First thermochemical property of Seaborgium determined
Energy Technology Data Exchange (ETDEWEB)
Tuerler, A. for a LBNL Berkeley - Univ. Bern - FLNR Dubna -GSI Darmstadt - TU Dresden - Chalmers Univ. of Technology Goeteborg - GH Kassel - ITS and LLNL Livermore - Univ. Mainz - Univ. Oslo - FZ Rossendorf - JAERI Tokai - PSI Villigen collaboration
1997-09-01
The chemical properties of SgO{sub 2}Cl{sub 2} (element 106 = Seaborgium, Sg) were successfully studied using the On-line Gas Chromatography Apparatus (OLGA III). After chemical separation of Sg the nuclides {sup 265}Sg and {sup 266}Sg were unambiguously identified and their half-lives were determined for the first time. The Sg nuclides were produced from the {sup 248}Cm({sup 22}Ne,4,5n){sup 266,265}Sg reaction at the GSI Darmstadt UNILAC accelerator. Simultaneously, short-lived W nuclides were produced from a small admixture of {sup 152}Gd to the Cm target material. As predicted by relativistic calculations and by extrapolations of chemical properties, it was demonstrated that Sg oxychlorides are indeed less volatile than their lighter homologue Mo- and equally or less volatile than W-oxychlorides. (author) 1 fig., 1 tab., 4 refs.
International Nuclear Information System (INIS)
Schumann, D.; Andrassy, M.; Nitsche, H.; Misiak, R.; Schaedel, M.; Bruechle, W.; Schausten, B.; Kratz, J.V.
1997-08-01
In model experiments with W, Hf, Th, and U radionuclides, a chemical system was developed for the separation of seaborgium from element 104 and heavy actinides, i.e., cation exchange on DOWEX 50 x 8 from solutions containing 0.1-1.0 M HCl and 0.5-2.0 vol.% H 2 O 2 . The system should be suitable for fast on-line experiments if seaborgium exibits a non-uranium-like behaviour. Adding hydrogen peroxide to mixed HCl/HF solutions suppresses the partial sorption of W and, presumably seaborgium, on the cation exchanger. This way, the elution volume can be minimized. Prospects for anion exchange separations of group 6 from 4 elements are also briefly discussed. (orig.)
First aqueous chemistry with Seaborgium (element 106)
International Nuclear Information System (INIS)
Schaedel, M.; Bruechle, W.; Schausten, B.; Schimpf, E.; Jaeger, E.; Wirth, G.; Guenther, R.; Gregorich, K.E.; Hoffman, D.C.; Lee, D.M.; Sylwester, E.R.; Nagame, Y.; Oura, Y.
1996-11-01
For the first time, chemical separations of element 106 (Seaborgium, Sg) were performed in aqueous solutions. The isotopes 265 Sg and 266 Sg were produced in the 248 Cm+ 22 Ne reaction at a beam energy of 121 MeV. The reaction products were continuously transported by a He(KCl)-jet to the computer-controlled liquid chromatography system ARCA. In 0.1 M HNO 3 /5 x 10 -4 M HF, Sg was found to be eluted within 10 s from 1.6 x 8 mm cation-exchange columns (Aminex A6, 17.5±2 μm) together with the hexavalent Mo- and W-ions, while hexavalent U-ions and tetravalent Zr-, Hf-, and element 104 ions were strongly retained on the column. Element 106 was detected by measuring correlated α-decays of the daughter isotopes 78-s 261 104 and 26-s 257 102. For the isotope 266 Sg, we have evidence for a spontaneous fission branch. It yields a partial spontaneous-fission half-life which is in agreement with recent theoretical predictions. The chemical results show that the most stable oxidation state of Sg in aqueous solution is +6, and that like its homologs Mo and W, Sg forms neutral or anionic oxo- or oxohalide-compounds under the present condition. In these first experiments, Sg exhibits properties very characteristic of group 6 elements, and does not show U-like properties. (orig.)
16 CFR 260.6 - General principles.
2010-01-01
... ENVIRONMENTAL MARKETING CLAIMS § 260.6 General principles. The following general principles apply to all environmental marketing claims, including, but not limited to, those described in § 260.7. In addition, § 260.7... 16 Commercial Practices 1 2010-01-01 2010-01-01 false General principles. 260.6 Section 260.6...
2010-01-01
... 7 Agriculture 7 2010-01-01 2010-01-01 false Information. 868.260 Section 868.260 Agriculture... Governing Application of Standards § 868.260 Information. Requests for the Rice Inspection Handbook, Equipment Handbook, or for information concerning approved devices and procedures, criteria for approved...
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Facilities. 260.100 Section 260.100... Basis 1 § 260.100 Facilities. Each official establishment shall be equipped with adequate sanitary facilities and accommodations, including, but not being limited to, the following: (a) Containers approved...
2010-07-01
... 40 Protection of Environment 17 2010-07-01 2010-07-01 false Definitions. 82.260 Section 82.260... STRATOSPHERIC OZONE Halon Emissions Reduction § 82.260 Definitions. Halon-containing equipment means equipment.... This group consists of the three halogenated hydrocarbons known as Halon 1211, Halon 1301, and Halon...
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Reports. 1209.260 Section 1209.260 Agriculture... CONSUMER INFORMATION ORDER Rules and Regulations Reports § 1209.260 Reports. Each first handler shall be required to report monthly to the Council such information as may be required under § 1209.60(a) of this...
2010-10-01
... 46 Shipping 8 2010-10-01 2010-10-01 false Reports. 401.260 Section 401.260 Shipping COAST GUARD... Pilots § 401.260 Reports. (a) A marine accident which occurs while a U.S. Registered Pilot is in the service of a vessel in U.S. or Canadian waters of the Great Lakes shall be reported by the Registered...
49 CFR 260.19 - Preapplication meeting.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Preapplication meeting. 260.19 Section 260.19 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Financial Assistance § 260.19 Preapplication meeting. Potential Applicants may request a meeting with the...
49 CFR 260.7 - Priority consideration.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Priority consideration. 260.7 Section 260.7... REHABILITATION AND IMPROVEMENT FINANCING PROGRAM Overview § 260.7 Priority consideration. When evaluating applications, the Administrator will give priority consideration (but not necessarily in the following order...
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Loan terms. 260.9 Section 260.9 Transportation... TRANSPORTATION REGULATIONS GOVERNING LOANS AND LOAN GUARANTEES UNDER THE RAILROAD REHABILITATION AND IMPROVEMENT FINANCING PROGRAM Overview § 260.9 Loan terms. The maximum repayment period for direct loans and guaranteed...
50 CFR 260.88 - Political activity.
2010-10-01
... part in political management or in political campaigns. Political activities in city, county, State, or... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Political activity. 260.88 Section 260.88... Products for Human Consumption Miscellaneous § 260.88 Political activity. All inspectors and licensed...
49 CFR 260.13 - Credit reform.
2010-10-01
... appropriations, direct payment of a Credit Risk Premium by the Applicant or a non-Federal infrastructure partner... 49 Transportation 4 2010-10-01 2010-10-01 false Credit reform. 260.13 Section 260.13... REHABILITATION AND IMPROVEMENT FINANCING PROGRAM Overview § 260.13 Credit reform. The Federal Credit Reform Act...
21 CFR 573.260 - Calcium silicate.
2010-04-01
... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Calcium silicate. 573.260 Section 573.260 Food and... Listing § 573.260 Calcium silicate. Calcium silicate, including synthetic calcium silicate, may be safely used as an anticaking agent in animal feed, provided that the amount of calcium silicate does not...
49 CFR 195.260 - Valves: Location.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Valves: Location. 195.260 Section 195.260... PIPELINE Construction § 195.260 Valves: Location. A valve must be installed at each of the following locations: (a) On the suction end and the discharge end of a pump station in a manner that permits isolation...
2010-04-01
... SUPPLEMENTARY FINANCING FOR INSURED PROJECT MORTGAGES Contract Rights and Obligations § 241.260 Definitions. All of the definitions contained in § 241.1 shall apply to this subpart. In addition, the term contract... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Definitions. 241.260 Section 241...
49 CFR 260.15 - Credit risk premium.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Credit risk premium. 260.15 Section 260.15... REHABILITATION AND IMPROVEMENT FINANCING PROGRAM Overview § 260.15 Credit risk premium. (a) Where available... pay to the Administrator a Credit Risk Premium adequate to cover that portion of the subsidy cost not...
45 CFR 2541.260 - Non-Federal audit.
2010-10-01
... awards in a fiscal year, shall: (1) Determine whether State or local subgrantees have met the audit... 45 Public Welfare 4 2010-10-01 2010-10-01 false Non-Federal audit. 2541.260 Section 2541.260... GOVERNMENTS Post-Award Requirements § 2541.260 Non-Federal audit. (a) Basic rule. Grantees and subgrantees are...
50 CFR 260.70 - Schedule of fees.
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Schedule of fees. 260.70 Section 260.70... Products for Human Consumption Fees and Charges § 260.70 Schedule of fees. (a) Unless otherwise provided in a written agreement between the applicant and the Secretary, the fees to be charged and collected...
21 CFR 137.260 - Enriched corn meals.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Enriched corn meals. 137.260 Section 137.260 Food... Flours and Related Products § 137.260 Enriched corn meals. (a) Enriched corn meals are the foods, each of which conforms to the definition and standard of identity prescribed for a kind of corn meal by §§ 137...
9 CFR 319.260 - Luncheon meat.
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Luncheon meat. 319.260 Section 319.260... ORGANIZATION AND TERMINOLOGY; MANDATORY MEAT AND POULTRY PRODUCTS INSPECTION AND VOLUNTARY INSPECTION AND CERTIFICATION DEFINITIONS AND STANDARDS OF IDENTITY OR COMPOSITION Luncheon Meat, Loaves and Jellied Products...
49 CFR 260.17 - Credit risk premium analysis.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Credit risk premium analysis. 260.17 Section 260... Financial Assistance § 260.17 Credit risk premium analysis. (a) When Federal appropriations are not available to cover the total subsidy cost, the Administrator will determine the Credit Risk Premium...
36 CFR 2.60 - Livestock use and agriculture.
2010-07-01
... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Livestock use and agriculture. 2.60 Section 2.60 Parks, Forests, and Public Property NATIONAL PARK SERVICE, DEPARTMENT OF THE INTERIOR RESOURCE PROTECTION, PUBLIC USE AND RECREATION § 2.60 Livestock use and agriculture. (a) The...
50 CFR 260.58 - Accessibility for sampling.
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Accessibility for sampling. 260.58 Section... Fishery Products for Human Consumption Sampling § 260.58 Accessibility for sampling. Each applicant shall cause the processed products for which inspection is requested to be made accessible for proper sampling...
40 CFR 260.3 - Use of number and gender.
2010-07-01
... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Use of number and gender. 260.3... (CONTINUED) HAZARDOUS WASTE MANAGEMENT SYSTEM: GENERAL General § 260.3 Use of number and gender. As used in parts 260 through 265 and 268 of this chapter: (a) Words in the masculine gender also include the...
46 CFR 107.260 - Rated load test for cranes.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Rated load test for cranes. 107.260 Section 107.260... INSPECTION AND CERTIFICATION Inspection and Certification § 107.260 Rated load test for cranes. (a) To meet the requirements in § 107.231(l), each crane must meet the following rated load test at both the...
12 CFR 250.260 - Miscellaneous interpretations; gold coin and bullion.
2010-01-01
... requirements? No. Section 19(c) of the Federal Reserve Act requires that reserve balances be satisfied either... bullion. 250.260 Section 250.260 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM MISCELLANEOUS INTERPRETATIONS Interpretations § 250.260 Miscellaneous...
40 CFR 260.1 - Purpose, scope, and applicability.
2010-07-01
....1 Section 260.1 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) HAZARDOUS WASTE MANAGEMENT SYSTEM: GENERAL General § 260.1 Purpose, scope, and applicability. (a) This part provides definitions of terms, general standards, and overview information applicable to...
40 CFR 260.2 - Availability of information; confidentiality of information.
2010-07-01
... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Availability of information; confidentiality of information. 260.2 Section 260.2 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) HAZARDOUS WASTE MANAGEMENT SYSTEM: GENERAL General § 260.2 Availability of information; confidentiality of...
45 CFR 260.51 - What definitions apply to this subpart?
2010-10-01
... of Domestic Violence? § 260.51 What definitions apply to this subpart? Family Violence Option (or FVO... 45 Public Welfare 2 2010-10-01 2010-10-01 false What definitions apply to this subpart? 260.51 Section 260.51 Public Welfare Regulations Relating to Public Welfare OFFICE OF FAMILY ASSISTANCE...
7 CFR 1901.260 - Coordination with other agencies.
2010-01-01
... 7 Agriculture 12 2010-01-01 2010-01-01 false Coordination with other agencies. 1901.260 Section... AGRICULTURE PROGRAM REGULATIONS PROGRAM-RELATED INSTRUCTIONS Procedures for the Protection of Historical and Archeological Properties § 1901.260 Coordination with other agencies. (a) When other Agencies are directly...
50 CFR 260.79 - Travel and other expenses.
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Travel and other expenses. 260.79 Section... PROCESSED FOOD PRODUCTS INSPECTION AND CERTIFICATION Inspection and Certification of Establishments and Fishery Products for Human Consumption Fees and Charges § 260.79 Travel and other expenses. Charges may be...
21 CFR 176.260 - Pulp from reclaimed fiber.
2010-04-01
... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Pulp from reclaimed fiber. 176.260 Section 176.260 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION (CONTINUED) INDIRECT FOOD ADDITIVES: PAPER AND PAPERBOARD COMPONENTS Substances...
46 CFR 28.260 - Electronic position fixing devices.
2010-10-01
... Trade § 28.260 Electronic position fixing devices. Each vessel 79 feet (24 meters) or more in length must be equipped with an electronic position fixing device capable of providing accurate fixes for the... 46 Shipping 1 2010-10-01 2010-10-01 false Electronic position fixing devices. 28.260 Section 28...
16 CFR 260.5 - Interpretation and substantiation of environmental marketing claims.
2010-01-01
... deceptive or unsubstantiated environmental advertising claims. A current list of environmental marketing... environmental marketing claims. 260.5 Section 260.5 Commercial Practices FEDERAL TRADE COMMISSION GUIDES AND TRADE PRACTICE RULES GUIDES FOR THE USE OF ENVIRONMENTAL MARKETING CLAIMS § 260.5 Interpretation and...
40 CFR 725.260 - Submission of health and environmental effects data.
2010-07-01
... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Submission of health and environmental effects data. 725.260 Section 725.260 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... for Research and Development Activities § 725.260 Submission of health and environmental effects data...
24 CFR 203.260 - Amount of mortgage insurance premium (periodic MIP).
2010-04-01
... Mortgage Insurance Premiums-Periodic Payment § 203.260 Amount of mortgage insurance premium (periodic MIP... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Amount of mortgage insurance premium (periodic MIP). 203.260 Section 203.260 Housing and Urban Development Regulations Relating to...
30 CFR 206.260 - Allocation of washed coal.
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Allocation of washed coal. 206.260 Section 206... MANAGEMENT PRODUCT VALUATION Federal Coal § 206.260 Allocation of washed coal. (a) When coal is subjected to washing, the washed coal must be allocated to the leases from which it was extracted. (b) When the net...
2010-04-01
... TISSUE-BASED PRODUCTS Current Good Tissue Practice § 1271.260 Storage. (a) Control of storage areas. You... distribution. (b) Temperature. You must store HCT/Ps at an appropriate temperature. (c) Expiration date. Where...
17 CFR 260.0-11 - Liability for certain statements by issuers.
2010-04-01
... future economic performance contained in management's discussion and analysis of financial condition and... statements by issuers. 260.0-11 Section 260.0-11 Commodity and Securities Exchanges SECURITIES AND EXCHANGE... § 260.0-11 Liability for certain statements by issuers. (a) A statement within the coverage of paragraph...
30 CFR 260.3 - What is MMS's authority to collect information?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What is MMS's authority to collect information? 260.3 Section 260.3 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE OUTER CONTINENTAL SHELF OIL AND GAS LEASING General Provisions § 260.3 What is MMS's authority to...
17 CFR 260.7a-25 - Words relating to the future.
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Words relating to the future. 260.7a-25 Section 260.7a-25 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... § 260.7a-25 Words relating to the future. Unless the context clearly shows otherwise, whenever words...
49 CFR 260.35 - Environmental assessment.
2010-10-01
... REHABILITATION AND IMPROVEMENT FINANCING PROGRAM Applications for Financial Assistance § 260.35 Environmental... decision by the Administrator on the applicant's financial assistance request. FRA's “Procedures for...
50 CFR 260.81 - Readjustment and increase in hourly rates of fees.
2010-10-01
... of fees. 260.81 Section 260.81 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL... Certification of Establishments and Fishery Products for Human Consumption Fees and Charges § 260.81 Readjustment and increase in hourly rates of fees. (a) When Federal Pay Act increases occur, the hourly rates...
42 CFR 440.260 - Methods and standards to assure quality of services.
2010-10-01
... 42 Public Health 4 2010-10-01 2010-10-01 false Methods and standards to assure quality of services. 440.260 Section 440.260 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH... and Limits Applicable to All Services § 440.260 Methods and standards to assure quality of services...
2010-10-01
... belongings, eat food, drink beverages, chew gum, or use tobacco in any form in areas where food or food... FOOD PRODUCTS INSPECTION AND CERTIFICATION Inspection and Certification of Establishments and Fishery... Basis 1 § 260.104 Personnel. The establishment management shall be responsible for taking all...
30 CFR 260.110 - What bidding systems may MMS use?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What bidding systems may MMS use? 260.110 Section 260.110 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE OUTER... MMS use? We will apply a single bidding system selected from those listed in this section to each...
49 CFR 260.31 - Execution and filing of the application.
2010-10-01
... Credit Risk Premium due from Applicant, if any, as provided in § 260.15. Applicant agrees to pay such Credit Risk Premium prior to the disbursement of direct or guaranteed loan, as appropriate. Such Credit Risk Premium may be refunded as provided in § 260.15. Respectfully submitted. Applicant(s) Seal(s) by...
16 CFR 260.8 - Environmental assessment.
2010-01-01
....8 Commercial Practices FEDERAL TRADE COMMISSION GUIDES AND TRADE PRACTICE RULES GUIDES FOR THE USE OF ENVIRONMENTAL MARKETING CLAIMS § 260.8 Environmental assessment. (a) National Environmental Policy... and analysis to determine whether issuing the Guides for the Use of Environmental Marketing Claims...
16 CFR 260.1 - Statement of purpose.
2010-01-01
... of Section 5 of the FTC Act to environmental advertising and marketing practices. They provide the... ENVIRONMENTAL MARKETING CLAIMS § 260.1 Statement of purpose. The guides in this part represent administrative...
21 CFR 172.260 - Oxidized polyethylene.
2010-04-01
... to 19. (b) The additive is used or intended for use as a protective coating or component of protective coatings for fresh avocados, bananas, beets, coconuts, eggplant, garlic, grapefruit, lemons, limes... Coatings, Films and Related Substances § 172.260 Oxidized polyethylene. Oxidized polyethylene may be safely...
37 CFR 260.3 - Terms for making payment of royalty fees.
2010-07-01
... royalty fees. 260.3 Section 260.3 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF... Terms for making payment of royalty fees. (a) All royalty payments shall be made to a designated agent(s... the month succeeding the month in which the royalty fees are set. (c) The agent designated to receive...
40 CFR 260.30 - Non-waste determinations and variances from classification as a solid waste.
2010-07-01
... from classification as a solid waste. 260.30 Section 260.30 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) HAZARDOUS WASTE MANAGEMENT SYSTEM: GENERAL Rulemaking Petitions § 260.30 Non-waste determinations and variances from classification as a solid waste. In...
40 CFR 260.32 - Variances to be classified as a boiler.
2010-07-01
... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Variances to be classified as a boiler... be classified as a boiler. In accordance with the standards and criteria in § 260.10 (definition of “boiler”), and the procedures in § 260.33, the Administrator may determine on a case-by-case basis that...
40 CFR 260.31 - Standards and criteria for variances from classification as a solid waste.
2010-07-01
... from classification as a solid waste. 260.31 Section 260.31 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) HAZARDOUS WASTE MANAGEMENT SYSTEM: GENERAL Rulemaking Petitions § 260.31 Standards and criteria for variances from classification as a solid waste. (a) The...
40 CFR 1065.260 - Flame-ionization detector.
2010-07-01
.... For compression-ignition engines, two-stroke spark-ignition engines, and four-stroke spark-ignition... CONTROLS ENGINE-TESTING PROCEDURES Measurement Instruments Hydrocarbon Measurements § 1065.260 Flame... that has compensation algorithms that are functions of other gaseous measurements and the engine's...
18 CFR 260.1 - FERC Form No. 2, Annual report for Major natural gas companies.
2010-04-01
... report for Major natural gas companies. 260.1 Section 260.1 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION, DEPARTMENT OF ENERGY APPROVED FORMS, NATURAL GAS ACT STATEMENTS AND REPORTS (SCHEDULES) § 260.1 FERC Form No. 2, Annual report for Major natural gas companies. (a...
40 CFR 260.41 - Procedures for case-by-case regulation of hazardous waste recycling activities.
2010-07-01
... of hazardous waste recycling activities. 260.41 Section 260.41 Protection of Environment... Rulemaking Petitions § 260.41 Procedures for case-by-case regulation of hazardous waste recycling activities... hazardous waste recycling activities described in § 261.6(a)(2)(iii) under the provisions of § 261.6 (b) and...
45 CFR 260.52 - What are the basic provisions of the Family Violence Option (FVO)?
2010-10-01
... Provisions Apply to Victims of Domestic Violence? § 260.52 What are the basic provisions of the Family... 45 Public Welfare 2 2010-10-01 2010-10-01 false What are the basic provisions of the Family Violence Option (FVO)? 260.52 Section 260.52 Public Welfare Regulations Relating to Public Welfare OFFICE...
16 CFR 260.3 - Structure of the guides.
2010-01-01
... ENVIRONMENTAL MARKETING CLAIMS § 260.3 Structure of the guides. The guides are composed of general principles and specific guidance on the use of environmental claims. These general principles and specific...
17 CFR 260.7a-24 - Words relating to periods of time in the past.
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Words relating to periods of time in the past. 260.7a-24 Section 260.7a-24 Commodity and Securities Exchanges SECURITIES AND... Requirements As to Contents § 260.7a-24 Words relating to periods of time in the past. Unless the context...
16 CFR 260.2 - Scope of guides.
2010-01-01
... through any other means, including marketing through digital or electronic means, such as the Internet or... ENVIRONMENTAL MARKETING CLAIMS § 260.2 Scope of guides. (a) These guides apply to environmental claims included in labeling, advertising, promotional materials and all other forms of marketing, whether asserted...
Cern faces 260m euro budget cuts
Banks, Michael
2010-01-01
"The Cern particle-physics lab near Geneva is to slash about 260m euro ($340m) from its budget for 2011-2015. The cut, which was approved by Cern's council last month, will require the lab to scale back research into future particles accelerators" (0.5 page)
18 CFR 260.2 - FERC Form No. 2-A, Annual report for Nonmajor natural gas companies.
2010-04-01
..., Annual report for Nonmajor natural gas companies. 260.2 Section 260.2 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION, DEPARTMENT OF ENERGY APPROVED FORMS, NATURAL GAS ACT STATEMENTS AND REPORTS (SCHEDULES) § 260.2 FERC Form No. 2-A, Annual report for Nonmajor natural gas...
33 CFR 162.260 - Channel leading to San Juan Harbor, P.R.; use, administration, and navigation.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Channel leading to San Juan Harbor, P.R.; use, administration, and navigation. 162.260 Section 162.260 Navigation and Navigable... WATERWAYS NAVIGATION REGULATIONS § 162.260 Channel leading to San Juan Harbor, P.R.; use, administration...
23 CFR 260.407 - Implementation and reimbursement.
2010-04-01
...) exclusive of travel, subsistence, or salary of trainees. (c) As provided in 23 U.S.C. 321(c), education and... EDUCATION AND TRAINING PROGRAMS State Education and Training Programs § 260.407 Implementation and...-related training and education. The principal recipients of this training shall be employees who are...
2010-10-01
... processed foods and/or components thereof; (10) Furnish and provide laundry service, as required by NMFS... inspection service at official establishments. 260.97 Section 260.97 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE PROCESSED FISHERY...
30 CFR 250.260 - What Coastal Zone Management Act (CZMA) information must accompany the DPP or DOCD?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What Coastal Zone Management Act (CZMA) information must accompany the DPP or DOCD? 250.260 Section 250.260 Mineral Resources MINERALS MANAGEMENT... Operations Coordination Documents (docd) § 250.260 What Coastal Zone Management Act (CZMA) information must...
