Methods
2012-09-05
... cost of goods sold cash or trade discounts that taxpayers do not capitalize for book purposes (and... to adjust additional section 263A costs for cash or trade discounts described in Sec. 1.471-3(b... Allocation of Costs Under the Simplified Methods AGENCY: Internal Revenue Service (IRS), Treasury. ACTION...
21 CFR 522.460 - Cloprostenol sodium.
2010-04-01
... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Cloprostenol sodium. 522.460 Section 522.460 Food... Cloprostenol sodium. (a)(1) Specifications. Each milliliter of the aqueous solution contains 263 micrograms of cloprostenol sodium (equivalent to 250 micrograms of cloprostenol) in a sodium citrate, anhydrous citric acid...
Proceedings – Mathematical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Proceedings – Mathematical Sciences. INDRANIL BISWAS. Articles written in Proceedings – Mathematical Sciences. Volume 111 Issue 3 August 2001 pp 263-269. Stability of Picard Bundle Over Moduli Space of Stable Vector Bundles of Rank Two Over a Curve · Indranil Biswas Tomás L Gómez.
26 CFR 1.199-3 - Domestic production gross receipts.
2010-04-01
... receipts for the taxable year that are recognized under the taxpayer's methods of accounting used for... consumer electronics stores. S requires that its customers purchase a minimum of 100 television sets per... accounting for its production activities under section 263A, and wishes to change its method of accounting to...
African Journals Online (AJOL)
DR GATSING
L'activité 14C du Maestrichtien est de 26,4 ± 0,6 pCM pour une teneur en 13C de -16,2 ..... carboniques mettant en jeu la phase gazeuse et ..... 14C method. ... fields of. Hydrolosphere, Sugarawa Festival,. Tokyo; 263-283. Jahns S, Hüls M, ...
2012-03-01
fall-2006/lecture-notes/lect11.pdf Chang, C.-T. (2005). A Linearization Approach for Inventory Models with Variable Lead Time. International Journal of Production Economics , 263...Demand and Lead Time are Stochastic. International Journal of Production Economics , 595-605. Hayya, J. C., Harrison, T. P., & He, X. (2011). The Impact
The National Benchmark Test of quantitative literacy: Does it ...
African Journals Online (AJOL)
Windows User
A total of 263,464 of these learners wrote this examination at the end of that year. On the .... it requires the activation of a range of enabling knowledge .... English. 197. 5.74. 708. 56.46. 821. 54.73 42 95.45 131 100 1,899. Xhosa. 1,271 37.01.
Endoscopy services in KwaZulu-Natal Province, South Africa, are ...
African Journals Online (AJOL)
There were 0.06 registered gastroenterologists (GEs) per 100 000 population. Each endoscopist performed an average of 263 endoscopies per annum. There were 1.18 endoscopy rooms available per unit, and two units had on-site fluoroscopy available. The average waiting period for an upper endoscopy was 27 (range 7 ...
Funke, Joachim
2013-01-01
This paper presents a bibliography of 263 references related to human problem solving, arranged by subject matter. The references were taken from PsycInfo and Academic Premier data-base. Journal papers, book chapters, and dissertations are included. The topics include human development, education, neuroscience, and research in applied settings. It…
Reproductive ecology and egg production of the radiated tortoise ...
African Journals Online (AJOL)
We captured and marked 1438 radiated tortoises of which 26% were adults. Mating and nesting coincided with the rainy season, and mating events peaked in December, shortly before females started nesting in January. The incubation period was approximately 263–342 days, and hatchlings emerged after the onset of the ...
African Journals Online (AJOL)
Items 201 - 250 of 263 ... Vol 11, No 1 (2010), The Phonological Problems Encountered by Igbo Students in Chinese Language Learning. Abstract PDF. IS Odinye. Vol 15, No 2 (2014), The Quest for a Sure Foundation of Cognitive Beliefs: Karl Popper's Fallibilist Critique of Rationalism and Empirisism, Abstract PDF. I Ndianefo.
Quantum nonlocality of photon pairs in interference in a Mach-Zehnder interferometer
Czech Academy of Sciences Publication Activity Database
Trojek, P.; Peřina ml., Jan
2003-01-01
Roč. 53, č. 4 (2003), s. 335-349 ISSN 0011-4626 R&D Projects: GA MŠk LN00A015 Institutional research plan: CEZ:AV0Z1010921 Keywords : entangled photon pairs * nonlocal interference * Mach-Zehender interferometer Subject RIV: BH - Optics, Masers, Lasers Impact factor: 0.263, year: 2003
Czech Academy of Sciences Publication Activity Database
Šremr, Jiří
2007-01-01
Roč. 132, č. 3 (2007), s. 263-295 ISSN 0862-7959 R&D Projects: GA ČR GP201/04/P183 Institutional research plan: CEZ:AV0Z10190503 Keywords : system of functional differential equations with monotone operators * initial value problem * unique solvability Subject RIV: BA - General Mathematics
African Journals Online (AJOL)
Items 1 - 50 of 263 ... Vol 17, No 3 (2017), Allomorphs in the Igbo Language: An Optimality Theory Approach, Abstract PDF. Thecla Udemmadu. Vol 17, No 2 (2016), An analysis of the auxiliary structure of basic Nigerian pidgin sentences, Abstract. Christopher Ufuoma Akaruese. Vol 18, No 2 (2017): Special Edition ...
Prevalence of Demodex spp among alcohol-dependent patients
Directory of Open Access Journals (Sweden)
Mehmet Hanifi Kokacya
2016-06-01
Conclusion: Demodex spp. are more common in alcohol-dependent patients due conditions of reduced self-care and immunosuppression. Demodex parasites should be considered in alcohol-dependent patients with skin lesions, especially on the face, and should to be treated if needed. [Cukurova Med J 2016; 41(2.000: 259-263
Lifescience Database Archive (English)
Full Text Available tr|Q092J0|Q092J0_STIAU Putative uncharacterized protein OS=Stigm... 40 0.094 tr|Q69340|Q69340_9ALPH Pseudorabies...PP--------VPLPRPVPGCGE 263 >tr|Q69340|Q69340_9ALPH Pseudorabies virus ORF1, ORF2, and ORF3 OS=Suid herpesvir
Czech Academy of Sciences Publication Activity Database
Moravec, František; Ali, A. H.