2010-04-01
... Administrative Requirements § 645.260 What health and safety provisions apply to participants in Welfare-to-Work... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false What health and safety provisions apply to participants in Welfare-to-Work programs? 645.260 Section 645.260 Employees' Benefits EMPLOYMENT AND TRAINING...
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Inclusion of items, differentiation between items and answers, omission of instructions. 260.7a-16 Section 260.7a-16 Commodity and... INDENTURE ACT OF 1939 Formal Requirements § 260.7a-16 Inclusion of items, differentiation between items and...
2010-07-01
... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Legitimate recycling of hazardous... (CONTINUED) HAZARDOUS WASTE MANAGEMENT SYSTEM: GENERAL Rulemaking Petitions § 260.43 Legitimate recycling of... demonstrate that the recycling is legitimate. Hazardous secondary material that is not legitimately recycled...
18 CFR 260.401 - FERC Form No. 552, Annual Report of Natural Gas Transactions.
2010-04-01
... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false FERC Form No. 552, Annual Report of Natural Gas Transactions. 260.401 Section 260.401 Conservation of Power and Water...) Prescription. The annual report for natural gas market participants, designated as FERC Form No. 552, is...
30 CFR 260.111 - What conditions apply to the bidding systems that MMS uses?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What conditions apply to the bidding systems that MMS uses? 260.111 Section 260.111 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE... What conditions apply to the bidding systems that MMS uses? (a) For each of the bidding systems in...
Energy Technology Data Exchange (ETDEWEB)
Morris, M.I.
2002-02-06
The Resource Conservation and Recovery Act (RCRA) defines several categories of mercury wastes, each of which has a defined technology or concentration-based treatment standard, or universal treatment standard (UTS). RCRA defines mercury hazardous wastes as any waste that has a TCLP value for mercury of 0.2 mg/L or greater. Three of these categories, all nonwastewaters, fall within the scope of this report on new technologies to treat mercury-contaminated wastes: wastes as elemental mercury; hazardous wastes with less than 260 mg/kg [parts per million (ppm)] mercury; and hazardous wastes with 260 ppm or more of mercury. While this report deals specifically with the last category--hazardous wastes with 260 ppm or more of mercury--the other two categories will be discussed briefly so that the full range of mercury treatment challenges can be understood. The treatment methods for these three categories are as follows: Waste as elemental mercury--RCRA identifies amalgamation (AMLGM) as the treatment standard for radioactive elemental mercury. However, radioactive mercury condensates from retorting (RMERC) processes also require amalgamation. In addition, incineration (IMERC) and RMERC processes that produce residues with >260 ppm of radioactive mercury contamination and that fail the RCRA toxicity characteristic leaching procedure (TCLP) limit for mercury (0.20 mg/L) require RMERC, followed by AMLGM of the condensate. Waste with <260 ppm mercury--No specific treatment method is specified for hazardous wastes containing <260 ppm. However, RCRA regulations require that such wastes (other than RMERC residues) that exceed a TCLP mercury concentration of 0.20 mg/L be treated by a suitable method to meet the TCLP limit for mercury of 0.025 mg/L. RMERC residues must meet the TCLP value of {ge}0.20 mg/L, or be stabilized and meet the {ge}0.025 mg/L limit. Waste with {ge}260 ppm mercury--For hazardous wastes with mercury contaminant concentrations {ge}260 ppm and RCRA
STABILIZATION OF A MIXED WASTE SLUDGE SURROGATE CONTAINING MORE THAN 260 PPM MERCURY
International Nuclear Information System (INIS)
Smith, W. J.; Feizollahi, F.; Brimley, R.
2002-01-01
In an earlier demonstration of an innovative mercury stabilization technology for the Department of Energy, ATG's full-scale process stabilized mercury in soils that initially contained more than 260 ppm of mercury of unknown speciation. The treated waste satisfied the leaching standards for mercury that qualify wastes containing less than 260 ppm for land disposal. This paper describes the extension of that work to demonstrate a full-scale process for the stabilization of a representative sludge that contained more than 260 ppm of Hg of several mercury species. RCRA (Resource Conservation and Recovery Act) regulations now require the recovery of mercury from any waste containing more than 260 ppm of mercury, usually with thermal retorts. The results of this work with a surrogate sludge, and of the previous work with an actual soil, support a proposal now before the U.S. EPA (Environmental Protection Agency) to allow such wastes to be stabilized without retorting. The full-scale demonstration with a sulfide reagent reduced the mercury concentrations in extracts of treated sludge below the relevant leaching standard, a Universal Treatment Standard (UTS) limit of 0.025 mg mercury per liter of leachate generated by the Toxicity Characteristic Leaching Procedure (TCLP). The sulfide formulation reduced the concentration to about onehalf the UTS limit
2010-04-01
..., Quarterly financial report of electric utilities, licensees, and natural gas companies. 260.300 Section 260... ENERGY APPROVED FORMS, NATURAL GAS ACT STATEMENTS AND REPORTS (SCHEDULES) § 260.300 FERC Form No. 3-Q, Quarterly financial report of electric utilities, licensees, and natural gas companies. (a) Prescription...
45 CFR 260.54 - Do States have flexibility to grant good cause domestic violence waivers?
2010-10-01
... 45 Public Welfare 2 2010-10-01 2010-10-01 false Do States have flexibility to grant good cause domestic violence waivers? 260.54 Section 260.54 Public Welfare Regulations Relating to Public Welfare OFFICE OF FAMILY ASSISTANCE (ASSISTANCE PROGRAMS), ADMINISTRATION FOR CHILDREN AND FAMILIES, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL TEMPORAR...
41 CFR 102-118.260 - Must my agency send all quotations, tenders, or contracts with a TSP to GSA?
2010-07-01
... quotations, tenders, or contracts with a TSP to GSA? 102-118.260 Section 102-118.260 Public Contracts and... REGULATION TRANSPORTATION 118-TRANSPORTATION PAYMENT AND AUDIT Use of Government Billing Documents Quotations, Tenders Or Contracts § 102-118.260 Must my agency send all quotations, tenders, or contracts with a TSP to...
The discovery of 260Md and the decay properties of 258Fm, 258m,gMd and 259Md
International Nuclear Information System (INIS)
Lougheed, R.W.; Hulet, E.K.; Dougan, R.J.; Wild, J.F.; Dupzyk, R.J.; Henderson, C.M.; Moody, K.J.; Hahn, R.L.; Suemmerer, K.; Bethune, G.
1986-01-01
We have discovered a new neutron-rich isotope, 260 Md, from 18 O and 22 Ne bombardments of 254 Es. We observed a spontaneous-fission (SF) activity with a half-life of 32 days in electromagnetically separated fractions with mass number 260 from these bombardments and we measured the mass and kinetic energy distributions of this SF activity. The mass distribution was symmetric with the principal energy peak at a total kinetic energy (TKE) of 234 MeV, similar to previous observations for heavy fermium isotopes. Surprisingly, we also observed a smaller symmetric component with a TKE of 195 MeV. We interpret these two peaks in the TKE distribution as arising from two types of fission in the same nucleus, or bimodal fission. The observed fission activity may be either from the SF decay of 260 Md or from 260 Fm which would arise from electron-capture (EC) decay of 260 Md. We have eliminated the possible β - decay of 260 Md by measuring β - -SF time correlations for the decay of 260 Md and we plan to determine whether 260 Md decays by EC by measuring time correlations between fermium X-rays and SF events. We also measured various properties of the heavy fermium and mendelevium isotopes and obtained 1. more accurate cross-sections for the neutron-rich mendelevium isotopes which we use to predict the production rates of yet undiscovered nuclides, 2. improved half-life measurements for 258m,g Md and 259 Md, 3. confirmation of the EC decay of 258m Md by measurement of the fermium X-rays preceding the SF decay of 258 Fm and 4. very substantially improved mass and TKE distributions for the SF decay of 258 Fm and 259 Md. (orig.)
2010-10-01
... be in accordance with an effective sanitation program. 260.103 Section 260.103 Wildlife and Fisheries... Operations and operating procedures shall be in accordance with an effective sanitation program. (a) All..., choppers, and containers which fail to meet appropriate and adequate sanitation requirements will be...
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Time sharing between DoD meteorological satellite systems and non-voice, non-geostationary satellite systems in the 400.15-401 MHz band. 25.260 Section 25.260 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES...
Association between CD14 gene C-260T polymorphism and inflammatory bowel disease: a meta-analysis.
Directory of Open Access Journals (Sweden)
Zhengting Wang
Full Text Available BACKGROUND: The gene encoding CD14 has been proposed as an IBD-susceptibility gene with its polymorphism C-260T being widely evaluated, yet with conflicting results. The aim of this study was to investigate the association between this polymorphism and IBD by conducting a meta-analysis. METHODOLOGY/PRINCIPAL FINDINGS: Seventeen articles met the inclusion criteria, which included a total of 18 case-control studies, including 1900 ulcerative colitis (UC cases, 2535 Crohn's disease (CD cases, and 4004 controls. Data were analyzed using STATA software. Overall, association between C-260T polymorphism and increased UC risk was significant in allelic comparison (odds ratio [OR] =1.21, 95% confidence interval [CI]: 1.02-1.43; P=0.027, homozygote model (OR =1.44, 95% CI: 1.03-2.01; P=0.033, as well as dominant model (OR =1.36, 95% CI: 1.06-1.75; P=0.016. However, there was negative association between this polymorphism and CD risk across all genetic models. Subgroup analyses by ethnicity suggested the risk-conferring profiles of -260T allele and -260 TT genotype with UC in Asians, but not in Caucasians. There was a low probability of publication bias. CONCLUSIONS/SIGNIFICANCE: Expanding previous results of individual studies, our findings demonstrated that CD14 gene C-260T polymorphism might be a promising candidate marker in susceptibility to UC, especially in Asians.
260 Gbit/s photonic-wireless link in the THz band
DEFF Research Database (Denmark)
Pang, X.; Jia, S.; Ozolins, O.
2016-01-01
A single-transmitter/single-receiver THz link (0.3-0.5 THz) with a record net data rate of 260 Gbit/s is experimentally demonstrated. Spectrally efficient multi-channel signal transmission is enabled by a novel frequency-band-allocation scheme with pre-and post- digital equalization....
2010-10-01
... 45 Public Welfare 2 2010-10-01 2010-10-01 false What are the additional requirements for Federal recognition of good cause domestic violence waivers? 260.55 Section 260.55 Public Welfare Regulations Relating to Public Welfare OFFICE OF FAMILY ASSISTANCE (ASSISTANCE PROGRAMS), ADMINISTRATION FOR CHILDREN AND FAMILIES, DEPARTMENT OF HEALTH AND...
Nonlinkage of D6S260, a putative schizophrenia locus, to bipolar affective disorder
Energy Technology Data Exchange (ETDEWEB)
Adams, L.J.; Mitchell, P.B. [Univ. of South Wales (Australia); Salmon, J. [Garvan Institute of Medical Research, Sydney, New South Wales (Australia)] [and others
1996-09-20
To examine whether genes that predispose to schizophrenia also confer a predisposition to other psychiatric disorders such as bipolar affective disorder (BAD), we tested for linkage between the recently identified schizophrenia susceptibility locus D6S260 and the inheritance of BAD in 12 large Australian pedigrees. We found no evidence for linkage over a region of 12-27 cM from the D6S260 locus, depending on the model used. Our results therefore do not provide support for the continuum theory of psychosis. 13 refs., 2 tabs.
18 CFR 260.200 - Original cost statement of utility property.
2010-04-01
... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Original cost statement...) § 260.200 Original cost statement of utility property. Any natural gas company becoming subject to the... of its predecessors: (1) The original cost (estimated only if not determinable from existing records...
40 CFR 260.22 - Petitions to amend part 261 to exclude a waste produced at a particular facility.
2010-07-01
... the manufacturing processes or other operations and feed materials producing the waste and an assessment of whether such processes, operations, or feed materials can or might produce a waste that is not... a waste produced at a particular facility. 260.22 Section 260.22 Protection of Environment...
17 CFR 260.10a-5 - Eligibility of Canadian Trustees.
2010-04-01
... pursuant to the Trust Companies Act (Canada), R.S.C. 1985, or the Canada Deposit Insurance Corporation Act... (CONTINUED) GENERAL RULES AND REGULATIONS, TRUST INDENTURE ACT OF 1939 Rule Under Section 310 § 260.10a-5... trustee under an indenture qualified or to be qualified under the Act and filed in connection with...
29 CFR 1952.260 - Description of the plan as initially approved.
2010-07-01
... have full authority to administer and to enforce all laws, rules and orders protecting employee safety... Section 1952.260 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH... general safety and construction safety standards while the Department of Public Health will be responsible...
17 CFR 260.4d-9 - Exemption for Canadian Trust Indentures from Specified Provisions of the Act.
2010-04-01
...) The Canada Business Corporations Act, R. S. C. 1985; (b) The Bank Act, R. S. C. 1985; (c) The Business Corporations Act, 1982 (Ontario), S. O. 1982; or (d) The Company Act, R.S.B.C. 1979, C. 59. [56 FR 30077, July... Indentures from Specified Provisions of the Act. 260.4d-9 Section 260.4d-9 Commodity and Securities Exchanges...
Periodic Impact Cratering and Extinction Events Over the Last 260 Million Years
Rampino, Michael R.; Caldeira, Ken
2015-01-01
The claims of periodicity in impact cratering and biological extinction events are controversial. Anewly revised record of dated impact craters has been analyzed for periodicity, and compared with the record of extinctions over the past 260 Myr. A digital circular spectral analysis of 37 crater ages (ranging in age from 15 to 254 Myr ago) yielded evidence for a significant 25.8 +/- 0.6 Myr cycle. Using the same method, we found a significant 27.0 +/- 0.7 Myr cycle in the dates of the eight recognized marine extinction events over the same period. The cycles detected in impacts and extinctions have a similar phase. The impact crater dataset shows 11 apparent peaks in the last 260 Myr, at least 5 of which correlate closely with significant extinction peaks. These results suggest that the hypothesis of periodic impacts and extinction events is still viable.
Royani, J. I.; Safarrida, A.; Rachmawati, I.; Khairiyah, H.; Mustika, I. P.; Suyono, A.; Rudiyana, Y.; Kubil; Nurjaya; Arianto, A.
2017-05-01
Rubber from Hevea brasiliensis is the only commercial natural rubber in the world. Propagation of rubber trees usually done by grafting and seed germination. BPPT had been producing rubber tree by in vitro technique with embryo somatic methods. Validation of mother plant for in vitro propagation is important to compare between mother plant and propagated plants. The aim for this research was to validation of PB 260 clone that planted at Cikumpay Plantation by SSR marker. Sampling of 10 rubber leaves were done at Cikumpay Plantation based on GPS position from the area of PB 260 clone. Rubber leaves were isolated with CTAB modification method to obtained DNA. Four of SSR primers from rubber, i.e.: hmac 4, hmac 5, hmct 1, and hmct 5, were used as primers to amplification of rubber DNA. The result showed that no band that different from 10 rubber of PB 260 clone at Cikumpay Plantation. This research will continue to compare genomic validation between mother plant and propagated plants that had been produced from BPPT.
20 CFR 1002.260 - What pension benefit plans are covered under USERRA?
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false What pension benefit plans are covered under... REEMPLOYMENT RIGHTS ACT OF 1994 Reemployment Rights and Benefits Pension Plan Benefits § 1002.260 What pension...) defines an employee pension benefit plan as a plan that provides retirement income to employees, or defers...
Energy Technology Data Exchange (ETDEWEB)
Venkateswara Rao, N.; Suryanarayana, C.; Narayana, D.G.S.; Bhuloka Reddy, S.; Satynarayana, G.; Sastry, D.L.; Chintalapudi, S.N.
1986-02-21
The 1.87 hours 543.7 keV (7/sup +/) isomeric state in /sup 198/Tl is produced via /sup 197/Au(..cap alpha.., 3n)sup(198m)Tl (Esub(..cap alpha..) = 35 MeV) reaction. The total conversion coefficient of 260.9 keV (7/sup +/ -> 3/sup -/) is determined for the first time by the intensity balance method. The value of ..cap alpha..sub(T)(260.9 keV) is found to be 40.1 +- 8.6 which is in good agreement with the theoretical value of Hager and Seltzer for pure M4 transition. The gamma transition probability of the 260.9 keV (M4) is calculated using the present value of ..cap alpha..sub(T) and compared with the single-particle estimate.
Dual-resolution dose assessments for proton beamlet using MCNPX 2.6.0
Chao, T. C.; Wei, S. C.; Wu, S. W.; Tung, C. J.; Tu, S. J.; Cheng, H. W.; Lee, C. C.
2015-11-01
The purpose of this study is to access proton dose distribution in dual resolution phantoms using MCNPX 2.6.0. The dual resolution phantom uses higher resolution in Bragg peak, area near large dose gradient, or heterogeneous interface and lower resolution in the rest. MCNPX 2.6.0 was installed in Ubuntu 10.04 with MPI for parallel computing. FMesh1 tallies were utilized to record the energy deposition which is a special designed tally for voxel phantoms that converts dose deposition from fluence. 60 and 120 MeV narrow proton beam were incident into Coarse, Dual and Fine resolution phantoms with pure water, water-bone-water and water-air-water setups. The doses in coarse resolution phantoms are underestimated owing to partial volume effect. The dose distributions in dual or high resolution phantoms agreed well with each other and dual resolution phantoms were at least 10 times more efficient than fine resolution one. Because the secondary particle range is much longer in air than in water, the dose of low density region may be under-estimated if the resolution or calculation grid is not small enough.
A comparative study of MONTEBURNS and MCNPX 2.6.0 codes in ADS simulations
International Nuclear Information System (INIS)
Barros, Graiciany P.; Pereira, Claubia; Veloso, Maria A.F.; Velasquez, Carlos E.; Costa, Antonella L.
2013-01-01
The possible use of the MONTEBURNS and MCNPX 2.6.0 codes in Accelerator-driven systems (ADSs) simulations for fuel evolution description is discussed. ADSs are investigated for fuel breeding and long-lived fission product transmutation so simulations of fuel evolution have a great relevance. The burnup/depletion capability is present in both studied codes. MONTEBURNS code links Monte Carlo N-Particle Transport Code (MCNP) to the radioactive decay burnup code ORIGEN2, whereas MCNPX depletion/ burnup capability is a linked process involving steady-state flux calculations by MCNPX and nuclide depletion calculations by CINDER90. A lead-cooled accelerator-driven system fueled with thorium was simulated and the results obtained using MONTEBURNS code and the results from MCNPX 2.6.0 code were compared. The system criticality and the variation of the actinide inventory during the burnup were evaluated and the results indicate a similar behavior between the results of each code. (author)
Directory of Open Access Journals (Sweden)
Chen Wu
2017-09-01
Full Text Available X-linked adrenoleukodystrophy (X-ALD is a rare inherited metabolic disease that results in the accumulation of very long chain fatty acids (VLCFA in plasma and all tissues. Recent studies regarding cerebral X-ALD (CALD treatment emphasize the importance of its early diagnosis. 26:0 lysophosphatidylcholine (LysoPC is a sensitive biomarker for newborn screening of X-ALD, while its application for Japanese DBS is unclear. Therefore, we evaluated the feasibility of 20:0 LysoPC and 24:0 LysoPC along with 26:0 LysoPC for diagnosing X-ALD in a cohort of newborns (n = 604, healthy adults (n = 50 and patients (n = 4. Results indicated that 26:0 LysoPC had strong significance for discrimination of patients by the amounts of 2.0 to 4.0 and 0.1 to 1.9 pmol/punch for patients and newborns/healthy adults, respectively. Based on these values, we recommend that further diagnostic confirmation is essential if the amount of 26:0 LysoPC in DBS is above 1.7 pmol/punch.
17 CFR 260.10a-4 - Consent of trustee to service of process.
2010-04-01
... § 260.10a-4 Consent of trustee to service of process. At the time of filing an application pursuant to... such suit, action or proceeding may be commenced by the service of process upon said agent for service of process, and that such service shall be taken and held in all courts to be as valid and binding as...
Zhou, Wei; Wang, Qingqing; Zhao, Xiujuan; Xu, Weiqi; Chen, Chen; Du, Wei; Zhao, Jian; Canonaco, Francesco; Prévôt, André S. H.; Fu, Pingqing; Wang, Zifa; Worsnop, Douglas R.; Sun, Yele
2018-03-01
Despite extensive efforts toward the characterization of submicron aerosols at ground level in the megacity of Beijing, our understanding of aerosol sources and processes at high altitudes remains low. Here we conducted a 3-month real-time measurement of non-refractory submicron aerosol (NR-PM1) species at a height of 260 m from 10 October 2014 to 18 January 2015 using an aerosol chemical speciation monitor. Our results showed a significant change in aerosol composition from the non-heating period (NHP) to the heating period (HP). Organics and chloride showed clear increases during HP due to coal combustion emissions, while nitrate showed substantial decreases from 28 to 15-18 %. We also found that NR-PM1 species in the heating season can have average mass differences of 30-44 % under similar emission sources yet different meteorological conditions. Multi-linear engine 2 (ME-2) using three primary organic aerosol (OA) factors as constraints, i.e., fossil-fuel-related OA (FFOA) dominantly from coal combustion emissions, cooking OA (COA), and biomass burning OA (BBOA) resolved from ground high-resolution aerosol mass spectrometer measurements, was applied to OA mass spectra of ACSM. Two types of secondary OA (SOA) that were well correlated with nitrate and chloride-CO, respectively, were identified. SOA played a dominant role in OA during all periods at 260 m although the contributions were decreased from 72 % during NHP to 58-64 % during HP. The SOA composition also changed significantly from NHP to HP. While the contribution of oxygenated OA (OOA) was decreased from 56-63 to 32-40 %, less oxidized OOA (LO-OOA) showed a large increase from 9-16 to 24-26 %. COA contributed a considerable fraction of OA at high altitude, and the contribution was relatively similar across different periods (10-13 %). In contrast, FFOA showed a large increase during HP due to the influences of coal combustion emissions. We also observed very different OA composition between ground level
Armangue, Thais; Orsini, Joseph J; Takanohashi, Asako; Gavazzi, Francesco; Conant, Alex; Ulrick, Nicole; Morrissey, Mark A; Nahhas, Norah; Helman, Guy; Gordish-Dressman, Heather; Orcesi, Simona; Tonduti, Davide; Stutterd, Chloe; van Haren, Keith; Toro, Camilo; Iglesias, Alejandro D; van der Knaap, Marjo S; Goldbach Mansky, Raphaela; Moser, Anne B; Jones, Richard O; Vanderver, Adeline
2017-11-01
Aicardi Goutières Syndrome (AGS) is a heritable interferonopathy associated with systemic autoinflammation causing interferon (IFN) elevation, central nervous system calcifications, leukodystrophy and severe neurologic sequelae. An infant with TREX1 mutations was recently found to have abnormal C26:0 lysophosphatidylcholine (C26:0 Lyso-PC) in a newborn screening platform for X-linked adrenoleukodystrophy, prompting analysis of this analyte in retrospectively collected samples from individuals affected by AGS. In this study, we explored C26:0 Lyso-PC levels and IFN signatures in newborn blood spots and post-natal blood samples in 19 children with a molecular and clinical diagnosis of AGS and in the blood spots of 22 healthy newborns. We used Nanostring nCounter™ for IFN-induced gene analysis and a high-performance liquid chromatography with tandem mass spectrometry (HPLC MS/MS) newborn screening platform for C26:0 Lyso-PC analysis. Newborn screening cards from patients across six AGS associated genes were collected, with a median disease presentation of 2months. Thirteen out of 19 (68%) children with AGS had elevations of first tier C26:0 Lyso-PC (>0.4μM), that would have resulted in a second screen being performed in a two tier screening system for X-linked adrenoleukodystrophy (X-ALD). The median (95%CI) of first tier C26:0 Lyso-PC values in AGS individuals (0.43μM [0.37-0.48]) was higher than that seen in controls (0.21μM [0.21-0.21]), but lower than X-ALD individuals (0.72μM [0.59-0.84])(p<0.001). Fourteen of 19 children had elevated expression of IFN signaling on blood cards relative to controls (Sensitivity 73.7%, 95%CI 51-88%, Specificity 95%, 95% CI 78-99%) including an individual with delayed disease presentation (36months of age). All five AGS patients with negative IFN signature at birth had RNASEH2B mutations. Consistency of agreement between IFN signature in neonatal and post-natal samples was high (0.85). This suggests that inflammatory markers
International Nuclear Information System (INIS)
Harrill, Alison H.; Eaddy, John S.; Rose, Kelly; Cullen, John M.; Ramanathan, Lakshmi; Wanaski, Stephen; Collins, Stephen; Ho, Yu; Watkins, Paul B.; LeCluyse, Edward L.
2014-01-01
NP260 was designed as a first-in-class selective antagonist of α4-subtype GABA A receptors that had promising efficacy in animal models of pain, epilepsy, psychosis, and anxiety. However, development of NP260 was complicated following a 28-day safety study in dogs in which pronounced elevations of serum aminotransferase levels were observed, although there was no accompanying histopathological indication of hepatocellular injury. To further investigate the liver effects of NP260, we assayed stored serum samples from the 28-day dog study for liver specific miRNA (miR-122) as well as enzymatic biomarkers glutamate dehydrogenase and sorbitol dehydrogenase, which indicate liver necrosis. Cytotoxicity assessments were conducted in hepatocytes derived from dog, rat, and human liver samples to address the species specificity of the liver response to NP260. All biomarkers, except ALT, returned toward baseline by Day 29 despite continued drug treatment, suggesting adaptation to the initial injury. In vitro analysis of the toxicity potential of NP260 to primary hepatocytes indicated a relative sensitivity of dog > human > rat, which may explain, in part, why the liver effects were not evident in the rodent safety studies. Taken together, the data indicate that a diagnostic biomarker approach, coupled with sensitive in vitro screening strategies, may facilitate interpretation of toxicity potential when an adaptive event masks the underlying toxicity. - Highlights: • NP260 caused ALT elevations in dogs without evidence of hepatocellular injury. • SDH, GLDH, and miRNA-122 elevations occurred, confirming hepatocellular necrosis. • NP260 toxicity is greater in dog and human hepatocytes than in rat hepatocytes. • Species sensitivity may explain why the rodent studies failed to indicate risk. • Diagnostic biomarkers and hepatocyte studies aid interpretation of hepatotoxicity
2012-01-11
... DEPARTMENT OF STATE [Public Notice: 7750] 60-Day Notice of Proposed Information Collection: DS-260, Electronic Application for Immigration Visa and Alien Registration, 1405-0185 ACTION: Notice of request for... for Immigration Visa and Alien Registration. OMB Control Number: 1405-0185. Type of Request: Extension...
Bajpeyi, Sudip; Covington, Jeffrey D; Taylor, Erin M; Stewart, Laura K; Galgani, Jose E; Henagan, Tara M
2017-07-01
Endurance exercise has been shown to improve lipid oxidation and increase mitochondrial content in skeletal muscle, two features that have shown dependence on increased expression of the peroxisome proliferator-activated receptor-γ coactivator 1α (PGC1α). It is also hypothesized that exercise-related alterations in PGC1α expression occur through epigenetic regulation of nucleosome positioning in association with differential DNA methylation status within the PGC1α promoter. In this study, we show that when primary human myotubes from obese patients with type 2 diabetes are exposed to lipolytic stimulus (palmitate, forskolin, inomycin) in vitro, nucleosome occupancy surrounding the -260 nucleotide (nt) region, a known regulatory DNA methylation site, is reduced. This finding is reproduced in vivo in the vastus lateralis from 11 healthy males after a single, long endurance exercise bout in which participants expended 650 kcal. Additionally, we show a significant positive correlation between fold change of PGC1α messenger RNA expression and -1 nucleosome repositioning away from the -260 nt methylation site in skeletal muscle tissue following exercise. Finally, we found that when exercise participants are divided into high and low responders based on the -260 nt methylation status, the -1 nucleosome is repositioned away from the regulatory -260 nt methylation site in high responders, those exhibiting a significant decrease in -260 nt methylation, but not in low responders. Additionally, high but not low responders showed a significant decrease in intramyocellular lipid content after exercise. These findings suggest a potential target for epigenetic modification of the PGC1α promoter to stimulate the therapeutic effects of endurance exercise in skeletal muscle. Copyright © 2017 Endocrine Society.
2010-07-01
... in § 260.110 to tracts selected for any OCS lease sale, we may, at our discretion, consider the... denote a ranking. (a) Providing fair return to the Federal Government; (b) Increasing competition; (c... in OCS lease sales. ...
Energy Technology Data Exchange (ETDEWEB)
Harrill, Alison H., E-mail: ahharrill@uams.edu [College of Public Health, The University of Arkansas for Medical Sciences, Little Rock, AR 72205 (United States); The Hamner-University of North Carolina Institute for Drug Safety Sciences, The Hamner Institutes for Health Sciences, Research Triangle Park, NC 27709 (United States); Eaddy, John S. [The Hamner-University of North Carolina Institute for Drug Safety Sciences, The Hamner Institutes for Health Sciences, Research Triangle Park, NC 27709 (United States); Rose, Kelly [The Institute for Chemical Safety Sciences, The Hamner Institutes for Health Sciences, Research Triangle Park, NC 27709 (United States); Cullen, John M. [College of Veterinary Medicine, North Carolina State University, Raleigh, NC 27607 (United States); Ramanathan, Lakshmi [QPS, Newark, DE 19711 (United States); Wanaski, Stephen; Collins, Stephen; Ho, Yu [NeuroTherapeutics Pharma, Inc., Chicago, IL 60631 (United States); Watkins, Paul B. [The Hamner-University of North Carolina Institute for Drug Safety Sciences, The Hamner Institutes for Health Sciences, Research Triangle Park, NC 27709 (United States); Schools of Pharmacy and Medicine, The University of North Carolina at Chapel Hill, Chapel Hill, NC 27599 (United States); LeCluyse, Edward L. [The Institute for Chemical Safety Sciences, The Hamner Institutes for Health Sciences, Research Triangle Park, NC 27709 (United States)
2014-06-01
NP260 was designed as a first-in-class selective antagonist of α4-subtype GABA{sub A} receptors that had promising efficacy in animal models of pain, epilepsy, psychosis, and anxiety. However, development of NP260 was complicated following a 28-day safety study in dogs in which pronounced elevations of serum aminotransferase levels were observed, although there was no accompanying histopathological indication of hepatocellular injury. To further investigate the liver effects of NP260, we assayed stored serum samples from the 28-day dog study for liver specific miRNA (miR-122) as well as enzymatic biomarkers glutamate dehydrogenase and sorbitol dehydrogenase, which indicate liver necrosis. Cytotoxicity assessments were conducted in hepatocytes derived from dog, rat, and human liver samples to address the species specificity of the liver response to NP260. All biomarkers, except ALT, returned toward baseline by Day 29 despite continued drug treatment, suggesting adaptation to the initial injury. In vitro analysis of the toxicity potential of NP260 to primary hepatocytes indicated a relative sensitivity of dog > human > rat, which may explain, in part, why the liver effects were not evident in the rodent safety studies. Taken together, the data indicate that a diagnostic biomarker approach, coupled with sensitive in vitro screening strategies, may facilitate interpretation of toxicity potential when an adaptive event masks the underlying toxicity. - Highlights: • NP260 caused ALT elevations in dogs without evidence of hepatocellular injury. • SDH, GLDH, and miRNA-122 elevations occurred, confirming hepatocellular necrosis. • NP260 toxicity is greater in dog and human hepatocytes than in rat hepatocytes. • Species sensitivity may explain why the rodent studies failed to indicate risk. • Diagnostic biomarkers and hepatocyte studies aid interpretation of hepatotoxicity.
Indian Academy of Sciences (India)
the discovery of new elements using particle accelerators. He con- cludes by stating that "we might have reached the limits of the periodic table as a predictive tool". The third article is by Butera on. Glenn Seaborg who holds the record for the discovery of the largest number of elements - one of them named Seaborgium.
Khatri, Yogan; Jóźwik, Ilona K; Ringle, Michael; Ionescu, Irina Alexandra; Litzenburger, Martin; Hutter, Michael Christopher; Thunnissen, Andy-Mark W H; Bernhardt, Rita
The production of regio- and stereoselectively hydroxylated steroids is of high pharmaceutical interest and can be achieved by cytochrome P450-based biocatalysts. CYP260A1 from Sorangium cellulosum strain So ce56 catalyzes hydroxylation of C19 or C21 steroids at the very unique 1-position. However,
Du, Wei; Zhao, Jian; Wang, Yuying; Zhang, Yingjie; Wang, Qingqing; Xu, Weiqi; Chen, Chen; Han, Tingting; Zhang, Fang; Li, Zhanqing; Fu, Pingqing; Li, Jie; Wang, Zifa; Sun, Yele
2017-06-01
Despite extensive studies into the characterization of particle number size distributions at ground level, real-time measurements above the urban canopy in the megacity of Beijing have never been performed to date. Here we conducted the first simultaneous measurements of size-resolved particle number concentrations at ground level and 260 m in urban Beijing from 22 August to 30 September. Our results showed overall similar temporal variations in number size distributions between ground level and 260 m, yet periods with significant differences were also observed. Particularly, accumulation-mode particles were highly correlated (r2 = 0. 85) at the two heights, while Aitken-mode particles presented more differences. Detailed analysis suggests that the vertical differences in number concentrations strongly depended on particle size, and particles with a mobility diameter between 100 and 200 nm generally showed higher concentrations at higher altitudes. Particle growth rates and condensation sinks were also calculated, which were 3.2 and 3.6 nm h-1, and 2.8 × 10-2 and 2.9 × 10-2 s-1, at ground level and 260 m, respectively. By linking particle growth with aerosol composition, we found that organics appeared to play an important role in the early stage of the growth (09:00-12:00 LT) while sulfate was also important during the later period. Positive matrix factorization of size-resolved number concentrations identified three common sources at ground level and 260 m, including a factor associated with new particle formation and growth events (NPEs), and two secondary factors that represent photochemical processing and regional transport. Cooking emission was found to have a large contribution to small particles and showed much higher concentration at ground level than 260 m in the evening. These results imply that investigation of NPEs at ground level in megacities needs to consider the influences of local cooking emissions. The impacts of regional emission controls on
Onset of surface stimulated emission at 260 nm from AlGaN multiple quantum wells
Li, Xiaohang
2015-12-14
We demonstrated onset of deep-ultraviolet (DUV) surface stimulated emission (SE) from c-plane AlGaNmultiple-quantum well(MQW)heterostructuresgrown on a sapphire substrate by optical pumping at room temperature. The onset of SE became observable at a pumping power density of 630 kW/cm2. Spectral deconvolution revealed superposition of a linearly amplified spontaneous emission peak at λ ∼ 257.0 nm with a full width at half maximum (FWHM) of ∼12 nm and a superlinearly amplified SE peak at λ ∼ 260 nm with a narrow FWHM of less than 2 nm. In particular, the wavelength of ∼260 nm is the shortest wavelength of surface SE from III-nitride MQWheterostructures to date. Atomic force microscopy and scanning transmission electron microscopy measurements were employed to investigate the material and structural quality of the AlGaNheterostructures, showing smooth surface and sharp layer interfaces. This study offers promising results for AlGaNheterostructuresgrown on sapphire substrates for the development of DUV vertical cavity surface emitting lasers(VCSELs).
Directory of Open Access Journals (Sweden)
W. Zhou
2018-03-01
Full Text Available Despite extensive efforts toward the characterization of submicron aerosols at ground level in the megacity of Beijing, our understanding of aerosol sources and processes at high altitudes remains low. Here we conducted a 3-month real-time measurement of non-refractory submicron aerosol (NR-PM1 species at a height of 260 m from 10 October 2014 to 18 January 2015 using an aerosol chemical speciation monitor. Our results showed a significant change in aerosol composition from the non-heating period (NHP to the heating period (HP. Organics and chloride showed clear increases during HP due to coal combustion emissions, while nitrate showed substantial decreases from 28 to 15–18 %. We also found that NR-PM1 species in the heating season can have average mass differences of 30–44 % under similar emission sources yet different meteorological conditions. Multi-linear engine 2 (ME-2 using three primary organic aerosol (OA factors as constraints, i.e., fossil-fuel-related OA (FFOA dominantly from coal combustion emissions, cooking OA (COA, and biomass burning OA (BBOA resolved from ground high-resolution aerosol mass spectrometer measurements, was applied to OA mass spectra of ACSM. Two types of secondary OA (SOA that were well correlated with nitrate and chloride–CO, respectively, were identified. SOA played a dominant role in OA during all periods at 260 m although the contributions were decreased from 72 % during NHP to 58–64 % during HP. The SOA composition also changed significantly from NHP to HP. While the contribution of oxygenated OA (OOA was decreased from 56–63 to 32–40 %, less oxidized OOA (LO-OOA showed a large increase from 9–16 to 24–26 %. COA contributed a considerable fraction of OA at high altitude, and the contribution was relatively similar across different periods (10–13 %. In contrast, FFOA showed a large increase during HP due to the influences of coal combustion emissions. We also
2010-04-01
... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Reports by natural gas..., NATURAL GAS ACT STATEMENTS AND REPORTS (SCHEDULES) § 260.9 Reports by natural gas pipeline companies on service interruptions and damage to facilities. (a)(1) Every natural gas company must report to the...
K2-60b and K2-107b. A Sub-Jovian and a Jovian Planet from the K2 Mission
International Nuclear Information System (INIS)
Eigmüller, Philipp; Csizmadia, Szilard; Smith, Alexis M. S.; Cabrera, Juan; Erikson, Anders; Gandolfi, Davide; Barragán, Oscar; Persson, Carina M.; Fridlund, Malcolm; Donati, Paolo; Cusano, Felice; Korth, Judith; Grziwa, Sascha; Prieto-Arranz, Jorge; Nespral, David; Deeg, Hans J.; Saario, Joonas; Cochran, William D.; Endl, Michael; Guenther, Eike W.
2017-01-01
We report the characterization and independent detection of K2-60b, as well as the detection and characterization of K2-107b, two transiting hot gaseous planets from the K2 space mission. We confirm the planetary nature of the two systems and determine their fundamental parameters combining the K2 time-series data with FIES@NOT and HARPS-N@TNG spectroscopic observations. K2-60b has a radius of 0.683 ± 0.037 R Jup and a mass of 0.426 ± 0.037 M Jup and orbits a G4 V star with an orbital period of 3.00267 ± 0.00006 days. K2-107b has a radius of 1.44 ± 0.15 R Jup and a mass of 0.84 ± 0.08 M Jup and orbits an F9 IV star every 3.31392 ± 0.00002 days. K2-60b is among the few planets at the edge of the so-called “desert” of short-period sub-Jovian planets. K2-107b is a highly inflated Jovian planet orbiting an evolved star about to leave the main sequence.
K2-60b and K2-107b. A Sub-Jovian and a Jovian Planet from the K2 Mission
Energy Technology Data Exchange (ETDEWEB)
Eigmüller, Philipp; Csizmadia, Szilard; Smith, Alexis M. S.; Cabrera, Juan; Erikson, Anders [Institute of Planetary Research, German Aerospace Center, Rutherfordstrasse 2, D-12489 Berlin (Germany); Gandolfi, Davide; Barragán, Oscar [Dipartimento di Fisica, Universitá di Torino, via P. Giuria 1, I-10125 Torino (Italy); Persson, Carina M.; Fridlund, Malcolm [Department of Earth and Space Sciences, Chalmers University of Technology, Onsala Space Observatory, SE-439 92 Onsala (Sweden); Donati, Paolo; Cusano, Felice [INAF—Osservatorio Astronomico di Bologna, Via Ranzani, 1, I-40127, Bologna (Italy); Korth, Judith; Grziwa, Sascha [Rheinisches Institut für Umweltforschung an der Universität zu Köln, Aachener Strasse 209, D-50931 Köln (Germany); Prieto-Arranz, Jorge; Nespral, David; Deeg, Hans J. [Instituto de Astrofísica de Canarias, E-38205 La Laguna, Tenerife (Spain); Saario, Joonas [Nordic Optical Telescope, Apartado 474, E-38700, Santa Cruz de La Palma (Spain); Cochran, William D.; Endl, Michael [Department of Astronomy and McDonald Observatory, University of Texas at Austin, 2515 Speedway, Stop C1400, Austin, TX 78712 (United States); Guenther, Eike W. [Thüringer Landessternwarte Tautenburg, Sternwarte 5, D-07778 Tautenberg (Germany); and others
2017-03-01
We report the characterization and independent detection of K2-60b, as well as the detection and characterization of K2-107b, two transiting hot gaseous planets from the K2 space mission. We confirm the planetary nature of the two systems and determine their fundamental parameters combining the K2 time-series data with FIES@NOT and HARPS-N@TNG spectroscopic observations. K2-60b has a radius of 0.683 ± 0.037 R {sub Jup} and a mass of 0.426 ± 0.037 M {sub Jup} and orbits a G4 V star with an orbital period of 3.00267 ± 0.00006 days. K2-107b has a radius of 1.44 ± 0.15 R {sub Jup} and a mass of 0.84 ± 0.08 M {sub Jup} and orbits an F9 IV star every 3.31392 ± 0.00002 days. K2-60b is among the few planets at the edge of the so-called “desert” of short-period sub-Jovian planets. K2-107b is a highly inflated Jovian planet orbiting an evolved star about to leave the main sequence.
Review of adverse reactions, including anaphylaxis, in 4,260 intravenous bolus injections
International Nuclear Information System (INIS)
Kanal, E.; Applegate, G.R.; Gillen, C.P.
1990-01-01
This paper evaluates the incidence and type of adverse reactions to Gd-DTPA (Magnevist) after bolus administration in an active clinical MR setting. Between May 1988 and March 1990, 4,260 bolus intravenous injections of Gd-DTPA, 0.1 mmol/kg, were administered during clinical MR examinations. Patient tolerance and reactions were recorded in each instance. All cases of suspected local infiltration were excluded from this study. Review of this data revealed 15 instances of nausea and 12 of emesis following contrast administration. In addition, there were five or fewer cases of associated headaches, dizziness, odd tastes, seizures (with prior seizure histories) mild chest pain, palpitations, hives, or wheezing
Global radiation damage at 300 and 260 K with dose rates approaching 1 MGy s{sup −1}
Energy Technology Data Exchange (ETDEWEB)
Warkentin, Matthew; Badeau, Ryan; Hopkins, Jesse B. [Cornell University, Ithaca, NY 14853 (United States); Mulichak, Anne M.; Keefe, Lisa J. [Argonne National Laboratory, Argonne, IL 60439 (United States); Thorne, Robert E., E-mail: ret6@cornell.edu [Cornell University, Ithaca, NY 14853 (United States)
2012-02-01
Approximately half of global radiation damage to thaumatin crystals can be outrun at 260 K if data are collected in less than 1 s. Global radiation damage to 19 thaumatin crystals has been measured using dose rates from 3 to 680 kGy s{sup −1}. At room temperature damage per unit dose appears to be roughly independent of dose rate, suggesting that the timescales for important damage processes are less than ∼1 s. However, at T = 260 K approximately half of the global damage manifested at dose rates of ∼10 kGy s{sup −1} can be outrun by collecting data at 680 kGy s{sup −1}. Appreciable sample-to-sample variability in global radiation sensitivity at fixed dose rate is observed. This variability cannot be accounted for by errors in dose calculation, crystal slippage or the size of the data sets in the assay.
Onset of surface stimulated emission at 260 nm from AlGaN multiple quantum wells
International Nuclear Information System (INIS)
Li, Xiaohang; Xie, Hongen; Ponce, Fernando A.; Ryou, Jae-Hyun; Detchprohm, Theeradetch; Dupuis, Russell D.
2015-01-01
We demonstrated onset of deep-ultraviolet (DUV) surface stimulated emission (SE) from c-plane AlGaN multiple-quantum well (MQW) heterostructures grown on a sapphire substrate by optical pumping at room temperature. The onset of SE became observable at a pumping power density of 630 kW/cm 2 . Spectral deconvolution revealed superposition of a linearly amplified spontaneous emission peak at λ ∼ 257.0 nm with a full width at half maximum (FWHM) of ∼12 nm and a superlinearly amplified SE peak at λ ∼ 260 nm with a narrow FWHM of less than 2 nm. In particular, the wavelength of ∼260 nm is the shortest wavelength of surface SE from III-nitride MQW heterostructures to date. Atomic force microscopy and scanning transmission electron microscopy measurements were employed to investigate the material and structural quality of the AlGaN heterostructures, showing smooth surface and sharp layer interfaces. This study offers promising results for AlGaN heterostructures grown on sapphire substrates for the development of DUV vertical cavity surface emitting lasers (VCSELs)
Phase-shift analysis in pion-/sup 4/He elastic scattering. [60 to 260 MeV
Energy Technology Data Exchange (ETDEWEB)
Falomkin, I V; Nichitiu, F; Sapozhnikov, M G; Shcherbakov, YU A [Joint Inst. for Nuclear Research, Dubna (USSR); Balestra, F; Bollini, E [Turin Univ. (Italy). Istituto di Fisica
1978-02-21
An energy-independent phase-shift analysis (PSA) of the elastic scattering of pions on /sup 4/He, in the energy range 60 to 260 MeV has been performed. All possible solutions, arising from the phase-shift analysis ambiguity, have been analyzed. Particular care has been taken in the choice of the physical solution. The calculated phase shifts have been compared with the results of the energy-dependent phase-shift analysis (EDPSA) and with the optical-model predictions.
The Performance of PS400 Subjected to Sliding Contact at Temperatures from 260 to 927 deg C
2016-09-14
bilities. Such candidate applications include process control valve stems, inlet guide vane bushings , butterfly valve stems, and waste gate valves for...cobalt-based superalloy bushings loaded against reciprocating PS400-coated shaft specimens in a flat-on-cylinder configuration at Hertz contact...contact at temperatures from 260 to 927C. The tests were performed on stationary, uncoated cobalt-based superalloy bushings loaded against
DEFF Research Database (Denmark)
Wagner, Hans Peter; Araoz, Mauricio; Boushel, Robert Christopher
2002-01-01
hyperoxic work, capacity was 73% greater in N. Buffering of lactic acid was greater in N, with 20% less increase in base deficit per millimole per liter rise in lactate. These data show in L persistent alkalosis even after 9 wk at 5,260 m. In N, the data show 1) insignificant reduction in exercise capacity...
Synthesis and detection of a seaborgium carbonyl complex
Even, J.; Yakushev, A.; Duellmann, Ch E.; Haba, H.; Asai, M.; Sato, T. K.; Brand, H.; Di Nitto, A.; Eichler, R.; Fan, F. L.; Hartmann, W.; Huang, M.; Jaeger, E.; Kaji, D.; Kanaya, J.; Kaneya, Y.; Khuyagbaatar, J.; Kindler, B.; Kratz, J. V.; Krier, J.; Kudou, Y.; Kurz, N.; Lommel, B.; Miyashita, S.; Morimoto, K.; Morita, K.; Murakami, M.; Nagame, Y.; Nitsche, H.; Ooe, K.; Qin, Z.; Schaedel, M.; Steiner, J.; Sumita, T.; Takeyama, M.; Tanaka, K.; Toyoshima, A.; Tsukada, K.; Tuerler, A.; Usoltsev, I.; Wakabayashi, Y.; Wang, Y.; Wiehl, N.; Yamaki, S.
2014-01-01
Experimental investigations of transactinoide elements provide benchmark results for chemical theory and probe the predictive power of trends in the periodic table. So far, in gas-phase chemical reactions, simple inorganic compounds with the transactinoide in its highest oxidation state have been
Chemistry of the heaviest elements--one atom at a time
International Nuclear Information System (INIS)
Hoffman, Darleane C.; Lee, Diana M.
2000-01-01
In keeping with the goal of the Viewpoint series of the Journal of Chemical Education, this article gives a 75-year perspective of the chemistry of the heaviest elements, including a 50-year retrospective view of past developments, a summary of current research achievements and applications, and some predictions about exciting, new developments that might be envisioned within the next 25 years. A historical perspective of the importance of chemical separations in the discoveries of the transuranium elements from neptunium (Z=93) through mendelevium (Z=101) is given. The development of techniques for studying the chemical properties of mendelevium and still heavier elements on the basis of measuring the radioactive decay of a single atom (''atom-at-a-time'' chemistry) and combining the results of many separate experiments is reviewed. The influence of relativistic effects (expected to increase as Z 2 ) on chemical properties is discussed. The results from recent atom-at-a-time studies of the chemistry of the heaviest elements through seaborgium (Z=106) are summarized and show that their properties cannot be readily predicted based on simple extrapolation from the properties of their lighter homologues in the periodic table. The prospects for extending chemical studies to still heavier elements than seaborgium are considered and appear promising
Dynamic nuclear polarization by frequency modulation of a tunable gyrotron of 260GHz.
Yoon, Dongyoung; Soundararajan, Murari; Cuanillon, Philippe; Braunmueller, Falk; Alberti, Stefano; Ansermet, Jean-Philippe
2016-01-01
An increase in Dynamic Nuclear Polarization (DNP) signal intensity is obtained with a tunable gyrotron producing frequency modulation around 260GHz at power levels less than 1W. The sweep rate of frequency modulation can reach 14kHz, and its amplitude is fixed at 50MHz. In water/glycerol glassy ice doped with 40mM TEMPOL, the relative increase in the DNP enhancement was obtained as a function of frequency-sweep rate for several temperatures. A 68 % increase was obtained at 15K, thus giving a DNP enhancement of about 80. By employing λ/4 and λ/8 polarizer mirrors, we transformed the polarization of the microwave beam from linear to circular, and achieved an increase in the enhancement by a factor of about 66% for a given power. Copyright © 2015 Elsevier Inc. All rights reserved.