2013-01-01
Roč. 58, č. 3 (2013), s. 263-268 ISSN 1230-2821 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Parasitic nematode * Philometra * new species * marine fish * Johnius * Iraq * Arabian Gulf Subject RIV: EA - Cell Biology Impact factor: 0.965, year: 2013
50 CFR 622.9 - Vessel monitoring systems (VMSs).
2010-10-01
..., St. Petersburg, FL 33701; phone: 800-758-4833. An operating VMS includes an operating mobile... board when on a trip in the South Atlantic. An operating VMS includes an operating mobile transmitting... Region, 263 13th Avenue South, St. Petersburg, FL 33701; phone: 800-758-4833; and (2) Submit to NMFS...
Factorial Validity and Psychometric Examination of the Exercise Dependence Scale-Revised
Downs, Danielle Symons; Hausenblas, Heather A.; Nigg, Claudio R.
2004-01-01
The research purposes were to examine the factorial and convergent validity, internal consistency, and test-retest reliability of the Exercise Dependence Scale (EDS). Two separate studies, containing a total of 1,263 college students, were undertaken to accomplish these purposes. Participants completed the EDS and measures of exercise behavior and…
Czech Academy of Sciences Publication Activity Database
Linek, Jan
2003-01-01
Roč. 208, 1-2 (2003), s. 261-263 ISSN 0378-3812 R&D Projects: GA ČR GA203/02/1098 Institutional research plan: CEZ:AV0Z4072921 Keywords : water * propane-1,2-diol * physical properties Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.165, year: 2003
Perceived Social Support and Locus of Control as the Predictors of Vocational Outcome Expectations
Isik, Erkan
2013-01-01
The purpose of this study was to examine the relationships of vocational outcome expectation to social support which is an environmental factor and locus of control which is a personal factor. With this purpose, using Social Cognitive Career Theory as the theoretical framework, 263 undergraduate students completed Vocational Outcome Expectations…
Extremely Energetic 4B/X17.2 Flare and Associated Phenomena ...
Indian Academy of Sciences (India)
Aryabhatta Research Institute of Observational Sciences (ARIES), Manora Peak,. Nainital 263 129 ... In this paper, we present the preliminary analysis of X17.2 flare, observed on. 28 October 2003. ... The Hα movie shows large scale .... we calculate the thermal energy (Eth) content of the flare applying the following formula:.
2013-10-11
.... Telecommunications Device for the Deaf (TDD) users may contact (202) 263-4869, Board of Governors of the Federal...- generated survey. First, under the guidance of Board economists, the Federal Reserve Banks survey business... use online survey tools to collect responses to the survey. The frequency and content of the questions...
77 FR 26513 - Marine Mammals; File No. 15777
2012-05-04
...; fax (978) 281-9394; and Southeast Region, NMFS, 263 13th Avenue South, Saint Petersburg, FL 33701... the Chief, Permits and Conservation Division, at the address listed above. Comments may also be... compliance with the National Environmental Policy Act of 1969 (42 U.S.C. 4321 et seq.), an initial...
75 FR 16077 - Marine Mammals; File No. 15430
2010-03-31
...) 713-0376; and Southeast Region, NMFS, 263 13th Avenue South, Saint Petersburg, FL 33701; phone (727..., Permits, Conservation and Education Division, at the address listed above. Comments may also be submitted... with the National Environmental Policy Act of 1969 (42 U.S.C. 4321 et seq.), an initial determination...
76 FR 80890 - Endangered Species; File Nos. 13599 and 1614
2011-12-27
..., 263 13th Avenue South, Saint Petersburg, Florida 33701; phone (727) 824-5312; fax (727) 824-5309..., at the address listed above. Comments may also be submitted by facsimile to (301) 713-0376, or by... be valid until each permit expires. In compliance with the National Environmental Policy Act of 1969...
78 FR 7755 - Marine Mammals; File No. 17754
2013-02-04
...)713-0376; and Southeast Region, NMFS, 263 13th Avenue South, Saint Petersburg, FL 33701; phone (727..., Permits and Conservation Division, at the address listed above. Comments may also be submitted by... of 1969 (42 U.S.C. 4321 et seq.), an initial determination has been made that the activity proposed...
The Relationship between EFL Learners' Language Learning Strategy Use and Achievement
Balci, Özgül; Ügüten, Selma Durak
2018-01-01
The primary purpose of this study was to examine the relationship between language learning strategy use and foreign language achievement, focusing on differences in gender. A total of 263 English as a foreign language students enrolled in English preparatory class program at Necmettin Erbakan University, School of Foreign Languages participated…
Blau, Gary; Drennan, Rob B.; Hochner, Arthur; Kapanjie, Darin
2016-01-01
An online survey tested the impact of background, technological, and course-related variables on perceived learning and timely graduation for a complete data sample of 263 business undergraduates taking at least one online or hybrid course in the fall of 2015. Hierarchical regression results showed that course-related variables (instructor…
Huisman, H.
1988-01-01
For pt.I see ibid., vol.35, no.2, p.263-8 (1988). A 15 kW three-phase prototype series-resonant power converter is constructed. The converter features sinusoidal output voltage and sinusoidal input currents. The control concepts and necessary electronics, as well as the layout of the power circuit,
Gordon Pershey, Monica
2011-01-01
This study measured self-perceptions of school competence among 263 4th- and 6th-grade African American students who attended an academically challenged school district. Self-perceptions of school competence are defined as self-perceptions of ability, confidence, and school satisfaction. Results indicated that 4th-grade students had lesser…
Ebsworth, Miriam Eisenstein; Tang, Frank Lixing; Razavi, Nikta; Aiello, Jacqueline
2014-01-01
This study explored the effects of cultural and linguistic background, L2 proficiency, and gender on language learning strategies for 263 college-level learners from Chinese, Russian, and Latino backgrounds. Data based on the SILL (Oxford, 2001) revealed that Russian students used significantly more strategies than the Chinese students in three…
Ebsworth, Miriam Eisenstein; Tang, Frank Lixing; Razavi, Nikta; Aiello, Jacqueline
2014-01-01
This study explored the effects of cultural and linguistic background, L2 proficiency, and gender on language learning strategies for 263 college-level learners from Chinese, Russian, and Latino backgrounds. Data based on the SILL (Oxford, 2001) revealed that Russian students used significantly more strategies than the Chinese students in three…
Akça, Figen
2012-01-01
The aim of this study was to investigate the relationship between self-handicapping, academic procrastination, the locus of control and academic success. The aim was also to determine whether these variables predicted self-handicapping behavior. The population of the study consisted of 263 undergraduates studying in different departments of the…
Periodic solutions to second-order indefinite singular equations
Czech Academy of Sciences Publication Activity Database
Hakl, Robert; Zamora, M.
2017-01-01
Roč. 263, č. 1 (2017), s. 451-469 ISSN 0022-0396 Institutional support: RVO:67985840 Keywords : degree theory * indefinite singularity * periodic solution * singular differential equation Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 1.988, year: 2016 http://www.sciencedirect.com/science/article/pii/S0022039617301134
The Johannesburg cardiac rehabilitation programme | Digenio ...
African Journals Online (AJOL)
Most patients were from social classes I and 11. Myocardial infarction, coronary artery bypass graft and a combination of both were the most common reasons for admission (35,4%. 23% and 21,2% respectively). On admission 72,9% of patients were smokers, 26,3% had hypertension and 34,3% had hypercholesterolaemia.
Czech Academy of Sciences Publication Activity Database
Jírová, Alena; Klaudisová, A.; Prach, Karel
2012-01-01
Roč. 15, č. 2 (2012), 245-252 ISSN 1402-2001 R&D Projects: GA ČR(CZ) GAP505/11/0256 Institutional research plan: CEZ:AV0Z60050516 Institutional support: RVO:67985939 Keywords : succession * vegetation * abandoned fields Subject RIV: EH - Ecology, Behaviour Impact factor: 2.263, year: 2012
International Nuclear Information System (INIS)
Hueggenberg, Daniel
2015-01-01
Until 2050 the renewable energies should provide 80% of the power in Germany according to Renewable Energy law. Due to that reason the conventional power plants are not used for base load, but rather for the supply of average and peak load. The change of the operating mode leads to shorter times at stationary temperatures and the number of faster start-ups/shut-downs of the power plants will increase. As a result of this the components are exposed to an interacting load of creep and fatigue which reduces the lifetimes. The aim of this thesis is the development and verification of a lifetime assessment procedure for components made of the nickel-base alloys Alloy 617 mod. and Alloy 263 under creep fatigue loading conditions based on numerical phenomenological models and on the approaches of different standards/recommendations. The focus lies on two components of the high temperature material test rig II (HWT II), a header made of Alloy 617 mod. and Alloy 263 as well as a formed part made of Alloy 617 mod. For the basis characterization of the HWT II melts, specimens of the Alloy 617 mod. and Alloy 263 are tested in uniaxial tensile tests, (creep-)fatigue tests, creep tests and charpy tests in a temperature range between 20 C and 725 C. From the comparisons of the test results and the material specifications respectively the results of the projects COORETEC DE4, MARCKO DE2 and MARCKO700 no deviations were obvious for both materials with the exception of the creep test results with Alloy 617 mod. material. The creep tests with Alloy 617 mod. material of the HWT II melt show differences regarding the deformation and damage behavior. In addition to the basis characterization tests some complex lab tests for the characterization of the material behavior under creep-fatigue and multiaxial loading conditions were conducted. The developments of the microstructure, the precipitations as well as the structure of dislocations are investigated in the light optical microscope
Energy Technology Data Exchange (ETDEWEB)
Hueggenberg, Daniel
2015-11-06
Until 2050 the renewable energies should provide 80% of the power in Germany according to Renewable Energy law. Due to that reason the conventional power plants are not used for base load, but rather for the supply of average and peak load. The change of the operating mode leads to shorter times at stationary temperatures and the number of faster start-ups/shut-downs of the power plants will increase. As a result of this the components are exposed to an interacting load of creep and fatigue which reduces the lifetimes. The aim of this thesis is the development and verification of a lifetime assessment procedure for components made of the nickel-base alloys Alloy 617 mod. and Alloy 263 under creep fatigue loading conditions based on numerical phenomenological models and on the approaches of different standards/recommendations. The focus lies on two components of the high temperature material test rig II (HWT II), a header made of Alloy 617 mod. and Alloy 263 as well as a formed part made of Alloy 617 mod. For the basis characterization of the HWT II melts, specimens of the Alloy 617 mod. and Alloy 263 are tested in uniaxial tensile tests, (creep-)fatigue tests, creep tests and charpy tests in a temperature range between 20 C and 725 C. From the comparisons of the test results and the material specifications respectively the results of the projects COORETEC DE4, MARCKO DE2 and MARCKO700 no deviations were obvious for both materials with the exception of the creep test results with Alloy 617 mod. material. The creep tests with Alloy 617 mod. material of the HWT II melt show differences regarding the deformation and damage behavior. In addition to the basis characterization tests some complex lab tests for the characterization of the material behavior under creep-fatigue and multiaxial loading conditions were conducted. The developments of the microstructure, the precipitations as well as the structure of dislocations are investigated in the light optical microscope
Relativistic hypernuclei: old problems and new prospects
Czech Academy of Sciences Publication Activity Database
Majling, Lubomír; Lukstins, J.; Parfenov, AN.; Chren, D.; Solar, M.; Sopko, B.
2003-01-01
Roč. 53, č. 8 (2003), s. 667-677 ISSN 0011-4626 R&D Projects: GA ČR GA202/02/0930; GA AV ČR KSK1048102 Keywords : quantum wave -guides * Schrödinger-operators * Dirichlet Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 0.263, year: 2003
North Atlantic weather oscillation and human infectious diseases in the Czech Republic, 1951-2003
Czech Academy of Sciences Publication Activity Database
Hubálek, Zdeněk
2005-01-01
Roč. 20, č. 3 (2005), s. 263-270 ISSN 0393-2990 R&D Projects: GA ČR(CZ) GA206/03/0726 Institutional research plan: CEZ:AV0Z60930519 Keywords : climate change * cluster analysis * human infectious diseases Subject RIV: FN - Epidemiology, Contagious Diseases ; Clinical Immunology Impact factor: 1.361, year: 2005
Journal of Chemical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
LCAE, Département de Chimie, Faculté des Sciences, Université Mohammed Premier, Oujda 60000, Morocco; Institut de Physique de Rennes, UMR 625, Université de Rennes 1, Campus de Beaulieu Bat. 11 A, 263 av. Général Leclerc, 35042 Rennes Cedex, France; Department of Chemistry, University of Science ...
Sadhana | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Sadhana. M Komaraiah. Articles written in Sadhana. Volume 36 Issue 2 April 2011 pp 223-249. In-plane anisotropy in tensile deformation and its influence on the drawability of Nimonic C–263 alloy sheets · K Ankamma D V V Satyanarayana G Chandramohan Reddy M Komaraiah N Eswara Prasad.
Sadhana | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Sadhana. K Ankamma. Articles written in Sadhana. Volume 36 Issue 2 April 2011 pp 223-249. In-plane anisotropy in tensile deformation and its influence on the drawability of Nimonic C–263 alloy sheets · K Ankamma D V V Satyanarayana G Chandramohan Reddy M Komaraiah N Eswara Prasad.