Nuclear structure studies in the seaborgium region at SHIP
Energy Technology Data Exchange (ETDEWEB)
Antalic, S., E-mail: Stanislav.Antalic@fmph.uniba.sk; Andel, B. [Comenius University in Bratislava, 84248 Bratislava (Slovakia); Heßberger, F. P.; Khuyagbaatar, J. [GSI - Helmhotzzentrum für Schwerionenforschung GmbH, 64291 Darmstadt (Germany); Helmholtz Institute in Mainz, 55099 Mainz (Germany); Ackermann, D. [GSI - Helmhotzzentrum für Schwerionenforschung GmbH, 64291 Darmstadt (Germany); GANIL, 14074 Caen (France); Heinz, S.; Hofmann, S.; Kindler, B.; Laatiaoui, M.; Lommel, B. [GSI - Helmhotzzentrum für Schwerionenforschung GmbH, 64291 Darmstadt (Germany); Kalaninová, Z. [Comenius University in Bratislava, 84248 Bratislava (Slovakia); Laboratory of Nuclear Problems, JINR, 141980 Dubna (Russian Federation); Piot, J.; Vostinar, M. [GANIL, 14074 Caen (France)
2015-10-15
New decay data for the isotopes {sup 259}Sg and {sup 255}Rf were obtained at the velocity filter SHIP using an α-decay spectroscopy measurement. Both isotopes were produced and studied via a one neutron evaporation channel in the compound fusion reaction {sup 54}Cr+{sup 208}Pb. New isomeric states were observed and the single-particle level systematics for isotones with 151 and 153 neutrons were extended. A change of the ground-state configuration for the heaviest N = 151 isotones was observed. Detailed Monte-Carlo simulation for the α decay of {sup 259}Sg applying the GEANT4 toolkit was performed and compared with experimental data.
Energy Technology Data Exchange (ETDEWEB)
Gupta, M. [Manipal University, Manipal (India); Burrows, T. W. [Brookhaven National Laboratory, National Nuclear Data Center, Upton, NY (United States)
2013-08-15
A=260-265: The evaluation methodology developed in 2005Gu33 (A=266-294) has been applied to the mass region A=260-265. While the evaluation technique is based on 1992Ba77, additional evaluation tools include using the approximations of 1984Sc13 for estimates of half-lives and an updated parameter set for the Viola-Seaborg phenomenology (1966Vi04). The nuclides which form the subject matter of the present evaluation were covered in 1999Ar21, 1999Ak02, and 2001Ak11 and 2000Fi12 ({sup 265}Rf). New data are available and an update is due. Also, some of the {alpha}-decay mass chains from heavier nuclei (A{>=}266) end in this region and it was felt that the same evaluation methodology adopted for (distant) ancestors could be usefully extended to descendants within a given {alpha}-decay chain for consistency and uniformity of treatment. In instances where no new data are available, a re-evaluation of existing data within this internally consistent framework also yields useful information. The current evaluation spans about 9 elements comprising about Almost-Equal-To 31 observed nuclides. Approximately 40% of these nuclides have been experimentally studied using chemical techniques which often provide increased statistics and could be used for independent verification of the data. Relevant experimental quantities such as information on cross-sections and atomic properties derived from chemical studies are also provided. Future plans are presented.
Directory of Open Access Journals (Sweden)
Alguacil, F. J.
2002-10-01
Full Text Available The adsorption of cadmium (II, from aqueous sulphate solutions, on Lewatit TP260 resin has been investigated in batch equilibrium experiments. The influence of pH and temperature on metal adsorption capacity have also been examined. The kinetic performance of the resin has been assesed and the results have been correlated by the pore diffusion model. The resin has been used in mini-columns to study its performance under dynamics conditions. The desorption of metal ion is achieved using sulphuric acid (0.25M and 0.5M.
Se estudia la adsorción de cadmio(II, de disoluciones en medio sulfato, sobre la resina Lewatit TP260. La adsorción del metal se ha investigado en función del pH, la temperatura y el tiempo de contacto con la resina. Los estudios cinéticos permiten correlacionar el proceso de intercambio iónico con el modelo de difusión en poro. Se ha empleado el sistema en mini columnas para evaluar el comportamiento de la resina bajo condiciones dinámicas. La desorción del metal se lleva a cabo con disoluciones de ácido sulfúrico (0,25M y 0,5M.
Zarrouk, A; Hammami, M; Moreau, T; Lizard, G
2015-02-01
Cholesterol oxide derivatives (oxysterols) are viewed as potential biomarkers of neurodegenerative diseases. 24S-hydroxycholesterol, an oxysterol produced only in brain neurons, is often found for unknown reasons in increased levels in the plasma in patients with neurodegenerative diseases. On human neuronal SK-N-BE cells treated with hexacosanoic acid (C26:0) identified at increased levels in the tissues and plasma of patients with peroxisomal leukodystrophies and Alzheimer's disease, we observed increased level of 24S-hydroxycholesterol associated with C26:0 induced lipotoxicity. This finding reinforces the hypothesis suggesting that 24S-hydroxycholesterol could constitute a biomarker of neurotoxicity. Copyright © 2014 Elsevier Masson SAS. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Beretta, D.; Lanzani, G. [Center for Nano Science and Technology @PoliMi, Istituto Italiano di Tecnologia, via Pascoli 70/3, 20133 Milano (MI) (Italy); Dipartimento di Fisica, P.zza Leonardo da Vinci 32, Politecnico di Milano, 20133 Milano (MI) (Italy); Bruno, P.; Caironi, M., E-mail: mario.caironi@iit.it [Center for Nano Science and Technology @PoliMi, Istituto Italiano di Tecnologia, via Pascoli 70/3, 20133 Milano (MI) (Italy)
2015-07-15
A new experimental setup for reliable measurement of the in-plane Seebeck coefficient of organic and inorganic thin films and bulk materials is reported. The system is based on the “Quasi-Static” approach and can measure the thermopower in the range of temperature between 260 K and 460 K. The system has been tested on a pure nickel bulk sample and on a thin film of commercially available PEDOT:PSS deposited by spin coating on glass. Repeatability within 1.5% for the nickel sample is demonstrated, while accuracy in the measurement of both organic and inorganic samples is guaranteed by time interpolation of data and by operating with a temperature difference over the sample of less than 1 K.
International Nuclear Information System (INIS)
Liu Binwen; Gao Xiusheng; Zhang Yahua; Pu Dongli
2003-01-01
Objective: To study the therapeutic effect and find new ways on treatment of Grave's hyperthyroidism in youngsters. Methods: 260 Grave's hyperthyroidism patients (age under 21 years) treated with 131 I were followed up 1-16 years later. Results: 118 of all patients were cured and 55 cases improved, failed treatment 2 cases, subclinical hypothyroidism 9 cases, clinical hypothyroidism 6 cases. 35 cases were treated with 131 I two or three times. All the patients with subclinical hypothyroidism and clinical hypothyroidism caused by 131 I were cured with medicine. 131 I treatment had no effect on growth and mentality and didn't cause leukemia nor thyroid cancer. Conclusions: The therapy of youngsters with Grave's hyperthyroidism with 131 I has the same effectiveness as adult. To the youngster Grave's patients who failed medical treatment, therapy with 131 I is safe and effective. It leads to temporary hypothyroidism which can be cured with medicine, no delayed hypothyroidism has been found
Directory of Open Access Journals (Sweden)
Amira Zarrouk
2012-01-01
Full Text Available In Alzheimer's disease, lipid alterations point towards peroxisomal dysfunctions. Indeed, a cortical accumulation of saturated very long chain fatty acids (VLCFAs: C22:0, C24:0, C26:0, substrates for peroxisomal β-oxidation, has been found in Alzheimer patients. This study was realized to investigate the effects of VLCFAs at the mitochondrial level since mitochondrial dysfunctions play crucial roles in neurodegeneration. On human neuronal SK-NB-E cells treated with C22:0, C24:0, or C26:0 (0.1–20 μM; 48 h, an inhibition of cell growth and mitochondrial dysfunctions were observed by cell counting with trypan blue, MTT assay, and measurement of mitochondrial transmembrane potential (Δψm with DiOC6(3. A stimulation of oxidative stress was observed with DHE and MitoSOX used to quantify superoxide anion production on whole cells and at the mitochondrial level, respectively. With C24:0 and C26:0, by Western blotting, lower levels of mitochondrial complexes III and IV were detected. After staining with MitoTracker and by transmission electron microscopy used to study mitochondrial topography, mass and morphology, major changes were detected in VLCFAs treated-cells: modification of the cytoplasmic distribution of mitochondria, presence of large mitochondria, enhancement of the mitochondrial mass. Thus, VLCFAs can be potential risk factors contributing to neurodegeneration by inducing neuronal damages via mitochondrial dysfunctions.
Achados cirúrgicos em 260 casos de impressão basilar e/ou malformação de Arnold-Chiari
Directory of Open Access Journals (Sweden)
José Alberto Gonçalves da Silva
1994-09-01
Full Text Available A impressão basilar é malformação frequentemente observada no Nordeste do Brasil. No período de 1971 a 1992 foram operados, em nosso Serviço, 260 pacientes com malformações occipitocervicais, sendo 29 (11,1% casos de impressão basilar pura, 18 (6,9% com malformação de Arnold-Chiari e 213 (81,9% com impressão basilar associada à malformação de Arnold-Chiari. São relatados os achados cirúrgicos do plano ósseo, da dura-máter, do tecido nervoso e dos vasos da fossa posterior.
International Nuclear Information System (INIS)
Bhattacharyya, D.P.; Gautam, V.P.
1982-01-01
The integral electron photon spectra of cosmic rays at airplane altitude and Lenin Peak (altitudes 260 and 400 g-cm -2 air) have been estimated from the primary proton spectrum of Goddard Space Flight Group using Fermilab data of pp→π +- +X and conventional cascade theory. The derived electron-photon spectra fits well the experimental data of Ohta et al. (1975) and Cherdyntseva and Nikol'skii (1976) for energies above 4 TeV
Southern African ancient genomes estimate modern human divergence to 350,000 to 260,000 years ago.
Schlebusch, Carina M; Malmström, Helena; Günther, Torsten; Sjödin, Per; Coutinho, Alexandra; Edlund, Hanna; Munters, Arielle R; Vicente, Mário; Steyn, Maryna; Soodyall, Himla; Lombard, Marlize; Jakobsson, Mattias
2017-11-03
Southern Africa is consistently placed as a potential region for the evolution of Homo sapiens We present genome sequences, up to 13x coverage, from seven ancient individuals from KwaZulu-Natal, South Africa. The remains of three Stone Age hunter-gatherers (about 2000 years old) were genetically similar to current-day southern San groups, and those of four Iron Age farmers (300 to 500 years old) were genetically similar to present-day Bantu-language speakers. We estimate that all modern-day Khoe-San groups have been influenced by 9 to 30% genetic admixture from East Africans/Eurasians. Using traditional and new approaches, we estimate the first modern human population divergence time to between 350,000 and 260,000 years ago. This estimate increases the deepest divergence among modern humans, coinciding with anatomical developments of archaic humans into modern humans, as represented in the local fossil record. Copyright © 2017 The Authors, some rights reserved; exclusive licensee American Association for the Advancement of Science. No claim to original U.S. Government Works.
International Nuclear Information System (INIS)
Liu, C.; Yuan, F.; Gen, Z.; Wang, L.; Cui, Y.G.; Wan, J.F.; Zhang, J.H.; Rong, Y.H.
2016-01-01
Temperature-dependence surface relief during cubic↔tetragonal martensitic transformation (MT) in Mn_6_9_._4Fe_2_6_._0Cu_4_._6 antiferromegnetic shape memory alloy was studied by means of in-situ atomic force microscopy. The surface morphology memory effect was found and the crystallography reversibility of the transformation and its shearing characters were directly verified. Twin shearing is suggested as the main mechanism of formation of tent-type surface relief. The surface relief angle (θ_α|θ_β)<0.5° was firstly measured and might be the smallest compared with that in other shape memory alloys. A Landau model was proposed to consider the shearing strain related with surface relief of MT varying with the coupling effect between second-order antiferromagnetic transition and first-order MT. According to this model, the Mn_6_9_._4Fe_2_6_._0Cu_4_._6 alloy belongs to the weak coupling system and this kind of weak coupling effect makes the main contribution to the small relief angle. - Highlights: • Temperature-dependence surface relief in Mn-Fe-Cu alloy was firstly studied. • The surface morphology memory effect in Mn-Fe-Cu alloy was found. • Smallest surface relief angle (θ_α|θ_β).
2014-04-01
A correlation between Wavelength Dispersive X-ray Fluorescence(WDXRF) analysis of Hardened : Concrete for Chlorides and Atomic Absorption (AA) analysis (current method AASHTO T-260, procedure B) has been : found and a new method of analysis has been ...
Amplifier Module for 260-GHz Band Using Quartz Waveguide Transitions
Padmanabhan, Sharmila; Fung, King Man; Kangaslahti, Pekka P.; Peralta, Alejandro; Soria, Mary M.; Pukala, David M.; Sin, Seth; Samoska, Lorene A.; Sarkozy, Stephen; Lai, Richard
2012-01-01
Packaging of MMIC LNA (monolithic microwave integrated circuit low-noise amplifier) chips at frequencies over 200 GHz has always been problematic due to the high loss in the transition between the MMIC chip and the waveguide medium in which the chip will typically be used. In addition, above 200 GHz, wire-bond inductance between the LNA and the waveguide can severely limit the RF matching and bandwidth of the final waveguide amplifier module. This work resulted in the development of a low-loss quartz waveguide transition that includes a capacitive transmission line between the MMIC and the waveguide probe element. This capacitive transmission line tunes out the wirebond inductance (where the wire-bond is required to bond between the MMIC and the probe element). This inductance can severely limit the RF matching and bandwidth of the final waveguide amplifier module. The amplifier module consists of a quartz E-plane waveguide probe transition, a short capacitive tuning element, a short wire-bond to the MMIC, and the MMIC LNA. The output structure is similar, with a short wire-bond at the output of the MMIC, a quartz E-plane waveguide probe transition, and the output waveguide. The quartz probe element is made of 3-mil quartz, which is the thinnest commercially available material. The waveguide band used is WR4, from 170 to 260 GHz. This new transition and block design is an improvement over prior art because it provides for better RF matching, and will likely yield lower loss and better noise figure. The development of high-performance, low-noise amplifiers in the 180-to- 700-GHz range has applications for future earth science and planetary instruments with low power and volume, and astrophysics array instruments for molecular spectroscopy. This frequency band, while suitable for homeland security and commercial applications (such as millimeter-wave imaging, hidden weapons detection, crowd scanning, airport security, and communications), also has applications to
New Sesquiterpene Oxidations with CYP260A1 and CYP264B1 from Sorangium cellulosum So ce56.
Schifrin, Alexander; Litzenburger, Martin; Ringle, Michael; Ly, Thuy T B; Bernhardt, Rita
2015-12-01
Sesquiterpenes are natural products derived from the common precursor farnesyl pyrophosphate (FPP) but are highly diverse in structure and function. Cytochrome P450 enzymes (P450s) exhibit the unique ability to introduce molecular oxygen into non-activated C-H bonds. In plant biosynthetic pathways, P450s commonly derivatize sesquiterpene hydrocarbons. However, the potential of bacterial P450s for terpene derivatization is still underinvestigated. This work compares the substrate specificities and regioselectivities of the sesquiterpene hydroxylases CYP260A1 and CYP264B1 from myxobacterium Sorangium cellulosum So ce56. Four tested substrate classes (eremophilanes, humulanes, caryophyllanes, and cedranes) were converted by both P450s. The achievable variety of oxidations is demonstrated on the model substrates (+)-nootkatone and zerumbone. Increasing the number of functionally investigated P450s, this study represents a step towards the selective derivatization of sesquiterpenes. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Energy Technology Data Exchange (ETDEWEB)
Mahboub, D.
1996-10-30
This work is focussed on the investigation of deformed nuclei. The asymmetric fusion-fission of light heavy-ions (A {<=}60) with a high excitation energy (T {approx} 4 MeV) had lead to a large deformation of the compound nucleus at the scission point. The angular correlations between light particles (LP) and their emitting fragments has been used to probe the deformation of nucleus. Exclusive measurements were performed for the {sup 35}Cl (260 MeV) + {sup 24}Mg system leading to the {sup 59}Cu compound nucleus (CN). The comparison between the energy spectra of LP`s and a statistical calculation carried out by a Monte-Carlo code CASCADE has suggested a deformation of 1.3 (for an oblate shape) of the CN within the frame work of fusion-evaporation process. The source velocity spectrum of {alpha} particles and angular correlations of LP`s have showed that pre-scission and pre-equilibrium emissions are negligible in the present reaction. Finally the confrontation of the data with the statistical code GEMINI has pointed out the sequential emission character of the LP`s from the fission fragments. (author). 175 refs.
Odd-Z Transactinide Compound Nucleus Reactions Including the Discovery of 260Bh
International Nuclear Information System (INIS)
Nelson, Sarah L; Nelson, Sarah L
2008-01-01
Several reactions producing odd-Z transactinide compound nuclei were studied with the 88-Inch Cyclotron and the Berkeley Gas-Filled Separator at the Lawrence Berkeley National Laboratory. The goal was to produce the same compound nucleus at or near the same excitation energy with similar values of angular momentum via different nuclear reactions. In doing so, it can be determined if there is a preference in entrance channel, because under these experimental conditions the survival portion of Swiatecki, Siwek-Wilcznska, and Wilczynski's 'Fusion By Diffusion' model is nearly identical for the two reactions. Additionally, because the same compound nucleus is produced, the exit channel is the same. Four compound nuclei were examined in this study: 258Db, 262Bh, 266Mt, and 272Rg. These nuclei were produced by using very similar heavy-ion induced-fusion reactions which differ only by one proton in the projectile or target nucleus (e.g.: 50Ti + 209Bi vs. 51V + 208Pb). Peak 1n exit channel cross sections were determined for each reaction in each pair, and three of the four pairs; cross sections were identical within statistical uncertainties. This indicates there is not an obvious preference of entrance channel in these paired reactions. Charge equilibration immediately prior to fusion leading to a decreased fusion barrier is the likely cause of this phenomenon. In addition to this systematic study, the lightest isotope of element 107, bohrium, was discovered in the 209Bi(52Cr,n) reaction. 260Bh was found to decay by emission of a 10.16 MeV alpha particle with a half-life of 35 ms. The cross section is 59 pb at an excitation energy of 15.0 MeV. The effect of the N = 152 shell is also seen in this isotope's alpha particle energy, the first evidence of such an effect in Bh. All reactions studied are also compared to model predictions by Swiatecki, Siwek-Wilcznska, and Wilczynski's 'Fusion By Diffusion' theory
Kjaergaard, Anders; Leon, Gloria R; Venables, Noah C
2015-04-01
The focus of this case report is on the psychological reintegration process following the achievement of a highly challenging long-duration and solitary endeavor. The participant was a 29 year old male who successfully circumnavigated the globe during a 260 day solo sailing expedition. We assessed the psychological aftermath in terms of stability and change in personality characteristics and personal beliefs prior to, and at 180 and 360 days after the completion of the journey. Overall, the personality configuration reflected adaptive personality functioning. A belief in an internal locus of control was consistent throughout, as were perceptions of personal growth as a result of the circumnavigation experience. NEO PI-R Neuroticism, Extraversion, Openness, and Triarchic Psychopathy Measure (Tri-PM) Boldness scores remained stable. Positive personality change was reflected by an elevation in Conscientiousness; negative change by a decline in Agreeableness and an increase in Tri-PM Disinhibition. While overall the participant exhibited positive change as a result of his journey, there were also some negative aspects of the reintegration phase in regard to interactions with other persons. This latter change may be related to the effects of isolation from usual social contacts over an extended period. © 2015 Scandinavian Psychological Associations and John Wiley & Sons Ltd.
Insertion of Balloon Retained Gastrostomy Buttons: A 5-Year Retrospective Review of 260 Patients
International Nuclear Information System (INIS)
Power, Sarah; Kavanagh, Liam N.; Shields, Mary C.; Given, Mark F.; Keeling, Aoife N.; McGrath, Frank P.; Lee, Michael J.
2013-01-01
Radiologically inserted gastrostomy (RIG) is an established way of maintaining enteral nutrition in patients who cannot maintain nutrition orally. The purpose of this study was to evaluate the safety and efficacy of primary placement of a wide bore button gastrostomy in a large, varied patient population through retrospective review. All patients who underwent gastrostomy placement from January 1, 2004 to January 1, 2009 were identified. 18-Fr gastrostomy buttons (MIC-Key G) were inserted in the majority. Follow-up ranged from 6 months to 4.5 years. A total of 260 patients (M:F 140:120, average age 59.2 years) underwent gastrostomy during the study period. Overall success rate for RIG placement was 99.6 %, with success rate of 95.3 % for primary button insertion. Indications included neurological disorders (70 %), esophageal/head and neck malignancy (21 %), and other indications (9 %). Major and minor complication rates were 1.2 and 12.8 %, respectively. Thirty-day mortality rate was 6.8 %. One third of patients underwent gastrostomy reinsertion during the study period, the main indication for which was inadvertent catheter removal. Patency rate was high at 99.5 %. The maximum number of procedures in any patient was 8 (n = 2), and the average tube dwell time was 125 days. Primary radiological insertion of a wide bore button gastrostomy is a safe technique, with high success rate, high patency rate, and low major complication rate. We believe that it is feasible to attempt button gastrostomy placement in all patients, once tract length is within limits of tube length. If difficulty is encountered, then a standard tube may simply be placed instead.
Insertion of Balloon Retained Gastrostomy Buttons: A 5-Year Retrospective Review of 260 Patients
Energy Technology Data Exchange (ETDEWEB)
Power, Sarah, E-mail: sarahpower28@yahoo.co.uk; Kavanagh, Liam N.; Shields, Mary C.; Given, Mark F.; Keeling, Aoife N.; McGrath, Frank P.; Lee, Michael J., E-mail: mlee@rcsi.ie [Beaumont Hospital, Department of Radiology (Ireland)
2013-04-15
Radiologically inserted gastrostomy (RIG) is an established way of maintaining enteral nutrition in patients who cannot maintain nutrition orally. The purpose of this study was to evaluate the safety and efficacy of primary placement of a wide bore button gastrostomy in a large, varied patient population through retrospective review. All patients who underwent gastrostomy placement from January 1, 2004 to January 1, 2009 were identified. 18-Fr gastrostomy buttons (MIC-Key G) were inserted in the majority. Follow-up ranged from 6 months to 4.5 years. A total of 260 patients (M:F 140:120, average age 59.2 years) underwent gastrostomy during the study period. Overall success rate for RIG placement was 99.6 %, with success rate of 95.3 % for primary button insertion. Indications included neurological disorders (70 %), esophageal/head and neck malignancy (21 %), and other indications (9 %). Major and minor complication rates were 1.2 and 12.8 %, respectively. Thirty-day mortality rate was 6.8 %. One third of patients underwent gastrostomy reinsertion during the study period, the main indication for which was inadvertent catheter removal. Patency rate was high at 99.5 %. The maximum number of procedures in any patient was 8 (n = 2), and the average tube dwell time was 125 days. Primary radiological insertion of a wide bore button gastrostomy is a safe technique, with high success rate, high patency rate, and low major complication rate. We believe that it is feasible to attempt button gastrostomy placement in all patients, once tract length is within limits of tube length. If difficulty is encountered, then a standard tube may simply be placed instead.
Wooldridge, Scott A.
2017-12-01
Changes in the atmospheric partial pressure of CO2 ( pCO2) leads to predictable impacts on the surface ocean carbonate system. Here, the importance of atmospheric pCO2 <260 ppmv is established for the optimum performance (and stability) of the algal endosymbiosis employed by a key suite of tropical reef-building coral species. Violation of this symbiotic threshold is revealed as a prerequisite for major historical reef extinction events, glacial-interglacial feedback climate cycles, and the modern decline of coral reef ecosystems. Indeed, it is concluded that this symbiotic threshold enacts a fundamental feedback mechanism needed to explain the characteristic dynamics (and drivers) of the coupled land-ocean-atmosphere carbon cycle of the Earth System since the mid-Miocene, some 25 million yr ago.
Odd-Z Transactinide Compound Nucleus Reactions Including the Discovery of 260Bh
Energy Technology Data Exchange (ETDEWEB)
Nelson, Sarah L. [Univ. of California, Berkeley, CA (United States)
2008-01-01
Several reactions producing odd-Z transactinide compound nuclei were studiedwith the 88-Inch Cyclotron and the Berkeley Gas-Filled Separator at the Lawrence Berkeley National Laboratory. The goal was to produce the same compound nucleus ator near the same excitation energy with similar values of angular momentum via differentnuclear reactions. In doing so, it can be determined if there is a preference in entrancechannel, because under these experimental conditions the survival portion of Swiatecki, Siwek-Wilcznska, and Wilczynski's"Fusion By Diffusion" model is nearly identical forthe two reactions. Additionally, because the same compound nucleus is produced, theexit channel is the same. Four compound nuclei were examined in this study: 258Db, 262Bh, 266Mt, and 272Rg. These nuclei were produced by using very similar heavy-ion induced-fusion reactions which differ only by one proton in the projectile or target nucleus (e.g.: 50Ti + 209Bi vs. 51V + 208Pb). Peak 1n exit channel cross sections were determined for each reaction in each pair, and three of the four pairs' cross sections were identical within statistical uncertainties. This indicates there is not an obvious preference of entrancechannel in these paired reactions. Charge equilibration immediately prior to fusionleading to a decreased fusion barrier is the likely cause of this phenomenon. In addition to this systematic study, the lightest isotope of element 107, bohrium, was discovered in the 209Bi(52Cr,n) reaction. 260Bh was found to decay by emission of a 10.16 MeV alpha particle with a half-life of 35$+19\\atop{-9}$ ms. The cross section is 59 pb at an excitation energy of 15.0 MeV. The effect of the N = 152 shell is also seen in this isotope's alpha particle energy, the first evidence of such an effect in Bh. All reactions studied are also compared to model predictions by Swiatecki
Dormenev, V.; Brinkmann, K.-T.; Korjik, M.; Novotny, R. W.
2017-11-01
One of the most critical aspects for the application of a scintillation material in high energy physics is the degradation of properties of the material in an environment of highly ionizing particles in particular due to hadrons. There are presently several detector concepts in consideration being based on organic scintillator material for fast timing of charged particles or sampling calorimeters. We have tested different samples of the organic plastic scintillator EJ-260 produced by the company Eljen Technology (Sweetwater, TX, USA). The ongoing activity has characterized the relevant parameters such as light output, kinetics and temperature dependence. The study has focused on the change of performance after irradiation with 150 MeV protons up to an integral fluence of 5·1013 protons/cm2 as well as with a strong 60Co γ-source accumulating an integral dose of 100 Gy. The paper will report on the obtained results.
Summar, Marshall L; Dobbelaere, Dries; Brusilow, Saul; Lee, Brendan
2008-10-01
A large longitudinal interventional study of patients with a urea cycle disorder (UCD) in hyperammonaemic crisis was undertaken to amass a significant body of data on their presenting symptoms and survival. Between 1982 and 2003, as part of the FDA approval process, data were collected on patients receiving an intravenous combination of nitrogen scavenging drugs (Ammonul sodium phenylacetate and sodium benzoate (10%, 10%)) for the treatment of hyperammonaemic crises caused by urea cycle disorders. A final diagnosis of a UCD was made for 260 patients, representing 975 episodes of hospitalization. Only 34% of these patients presented within the first 30 days of life and had a mortality rate of 32%. The most common presenting symptoms were neurological (80%), or gastrointestinal (33%). This cohort is the largest collection of patients reported for these diseases and the first large cohort in the United States. Surprisingly, the majority (66%) of patients with heritable causes of hyperammonaemia present beyond the neonatal period (>30 days). Patients with late-onset presenting disorders exhibited prolonged survival compared to the neonatal-presenting group.
Iglesias, Pedro; Díez, Juan J
2008-10-01
Several aspects of thyroid dysfunction have not been fully characterized in large series of male patients. Our aim was to investigate the etiology and clinical features of hypothyroidism and assess the adequacy of replacement therapy in men attending an endocrinology clinic. We studied a group of 260 men (mean (+/-standard deviation) age 58.3 +/- 16.1 years) periodically seen because of thyroid hypofunction. We evaluated the etiology of hypothyroidism, presence or absence of goiter, time of evolution from diagnosis, current thyroid autoimmunity and thyroid functional status, and adequacy of disease control. Overt hypothyroidism was found in 182 (70.0%) and subclinical hypothyroidism in 78 (30.0%) patients. Autoimmune thyroiditis was the most frequent etiology (n = 107, 41.2%). Of these, 96 (89.7%) showed no goiter. Thyroid peroxidase antibodies were measured in 238 patients, being positive in 129 (54.2%) and negative in 109 (45.8%) patients. After excluding patients with thyroid carcinoma and those with recently diagnosed hypothyroidism, we found an adequate control of thyroid function, ie, normal thyrotropin and free thyroxine levels, in 95 patients (64.2%). Adequacy of treatment did not show any relationship with age, age at diagnosis, etiology, and autoimmune status. However, adequacy was significantly related to the degree of thyroid hypofunction (P < 0.001) and to the duration of disease (P < 0.01). We conclude that autoimmune thyroiditis, mainly the nongoitrous form, and postoperative hypothyroidism are the foremost causes of thyroid hypofunction in male patients. Adequacy of replacement treatment seems to be mainly related to the degree of thyroid hypofunction and the time from starting therapy.
Directory of Open Access Journals (Sweden)
S. A. Wooldridge
2012-05-01
Full Text Available Most scleractinian corals and many other cnidarians host intracellular photosynthetic dinoflagellate symbionts ("zooxanthellae". The zooxanthellae contribute to host metabolism and skeletogenesis to such an extent that this symbiosis is well recognised for its contribution in creating the coral reef ecosystem. The stable functioning of cnidarian symbioses is however dependent upon the host's ability to maintain demographic control of its algal partner. In this review, I explain how the modern envelope of seawater conditions found within many coral reef ecosystems (characterised by elevated temperatures, rising pCO2, and enriched nutrient levels are antagonistic toward the dominant host processes that restrict excessive symbiont proliferation. Moreover, I outline a new hypothesis and initial evidence base, which support the suggestion that the additional "excess" zooxanthellae fraction permitted by seawater pCO2 levels beyond 260 ppmv significantly increases the propensity for symbiosis breakdown ("bleaching" in response to temperature and irradiance extremes. The relevance of this biological threshold is discussed in terms of historical reef extinction events, glacial-interglacial climate cycles and the modern decline of coral reef ecosystems.
Wooldridge, S. A.
2012-05-01
Most scleractinian corals and many other cnidarians host intracellular photosynthetic dinoflagellate symbionts ("zooxanthellae"). The zooxanthellae contribute to host metabolism and skeletogenesis to such an extent that this symbiosis is well recognised for its contribution in creating the coral reef ecosystem. The stable functioning of cnidarian symbioses is however dependent upon the host's ability to maintain demographic control of its algal partner. In this review, I explain how the modern envelope of seawater conditions found within many coral reef ecosystems (characterised by elevated temperatures, rising pCO2, and enriched nutrient levels) are antagonistic toward the dominant host processes that restrict excessive symbiont proliferation. Moreover, I outline a new hypothesis and initial evidence base, which support the suggestion that the additional "excess" zooxanthellae fraction permitted by seawater pCO2 levels beyond 260 ppmv significantly increases the propensity for symbiosis breakdown ("bleaching") in response to temperature and irradiance extremes. The relevance of this biological threshold is discussed in terms of historical reef extinction events, glacial-interglacial climate cycles and the modern decline of coral reef ecosystems.
Glenn Seaborg's Contributions to Heavy Element Science and the Periodic Table
International Nuclear Information System (INIS)
Hobart, David E.
2012-01-01
In celebrating the centennial anniversary of the birth of Glenn T. Seaborg it is fitting that we recount and pay tribute to his legacy. Many know of the scientific accomplishments of this man who became a legend and anyone who has attended his lectures can attest to how informative, educational, and entertaining he was. He had a beguiling and whimsical sense of humor and used this to drive home his points and share his passion and quest for discovery. The periodic table is a fundamental cornerstone of science and remains a central unifying principal. Seaborg was the architect of the actinide series of elements and their proper placement in the periodic table and co-discoverer of ten transuranium elements - one of which bears his name, element 106, seaborgium. The work and achievements of this Nobel laureate have touched the lives of many and his legacy will continue for generations to come.
Glann Seaborg's Contributions to Heavy Element Science and the Periodic Table
Energy Technology Data Exchange (ETDEWEB)
Hobart, David E. [Los Alamos National Laboratory
2012-08-17
In celebrating the centennial anniversary of the birth of Glenn T. Seaborg it is fitting that we recount and pay tribute to his legacy. Many know of the scientific accomplishments of this man who became a legend and anyone who has attended his lectures can attest to how informative, educational, and entertaining he was. He had a beguiling and whimsical sense of humor and used this to drive home his points and share his passion and quest for discovery. The periodic table is a fundamental cornerstone of science and remains a central unifying principal. Seaborg was the architect of the actinide series of elements and their proper placement in the periodic table and co-discoverer of ten transuranium elements - one of which bears his name, element 106, seaborgium. The work and achievements of this Nobel laureate have touched the lives of many and his legacy will continue for generations to come.
LONG-TERM OPTICAL OBSERVATIONS OF TWO LMXBs: UW CrB (=MS 1603+260) AND V1408 Aql (=4U 1957+115)
International Nuclear Information System (INIS)
Mason, Paul A.; Robinson, Edward L.; Bayless, Amanda J.; Hakala, Pasi J.
2012-01-01
We present new optical photometry of two low-mass X-ray binary stars, UW CrB (MS 1603+260) and V1408 Aql (4U 1957+115). UW CrB is an eclipsing binary and we refine its eclipse ephemeris and measure an upper limit to the rate of change of its orbital period, | P-dot | -11 (unitless). The light curve of UW CrB shows optical counterparts of type I X-ray bursts. We tabulate the times, orbital phases, and fluences of 33 bursts and show that the optical flux in the bursts comes primarily from the accretion disk, not from the secondary star. The new observations are consistent with a model in which the accretion disk in UW CrB is asymmetric and precesses in the prograde direction with a period of ∼5.5 days. The light curve of V1408 Aql has a low-amplitude modulation at its 9.33 hr orbital period. The modulation remained a nearly pure sine curve in the new data as it was in 1984 and 2008, but its mean amplitude was lower, 18% against 23% in the earlier data. A model in which the orbital modulation is caused by the varying aspect of the heated face of the secondary star continues to give an excellent fit to the light curve. We derive a much improved orbital ephemeris for the system.
Björkstén, Karin S; Fälldin, Kerstin; Ulfvarson, Johanna
2014-08-26
In the modern world with new family structures, international migration and increased life expectancy, there is a growing need for legal ways of assisting elderly with impaired mental capacity to decide about their life and assets. There are few studies about the physician's role when a court appoints proxies for vulnerable elderly. Many doctors do not know how to assess mental capacity, and most lawyers and judges know little about medicine. Applications for a custodian sent to the Stockholm Chief Guardian' Office in Sweden were used. Physician's statements to the court for elderly with memory impairment were selected and 260 statements were scrutinized with regard to formal quality, the narrative content and the physician who wrote it. The quality of the statements varied from one sentence to excellent. Most statements were written by senior family practitioners or geriatricians. Seventeen % of the statements were handwritten and had more formal shortcomings than machine/computer written statements.The majority of patients needed massive help with daily life and economy. Median age was 84 years of age. MMSE score was given in 20% of the cases and varied from 6-27.A diagnosis of dementia was established in 57%. At the time of application, at least 48% were in a hospital or nursing home and at least 27% were in their private home. Only 5% were living with a spouse or a child. In 53% of the cases, the doctor knew the patient, but in 40% of the cases, the identity of the patient was not confirmed. The physician found that 54% were unable to understand the idea of getting a custodian, but out of those very vulnerable elderly, 20% had signed consent and 57% were considered able to be heard in court. There is a large variation in the quality of physicians' statements to the court concerning the mental capacity of elderly patients with cognitive impairment. Many statements have serious short-comings, and the system is not safe. There is a strong need for guide
Astell-Burt, Thomas; Feng, Xiaoqi; Kolt, Gregory S
2013-11-01
While many studies report that green spaces promote mental health, some suggest the psychological benefits of physical activity are amplified if participation occurs within greener environs. We investigated whether this relationship could be observed among adults in middle-to-older age. Multilevel logit regression was used to investigate association between green space and psychological distress (Kessler scores of 22+) among 260,061 Australians over 45 years old living in New South Wales (2006-2009). Physical activity was measured using the Active Australia survey. Percentage green space was estimated within a 1-kilometre of residence. In comparison to residents of the least green areas, those in the greenest neighbourhoods were at a lower risk of psychological distress (Odds Ratio 0.83, 95% CI: 0.76, 0.92) and were less sedentary (0.81: 0.77, 0.87). An interaction was observed between physical activity and green space (p=0.0028). More green space did not appear to benefit mental health among the least active (0.99: 0.85, 1.15), but there was a protective association for the more physically active (0.82: 0.67, 0.99). For adults in middle-to-older age, green spaces are not only important for promoting physical activity, but the mental health benefits of greener environs appear contingent upon those active lifestyles. © 2013.
Pershina, V; Anton, J
2013-05-07
Fully relativistic, four-component density functional theory electronic structure calculations were performed for M(CO)6 of group-6 elements Cr, Mo, W, and element 106, Sg, with an aim to predict their adsorption behaviour in the gas-phase chromatography experiments. It was shown that seaborgium hexacarbonyl has a longer M-CO bond, smaller ionization potential, and larger polarizability than the other group-6 molecules. This is explained by the increasing relativistic expansion and destabilization of the (n - 1)d AOs with increasing Z in the group. Using results of the calculations, adsorption enthalpies of the group-6 hexacarbonyls on a quartz surface were predicted via a model of physisorption. According to the results, -ΔHads should decrease from Mo to W, while it should be almost equal--within the experimental error bars--for W and Sg. Thus, we expect that in the future gas-phase chromatography experiments it will be almost impossible--what concerns ΔHads--to distinguish between the W and Sg hexacarbonyls by their deposition on quartz.
Chemistry of superheavy elements
International Nuclear Information System (INIS)
Schaedel, M.
2012-01-01
The chemistry of superheavy elements - or transactinides from their position in the Periodic Table - is summarized. After giving an overview over historical developments, nuclear aspects about synthesis of neutron-rich isotopes of these elements, produced in hot-fusion reactions, and their nuclear decay properties are briefly mentioned. Specific requirements to cope with the one-atom-at-a-time situation in automated chemical separations and recent developments in aqueous-phase and gas-phase chemistry are presented. Exciting, current developments, first applications, and future prospects of chemical separations behind physical recoil separators ('pre-separator') are discussed in detail. The status of our current knowledge about the chemistry of rutherfordium (Rf, element 104), dubnium (Db, element 105), seaborgium (Sg, element 106), bohrium (Bh, element 107), hassium (Hs, element 108), copernicium (Cn, element 112), and element 114 is discussed from an experimental point of view. Recent results are emphasized and compared with empirical extrapolations and with fully-relativistic theoretical calculations, especially also under the aspect of the architecture of the Periodic Table. (orig.)
Directory of Open Access Journals (Sweden)
Gutiérrez de Solabarría, S.
1995-10-01
Full Text Available Flying ashes captured by ciclones in the experimental plant for combustion in pressure fluid bed, in Escatrón Power Plant (Zaragoza, Spain, circulate through the gas cleaning system and are evacuated by means of pneumatic transport. The temperature of these ashes is aprox. 800 °C and the relative pressure is up to 8 negative bars relating the outdoor pressure of the transport pipe. The configuration of the pneumatic transport lines is Incolloy 800 HT quality composite tubes lined with Stal 2465 in straight stretches. Regarding direction changes, ferritic stainless casting, quality GX 260 Cr 27 elbows are used. The aim of this work is to study the possibility of manufacturing a solidary system by means of melting between the ferritic stainless casting elbow and the composite pipe.
Las cenizas volantes captadas por ciclones en la planta experimental de combustión en lecho fluido a presión, de la central térmica de Escatrón (Zaragoza, circulan por el sistema de depuración de gases y son evacuadas mediante transporte neumático. Estas cenizas se encuentran a una temperatura aproximada de 800 °C y a una presión relativa de hasta 8 bares negativos con respecto a la presión en el exterior de la tubería de transporte. Para configurar las líneas de transporte neumático, se utilizan en los tramos rectos tubos composite de calidad Incolloy 800 HT recubiertos interiormente de material Stal 2465. Para los cambios de dirección, se utilizan codos de fundición inoxidable ferrítica de calidad GX 260 Cr 27. El objetivo del presente trabajo es estudiar la viabilidad de fabricación de un sistema solidario por fusión entre el codo de fundición inoxidable ferrítica y la tubería composite.
2010-06-28
... regulation by the close of business July 28, 2010. If the EPA receives such comments, it will publish a... the comment includes information claimed to be Confidential Business Information or other information... analog. or ``SWMU''''. 260.20(b) intro 260.20(b) intro. 260.20(b)(3) 260.20(b)(3). 260.20(c)-(f) 260.20(c...
Transuranium elements: Past, present, and future
International Nuclear Information System (INIS)
Seaborg, G.T.
1995-01-01
In this illustrative Account the authors shall concentrate on four of these elements, chosen for their current interest or pivotal role. The story of plutonium is one of the most dramatic in the history of science, and today, plutonium is at the focus of an extraordinary dilemma. Mendelevium (element 101) has played a pivotal role in blazing the trail for the discovery of the heaviest elements on the basis of open-quotes one atom at a timeclose quotes production. Seaborgium (element 106) was recently named in my honor by the discoverers and may be the last element, at least for some time, for which it will be possible to determine many chemical properties. And element 110 represents recent evidence, after a lapse of 10 years, for the discovery of a chemical element. Recent (1994) recommendations of the IUPAC Commission on the Nomenclature of Inorganic Chemistry for the renaming of elements 104-108 have met with widespread rejection. The author is using the names proposed by the acknowledged discoverers (elements 106-109) or, in the case of the disputed elements 104 and 105, the most logical names. 21 refs., 5 figs
Aqueous chemistry of transactinides
International Nuclear Information System (INIS)
Schaedel, M.
2001-01-01
The aqueous chemistry of the first three transactinide elements is briefly reviewed with special emphasis given to recent experimental results. Short introductory remarks are discussing the atom-at-a-time situation of transactinide chemistry as a result of low production cross-sections and short half-lives. In general, on-line experimental techniques and, more specifically, the automated rapid chemistry apparatus, ARCA, are presented. Present and future developments of experimental techniques and resulting perspectives are outlined at the end. The central part is mainly focussing on hydrolysis and complex formation aspects of the superheavy group 4, 5, and 6 transition metals with F - and Cl - anions. Experimental results are compared with the behaviour of lighter homologous elements and with relativistic calculations. It will be shown that the chemical behaviour of the first superheavy elements is already strongly influenced by relativistic effects. While it is justified to place rutherfordium, dubnium and seaborgium in the Periodic Table of the Elements into group 4, 5 and 6, respectively, it is no more possible to deduce from this position in detail the chemical properties of these transactinide or superheavy elements. (orig.)
Okubo, Sumiko; Nishiuma, Shinichi; Kobayashi, Noriko; Taketsuna, Masanori; Taniai, Hisashi
2012-11-01
Gemcitabine was approved for the treatment of biliary tract cancer in 2006 in Japan. While biliary tract cancer is usually associated with patients 70 years of age or older and/or those who tend to have underlying liver dysfunction, data on this population were limited in the Japanese Phase II study of gemcitabine. Thus, further evaluation of safety and effectiveness in this population was planned. This special post-marketing surveillance was conducted as an observational study on the use of gemcitabine in a clinical practice setting. Gemcitabine-naïve patients with biliary tract cancer were enrolled from 2006 to 2008 and observed over 12 months; one or more doses of gemcitabine were administered during the period. Data such as patient background, treatment details, adverse events occurring during the observational period, laboratory values of liver enzyme and survival status were collected 3 and 12 months after the start of therapy. Of the 285 patients registered for the study, 260 were included in the analysis. The mean age was 66.9 years. There were 120 patients (46.2%) classified as elderly (70 years or older). Haematotoxicities were the most common adverse drug reactions. In the elderly and the non-elderly, adverse drug reactions (serious) occurred in 48.3% (20.8%) and 50.7% (12.9%), respectively. The overall estimated 1-year survival rate was 52.5% (95% confidence interval, 45.9-58.7%). In line with previous clinical and post-marketing studies conducted in Japan, the results of this study suggest that gemcitabine could be used safely and effectively for biliary tract cancer patients including the elderly.
Directory of Open Access Journals (Sweden)
João Carlos de Campos Guerra
2005-06-01
Full Text Available Objective: To evaluate the prevalence of genetic polymorphism incoagulation factors in thromboembolic disease in patients withclinical suspicion of thrombosis. Methods: A retrospective casecollection was performed searching all patients with clinicalsuspicion of thrombosis who were submitted to coagulation factoranalysis at the Hospital Israelita Albert Einstein from November2003 to April 2004. We included 260 patients, 118 male and 142female, mean age of 46 years. Prothrombin mutation and Leiden Vfactor were evaluated with multiplex PCR. Protein C, S and lupusanticoagulant were studied in coagulation assays. AntithrombinIII was studied by chromogenic assay. Anticardiolipin was evaluatedthrough an immunoenzymatic method and homocysteine by animmunometric method. Results: Factor V Leiden was found in 22cases (8.3 %, one homozygote and 21 heterozygotes. Prothrombinmutation was found in 18 cases (6.8%, one homozygote and 17heterozygotes. Forty cases with genetic alteration showed 34 caseswith thrombosis (85%, 29 venous thrombosis and 4 arterialthrombosis. One hundred and seven patients were tested foranticardiolipin antibodies: 21 were anticardiolipin antibody positives(19.6%, and 15 of them had IgG antibodies, 3 IgM and 3 IgA. Sixteenof the 21 patients had thrombosis, 11 venous thrombosis and 5arterial thrombosis. Lupus anticoagulant was found in two patients,both with thrombosis. There was only one case ofhyperhomocystinemia, with thrombosis. Protein C, protein S andantithrombin III deficiencies were found in 63 cases (12%. Out of31 cases with thrombosis (49,2 %, 26 cases had venous thrombosisand 5 had arterial thrombosis. Conclusion: Thromboembolicdisease is clearly associated with genetic factors but there isconsensus its cause is multifactorial. Genetic alterations, however,should be studied when there is clinical evidence of thrombosis,at least in young patients.
Directory of Open Access Journals (Sweden)
Danilović Milorad
2015-01-01
Full Text Available This paper presents the results of research of efficacy of the lightweight low power chainsaw Stihl MS 260 in the operations of juvenile thinning in preserved even-aged mixed stands of pedunculate oak with hornbeam, ash and other hard hardwoods. The investigations were carried out in the territory of FE “Sremska Mitrovica” in three sample plots of different ages. It is the first research of this kind based on the choice of optimal technological solution for the cleaning cuts of oak stands. Technology of work is based on cutting unwanted species at a certain height in order to favor pedunculate oak as the main species. In sample plot 1 the cutting through of undesirable species was carried out in one place and then third parties carried out their processing and transportation. In sample plots 2 and 3 workers cut the unwanted species in several places and stacked the timber on the ground so as not to interfere with the growth of pedunculate oak which does not tolerate shading. In this study, we applied time and work study. Group system of work was recorded. The group typically consisted of 4 workers and a foreman. Fuel consumption was recorded by the method of tank refuelling. The research results show that operating conditions have a significant impact on the effects of work with a chainsaw, as well as on the consumption of fuel and lubricants. The differences are mainly caused by different structures of cut timber.
2010-07-01
... physical sciences and the principles of engineering and mathematics, acquired by a professional education... determined by an explosives or munitions emergency response specialist. Such situations may require immediate and expeditious action by an explosives or munitions emergency response specialist to control...
2010-04-01
... school including tuition, student fees, books, and expendable supplies but excluding travel expenses to and from the school. (c) Employing agency. The agency for which the candidate works. This may be either a State or local highway/transportation agency or the FHWA. (d) Fellowship. The grant presented to...
2010-10-01
... appropriations and which must be paid by Applicant or its non-Federal infrastructure partner before that direct... provisions of this part. (j) Including means including but not limited to. (k) Infrastructure partner means... subtitle IV of title 49, United States Code. (s) Subsidy cost of a direct loan means the net present value...
2010-04-01
..., location, service area, or objectives of an activity or the number of eligible persons served must be... proposed use of funds. Funds may not be expended for the revised proposed use of funds until: (1) HUD... funds has been completed in accordance with § 574.510. (Approved by the Office of Management and Budget...
2010-07-01
..., signifying its agreement or alternate selection of a location and its selection of type of vending facility... owned building in which the lessor or any of its tenants have an existing restaurant or other food... substantial direct competition with such restaurant or other food operation, the requirement to provide a...
China Report, Agriculture, No. 260.
1983-06-09
million poultry and 770,000 hives of honey bees in 1982. By the end of that year, the poultry on hand was three and a half times the number at the end of...transformation overnight. There must be a process of the combina- tion of things and the substitution of one for the other. And it is neces- sary to...nutritional analysis of fodder and did work on the concocting and screening of scientific preparation formulas. Its research unearthed a new protein feed
2010-10-01
..., packaging, or storing any processed products or any ingredients used in the manufacture or production thereof, shall be of such design, material, and construction as will: (a) Enable the examination... with Good Manufacturing Practice Regulations, 21 CFR part 128. [36 FR 21041, Nov. 3, 1971] ...