Indian Academy of Sciences (India)
Home; Journals; Sadhana. G Chandramohan Reddy. Articles written in Sadhana. Volume 36 Issue 2 April 2011 pp 223-249. In-plane anisotropy in tensile deformation and its influence on the drawability of Nimonic C–263 alloy sheets · K Ankamma D V V Satyanarayana G Chandramohan Reddy M Komaraiah N Eswara ...
Profile of children with cerebral palsy attending outpatient ...
African Journals Online (AJOL)
Jaundice (39.9%), asphyxia (26.8%) and infection (17.4%) were the leading causes of CP and spastic CP was the most common type (81.7%). Quadriplegic CP presentation was predominant (67.1%), and leading co-morbidities were mental retardation (31%) and speech impairment (26.3%). About 50% of the children ...
Hobojista Arnošt König a jeho působení v pražském hudebním životě
Czech Academy of Sciences Publication Activity Database
Kolátorová, Petra
2012-01-01
Roč. 49, č. 3 (2012), s. 263-284 ISSN 0018-7003 R&D Projects: GA ČR GA408/08/1020 Institutional support: RVO:68378076 Keywords : Arnošt König * oboist * Prague´s musical life * Antonín Dvořák Subject RIV: AL - Art, Architecture, Cultural Heritage
Czech Academy of Sciences Publication Activity Database
Kučera, Jan; Zeisler, R.
2005-01-01
Roč. 263, č. 3 (2005), s. 811-816 ISSN 0236-5731 R&D Projects: GA ČR GA202/03/0891 Institutional research plan: CEZ:AV0Z10480505 Keywords : gel breast implants * alzhemers-disease * renal-failure Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.460, year: 2005
Holloway, Ian W.; Schrager, Sheree M.; Wong, Carolyn F.; Dunlap, Shannon L.; Kipke, Michele D.
2014-01-01
House and Ball communities (HBCs), represent a prime context for human immunodeficiency virus prevention with African American young men who have sex with men and transgender persons. This study sought to understand the composition and function of social support and sexual networks of HBC members in Los Angeles, California (N = 263). Participants…
probing the cob(ii)alamin conductor hypothesis with glutamate ...
African Journals Online (AJOL)
dell
Glutamate mutase activity was also demonstrated upon incubation of GlmS and E with 3',5'- ... overproduced in E.coli (Huhta et al. 2001,. Huhta et ..... Biochemistry. 37: 9704-9715. Buckel W 2001 Unusual enzymes involved in five pathways of glutamate fermentation. Appl. Microbiol. Biotechnol. 57: 263-273. Buckel W and ...
Halme, Nina; Astedt-Kurki, Paivi; Tarkka, Marja-Terttu
2009-01-01
The purpose of this study was to describe how fathers (n = 263) spent time with their preschool-age children and to compare it in different family structures. Data were gathered by structured questionnaires. The instrument included five categories of variables for the time spent: the quantity of time, physical activities, fathers' attitude towards…
2015-06-12
sending their men to fight the British or to die trying. Like the rage militaire that spurred men to surround the city of Boston, public support for...those around him “with vast ease and dignity , and dispens[ed] happiness around him.”263 Washington also consulted with and advised the Continental
African Journals Online (AJOL)
Babalola OE, Rachel Eye Center, PO Box 4108, Garki, Abuja. M ESUGA (MBBS). PKATO YOHANA (RN, Diploma in ... This can often best be achieved through eye camps. Outreach programmes also help to define the extent of .... prescribed eye drops for glaucoma. Ophthalmic Surg 1995;. 26(3): 233-6. Thomas R and ...
Differential immunodominance hierarchy of CD8+ T-cell responses in HLA-B*27
DEFF Research Database (Denmark)
Adland, Emily; Hill, Matilda; Lavandier, Nora
2018-01-01
The well-characterized association between HLA-B*27:05 and protection against HIV disease progression has been linked to immunodominant HLA-B*27:05- restricted CD8+ T-cell responses toward the conserved Gag KK10 (residues 263 to 272) and polymerase (Pol) KY9 (residues 901 to 909) epitopes. We stu...
Nelson, Jackie A.; de Lucca Freitas, Lia Beatriz; O'Brien, Marion; Calkins, Susan D.; Leerkes, Esther M.; Marcovitch, Stuart
2013-01-01
Developmental precursors to children's early understanding of gratitude were examined. A diverse group of 263 children was tested for emotion and mental state knowledge at ages 3 and 4, and their understanding of gratitude was measured at age 5. Children varied widely in their understanding of gratitude, but most understood some aspects of…
Yet another call for a greater role for good faith in the South African ...
African Journals Online (AJOL)
NWUuser
(Pty) Ltd and a KwaZulu-Natal franchisee, Dula Investments (Pty) Ltd, .... Company v The Paul Armstrong Company 263 NY 79; 188 NE 163; 1933 NY 167 (as recently ..... where his best advantage lies has a state of mind that falls short of the ...... ravages of apartheid, disadvantage and inequality are just immeasurable.
Journal of Astrophysics and Astronomy | Indian Academy of Sciences
Indian Academy of Sciences (India)
Author Affiliations. A. Pirya1 S. Nandi1 D. J. Saikia2 C. Konar3 M. Singh1. Aryabhatta Research Institute of Observational Sciences, Manora Peak, Nainital 263 129, India. National Centre for Radio Astrophysics, Pune University Campus, Post Bag 3, Pune 411 007, India. ASIAA, Taipei 10617, Taiwan, Republic of China.
Educators vs. Entrepreneurs: Traits and Bias in the Teaching of SWOT
Clark, Andre
2011-01-01
A study of the marks allocated by 10 tutors to 263 students' SWOT (Strengths, Weaknesses, Opportunities, Threats) analyses on a range of business education courses reveals a largely hidden assumption regarding the balance of the four factors. To investigate the significance of this in light of the suggestion in the trait literature that…
Measurements of fast-neutron-induced signals in silicon pad detectors
Czech Academy of Sciences Publication Activity Database
Linhart, V.; Bedajanek, I.; Bém, Pavel; Götz, Miloslav; Honusek, Milan; Pospíšil, S.; Šimečková, Eva
2006-01-01
Roč. 563, č. 1 (2006), s. 263-267 ISSN 0168-9002 R&D Projects: GA MPO(CZ) 1H-PK/07 Institutional research plan: CEZ:AV0Z10480505 Keywords : background signals * neutron reactions * solid-state detectors Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.185, year: 2006
Proceedings – Mathematical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Proceedings – Mathematical Sciences. Vijay Kodiyalam. Articles written in Proceedings – Mathematical Sciences. Volume 110 Issue 3 August 2000 pp 263-292. The Algebra of -relations · Vijay Kodiyalam R Srinivasan V S Sunder · More Details Abstract Fulltext PDF. In this paper, we study a tower { A n G ...
Review of adult head injury admissions into the intensive care unit of ...
African Journals Online (AJOL)
The most common mode of injury was road traffic accident. All the patients admitted to ICU had either moderate or severe head injury, with 73.7% having severe head injury. About 26.3% of the patients had associated cervical spine injuries and 50% had various musculoskeletal and soft tissue injuries. Cranial computed ...
Evaluation of age and peripheral vascular disease as risk factors for ...
African Journals Online (AJOL)
Results: Among the 120 diabetic participants, peripheral vascular disease (PVD) was detected only in those aged 50 years and above and all the three diagnostic methods detected PVD increasingly with advancing age. Clinical criteria detected PVD in 4.7% of those aged 50-59 years and 26.3% of those aged .70years.
75 FR 42689 - Marine Mammals; File Nos. 15498 and 15500
2010-07-22
...-9394; and File No. 15500: Southeast Region, NMFS, 263 13th Avenue South, Saint Petersburg, FL 33701... Beard, (301) 713-2289. SUPPLEMENTARY INFORMATION: On May 3, 2010, notice was published in the Federal... Policy Act of 1969 (42 U.S.C. 4321 et seq.), a final determination has been made that the activity...
76 FR 63286 - Marine Mammals; File No. 15537
2011-10-12
..., Silver Spring, MD 20910; phone (301) 427-8401; fax (301) 713-0376; and Southeast Region, NMFS, 263 13th... INFORMATION CONTACT: Jennifer Skidmore or Amy Sloan, (301) 427-8401. SUPPLEMENTARY INFORMATION: On May 20... activities on the human environment in compliance with the National Environmental Policy Act of 1969 (42 U.S...
77 FR 13562 - Marine Mammals; File No. 14241
2012-03-07
... the permit, July 31, 2014. In compliance with the National Environmental Policy Act of 1969 (42 U.S.C.... Documents may be reviewed in the following locations: Permits and Conservation Division, Office of Protected... Southeast Region, NMFS, 263 13th Avenue South, Saint Petersburg, FL 33701; phone (727) 824-5312; fax (727...
75 FR 23242 - Marine Mammals; File Nos. 15498 and 15500
2010-05-03
... (978) 281-9394; and File No. 15500: Southeast Region, NMFS, 263 13th Avenue South, Saint Petersburg, FL... the address listed above. Comments may also be submitted by facsimile to (301) 713-0376, or by email... activities stated in the applications. In compliance with the National Environmental Policy Act of 1969 (42 U...
2011-12-02
..., 263 13th Avenue South, Saint Petersburg, Florida 33701; phone (727) 824-5312; fax (727) 824-5309. FOR... (Globicephala melas), although other small cetacean species may also be studied. The locations for the field... of 1969 (42 U.S.C. 4321 et seq.), an initial determination has been made that the activity proposed...
78 FR 56218 - Marine Mammals; File No. 18171
2013-09-12
...; and Southeast Region, NMFS, 263 13th Avenue South, Saint Petersburg, FL 33701; phone (727) 824-5312... Conservation Division, at the address listed above. Comments may also be submitted by facsimile to (301) 713... mammal program. In compliance with the National Environmental Policy Act of 1969 (42 U.S.C. 4321 et seq...
77 FR 45592 - Marine Mammals; File No. 17157
2012-08-01
..., Silver Spring, MD 20910; phone (301) 427-8401; fax (301) 713-0376; and Southeast Region, NMFS, 263 13th... INFORMATION CONTACT: Laura Morse or Jennifer Skidmore, (301) 427-8401. SUPPLEMENTARY INFORMATION: On May 21... 1969 (42 U.S.C. 4321 et seq.), a final determination has been made that the activity proposed is...
77 FR 33444 - Marine Mammals; File No. 17217
2012-06-06
... (301) 427-8401; fax (301) 713-0376; and Southeast Region, NMFS, 263 13th Avenue South, Saint Petersburg... National Environmental Policy Act of 1969 (42 U.S.C. 4321 et seq.), a final determination has been made... assessment or environmental impact statement. Dated: May 30, 2012. Tammy C. Adams, Acting Chief, Permits and...
75 FR 29991 - Marine Mammals; receipt of application for permit amendment
2010-05-28
...; phone (978)281-9300; fax (978)281-9333; and Southeast Region, NMFS, 263 13th Avenue South, Saint... delphinids such as long-finned pilot whales (Globicephala melas), although other small cetacean species may... expiration date of the permit. In compliance with the National Environmental Policy Act of 1969 (42 U.S.C...
78 FR 69049 - Marine Mammals; File No. 18171
2013-11-18
... (301) 427-8401; fax (301) 713-0376; and Southeast Region, NMFS, 263 13th Avenue South, Saint Petersburg... and 60 killer whales, could be approached and filmed annually. Filming may occur year-round. The... 1969 (42 U.S.C. 4321 et seq.), a final determination has been made that the activity proposed is...
76 FR 51001 - Marine Mammals; File Nos. 16109 and 15575
2011-08-17
... Southeast Region, NMFS, 263 13th Avenue South, Saint Petersburg, FL 33701; phone (727) 824-5312; fax (727..., Conservation and Education Division, at the address listed above. Comments may also be submitted by facsimile... in compliance with the National Environmental Policy Act of 1969 (42 U.S.C. 4321 et seq.), to examine...
Intrapartální fetální monitoring, senzitivita a specificita metod
Czech Academy of Sciences Publication Activity Database
Hájek, Z.; Srp, B.; Pavlíková, Markéta; Zvárová, Jana; Liška, K.; Haddad El, R.; Pašková, A.; Pařízek, A.