2010-07-01
... blind vending facilities. (d) Specified income from vending machines operated on DoD-controlled property... Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS VENDING... shall be given priority in the establishment and operation of vending facilities. (b) The blind shall be...
2010-07-01
... operations. Direct competition. The presence and operation of a DoD Component vending machine or a vending... machines or vending facilities operated in areas serving employees, the majority of whom normally do not... the United States. Vending facility. Automatic vending machines, cafeterias, snack bars, cart service...
2010-07-01
... Chromatography,” IBR approved for § 264.1063. (4) ASTM D 2382-83, “Standard Test Method for Heat of Combustion of Hydrocarbon Fuels by Bomb Calorimeter (High-Precision Method),” IBR approved for §§ 264.1033, 265.1033. (5..., “Standard Test Methods for Flash Point for Liquids by Setaflash Closed Tester,” IBR approved for § 261.21(a...
Lensel, A-S; Lermusiaux, P; Boileau, C; Feugier, P; Sérusclat, A; Zerbib, Y; Ninet, J
2013-12-01
We hypothezised that patients (cases) who are hospitalized for a major ischemic event--myocardial infarction, stroke, decompensation of peripheral arterial disease--acquire better knowledge than a control population--atheromatous patients without a major ischemic event, patients consulting for a vein disease or a diabetes evaluation, and accompanists--about cardiovascular risk factors (smoking, hypertension, diabetes, dyslipidemia, obesity) and have a better understanding of the usefulness of making changes in their lifestyle (quit smoking, regular exercise, Mediterranean diet, low salt diet, weight control, diabetes care). A questionnaire was proposed at vascular surgery consultations and vascular and cardiac functional explorations, at the M Pavillon of the Édouard-Herriot hospital, Lyon, France. In five months, 395 questionnaires (135 cases and 260 controls) were analyzed. The global knowledge score was statistically higher for cases than for controls (cases 3.23±1.81; controls 2.77±2.03; P=0.037). Cases did not abide by monitoring and dietary rules better, except as regards the management of diabetes. Regular physical activity was statistically more prevalent among controls than among cases. Cases mainly received their information from their doctors (general practitioner for 59% of controls and 78% of cases, cardiologist for 25% of controls and 57% of cases) while controls got their information more through magazines or advertising. Our results show that after a major ischemic event, cases' knowledge of risk factors is better than the rest of the population without improved rules lifestyle changes. This suggests the usefulness of evaluating a therapeutic education program for atheromatous disease. Copyright © 2013 Elsevier Masson SAS. All rights reserved.
International Nuclear Information System (INIS)
1999-01-01
Mercury-contaminated wastes in many forms are present at various U. S. Department of Energy (DOE) sites. At least 26 different DOE sites have this type of mixed low-level waste in their storage facilities, totaling approximately 6,000 m 3 . Mercury contamination in the wastes at DOE sites presents a challenge because it exists in various forms, such as soil, sludges, and debris, as well as in different chemical species of mercury. Stabilization is of interest for radioactively contaminated mercury waste (<260 ppm Hg) because of its success with particular wastes, such as soils, and its promise of applicability to a broad range of wastes. However, stabilization methods must be proven to be adequate to meet treatment standards. They must also be proven feasible in terms of economics, operability, and safety. This report summarizes the findings from a stabilization technology demonstration conducted by GTS Duratek, Inc. Phase I of the study involved receipt and repackaging of the material, followed by preparations for waste tracking. Phase II examined the bench-scale performance of grouting at two different loadings of waste to grouted mass. Phase III demonstrated in-drum mixing and solidification using repackaged drums of sludge. Phase IV initially intended to ship final residues to Envirocare for disposal. The key results of the demonstration are as follows: (1) Solidification tests were performed at low and high waste loading, resulting in stabilization of mercury to meet the Universal Treatment Standard of 0.025 mg/L at the low loading and for two of the three runs at the high loading. The third high-loading run had a Toxicity Characteristic Leaching Procedure (TCLP) of 0.0314 mg/L. (2) Full-drum stabilization using the low loading formula was demonstrated. (3) Organic compound levels were discovered to be higher than originally reported, including the presence of some pesticides. Levels of some radionuclides were much higher than initially reported. (4
Cappellari, Michele; Emsellem, Eric; Krajnović, Davor; McDermid, Richard M.; Scott, Nicholas; Verdoes Kleijn, G. A.; Young, Lisa M.; Alatalo, Katherine; Bacon, R.; Blitz, Leo; Bois, Maxime; Bournaud, Frédéric; Bureau, M.; Davies, Roger L.; Davis, Timothy A.; de Zeeuw, P. T.; Duc, Pierre-Alain; Khochfar, Sadegh; Kuntschner, Harald; Lablanche, Pierre-Yves; Morganti, Raffaella; Naab, Thorsten; Oosterloo, Tom; Sarzi, Marc; Serra, Paolo; Weijmans, Anne-Marie
2011-05-01
The ATLAS3D project is a multiwavelength survey combined with a theoretical modelling effort. The observations span from the radio to the millimetre and optical, and provide multicolour imaging, two-dimensional kinematics of the atomic (H I), molecular (CO) and ionized gas (Hβ, [O III] and [N I]), together with the kinematics and population of the stars (Hβ, Fe5015 and Mg b), for a carefully selected, volume-limited (1.16 × 105 Mpc3) sample of 260 early-type (elliptical E and lenticular S0) galaxies (ETGs). The models include semi-analytic, N-body binary mergers and cosmological simulations of galaxy formation. Here we present the science goals for the project and introduce the galaxy sample and the selection criteria. The sample consists of nearby (D 15°) morphologically selected ETGs extracted from a parent sample of 871 galaxies (8 per cent E, 22 per cent S0 and 70 per cent spirals) brighter than MK statistically representative of the nearby galaxy population. We present the size-luminosity relation for the spirals and ETGs and show that the ETGs in the ATLAS3D sample define a tight red sequence in a colour-magnitude diagram, with few objects in the transition from the blue cloud. We describe the strategy of the SAURON integral field observations and the extraction of the stellar kinematics with the pPXF method. We find typical 1σ errors of ΔV≈ 6 km s-1, Δσ≈ 7 km s-1, Δh3≈Δh4≈ 0.03 in the mean velocity, the velocity dispersion and Gauss-Hermite (GH) moments for galaxies with effective dispersion σe≳ 120 km s-1. For galaxies with lower σe (≈40 per cent of the sample) the GH moments are gradually penalized by pPXF towards zero to suppress the noise produced by the spectral undersampling and only V and σ can be measured. We give an overview of the characteristics of the other main data sets already available for our sample and of the ongoing modelling projects.
Differential survival among sSOD-1* genotypes in Chinook Salmon
Hayes, Michael C.; Reisenbichler, Reginald R.; Rubin, Stephen P.; Wetzel, Lisa A.; Marshall , Anne R.
2011-01-01
Differential survival and growth were tested in Chinook salmon Oncorhynchus tshawytscha expressing two common alleles, *–100 and *–260, at the superoxide dismutase locus (sSOD-1*). These tests were necessary to support separate studies in which the two alleles were used as genetic marks under the assumption of mark neutrality. Heterozygous adults were used to produce progeny with –100/–100, –100/–260, and –260/–260 genotypes that were reared in two natural streams and two hatcheries in the states of Washington and Oregon. The latter also were evaluated as returning adults. In general, the genotype ratios of juveniles reared at hatcheries were consistent with high survival and little or no differential survival in the hatchery. Adult returns at one hatchery were significantly different from the expected proportions, and the survival of the –260/–260 genotype was 0.56–0.89 times that of the –100/–100 genotype over four year-classes. Adult returns at a second hatchery (one year-class) were similar but not statistically significant: survival of the –260/–260genotype relative to the –100/–100 genotype was 0.76. The performance of the heterozygote group was intermediate at both hatcheries. Significant differences in growth were rarely observed among hatchery fish (one year-class of juveniles and one age-class of adult males) but were consistent with greater performance for the –100/–100 genotype. Results from two groups of juveniles reared in streams (one year-class from each stream) suggested few differences in growth, but the observed genotype ratios were significantly different from the expected ratios in one stream. Those differences were consistent with the adult data; survival for the –260/–260 genotype was 76% of that of the –100/–100 genotype. These results, which indicate nonneutrality among sSOD-1* genotypes, caused us to modify our related studies and suggest caution in the interpretation of results and analyses in
2010-10-01
.... “Establishment” means any premises, buildings, structures, facilities, and equipment (including vehicles) used in... United States (including, but not limited to, any corporate agencies thereof), any State, county, or municipal government, any common carrier, and any authorized agent of any of the foregoing. Plant. “Plant...
Publications | Page 260 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Wi-fi: a new bridge for the digital divide? Connecting to the Internet using a simple aluminum antenna and a wireless network card could be the best way to narrow ... Broadening the benefits of trade: The Latin American trade network. Limit the ...
38 CFR 21.260 - Subsistence allowance.
2010-07-01
... rehabilitation facility or sheltered workshop; independent instructor; institutional non-farm cooperative: Full...) VOCATIONAL REHABILITATION AND EDUCATION Vocational Rehabilitation and Employment Under 38 U.S.C. Chapter 31... rehabilitation program under 38 U.S.C. Chapter 31 will receive a monthly subsistence allowance at the rates in...
Czech Academy of Sciences Publication Activity Database
Šimon, Vojtěch
2010-01-01
Roč. 513, April (2010), A71/1-A71/10 ISSN 0004-6361 R&D Projects: GA ČR GA205/08/1207 Institutional research plan: CEZ:AV0Z10030501 Keywords : stars * accretion disks * X-rays binaries Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.410, year: 2010
Publications | Page 260 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Patronage or partnership: Local capacity building in humanitarian crises. It is early 1998, on the outskirts of Bujumbura, the capital of Burundi. "People are dying like flies," says an understandably emotional American missionary running a refugee camp for four thousand Hutus. Asked by a reporter about a.
7 CFR 1944.260 - Cost distribution.
2010-01-01
... limited to 10 percent of the 50 percent matching amount), such as the current market value of donated common or office space, utility costs, furniture, material, supplies, equipment and food used in direct...
50 CFR 260.86 - Approved identification.
2010-10-01
... assure compliance with the requirements for wholesomeness established for the raw product and of sanitation established for the preparation and processing operations, and (2) has been certified by an... part to assure compliance with the requirements for wholesomeness established for the raw product and...
49 CFR 260.39 - Maintenance standards.
2010-10-01
... REHABILITATION AND IMPROVEMENT FINANCING PROGRAM Standards for Maintenance of Facilities Involved in the Project... the project. (b) When the proceeds of a direct loan or an obligation guaranteed by the Administrator...
40 CFR Appendix Ix to Part 261 - Wastes Excluded Under §§ 260.20 and 260.22
2010-07-01
... manage industrial solid waste. This exclusion was published on April 6, 1999.1. The constituent... be taken from each hopper (or other container) of kiln residue generated during each 24-hour run; all... minimum of four grab samples must also be taken from each hopper (or other container) of spray dryer...
2012-07-13
... 11, 2012, unless the EPA receives adverse written comment on this regulation by the close of business... waste management system: General) 105.I.1 260.21(a). 105.I.2.c 260.21(b)(3). 105.O.1 intro 260.30 intro... analogs to 40 CFR Part 261 provisions (Identification and listing of hazardous waste) 105.D.2.l intro 261...
Chemistry of the superheavy elements.
Schädel, Matthias
2015-03-13
The quest for superheavy elements (SHEs) is driven by the desire to find and explore one of the extreme limits of existence of matter. These elements exist solely due to their nuclear shell stabilization. All 15 presently 'known' SHEs (11 are officially 'discovered' and named) up to element 118 are short-lived and are man-made atom-at-a-time in heavy ion induced nuclear reactions. They are identical to the transactinide elements located in the seventh period of the periodic table beginning with rutherfordium (element 104), dubnium (element 105) and seaborgium (element 106) in groups 4, 5 and 6, respectively. Their chemical properties are often surprising and unexpected from simple extrapolations. After hassium (element 108), chemistry has now reached copernicium (element 112) and flerovium (element 114). For the later ones, the focus is on questions of their metallic or possibly noble gas-like character originating from interplay of most pronounced relativistic effects and electron-shell effects. SHEs provide unique opportunities to get insights into the influence of strong relativistic effects on the atomic electrons and to probe 'relativistically' influenced chemical properties and the architecture of the periodic table at its farthest reach. In addition, they establish a test bench to challenge the validity and predictive power of modern fully relativistic quantum chemical models. © 2015 The Author(s) Published by the Royal Society. All rights reserved.
Ft. Lewis/Gray, Washington. Revised Uniform Summary of Surface Weather Observations. Parts A-F.
1987-07-27
75.9 75.9 76.1 76.2 GE 30001 5.3 66.8 70.6 73.0 75.6 7.7 76.4 76.9 77.0 78.0 78.0 78.0 78.4 78.4 7R.7 78.8 IE 27001 5.3 69.3 73.1 75.7 78.2 78.3 79.1...25.1 25.2 25.2 25.6 25.6 25.7 26.0 26.0 26.0 26.0 26.0 2b.2 6.E ISO DO 16.8 25.9 26.S 26.9 27.0 27.2 27.3 27.7 27.7 27.9 26.1 28.1 28.1 28.1 ip.1 28.1...3.259 3.596 5.103 6.164 8.878 9.563 T.O7 ITO! 0BSf 309 282 310 299 310 300 310 310 300 309 300 298 3632 22 ISO 1 9.724 9.333 8.111 6.610 5.262 9.228
Liu, Junlong; Guan, Guiquan; Liu, Aihong; Li, Youquan; Yin, Hong; Luo, Jianxun
2014-03-01
In this study, two pairs of oligonucleotide primers were designed according to the nucleotide sequence of the internal transcribed spacers (ITSs) of Babesia bigemina and B. bovis isolates from China. The primers were used in a multiplex PCR to detect parasite DNA in blood samples from cattle. There was no cross reactions with B. ovata, B. major, B. sp. Kashi, Theileria annulata, T. sergenti, T. sinensis or normal bovine DNA. The sensitivity of multiplex PCR assay was 1 pg and 10 pg DNA for B. bigemina and B. bovis, respectively. A total of 260 field blood samples collected from cattle in five provinces of China were analyzed by multiplex PCR and light microscopy. PCR testing revealed that 7.3% (19/260) and 5.8% (15/260) of cattle were positive for B. bigemina and B. bovis and 1.2% (3/260) of cattle were co-infected with B. bigemina and B. bovis. Using light microscopy, 2.3% (6/260) and 1.5% (4/260) of cattle were infected by B. bigemina and B. bovis, respectively, and no co-infection was found. The results showed that the multiplex PCR developed in the present study could be an alternative diagnostic tool for the detection of B. bovis and B. bigemina infection in cattle.
Microbial raw data for UV-C LED disinfection study
U.S. Environmental Protection Agency — This study evaluated ultraviolet (UV) light emitting diodes (LEDs) emitting at 260 nm, 280 nm, and the combination of 260|280 nm together for their efficacy at...
50 CFR 260.99 - Buildings and structures.
2010-10-01
... each room and compartment thereof to prevent excessive condensation of moisture and to insure sanitary... condensation, the Director may require that suitable facilities be provided to prevent the condensate from...
29 CFR 779.260 - Trade-in allowances.
2010-07-01
... RETAILERS OF GOODS OR SERVICES Employment to Which the Act May Apply; Enterprise Coverage Annual Gross... is sold the amount of the sale will be included in the annual gross volume. Excise Taxes ...
77 FR 260 - Forest Resource Coordinating Committee
2012-01-04
... USDA and the broader forestry sector, with specific focus on owners of non-industrial private... Coordinator, by phone at (202) 205-1376 or by email at [email protected]us or Ted Beauvais, FRCC Designted Federal Officer, by phone (202) 205-1190 or by email at [email protected]us . Individuals who use...
7 CFR 1493.260 - Facility payment guarantee.
2010-01-01
... event that the foreign bank fails to pay under the foreign bank letter of credit or related obligation... date of export. The final payments of principal and interest by the foreign bank must come due within... from Canada into the U.S. with a U.S. customs valuation of $20,000. 5. A U.S. citizen, will travel on a...
50 CFR 260.93 - Debarment and suspension.
2010-10-01
... conjunction with any application or request for an inspection contract, inspection service, inspection appeal... advertising of any processed product, when such product has not been inspected under the regulations of this..., or in the advertising of any processed product, when such product has not been inspected under the...
49 CFR 260.51 - Conditions of guarantee.
2010-10-01
... by the Lender or the Holder to the extent any loss is occasioned by the violation of usury laws... this part. In the event of material fraud, negligence or misrepresentation by the Lender or the Lender's participation in or condoning of such material fraud, negligence or misrepresentation, the Lender...
16 CFR 260.7 - Environmental marketing claims.
2010-01-01
... pieces if left uncovered in sunlight.” The claim is supported by competent and reliable scientific... sunlight and into sufficiently small pieces to become part of the soil. The qualified claim is not... time. The claim is not deceptive. Example 4: A plastic six-pack ring carrier is marked with a small...
7 CFR 2.60 - Chief, Forest Service.
2010-01-01
... employee has probable cause to believe are being committed in that employee's presence or view, or for a..., Executive Order 12777, 3 CFR, 1991 Comp., p. 351, and the National Contingency Plan, 40 CFR Part 300. (36...
18 CFR 260.400 - Cash management programs.
2010-04-01
... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Cash management... Cash management programs. Natural gas companies subject to the provisions of the Commission's Uniform... management programs must file these agreements with the Commission. The documentation establishing the cash...
Czech Academy of Sciences Publication Activity Database
Šumberová, Kateřina; Ducháček, M.
2009-01-01
Roč. 44, č. 2 (2009), s. 260-260 ISSN 1211-5258 Institutional research plan: CEZ:AV0Z60050516 Keywords : strongly endangered species * flora of fish storage pond complexes * ruderal grasslands Subject RIV: EF - Botanics
Prevalence of C. botulinum and C. perfringens spores in food products available on Polish market
Directory of Open Access Journals (Sweden)
Grenda Tomasz
2017-09-01
Full Text Available Introduction: The aim of this study was to evaluate the prevalence of Clostridium botulinum and Clostridium perfringens in food samples purchased from Polish producers. Material and Methods: The analyses were performed on 260 food samples collected in Lublin and Subcarpathian regions: 56 of smoked meat, 21 of pork meat, 20 of dairy products, 26 of vegetable and fruit preserves, 40 of ready-to-eat meals, 27 of fish preserves, and 70 of honey collected directly from apiaries. Results: C. botulinum strains were isolated from 2.3% (6/260 of samples and the isolates were classified as toxin types A (4/260 and B (2/260. C. perfringens strains were isolated from 14% (37/260 of samples. All the isolates were classified as toxin type A, 28 of them were able also to produce α toxin and 9 - β2 toxin. Conclusion: On the basis of the obtained results it could be suggested that risk assessment, especially regarding the entire honey harvesting process, should be provided in order to ensure the microbiological safety of the products to be consumed by infants and people with a weakened immune system.
Variation of Optical Quenching of Photoconductivity with Resistivity in Unintentional Doped GaN
International Nuclear Information System (INIS)
Qi-Feng, Hou; Xiao-Liang, Wang; Hong-Ling, Xiao; Cui-Mei, Wang; Cui-Bai, Yang; Jin-Min, Li
2010-01-01
The optical quenching of photoconductivity under dual illumination in GaN samples with different resistivity is investigated to reveal the variation of deep levels. The samples are grown by metal organic chemical vapour deposition without intentional doping. Quenching bands centered at 1.35eV, 1.55eV, 1.98eV, and 2.60eV are observed. It is found that the 1.98eV quenching band is dominated in all the samples and the 2.60eV band is observed only in the high-resistivity samples. The possible defect levels responsible for the quenching bands and the origin of different quenching behaviour at 2.60eV are discussed. It is suggested that the defect level responsible for quenching at 2.60eV plays an important role for the enhancement of resistivity
Landing Zone and Drop Zone Criteria
2017-05-01
Points of Impact (RPI) ............................................................................................. 75 6.5.5 Multiple Points of Impact ...Helicopter IFR runway (UFC 3-260-01, Fig. 4-2) ....................................................................... 48 11 IFR airspace imaginary...surfaces: IFR Helicopter runways and helipad (UFC 3- 260-01, Fig. 4-3
Landing-Zone and Drop-Zone Criteria
2017-05-01
Points of Impact (RPI) ............................................................................................. 75 6.5.5 Multiple Points of Impact ...Helicopter IFR runway (UFC 3-260-01, Fig. 4-2) ....................................................................... 48 11 IFR airspace imaginary...surfaces: IFR Helicopter runways and helipad (UFC 3- 260-01, Fig. 4-3
Superheavy element chemistry. Achievements and perspectives
International Nuclear Information System (INIS)
Schaedel, M.
2007-01-01
Superheavy elements have been synthesized and chemically characterized one-atom-at-a-time up to element 108. Presently, the quest for element 112 is one of the hottest topics in this field. The transactinide elements 104 to 108 are members of group 4 to 8 of the Periodic Table and element 112 belongs into group 12. Chemical properties of some of these elements, like elements 104 and 105, show stunning deviations from simple extrapolations within their respective group while others exhibit great similarities with their lighter homologues elements. First experiments to investigate seaborgium (Sg, element 106) in aqueous solution were performed. Again, in large international collaborations at the GSI, several gas-phase chemistry experiments were performed with hassium (Hs, element 108). Recently, the highly efficient and very clean separation of Hs was applied for nuclear studies of various Hs nuclides investigating their cross section and their nuclear decay properties in the region of the doubly-magic 270 Hs (Z=108, N=162). To overcome certain limitations of the presently used on-line chemical separations the new TransActinide Separation and Chemistry Apparatus (TASCA) - with a gas-filled recoil separator as a front-end tool - was designed and built at the GSI in a collaborative effort. Presently in its commissioning phase, TASCA shall be a key instrument for a big leap into quantitatively and qualitatively new experiments in the region of superheavy elements. (author)
New aspects of magnetocaloric effect in NiMn{sub 0.89}Cr{sub 0.11}Ge
Energy Technology Data Exchange (ETDEWEB)
Jaworska-Gołąb, T., E-mail: teresa.jaworska-golab@uj.edu.pl [Institute of Physics, Jagiellonian University, Łojasiewicza 11, 30-348 Kraków (Poland); Baran, S. [Institute of Physics, Jagiellonian University, Łojasiewicza 11, 30-348 Kraków (Poland); Duraj, R. [Institute of Physics, Cracow University of Technology, Podchorążych 1, 30-084 Kraków (Poland); Marzec, M. [Institute of Physics, Jagiellonian University, Łojasiewicza 11, 30-348 Kraków (Poland); Dyakonov, V. [Institute of Physics, Polish Academy of Sciences, al. Lotników 32/46, 02-668 Warszawa (Poland); A.A. Galkin Donetsk Physico-Technical Institute, 83-114 Donetsk (Ukraine); Sivachenko, A. [A.A. Galkin Donetsk Physico-Technical Institute, 83-114 Donetsk (Ukraine); Tyvanchuk, Yu. [Chemistry Department, Ivan Franko National University of Lviv, 79-005 Lviv (Ukraine); Szymczak, H. [Institute of Physics, Polish Academy of Sciences, al. Lotników 32/46, 02-668 Warszawa (Poland); Szytuła, A. [Institute of Physics, Jagiellonian University, Łojasiewicza 11, 30-348 Kraków (Poland)
2015-07-01
Investigations of structural and magnetic phase transitions in the NiMn{sub 0.89}Cr{sub 0.11}Ge half-Heusler alloy were carried out by DSC, XRD (80–400 K), magnetic susceptibility and magnetization (1.9–400 K, magnetic field up to 9.0 T, pressure up to 5.25 kbar) measurements. At high temperatures the sample is a single phase crystallizing in the hexagonal crystal structure (Ni{sub 2}In-type, space group P6{sub 3}/mmc) while below 260 K, down to 100 K, some amount of the hexagonal phase coexists with the orthorhombic (TiNiSi-type, space group Pnma) one. Strong magnetostructural coupling is observed. Magnetic data indicate that with increasing temperature magnetic properties of the sample change from antiferro- to ferro- and then to paramagnetic ones. The latter magnetic phase transition is associated with the crystal structure change and results in large magnetic entropy change equal to −51 J/kg K at μ{sub 0}H= 9.0 T near 260 K. Application of external pressure shifts T{sub C} towards lower temperatures. - Highlights: • # Pnma below 210 K, # P6{sub 3}/mmc above 260 K, for 210 K
2010-09-22
... Waste Management System; Identification and Listing of Hazardous Waste Amendment AGENCY: Environmental...) 260.20 and 260.22 allows facilities to demonstrate that a specific waste from a particular generating facility should not be regulated as a hazardous waste. Based on waste-specific information provided by the...