2006-01-01
Roč. 71, č. 4 (2006), s. 263-267 ISSN 1210-7832 Grant - others:GA MZd(CZ) NH7664 Institutional research plan: CEZ:AV0Z10300504 Keywords : senzitivita * specificita * diagnostika hypoxie * kardiotokografie * fetální pulzní oxymetrie * ST analýza EKG plodu Subject RIV: BB - Applied Statistics, Operational Research
Long-term monitoring of native bullhead and invasive gobiids in the Danubian rip-rap zone
Czech Academy of Sciences Publication Activity Database
Janáč, Michal; Roche, Kevin Francis; Šlapanský, Luděk; Polačik, Matej; Jurajda, Pavel
2018-01-01
Roč. 807, č. 1 (2018), s. 263-275 ISSN 0018-8158 R&D Projects: GA ČR(CZ) GBP505/12/G112 Institutional support: RVO:68081766 Keywords : Competition * Fish population structure * Invasive species impact * Ponto–Caspian gobies * River bank stabilisation Subject RIV: EG - Zoology Impact factor: 2.056, year: 2016
Indian Academy of Sciences (India)
Home; Journals; Bulletin of Materials Science. K Srinivasan. Articles written in Bulletin of Materials Science. Volume 23 Issue 1 February 2000 pp 35-37 Metallic Materials. Impact toughness of ternary Al–Zn–Mg alloys in as cast and homogenized condition measured in the temperature range 263–673 K · Harish Kundar ...
African Journals Online (AJOL)
abp
2017-09-27
Sep 27, 2017 ... protein, carotid intima -media thickness and asymmetric dimethyl arginine have been .... with LVH had a higher body mass index (27.3 vs 26.3, p=0.04) and were slightly .... adversely impacts cardiovascular morbidity and mortality in CKD patients [2-4]. ... conceptualized and designed the study. Yaw Ampem ...
Czech Academy of Sciences Publication Activity Database
Aad, G.; Abbott, B.; Abdallah, J.; Chudoba, Jiří; Havránek, Miroslav; Hejbal, Jiří; Jakoubek, Tomáš; Kepka, Oldřich; Kupčo, Alexander; Kůs, Vlastimil; Lokajíček, Miloš; Lysák, Roman; Marčišovský, Michal; Mikeštíková, Marcela; Němeček, Stanislav; Šícho, Petr; Staroba, Pavel; Svatoš, Michal; Taševský, Marek; Vrba, Václav
2015-01-01
Roč. 75, č. 6 (2015), s. 263 ISSN 1434-6044 R&D Projects: GA MŠk(CZ) LG13009 Institutional support: RVO:68378271 Keywords : ATLAS * CERN LHC Coll * mass spectrum * (Z0 Higgs particle) * technicolor * background * triplet Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 4.912, year: 2015
Effects of Malnutrition as a Co-Morbid Factor on Neurocognitive ...
African Journals Online (AJOL)
Objectives: To investigate the effects of malnutrition as a co-morbid factor on neurocognitive functioning in HIV positive adults in Lusaka. Design: A cross- sectional study consisting of 263 participants. The sample comprised of 109 (40.2 %) males and 162 (59.8%) females with an age range of between 20 and 65 years.
The objective of this research was to investigate the effects on plasma metabolites and rumen measures when butyrate was infused into the rumen or abomasum of lactating cows. Jugular catheters were inserted into 5 ruminally fistulated Holstein cows (94.2 ± 26.3 days in milk [DIM]; 717 ± 45 kg body w...
Indian Academy of Sciences (India)
Bhat B V Radhakrishna -. Increase in the yield of silicon carbide whiskers from rice husk 295. Bhattacherjee S see Datta A. K. 103. Bhoga SS see Singh K 263. Bhushan Bharat see Kashyap C Subhash 169. Byrappa K ... of the microhardness and compression testing of ferroelectric lead nitrate phosphate single crystals 343.
Sorption of Sr(II) onto nanocomposites of graphene oxide-polymeric matrix
Czech Academy of Sciences Publication Activity Database
Bubeníková, M.; Ecorchard, Petra; Szatmáry, L.; Mrózek, Ondřej; Salačová, P.; Tolasz, Jakub
2018-01-01
Roč. 315, č. 2 (2018), s. 263-272 ISSN 0236-5731 R&D Projects: GA TA ČR(CZ) TA04020222 Institutional support: RVO:61388980 Keywords : Graphene oxide * Nanocomposite * PA66 * Polystyrene * Radiostrontium removal Subject RIV: CA - Inorganic Chemistry OBOR OECD: Inorganic and nuclear chemistry Impact factor: 1.282, year: 2016
26 CFR 1.263(b)-1 - Expenditures for advertising or promotion of good will.
2010-04-01
... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Expenditures for advertising or promotion of... advertising or promotion of good will. See § 1.162-14 for the rules applicable to a corporation which has elected to capitalize expenditures for advertising or the promotion of good will under the provisions of...
SU-E-J-263: Repeatability of SUV and Texture Parameters in Serial PET Studies
Energy Technology Data Exchange (ETDEWEB)
Schwartz, J; Humm, J; Nehmeh, S; Schoder, H [Memorial Sloan-Kettering Cancer Center, New York, NY (United States)
2015-06-15
Purpose: Standardized uptake values (SUV) are standard quantitative PET measures of FDG tumor uptake used,and are used as a tool to monitor response to therapy. Textural analysis is emerging as a new tool for assessing intratumoral heterogeneity which may allow better tissue characterization and improved prediction of response and survival rate.Understanding what variations may be expected in these parameters is key in order to make decisions based on how the change throughout the course of treatment. The aim of this study was to assess repeatability in SUV measures and texture parameters,and establish criteria that differentiate changes associated with treatment rather than statistical variability. Methods: Eighty patients,167 random lesions total,were scanned in a GE Discovery STE PET/CT Scanner. One field-of-view was chosen centered on the largest lesion observed in a clinical whole-body FDG PET.Immediately following,a gated 9 min scan was acquired in list mode,without changing the patient’s position between any scans. Data was replayed into 3 time bins,3 min each,in order to insure equivalent noise characteristics in each replicate.Data was reconstructed into 128×128×47 square matrices.One VOI was drawn over each lesion for each patient and used to segment all 3 replicates. The mean.max and peak SUV were calculated for each VOI and replicate. First-order textural features were also calculated (skewness and kurtosis). Repeatability was calculated as the average standard deviation over the mean for the 3 repeated measurements for each lesion. Results: The average percent error in the SUV max,peak and mean were 3.4%(0– 12.9%),1.9% (0–7.5%),2.8% (0–12.2%),respectively.For skewness and kurtosis they were 10.9% and 17.8%. Conclusion: We have shown that there is a large variation in %error in SUV measures across patients. SUVpeak is the least variable and kurtosis and skewness parameters are less reliable thatn SUVs.Higher order textures are be.