Evaluating UV-C LED disinfection performance and investigating potential dual-wavelength synergy
This study evaluated ultraviolet (UV) light emitting diodes (LEDs) emitting at 260 nm, 280 nm, and the combination of 260|280 nm together for their efficacy at inactivating Escherichia. coli, MS2 coliphage, human adenovirus type 2 (HAdV2), and Bacillus pumilus spores; research in...
700 kg jern med de smukkeste krystaller
DEFF Research Database (Denmark)
Pedersen, Jens Olaf Pepke
2017-01-01
Anmeldelse af Holger Pedersen, “Pallas Iron – Russia’s first meteorite”, 260 sider, 190 kr. BoD 2017 (www.bod.dk/bog/).......Anmeldelse af Holger Pedersen, “Pallas Iron – Russia’s first meteorite”, 260 sider, 190 kr. BoD 2017 (www.bod.dk/bog/)....
International Nuclear Information System (INIS)
Feng, R.; Cooper, G.; Burton, G.R.; Brion, C.E.; Avaldi, L.
1999-01-01
Absolute photoabsorption oscillator strengths (cross-sections) for the valence shell discrete and continuum regions of sulphur dioxide from 3.5 to 51 eV have been measured using high resolution (∼0.05 eV FWHM) dipole (e,e) spectroscopy. A wide-range spectrum, covering both the valence shell and the S 2p and 2s inner shells, has also been obtained from 5 to 260 eV at low resolution (∼1 eV FWHM), and this has been used to determine the absolute oscillator strength scale using valence shell TRK (i.e., S(0)) sum-rule normalization. The present measurements have been undertaken in order to investigate the recently discovered significant quantitative errors in our previously published low resolution dipole (e,e) work on sulphur dioxide (Cooper et al., Chem. Phys. 150 (1991) 237; 150 (1991) 251). These earlier measurements were also in poor agreement with other previously published direct photoabsorption measurements. We now report new absolute photoabsorption oscillator strengths using both high and low resolution dipole (e,e) spectroscopies. These new measurements cover a wider energy range and are much more consistent with the previously published direct photoabsorption measurements. The accuracy of our new measurements is confirmed by an S(-2) dipole sum-rule analysis which gives a static dipole polarizability for sulphur dioxide in excellent agreement (within 3.5%) with previously reported polarizability values. Other dipole sums S(u) (u=-1,-3 to -6,-8,-10) and logarithmic dipole sums L(u) (u=-1 to -6) are also determined from the presently reported absolute oscillator strength distributions. (Copyright (c) 1999 Elsevier Science B.V., Amsterdam. All rights reserved.)
Evaluating UV-C LED disinfection performance and ...
This study evaluated ultraviolet (UV) light emitting diodes (LEDs) emitting at 260 nm, 280 nm, and the combination of 260|280 nm together for their efficacy at inactivating Escherichia. coli, MS2 coliphage, human adenovirus type 2 (HAdV2), and Bacillus pumilus spores; research included an evaluation of genomic damage. Inactivation by the LEDs was compared with the efficacy of conventional UV sources, the low-pressure (LP) and medium-pressure (MP) mercury vapor lamps. The work also calculated the electrical energy per order of reduction of the microorganisms by the five UV sources.For E. coli, all five UV sources yielded similar inactivation rates. For MS2 coliphage, the 260 nm LED was most effective. For HAdV2 and B. pumilus, the MP UV lamp was significantly more effective than the LP UV and UVC LED sources. When considering electrical energy per order of reduction, the LP UV lamp was the most efficient for E. coli and MS2, and the MPUV and LPUV were equally efficient for HAdV2 and B. pumilus spores. Among the UVC LEDs, the 280 nm LED unit required the least energy per log reduction of E. coli and HAdV2. The 280 nm and 260|280 nm LED units were equally efficient per log reduction of B. pumilus spores, and the 260 nm LED unit required the lowest energy per order of reduction of MS2 coliphage. The combination of the 260 nm and 280 nm UV LED wavelengths was also evaluated for potential synergistic effects. No dual-wavelength synergy was detected for inactivation of
2012-05-29
..., because the privacy and security principles from which the rule derives its language applies specifically... paragraph (a) of Sec. 155.260, which also applies to the creation of personally identifiable information. In this notice, we are adding the word ``creation'' to Sec. 155.260(d). On page 18456, we presented...
Evidence for bimodal fission in the heaviest elements
International Nuclear Information System (INIS)
Hulet, E.K.; Wild, J.F.; Lougheed, R.W.
1987-08-01
We have measured the mass and kinetic-energy partitioning in the spontaneous fission of five heavy nuclides: 258 Fm, 259 Md, 260 Md 258 No, and 260 [104]. Each was produced by heavy-ion reactions with either 248 Cm, 249 Bk, or 254 Es targets. Energies of correlated fragments from the isotopes with millisecond half lives, 258 No and 260 [104], were measured on-line by a special rotating-wheel instrument, while the others were determined off-line after mass separation. All fissioned with mass distributions that were symmetric. Total-kinetic-energy distributions peaked near either 200 or 235 MeV. Surprisingly, because only a single Gaussian energy distribution had been observed previously in actinide fission, these energy distributions were skewed upward or downward from the peak in each case, except for 260 [104], indicating a composite of two energy distributions. We were able to fit accurately two Gaussian curves to the gross energy distributions from the four remaining nuclides. From the multiple TKE distributions and the shapes of the mass distributions, we conclude that there is a low-energy fission component with liquid-drop characteristics which is admixed with a much higher-energy component due to closed fragment shells. We now have further evidence for this conclusion from measurements of the neutron multiplicity in the spontaneous fission of 260 Md. 25 refs., 9 figs
37 CFR 260.6 - Verification of royalty payments.
2010-07-01
... verification of the payment of royalty fees to those parties entitled to receive such fees, according to terms... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Verification of royalty... COPYRIGHT ARBITRATION ROYALTY PANEL RULES AND PROCEDURES RATES AND TERMS FOR PREEXISTING SUBSCRIPTION...
Lifescience Database Archive (English)
Full Text Available RP11-626A3 map 2, WORKING DRAFT SEQUENCE, 29 unordered pieces. 42 6.4 1 AE014305 |AE014305.1 Homo sapiens chromosome 13q34 schizophre...nia region contig 1 section 2 of 11 of the complete sequence. 42 6.4 1 BZ851208 |BZ
21 CFR 520.260 - n-Butyl chloride capsules.
2010-04-01
... be followed in 1/2 to 1 hour with a teaspoonful to a tablespoonful of milk of magnesia or 1 or 2 milk of magnesia tablets. Normal rations may be resumed 4 to 8 hours after treatment. Puppies and kittens...
49 CFR 260.53 - Lenders' functions and responsibilities.
2010-10-01
... that are eligible and financially feasible; (4) Obtaining valid evidence of debt and collateral in accordance with sound lending practices; (5) Supervising construction, where appropriate; (6) Distributing... environmental issues related to a proposed project or items that may require extensive environmental review...
profitability of groundnut-based cropping systems among farmers in ...
African Journals Online (AJOL)
accounting for all cost. The rate of return on investment (RRI) analysis shows that groundnut/sorghum enterprise has RRI of. 232%, while sole groundnut enterprise has RRI of. 260%. This implies that an average farmer earns N232 profit for every naira invested in groundnut/sorghum production, while N260 is earned for ...
2010-10-05
... Waste Management System; Identification and Listing of Hazardous Waste; Correction AGENCY: Environmental... thermal desorber residual solids with Hazardous Waste Numbers: F037, F038, K048, K049, K050, and K051. In... and correcting it in Table 1 of appendix IX to part 261--Waste Excluded Under Sec. Sec. 260.20 and 260...
Evaluation of drought tolerance indices among some winter ...
African Journals Online (AJOL)
Administrator
2011-09-14
Sep 14, 2011 ... double low. 280-260. Cold and Mild-Cold. 7. Talaye. Germany. Open- pollination. 43-40 double low. 280-260. Cold and Mild-Cold. 1GSL: Growing season length, 2“double low”: low erucic acid and low glucosinolate. Table 2. Physical and chemical properties of experimental soil before planting. Available k.
Reaching the superlinear convergence phase of the CG method
Czech Academy of Sciences Publication Activity Database
Axelsson, Owe; Karátson, J.
2014-01-01
Roč. 260, č. 260 (2014), s. 244-257 ISSN 0377-0427 R&D Projects: GA MŠk ED1.1.00/02.0070 Institutional support: RVO:68145535 Keywords : superlinear convergence * conjugate gradient method * eigenvalues Subject RIV: BA - General Mathematics Impact factor: 1.266, year: 2014 http://www.sciencedirect.com/science/article/pii/S0377042713005451
Ochs, Bjoern Gunnar; Stuby, Fabian Maria; Ateschrang, Atesch; Stoeckle, Ulrich; Gonser, Christoph Emanuel
2014-10-01
Percutaneous screw placement can be used for minimally invasive treatment of none or minimally displaced fractures of the anterior column. The complex pelvic geometry can pose a major challenge even for experienced surgeons. The present study examined the preformed bone stock of the anterior column in 260 hemipelvises (130 male and 130 female). Screws were virtually implanted using iPlan(®) CMF (BrainLAB AG, Feldkirchen, Germany); the maximal implant length and the maximal implant diameter were assessed. The study showed, that 6.5mm can generally be used in men; in women however individual planning is essential in regard to the maximal implant diameter since we found that in 15.4% of women, screws with a diameter less than 6.5mm were necessary. The virtual analysis of the preformed bone stock corridor of the anterior column showed two constrictions of crucial clinical importance. These can be found after 18% and 55% (men) respectively 16% and 55% (women) measured from the entry point along the axis of the implant. The entry point of the retrograde anterior column screw in our collective was located lateral of tuberculum pubicum at the level of the superior-medial margin of foramen obturatum. In female patients, the entry point was located significantly more lateral of symphysis and closer to the cranial margin of ramus superior ossis pubis. The mean angle between the screw trajectory and the anterior pelvic plane in sagittal section was 31.6 ± 5.5°, the mean angle between the screw trajectory and the midsagittal plane in axial section was 55.9 ± 4.6° and the mean angle between the screw trajectory and the midsagittal plane in coronal section was 42.1 ± 3.9° with no significant deviation between both sexes. The individual angles formed by the screw trajectory and the anterior pelvic and midsagittal plane are independent from anthropometric parameters sex, age, body length and weight. Therefore, they can be used for orientation in lag screw placement keeping
Casco, G; Taylor, T M; Alvarado, C
2015-04-01
Essential oils and their constituents are reported to possess potent antimicrobial activity, but their use in food processing is limited because of low solubility in aqueous systems and volatilization during processing. Two proprietary noncommercial essential oil-containing phosphate blends were evaluated for antimicrobial activity against Salmonella enterica cocktail (SC)-and Listeria monocytogenes (Lm)-inoculated deli meat products made from pork, poultry, or beef. Four treatments were tested on restructured cured pork ham, emulsified chicken bologna, and restructured beef loaf: nonencapsulated essential oil with phosphate version 1 at 0.45% of final batch (EOV145; chicken and pork, or EEOV245 beef), micronized encapsulated essential oil with phosphate version 2 at 0.60% of final batch (EEOV260), a 2.0% potassium lactate (PL) control, and a negative control (CN) with no applied antimicrobial agent. Compared with the CN, none of the antimicrobial agents (EEOV260, EOV145, PL) successfully limited Lm or SC growth to deli loaves, the EEOV260 inhibited growth of SC at days 21 and 28 to the same level of efficacy as PL (0.5 log cycle). In roast beef samples, on day 35, the SC growth was inhibited ca. 0.5 log CFU/g by EEOV260 when compared with the CN. In conclusion the EEOV260 can function to replace PL to limit Salmonella and Lm growth in ready-to-eat deli products. Further testing is needed to ensure consumer acceptability.
Directory of Open Access Journals (Sweden)
Jana Hönke
2011-01-01
Full Text Available Review of the monograph: Katja Werthmann, Bitteres Gold: Bergbau, Land und Geld in Westafrika, Köln: Rüdiger Köppe Verlag, 2009, ISBN 978-3-89645-821-6, 260 pp.Besprechung der Monographie: Katja Werthmann, Bitteres Gold: Bergbau, Land und Geld in Westafrika, Köln: Rüdiger Köppe Verlag, 2009, ISBN 978-3-89645-821-6, 260 Seiten.
Sun, Yele; Du, Wei; Wang, Qingqing; Zhang, Qi; Chen, Chen; Chen, Yong; Chen, Zhenyi; Fu, Pingqing; Wang, Zifa; Gao, Zhiqiu; Worsnop, Douglas R
2015-10-06
Despite extensive efforts into the characterization of air pollution during the past decade, real-time characterization of aerosol particle composition above the urban canopy in the megacity Beijing has never been performed to date. Here we conducted the first simultaneous real-time measurements of aerosol composition at two different heights at the same location in urban Beijing from December 19, 2013 to January 2, 2014. The nonrefractory submicron aerosol (NR-PM1) species were measured in situ by a high-resolution aerosol mass spectrometer at near-ground level and an aerosol chemical speciation monitor at 260 m on a 325 m meteorological tower in Beijing. Secondary aerosol showed similar temporal variations between ground level and 260 m, whereas much weaker correlations were found for the primary aerosol. The diurnal evolution of the ratios and correlations of aerosol species between 260 m and the ground level further illustrated a complex interaction between vertical mixing processes and local source emissions on aerosol chemistry in the atmospheric boundary layer. As a result, the aerosol compositions at the two heights were substantially different. Organic aerosol (OA), mainly composed of primary OA (62%), at the ground level showed a higher contribution to NR-PM1 (65%) than at 260 m (54%), whereas a higher concentration and contribution (15%) of nitrate was observed at 260 m, probably due to the favorable gas-particle partitioning under lower temperature conditions. In addition, two different boundary layer structures were observed, each interacting differently with the evolution processes of aerosol chemistry.
75 FR 44144 - Washington: Final Authorization of State Hazardous Waste Management Program Revisions
2010-07-28
...)(c)(ix)(K), 400(3)(c)(ix)(L), 400(3)(c)(x), 400(3)(c)(xi)(A), 400(3)(c)(xii)(B), 400(3)(a)(xiii), 400.... definition--Upda ted to match Federal rule. 040 Staging Pile 260.10. definition--Upda ted to match Federal... test methods to latest revision date. 110(3)(g)(x) Duplicate deleted 260.11(15). [see 110(3)(g)(vii...
Czech Academy of Sciences Publication Activity Database
Kuda, Ondřej; Jílková, Zuzana; Rossmeisl, Martin; Flachs, Pavel; Ogston, N. C.; Mohamed-Ali, V.; Cinti, S.; Kopecký, Jan
2007-01-01
Roč. 50, Suppl.1 (2007), S260-S260 ISSN 0012-186X. [Annual Meeting of the European Association for the Study of Diabetes /43./. 18.09.2007-21.09.2007, Amsterdam] R&D Projects: GA ČR(CZ) GD303/03/H065 Institutional research plan: CEZ:AV0Z50110509 Keywords : cpo1 * insulin * rosiglitazone * PUFA Subject RIV: FB - Endocrinology, Diabetology, Metabolism, Nutrition
Energy Technology Data Exchange (ETDEWEB)
Geng, Zhi; Zhang, Yu; Yuan, Xing; Huo, Mingxin; Zhao, Yahui; Lu, Ying, E-mail: luy332@nenu.edu.cn; Qiu, Yue
2015-09-25
Highlights: • The Cu{sub 2}O NCs/TiO{sub 2} PC composite was synthesized and exhibited high photocatalysis. • The improved light harvesting and increased quantum yield was achieved. • The hydroxyl radical was the primary oxidant in Cu{sub 2}O NCs/TiO{sub 2} PC photocatalysis. - Abstract: A 3D UV–visible light responsive photocatalyst was fabricated by infiltrating Cu{sub 2}O nanocrystals (NCs) into TiO{sub 2} photonic crystal (PC). Morphology characterization presented that Cu{sub 2}O NCs with average diameter around 10 nm were dispersed uniformly into TiO{sub 2} PC. The transmittance spectra showed that Cu{sub 2}O NCs/TiO{sub 2} 260, prepared by integrating Cu{sub 2}O NCs with TiO{sub 2} 260 which was fabricated from 260 nm polystyrene spheres, exhibited the highest light harvesting. The photoluminescence spectra confirmed the electron/hole pairs recombination of Cu{sub 2}O NCs/TiO{sub 2} 260 was efficiently inhibited due to the unique heterojunction structure between TiO{sub 2} and Cu{sub 2}O. In the photocatalytic degradation of Rhodamine B and Bisphenol A under UV–visible light (320 nm < λ < 780 nm) irradiation, the kinetic constant using Cu{sub 2}O NCs/TiO{sub 2} 260 was 3.99 and 8.37-fold larger than that using TiO{sub 2} nanoparticle (NP), respectively. The enhanced photocatalysis benefited from the increased light harvesting owing to the excitation of both TiO{sub 2} and Cu{sub 2}O NCs whose optical absorption was intensified by the photonic effect of TiO{sub 2} 260 and the high quantum efficiency due to the Cu{sub 2}O/TiO{sub 2} heterojunction. The hydroxyl radical, generated from the protonation of superoxide radical which was derived from the reduction of oxygen by photogenerated electrons, was the main oxidant responsible for pollutant degradation.
Using LEDs to stimulate the recovery of radiation damage to plastic scintillators
Energy Technology Data Exchange (ETDEWEB)
Wetzel, J., E-mail: james-wetzel@uiowa.edu [The University of Iowa, Iowa City, IA (United States); Tiras, E. [The University of Iowa, Iowa City, IA (United States); Bilki, B. [The University of Iowa, Iowa City, IA (United States); Beykent University, Istanbul (Turkey); Onel, Y. [The University of Iowa, Iowa City, IA (United States); Winn, D. [Fairfield University, Fairfield, CT (United States)
2017-03-15
In this study, we consider using LEDs to stimulate the recovery of scintillators damaged from radiation in high radiation environments. We irradiated scintillating tiles of polyethylene naphthalate (PEN), Eljen brand EJ-260 (EJN), an overdoped EJ-260 (EJ2P), and a lab-produced elastomer scintillator (ES) composed of p-terphenyl (ptp) in epoxy. Two different high-dose irradiations took place, with PEN dosed to 100 kGy, and the others to 78 kGy. We found that the ‘blue’ scintillators (PEN and ES) recovered faster and maximally higher with LEDs than without. Conversely exposing the ‘green’ scintillators (EJ-260) to LED light had a nearly negligible effect on the recovery. We hypothesize that the ‘green’ scintillators require wavelengths that match their absorption and emission spectra for LED stimulated recovery.
A Method to Achieve High Fidelity in Internet-Distributed Hardware-in-the-Loop Simulation
2012-08-01
Terrain Vehicle (M-ATV) Weight 14,403 kg Payload 1814 kg Frontal Area 5.72 m 2 Engine 6.4L V8 turbo - diesel : 260 kW Generator Permanent Magnet: 265 kW...6.4L V8 diesel engine with 260 kW rated power at 3000 rpm and a rated torque of 880 Nm at 2000 rpm. It is intended for a variety of medium-duty truck
Evaluating UV-C LED disinfection performance and investigating potential dual-wavelength synergy.
Beck, Sara E; Ryu, Hodon; Boczek, Laura A; Cashdollar, Jennifer L; Jeanis, Kaitlyn M; Rosenblum, James S; Lawal, Oliver R; Linden, Karl G
2017-02-01
A dual-wavelength UV-C LED unit, emitting at peaks of 260 nm, 280 nm, and the combination of 260|280 nm together was evaluated for its inactivation efficacy and energy efficiency at disinfecting Escherichia coli, MS2 coliphage, human adenovirus type 2 (HAdV2), and Bacillus pumilus spores, compared to conventional low-pressure and medium-pressure UV mercury vapor lamps. The dual-wavelength unit was also used to measure potential synergistic effects of multiple wavelengths on bacterial and viral inactivation and DNA and RNA damage. All five UV sources demonstrated similar inactivation of E. coli. For MS2, the 260 nm LED was most effective. For HAdV2 and B. pumilus, the MP UV lamp was most effective. When measuring electrical energy per order of reduction, the LP UV lamp was most efficient for inactivating E. coli and MS2; the LP UV and MP UV mercury lamps were equally efficient for HAdV2 and B. pumilus spores. Among the UV-C LEDs, there was no statistical difference in electrical efficiency for inactivating MS2, HAdV2, and B. pumilus spores. The 260 nm and 260|280 nm LEDs had a statistical energy advantage for E. coli inactivation. For UV-C LEDs to match the electrical efficiency per order of log reduction of conventional LP UV sources, they must reach efficiencies of 25-39% or be improved on by smart reactor design. No dual wavelength synergies were detected for bacterial and viral inactivation nor for DNA and RNA damage. Copyright © 2016 Elsevier Ltd. All rights reserved.
Schimelman, Jacob B; Dryden, Daniel M; Poudel, Lokendra; Krawiec, Katherine E; Ma, Yingfang; Podgornik, Rudolf; Parsegian, V Adrian; Denoyer, Linda K; Ching, Wai-Yim; Steinmetz, Nicole F; French, Roger H
2015-02-14
The role of base pair composition and stacking sequence in the optical properties and electronic transitions of DNA is of fundamental interest. We present and compare the optical properties of DNA oligonucleotides (AT)10, (AT)5(GC)5, and (AT-GC)5 using both ab initio methods and UV-vis molar absorbance measurements. Our data indicate a strong dependence of both the position and intensity of UV absorbance features on oligonucleotide composition and stacking sequence. The partial densities of states for each oligonucleotide indicate that the valence band edge arises from a feature associated with the PO4(3-) complex anion, and the conduction band edge arises from anti-bonding states in DNA base pairs. The results show a strong correspondence between the ab initio and experimentally determined optical properties. These results highlight the benefit of full spectral analysis of DNA, as opposed to reductive methods that consider only the 260 nm absorbance (A260) or simple purity ratios, such as A260/A230 or A260/A280, and suggest that the slope of the absorption edge onset may provide a useful metric for the degree of base pair stacking in DNA. These insights may prove useful for applications in biology, bioelectronics, and mesoscale self-assembly.
49 CFR 260.27 - Additional information for loan guarantees.
2010-10-01
... history on that obligation; and (b) With respect to each existing Lender, Holder, or prospective Lender, a statement as to: (1) Full and correct name and principal business address; (2) Reference to applicable provisions of law and the charter or other governing instruments conferring authority to do business on the...
33 CFR 104.260 - Security systems and equipment maintenance.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Security systems and equipment... systems and equipment maintenance. (a) Security systems and equipment must be in good working order and... procedures for identifying and responding to security system and equipment failures or malfunctions. ...
All projects related to | Page 260 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
2011-08-26
. Start Date: August 26, 2011. End Date: February 26, 2015. Topic: INFECTIOUS DISEASES, DISEASE VECTORS, PREVENTIVE MEDICINE, ENVIRONMENTAL ASPECTS. Region: Nepal, Central Asia, Far East Asia, South Asia. Program: ...
Nuclear Science Division 1994 annual report
International Nuclear Information System (INIS)
Myers, W.D.
1995-06-01
This report describes the activities of the Nuclear Science Division for the period of January 1, 1994, to December 31, 1994. This was a time of significant accomplishment for all of the programs in the Division. Assembly of the solar neutrino detector at the Sudbury Neutrino Observatory is well under way. All of the components fabricated by LBL were shipped to Sudbury early in the year and our efforts are now divided between assisting the assembly of the detector and preparing software for data analysis once the detector is operational in 1996. Much of the activity at the 88-Inch Cyclotron centered on Gammasphere. The open-quotes early implementationclose quotes phase of the detector ended in September. This phase was extremely successful, involving over 60 experiments with nearly 200 users from 37 institutions worldwide. The mechanical structure was installed and the final electronic system is expected to operate in March 1995. The Division concurrently hosted a conference on physics for large γ-ray detector arrays at the Clark Kerr Campus at UC Berkeley in August. This was a very successful meeting, reflecting the enthusiasm for this field worldwide. Also at the Cyclotron, the progress toward weak interaction experiments using ultra-thin sources passed a major milestone with the trapping of radioactive 21 Na atoms. We are now engaged in a major upgrade of the experimental area and the outlook is very promising for these novel experiments. Another highlight of research at the Cyclotron was the confirmation of element 106. This development allowed the original LLNL/LBL discovery team to move forward with their proposal to name this element seaborgium
Nuclear Science Division 1994 annual report
Energy Technology Data Exchange (ETDEWEB)
Myers, W.D. [ed.