SU-E-J-263: Repeatability of SUV and Texture Parameters in Serial PET Studies
International Nuclear Information System (INIS)
Schwartz, J; Humm, J; Nehmeh, S; Schoder, H
2015-01-01
Purpose: Standardized uptake values (SUV) are standard quantitative PET measures of FDG tumor uptake used,and are used as a tool to monitor response to therapy. Textural analysis is emerging as a new tool for assessing intratumoral heterogeneity which may allow better tissue characterization and improved prediction of response and survival rate.Understanding what variations may be expected in these parameters is key in order to make decisions based on how the change throughout the course of treatment. The aim of this study was to assess repeatability in SUV measures and texture parameters,and establish criteria that differentiate changes associated with treatment rather than statistical variability. Methods: Eighty patients,167 random lesions total,were scanned in a GE Discovery STE PET/CT Scanner. One field-of-view was chosen centered on the largest lesion observed in a clinical whole-body FDG PET.Immediately following,a gated 9 min scan was acquired in list mode,without changing the patient’s position between any scans. Data was replayed into 3 time bins,3 min each,in order to insure equivalent noise characteristics in each replicate.Data was reconstructed into 128×128×47 square matrices.One VOI was drawn over each lesion for each patient and used to segment all 3 replicates. The mean.max and peak SUV were calculated for each VOI and replicate. First-order textural features were also calculated (skewness and kurtosis). Repeatability was calculated as the average standard deviation over the mean for the 3 repeated measurements for each lesion. Results: The average percent error in the SUV max,peak and mean were 3.4%(0– 12.9%),1.9% (0–7.5%),2.8% (0–12.2%),respectively.For skewness and kurtosis they were 10.9% and 17.8%. Conclusion: We have shown that there is a large variation in %error in SUV measures across patients. SUVpeak is the least variable and kurtosis and skewness parameters are less reliable thatn SUVs.Higher order textures are be
Pelton, Rick; Espy, John
This third in a series of seven modules for a course titled Nondestructive Examination (NDE) Techniques I describes the principles and practices associated with hydrostatic testing. The module follows a typical format that includes the following sections: (1) introduction, (2) module prerequisites, (3) objectives, (4) notes to instructor/student,…
26 CFR 1.263A-4 - Rules for property produced in a farming business.
2010-04-01
... the end of 7 months, Farmer B takes possession of the plants and plants them in the permanent orchard...): Example 1. Farmer A grows trees that have a preproductive period in excess of 2 years, and that produce an annual crop. Farmer A is not required by section 447 to use an accrual method or prohibited by section...
Konkomitantes Auftreten von Lichen sclerosus und Hashimoto-Thyreoiditis
Directory of Open Access Journals (Sweden)
Eberz B
2009-01-01
Full Text Available Der Lichen sclerosus (LS zählt zu den chronisch entzündlichen Hauterkrankungen, der auf dem Boden einer Immundysregulierung entsteht. Per 01.06.2009 war die Prävalenz des klinisch und stanzbioptisch diagnostizierten anogenitalen Lichen sclerosus in einer allgemein gynäkologischen Praxis in Mürzzuschlag 9,1 % (278/3040 Patientinnen. Die frühzeitige Abklärung chronischer Vulvabeschwerden unter standardmäßiger Einbeziehung einer Vulvabiopsie erlaubte es, auch Frühformen des LS zu erfassen. Nach klinischer und stanzbioptischer Diagnose eines LS wird in Anlehnung an die "Guidelines for the Management of Lichen Sclerosus" [1] ein serologisches Screening auf Autoantikörper (TPO-AK, TG-AK, Parietalzell- und antinukleäre Antikörper durchgeführt. Bei 263 unserer 278 LS-Patientinnen wurde ein serologisches Screening auf Autoimmunerkrankungen durchgeführt. Insgesamt hatten 58/263 LS-Patientinnen pathologisch erhöhte Thyroidperoxidase-(TPO- und/oder Thyreoglobulin- (TG- Antikörpertiter (23 %, davon 50/263 (19 % auch eine sonographisch bestätigte Hashimoto-Thyreoiditis. Bei 50 % dieser Hashimoto-Patientinnen war bereits im Vorfeld eine Hypothyreose bekannt, bei den restlichen 25 Patientinnen handelte es sich allerdings um eine Erstdiagnose im Rahmen des Screenings für LS. Aufgrund der hohen Prävalenz von Hashimoto-Thyreoiditis in LS-Patientinnen empfehlen wir bei allen Frauen mit LS ein Screening auf TPO- und TG-Antikörper. Bei erhöhten Titern sollte eine Abklärung mittels Schilddrüsensonogramm sowie eine Bestimmung von basalem "thyroid-stimulating hormone" (TSH, freiem T3 und freiem T4 erfolgen. In der Schilddrüsensprechstunde sollten Frauen mit Hashimoto-Thyreoiditis gezielt nach chronischen bzw. rezidivierenden anogenitalen Beschwerden, insbesondere Pruritus, Brennen oder Dyspareunie befragt werden. Bei positiver Anamnese ist eine Zuweisung an einen auf Vulvaerkrankungen spezialisierten Facharzt für Gynäkologie sinnvoll.
Study of plasmonics in hybrids made from a quantum emitter and double metallic nanoshell dimer
Guo, Jiaohan; Black, Kevin; Hu, Jiawen; Singh, Mahi
2018-05-01
We developed a theory for the fluorescence (FL) for quantum emitter and double metallic nanoshell dimer hybrids using the density matrix method. The dimer is made from two identical double metallic nanoshells, which are made of a dielectric core, a gold metallic shell and a dielectric spacer layer. The quantum emitters are deposited on the surface of the spacer layers of the dimers due to the electrostatic absorptions. We consider that dimer hybrids are surrounded by biological cells. This can be achieved by injecting them into human or animal cells. The surface plasmon polaritons (SPP) are calculated for the dimer using Maxwell’s equations in the static wave approximation. The calculated SPP energy agrees with experimental data from Zhai et al (2017 Plasmonics 12 263) for the dimer made from a silica core, a gold metallic nanoshell and a silica spacer layer. We have also obtained an analytical expression of the FL using the density matrix method. We compare our theory with FL experimental data from Zhai et al (2017 Plasmonics 12 263) where the FL spectrum was measured by varying the thickness of the spacer layer from 9 nm to 40 nm. A good agreement between theory and experiment is found. We have shown that the enhancement of the FL increases as the thickness of the spacer layer decreases. We have also found that the enhancement of the FL increases as the distance between the double metallic nanoshells in the dimer decreases. These are interesting findings which are consistent with the experiments of Zhai et al (2017 Plasmonics 12 263) and can be used to control the FL enhancement in the FL-based biomedical imaging and cancer treatment. These interesting findings may also be useful in the fabrication of nanosensors and nanoswitches for applications in medicine.
Lifescience Database Archive (English)
Full Text Available 27-F10, full insert seque... 264 2e-69 tr|Q40093|Q40093_IPONI PNIL34 OS=Ipomoea nil GN=PNIL 34 PE=2 SV=1 263...LVY 487 VKNL+R+P Y M P++SGSVD AEFEPQLVY Sbjct: 367 VKNLKRIPHVAALVSEIIAAYLMPPIESGSVDFAEFEPQLVY 408 >tr|Q40093|Q40093_IPONI PNIL34
Markets and medicine: the politics of health care reform in Britain, Germany, and the United States
National Research Council Canada - National Science Library
Giaimo, Susan
2002-01-01
...: The Limits of Markets in Health Care 193 Appendix: Information on Interviews and Methodology 225 Notes 233 Bibliography 263 Index 293 List of TablesTables I. Physicians' Earnings Relative to Other Occupations in the United Kingdom, Germany, and the United States, 1965-92 13 2. Physicians' Mean Gross Income in the United Kingdom, Germany, and...
VizieR Online Data Catalog: Inner/outer HII regions: galaxy sample (Rodriguez-Baras+, 2018)
Rodriguez-Baras, M.; Diaz, A. I.; Rosales-Ortega, F. F.; Sanchez, S. F.
2017-11-01
Physical properties for 263 isolated spiral galaxies, observed by the CALIFA survey, are presented. These galaxies compose this work galaxy sample. For each galaxy redshift, morphological type, inclination, distance, effective radius, g and r SDSS magnitudes, absolute B magnitude and total number of HII regions extracted in the galaxy are given. (1 data file).
20 CFR 628.804 - Authorized services.
2010-04-01
...) Schoolwide projects for low-income schools shall meet the conditions in sections 263(g)(1) and (2) of the Act... programs that coordinate educational programs with work in the private sector. Subsidized wages are not... this chapter and shall: (i) Be for positions that pay the participant a wage that equals or exceeds on...
Cross-Cultural Comparison of Anxiety Symptoms in Colombian and Australian Children
Amaya, Andrea Crane; Campbell, Marilyn
2010-01-01
Introduction: This cross-cultural study compared both the symptoms of anxiety and their severity in a community sample of children from Colombia and Australia. Method: The sample comprised 516 children (253 Australian children and 263 Colombian children), aged 8 to 12-years-old. The Spence Children's Anxiety Scale (SCAS) was used to measure both…
Blurring alien introduction pathways risks losing focus on invasive species policy
Czech Academy of Sciences Publication Activity Database
Hulme, P. E.; Bacher, S.; Kenis, M.; Kühn, I.; Pergl, Jan; Pyšek, Petr; Roques, A.; Vila, M.
2017-01-01
Roč. 10, č. 2 (2017), s. 265-266 ISSN 1755-263X Grant - others:AV ČR(CZ) AP1002 Program:Akademická prémie - Praemium Academiae Institutional support: RVO:67985939 Keywords : biological invasions * introductions pathways * management Subject RIV: EH - Ecology, Behaviour OBOR OECD: Biodiversity conservation Impact factor: 7.020, year: 2016
Czech Academy of Sciences Publication Activity Database
Hofmeister, Jeňýk; Hošek, J.; Brabec, Marek; Kočvara, R.
2017-01-01
Roč. 401, OCT (2017), s. 255-263 ISSN 0378-1127 Institutional support: RVO:67179843 ; RVO:67985807 Keywords : Clearing * Dryocopus martius * Forest bird * Forest management * Generalized additive model * Habitat fragmentation Subject RIV: GK - Forestry; BB - Applied Statistics, Operational Research (UIVT-O) OBOR OECD: Forestry; Statistics and probability (UIVT-O) Impact factor: 3.064, year: 2016
Effect of plant species richness on weed invasion in experimental plant communities
Czech Academy of Sciences Publication Activity Database
Lanta, Vojtěch; Lepš, Jan
2008-01-01
Roč. 198, č. 2 (2008), s. 253-263 ISSN 1385-0237 R&D Projects: GA ČR GD206/03/H034; GA MŠk LC06073 Institutional research plan: CEZ:AV0Z60050516; CEZ:AV0Z50070508 Keywords : Biodiversity * Invasion * Weeds Subject RIV: EF - Botanics Impact factor: 1.730, year: 2008
2010-04-01
... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Riboflavin. 73.450 Section 73.450 Food and Drugs... ADDITIVES EXEMPT FROM CERTIFICATION Foods § 73.450 Riboflavin. (a) Identity. (1) The color additive riboflavin is the riboflavin defined in the Food Chemicals Codex, 3d Ed. (1981), pp. 262-263, which is...
Arithmetic on the European Logarithmic Microprocessor
Czech Academy of Sciences Publication Activity Database
Coleman, J. N.; Chester, E. I.; Softley, C. I.; Kadlec, Jiří
2000-01-01
Roč. 49, č. 7 (2000), s. 702-715 ISSN 0018-9340 Grant - others:MŠMT(CZ) OK 314; MŠMT(CZ) LN00B096; Commission EC(XE) ESPRIT 33544 HSLA Program:OK; LN Institutional research plan: AV0Z1075907 Subject RIV: JC - Computer Hardware ; Software Impact factor: 1.263, year: 2000
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education. Edward U Lorenz. Articles written in Resonance – Journal of Science Education. Volume 20 Issue 3 March 2015 pp 260-263 Classics. Predictability: Does the Flap of a Butterfly's Wings in Brazil Set off a Tornado in Texas? Edward U Lorenz · More Details Fulltext ...
de Graaf, Hanneke; Vanwesenbeeck, Ine; Woertman, Liesbeth; Keijsers, Loes; Meijer, Suzanne; Meeus, Wim
2010-01-01
This study investigated age- and gender-specific associations between parental support and parental knowledge of the child's whereabouts, on the one hand, and sexual experience and sexual health (the ability to have safe and pleasurable sexual experiences) on the other hand. A representative Dutch sample of 1,263 males and 1,353 females (aged…
Journal of Genetics | Indian Academy of Sciences
Indian Academy of Sciences (India)
These results suggest that sexual preference may be influenced in a significant proportion of homosexual men by a biological/genetic factor that also controls direction of hair-whorl rotation. pp 257-263 Research Article. Cloning of a novel gene, Cymg1, related to family 2 cystatins and expressed at specific stages of mouse ...
Indian Academy of Sciences (India)
Potentials of Potatoes: A Surprise in Newtonian Gravity*. T Padmanabhan. * This is based on an article originally published by the au- thor in Physics Education, Vol. 22, No. 4, p.263, 2006. T Padmanabhan works at. IUCAA, Pune and is interested in all areas of theoretical physics, especially those which have something to ...