1995-06-01
This report describes the activities of the Nuclear Science Division for the period of January 1, 1994, to December 31, 1994. This was a time of significant accomplishment for all of the programs in the Division. Assembly of the solar neutrino detector at the Sudbury Neutrino Observatory is well under way. All of the components fabricated by LBL were shipped to Sudbury early in the year and our efforts are now divided between assisting the assembly of the detector and preparing software for data analysis once the detector is operational in 1996. Much of the activity at the 88-Inch Cyclotron centered on Gammasphere. The {open_quotes}early implementation{close_quotes} phase of the detector ended in September. This phase was extremely successful, involving over 60 experiments with nearly 200 users from 37 institutions worldwide. The mechanical structure was installed and the final electronic system is expected to operate in March 1995. The Division concurrently hosted a conference on physics for large {gamma}-ray detector arrays at the Clark Kerr Campus at UC Berkeley in August. This was a very successful meeting, reflecting the enthusiasm for this field worldwide. Also at the Cyclotron, the progress toward weak interaction experiments using ultra-thin sources passed a major milestone with the trapping of radioactive {sup 21}Na atoms. We are now engaged in a major upgrade of the experimental area and the outlook is very promising for these novel experiments. Another highlight of research at the Cyclotron was the confirmation of element 106. This development allowed the original LLNL/LBL discovery team to move forward with their proposal to name this element seaborgium.
Breton, Jacques; Lavergne, Jérôme; Wakeham, Marion C; Nabedryk, Eliane; Jones, Michael R
2007-06-05
In native reaction centers (RCs) from photosynthetic purple bacteria the primary quinone (QA) and the secondary quinone (QB) are interconnected via a specific His-Fe-His bridge. In Rhodobacter sphaeroides RCs the C4=O carbonyl of QA forms a very strong hydrogen bond with the protonated Npi of His M219, and the Ntau of this residue is in turn coordinated to the non-heme iron atom. The second carbonyl of QA is engaged in a much weaker hydrogen bond with the backbone N-H of Ala M260. In previous work, a Trp side chain was introduced by site-directed mutagenesis at the M260 position in the RC of Rb. sphaeroides, resulting in a complex that is completely devoid of QA and therefore nonfunctional. A photochemically competent derivative of the AM260W mutant was isolated that contains a Cys side chain at the M260 position (denoted AM260(W-->C)). In the present work, the interactions between the carbonyl groups of QA and the protein in the AM260(W-->C) suppressor mutant have been characterized by light-induced FTIR difference spectroscopy of the photoreduction of QA. The QA-/QA difference spectrum demonstrates that the strong interaction between the C4=O carbonyl of QA and His M219 is lost in the mutant, and the coupled CO and CC modes of the QA- semiquinone are also strongly perturbed. In parallel, a band assigned to the perturbation of the C5-Ntau mode of His M219 upon QA- formation in the native RC is lacking in the spectrum of the mutant. Furthermore, a positive band between 2900 and 2400 cm-1 that is related to protons fluctuating within a network of highly polarizable hydrogen bonds in the native RC is reduced in amplitude in the mutant. On the other hand, the QB-/QB FTIR difference spectrum is essentially the same as for the native RC. The kinetics of electron transfer from QA- to QB were measured by the flash-induced absorption changes at 780 nm. Compared to native RCs the absorption transients are slowed by a factor of about 2 for both the slow phase (in the
Development of a One-Handed, Environmental Surface-Sampling Device
2016-05-01
individual packaging, an operator can generate a large amount of waste that needs to be managed during a sampling mission. The U.S. Army Edgewood...prepared and spore spotting was performed in a biological safety cabinet. For the spore- spotting procedures, the surfaces were spotted with 1 mL of...260 nm (A260) and 280 nm (A280). To determine the DNA concentration for each sample, the NanoDrop software used a modified Beer –Lambert equation and
Charoenlerdchanya, A.; Rattanadecho, P.; Keangin, P.
2018-01-01
An infrared gas stove is a low-pressure gas stove type and it has higher thermal efficiency than the other domestic cooking stoves. This study considers the computationally determine water and air temperature distributions, water and air velocity distributions and thermal efficiency of the infrared gas stove. The goal of this work is to investigate the effect of various pot diameters i.e. 220 mm, 240 mm and 260 mm on the water and air temperature distributions, water and air velocity distributions and thermal efficiency of the infrared gas stove. The time-dependent heat transfer equation involving diffusion and convection coupled with the time-dependent fluid dynamic equation is implemented and is solved by using the finite element method (FEM). The computer simulation study is validated with an experimental study, which is use standard experiment by LPG test for low-pressure gas stove in households (TIS No. 2312-2549). The findings revealed that the water and air temperature distributions increase with greater heating time, which varies with the three different pot diameters (220 mm, 240 mm and 260 mm). Similarly, the greater heating time, the water and air velocity distributions increase that vary by pot diameters (220, 240 and 260 mm). The maximum water temperature in the case of pot diameter of 220 mm is higher than the maximum water velocity in the case of pot diameters of 240 mm and 260 mm, respectively. However, the maximum air temperature in the case of pot diameter of 260 mm is higher than the maximum water velocity in the case of pot diameters of 240 mm and 220 mm, respectively. The obtained results may provide a basis for improving the energy efficiency of infrared gas stoves and other equipment, including helping to reduce energy consumption.
Rice, Treva K; Sarzynski, Mark A; Sung, Yun Ju; Argyropoulos, George; Stütz, Adrian M; Teran-Garcia, Margarita; Rao, D C; Bouchard, Claude; Rankinen, Tuomo
2012-08-01
Although regular exercise improves submaximal aerobic capacity, there is large variability in its response to exercise training. While this variation is thought to be partly due to genetic differences, relatively little is known about the causal genes. Submaximal aerobic capacity traits in the current report include the responses of oxygen consumption (ΔVO(2)60), power output (ΔWORK60), and cardiac output (ΔQ60) at 60% of VO2max to a standardized 20-week endurance exercise training program. Genome-wide linkage analysis in 475 HERITAGE Family Study Caucasians identified a locus on chromosome 13q for ΔVO(2)60 (LOD = 3.11). Follow-up fine mapping involved a dense marker panel of over 1,800 single-nucleotide polymorphisms (SNPs) in a 7.9-Mb region (21.1-29.1 Mb from p-terminus). Single-SNP analyses found 14 SNPs moderately associated with both ΔVO(2)60 at P ≤ 0.005 and the correlated traits of ΔWORK60 and ΔQ60 at P < 0.05. Haplotype analyses provided several strong signals (P < 1.0 × 10(-5)) for ΔVO(2)60. Overall, association analyses narrowed the target region and included potential biological candidate genes (MIPEP and SGCG). Consistent with maximal heritability estimates of 23%, up to 20% of the phenotypic variance in ΔVO(2)60 was accounted for by these SNPs. These results implicate candidate genes on chromosome 13q12 for the ability to improve submaximal exercise capacity in response to regular exercise. Submaximal exercise at 60% of maximal capacity is an exercise intensity that falls well within the range recommended in the Physical Activity Guidelines for Americans and thus has potential public health relevance.
Problems associated with scintillation counting of NaH14CO3 and gel suspension counting of Ba14CO3
International Nuclear Information System (INIS)
MacRae, J.C.; Wilson, S.
1978-01-01
Liquid NaH 14 CO 3 was assayed in emulsion-type (NE260 and Unisolve) and dioxan-based (NE250) scintillation cocktails contained in glass or polyethylene vials kept at 2 0 or 24-30 0 C. Different particle size ranges of standard Ba 14 CO 3 were assayed by gel suspension counting in Cabosil scintillation cocktail and in NE260 following solubilisation in EDTA-tetrasodium salt. Initial detectable activities of NaH 14 CO 3 in glass and polyethylene vials in NE250, NE260 and Unisolve were 97 and 96, 68 and 83, 71 and 89% of the true value respectively. Subsequent losses of activity over 7 days with the emulsion-type scintillators was greater from the polyethylene vials. Addition of phenylethylamine to the NE260 and Unisolve cocktails gave the true activity levels for all vials with no loss of activity over 6 days. When different particle size ranges of Standard Ba 14 CO 3 were suspended in Cabosil scintillation cocktail there was considerable variation in counting efficiency (77-88%) with little relationship between particle size and counting efficiency. The relationship between counting efficiency and channels ratio was not sufficiently precise for predictive purposes. Solubilisation of Ba 14 CO 3 in EDTA-tetrasodium salt gave similar counting efficiency and channels ratio values for all samples. (U.K.)
International Nuclear Information System (INIS)
Boado, R.J.; Ulloa, E.R.; Zaninovich, A.A.
1982-01-01
Wistar rats were treated with 7.8 or 260 nmols T4/100 g BW, 1.5 or 260 nmols T3/100 g BW, or saline as control. Twenty minutes later 1 μg TRH/100 g BW was injected iv. Heparinized blood samples were drawn at times 0 and 30 minutes (10 min post-TRH) for determination of plasma TSH, T4 and T3 by RIA. Other group of rats were administered with 150 μCi of 3',5'- 125 I-T4 prepared by iodination of 3,5-diiodothyronine. Thirty minutes later the hypophyses were removed, and chromatographed. Other group of animals were treated with 5 mg of iopanoic acid (IOP)/100 g BW. Thereafter, rats were injected iv with 260 nmols T4 or T3/100 g BW and the TRH-test performed as described above. In the control group there was a 11-fold increase in plasma TSH at 10 minutes post-TRH. In rats treated with 260 nmols T4 the post-TRH increment in plasma TSH was 5+-1-fold (p 125 I-T3 in the hypophyses 30 minutes after 125 I-T4 administration. The present data indicate that T4 is capable of depressing the release of TSH in response to TRH stimulation in normal rats. (M.E.L.) [es
ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available KVELILYKPGNKFKCDILYQCILRNQLIWINDWDLYSIATVFKRILS 260 ... LYQIFKIVENNGNKVELILYKPGNKFKCDILYQCILRNQLIWIND...WDLYSIATVFKRILS Sbjct: 1 ... LYQIFKIVENNGNKVELILYKPGNKFKCDILYQCILRNQLIWINDWDLYSIATV
Neurotological symptoms and academic performance of university students.
Marques, Marcia Mattos; Ganança, Mauricio Malavasi; Marques, Carolina Mattos; Ganança, Fernando Freitas; Caovilla, Heloisa Helena
2010-02-01
To compare the academic performance of university students with or without neurotological symptoms. 100 students enrolled in the Biomedical Sciences Graduate School - Medical Modality of UNIFESP-EPM in 2007 and answered a neurotological screening questionnaire. The symptoms presented once, sometimes, many times or always, in a decreasing order of prevalence, were headache (74.0%), difficulty with concentration (57.0%), lack of memory (45.0%), physical indisposition, nausea /dizziness when in moving vehicle (37.0%), fainting (27.0%), nausea (26.0%), sensation of fullness in the ear (26.0%), hypersensitivity to sounds (26.0%), tinnitus (22.0%), vertigo and other kinds of dizziness (21.0%), imbalance when walking (21.0%), difficulty in hearing (21.0%), imminent sensation of fainting (11.0%) and vomiting (8.0%), alone or in different associations; convulsion was not mentioned. The final academic performance score ranged from 5.1 to 10.0. University students with or without neurotological symptoms have manifested similar academic performance.
Directory of Open Access Journals (Sweden)
Marcia Mattos Marques
2010-02-01
Full Text Available OBJECTIVE: To compare the academic performance of university students with or without neurotological symptoms. METHOD: 100 students enrolled in the Biomedical Sciences Graduate School - Medical Modality of UNIFESP-EPM in 2007 and answered a neurotological screening questionnaire. RESULTS: The symptoms presented once, sometimes, many times or always, in a decreasing order of prevalence, were headache (74.0%, difficulty with concentration (57.0%, lack of memory (45.0%, physical indisposition, nausea /dizziness when in moving vehicle (37.0%, fainting (27.0%, nausea (26.0%, sensation of fullness in the ear (26.0%, hypersensitivity to sounds (26.0%, tinnitus (22.0%, vertigo and other kinds of dizziness (21.0%, imbalance when walking (21.0%, difficulty in hearing (21.0%, imminent sensation of fainting (11.0% and vomiting (8.0%, alone or in different associations; convulsion was not mentioned. The final academic performance score ranged from 5.1 to 10.0. CONCLUSION: University students with or without neurotological symptoms have manifested similar academic performance.OBJETIVO: Comparar o rendimento escolar de universitários com e sem sintomas otoneurológicos. MÉTODO: Cem alunos matriculados e ativos no Curso de Graduação em Ciências Biomédicas - Modalidade Médica da UNIFESP-EPM em 2007 responderam um questionário de triagem otoneurológica. RESULTADOS: Os sintomas presentes uma vez, algumas vezes, muitas vezes ou sempre, em ordem decrescente de prevalência, foram: dor de cabeça (74,0%, dificuldade de concentração (57,0%, dificuldade de memória (45,0%, mal-estar/enjôo/tontura em veículos em movimento (37,0%, desmaio (27,0%, enjôo (26,0%, sensação de ouvido tapado (26,0%, hipersensibilidade a sons (26,0%, zumbido (22,0%, vertigem ou outros tipos de tontura (21,0%, desequilíbrio ao andar (21,0%, dificuldade para ouvir (21,0%, sensação de desmaio iminente (11,0% e vômito (8,0%, isoladamente ou em diferentes combinações; convuls
Association between CD14 gene polymorphisms and cancer risk: a meta-analysis.
Directory of Open Access Journals (Sweden)
Jun Wang
Full Text Available BACKGROUND: Two polymorphisms, -260C/T and -651C/T, in the CD14 gene have been implicated in susceptibility to cancer. However, the results remain inconclusive. This meta-analysis aimed to investigate the association between the two polymorphisms and risk of cancer. METHODS: All eligible case-control studies published up to March 2014 were identified by searching PubMed, Web of Science, CNKI and WanFang database. Pooled odds ratio (OR with 95% confidence interval (CI were used to access the strength of this association in fixed- or random-effects model. RESULTS: 17 case-control studies from fourteen articles were included. Of those, there were 17 studies (4198 cases and 4194 controls for -260C/T polymorphism and three studies (832 cases and 1190 controls for -651C/T polymorphism. Overall, no significant associations between the two polymorphisms of CD14 gene and cancer risk were found. When stratified by ethnicity, cancer type and source of control, similar results were observed among them. In addition, in further subgroups analysis by Helicobacter pylori (H. pylori infection status and tumor location in gastric cancer subgroup, we found that the CD14 -260C/T polymorphism may increase the risk of gastric cancer in H. pylori-infected individuals. CONCLUSIONS: This meta-analysis suggests that the CD14 -260C/T polymorphism may increase the risk of gastric cancer in H. pylori-infected individuals. However, large and well-designed studies are warranted to validate our findings.
Luminescence properties of KCl:Ag{sup -} crystals excited near the fundamental absorption edge
Energy Technology Data Exchange (ETDEWEB)
Kawai, Taketoshi, E-mail: buri@p.s.osakafu-u.ac.jp [Department of Physical Science, Graduate School of Science, Osaka Prefecture University, Gakuen-cho 1-1, Naka-ku, Sakai, Osaka 599-8531 (Japan); Hirai, Takeshi [Department of Physical Science, Faculty of Science and Engineering, Ritsumeikan University, Noji Higashi 1-1-1, Kusatsu, Shiga 525-8577 (Japan)
2012-02-15
Luminescence properties of KCl single crystals doped with Ag{sup -} centers have been investigated under various excitation energies around the fundamental absorption edge at low temperatures. Under the excitation at 6.89 eV, which is lower than the intrinsic exciton energy by 0.87 eV, the A Prime luminescence band due to the intraionic transition in the Ag{sup -} ion is dominantly observed at 2.91 eV. On the other hand, the excitation at 6.66 eV induces a broad luminescence band at 2.60 eV in addition to the A Prime luminescence band. From the comparison with the localized excitons in KCl:I crystals, the 2.60 eV luminescence band is attributed to the two-center type localized exciton related with the Ag{sup -} ion. The adiabatic potential energy surfaces of the excited states in the Ag{sup -} center and the localized exciton in KCl:Ag{sup -} are discussed. - Highlights: Black-Right-Pointing-Pointer We study the luminescence properties of KCl single crystals doped with Ag{sup -} ions. Black-Right-Pointing-Pointer The excitation around the absorption edge induces a broad luminescence at 2.60 eV. Black-Right-Pointing-Pointer The 2.60 eV luminescence is attributed to the exciton localized at the Ag{sup -} ion. Black-Right-Pointing-Pointer The localized exciton has the two-center type configuration of the relaxed exciton.
ORF Alignment: NC_003424 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available HRTRARTESSVFVIDKKTSQCVHYQANERGKHYV 180 ... Query: 260 KIHCHVAKENYAARVRSLQTYDAISKDVLS...RWVYPFVPDSNLLNQTFSYQRHQIYKEEDV 319 ... KIHCHVAKENYAARVRSLQTYDAISKDVLSRWVYPFVPDSNLLNQTFSYQRHQIYKEEDV Sbjct: 241 KIHCHVAKENYA
DEFF Research Database (Denmark)
Vionnet, Christine; Roubaty, Carole; Ejsing, Christer S.
2010-01-01
In yeast, the inositolphosphorylceramides mostly contain C26:0 fatty acids. Inositolphosphorylceramides were considered to be important for viability, since the inositolphosphorylceramide synthase AUR1 is essential. Yet, lcb1 cells, unable to make sphingoid bases and inositolphosphorylceramides......, are viable if they harbor SLC1-1, a gain of function mutation in the 1-acyl-glycerol-3-phosphate acyltransferase SLC1. SLC1-1 allows to incorporate C26:0 fatty acids into phosphatidylinositol (PI), thus generating PIii, an abnormal, C26-containing PI, presumably acting as surrogate...
Occupational Survey Report. Food Service Career Ladder AFSC 622X0
1980-09-01
FRY MEATS, SEAFOODS, OR POULTRY 47 G212 COOK CEREALS SUCH AS OATMEAL OR CORNMEAL 47 G209 BRAISE MEATS, SEAFOODS, OR POULTRY 47 G253 PREPARE MEATS...OATMEAL OR CORNMEAL 62 G210 BREW COFFEE OR TEA 62 G259 PREPARE SANDWICHES 61 G245 PREPARE GARNISHES 61 G260 PREPARE SOUPS 61 1341 CLEAN WORK TABLES 61 H288...EGGS FOR COOKING 80 G260 PREPARE SOUPS 80 G257 PREPARE RICE OR PASTA 80 G212 COOK CEREALS, SUCH AS OATMEAL OR CORNMEAL 77 H288 PREPARE GRIDDLES FOR USE
Effect of chronic administration of Tamoxifen on fertility in male bonnet monkeys (Macaca radiata).
Rao, A J; Ramachandra, S G; Ramesh, V; Krishnamurthy, H N; Jayaraman, S; Gopalakrishnan, K; Juneja, H S
1998-01-01
Administration of Tamoxifen via the Alzet pump at a rate of 50 micrograms hr-1 for 90 days in the adult male bonnet monkeys Macaca radiata had no effect on the serum testosterone concentration determined at 10 AM and 10 PM as well as total sperm count determined at 15-day intervals over a period of 260 days. However, a significant reduction in sperm motility was observed beyond 90 days up until the 225th day. Breeding studies conducted from day 90 to 260 revealed that these males were infertile.
49 CFR 260.23 - Form and content of application generally.
2010-10-01
... information: (a) Full and correct name and principal business address of the Applicant; (b) Date of Applicant... analyses and studies that have been performed to determine present and future demand for rail services or... how the project will contribute to, or enhance, the safe operation of the railroad, considering such...
Aerospace Technology Curriculum Guide. Invest in Success. Vo. Ed. #260.
Idaho State Dept. of Education, Boise. Div. of Vocational Education.
This document contains standards for an articulated secondary and postsecondary curriculum in aerospace technology. The curriculum standards can be used to ensure that vocational programs meet the needs of local business and industry. The first part of the document contains a task list and student performance standards for the aerospace technology…
49 CFR 260.45 - Events of default for guaranteed loans.
2010-10-01
... reflect the fair market value and potential liquidation value. In order to formulate a liquidation plan... must continue to submit this information to the Administrator each month until such time as the loan is... and interest in accordance with the note. If the loan is brought current, the Lender will repay to the...
37 CFR 260.4 - Confidential information and statements of account.
2010-07-01
... Confidential information and statements of account. (a) For purposes of this part, confidential information shall include statements of account and any information pertaining to the statements of account... included on the statement of account. (d) Access to the confidential information pertaining to the royalty...
ORF Alignment: NC_001133 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available STPDHGYVLVCTVHTKHPNIIIVGTSKGWLDFYKFH 180 ... Query: 260 YQDVINKLQWNCILFSNNTAEYLVASTHGSSAHEL...YIWETTSGTLVRVLEGAEEELIDIN 319 ... YQDVINKLQWNCILFSNNTAEYLVASTHGSSAHELYIWETTSGTLVRVLEGAEEELIDIN... Sbjct: 241 YQDVINKLQWNCILFSNNTAEYLVASTHGSSAHELYIWETTSGTLVRVLEGAEEELIDIN 300 ...
ORF Alignment: NC_002696 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available GRSGRPETGRQGYSISAVNEFDAL 180 ... Query: 260 ATFMAKPMANEPGSAMHIHQSIVDKKGRNLFSDEDGAESAMFHGFIAGQQTYLPAIMAIL 319 ... ... ... ATFMAKPMANEPGSAMHIHQSIVDKKGRNLFSDEDGAESAMFHGFIAGQQTYLPAIMAIL Sbjct: 241 ...ATFMAKPMANEPGSAMHIHQSIVDKKGRNLFSDEDGAESAMFHGFIAGQQTYLPAIMAIL 300 ... Query: 380 SLAAGYLGMVQGLKPSEPVSIDAGARGIELP
Directory of Open Access Journals (Sweden)
H. Aryansyah
2007-07-01
Full Text Available This experiment was conducted to determine the effect of different dietary chromium level on the growth performance of catfish (Clarias sp. juvenile. Five experimental diets contain different chromium level, namely diet A (as a control diet 0.01; B 1.30; C 2.60; D 3.90 and E 5.20 mg/kg diet were used in this experiment. Fish with body weight of 5.57 ± 0.01 g/ind, fed on the experimental diet, twice a day, at satiation. Feeding trial was conducted for 60 days. Based on the evaluation of protein level of the whole body, protein and lipid retention, daily growth rate and feed efficiency, it was concluded that the optimum dietary chromium level for catfish juvenile was 2.60 mg/kg diet. Keywords: chromium, growth, Clarias sp. ABSTRAK Penelitian ini dilakukan untuk mengetahui pengaruh pemberian kromium dengan level berbeda terhadap pertumbuhan ikan lele (Clarias sp. juvenil. Lima jenis pakan yang mengandung kromium berbeda, yaitu pakan A (kontrol 0,01; B 1,30; C 2,60; D 3,90 dan pakan E 5,20 mg/kg digunakan dalam penelitian ini. Ikan dengan bobot 5,57 ± 0,01 g/ind., diberi pakan 2 kali sehari secara satiasi. Pemeliharaan ikan dilakukan selama 60 hari. Berdasarkan analisa retensi protein, kandungan protein dan retensi lemak dalam tubuh ikan lele, disimpulkan bahwa kadar kromium yang optimum untuk juvenil ikan lele adalah 2,60 mg/kg pakan. Kata kunci: kromium, pertumbuhan, Clarias sp.
Thermal decomposition behavior of the co-precipitated carbonate precursor for La0.84Sr0.16MnO3
International Nuclear Information System (INIS)
Sankaranarayanan, A.; Kalekar, B.B.; Ramanathan, S.
2004-01-01
A carbonate precursor for lanthanum strontium manganite powder (La 0.84 Sr 0.16 MnO 3 - LSM) was obtained by addition of an aqueous solution of nitrates of lanthanum, strontium and manganese into a bath of ammonium carbonate solution. The precipitate was filtered, washed, dried and dry ground for homogenization. The thermal decomposition behavior of the precursor was studied by simultaneous TG-DTA-EGA technique while the precursor and intermediates formed at different temperatures were characterized by FTIR and XRD techniques for decomposition of carbonate and compound formation. It exhibited a loss in weight and endotherms in stages in the temperature ranges of 20 to 260 deg C, 260 deg to 500 deg C, 500 deg to 600 deg C, 600 deg to 900 deg C. The loss of carbon dioxide was exhibited in the EGA data and FTIR spectra while phase formation was confirmed by XRD. A comparative study of all these results showed that the processes occurring at various temperature ranges (20 deg to 260 deg C, 260 deg to 500 deg C, 500 deg to 600 deg C, 600 deg to 900 deg C) are dehydration of adsorbed moisture and water of crystallization, decomposition of manganese hydroxycarbonate to manganese dioxide, lanthanum carbonate to lanthanum oxy-carbonate and interaction between lanthanum oxy-carbonate, manganese dioxide and strontium carbonate to form finally LSM. Even though decomposition of carbonates into oxides was complete at 900 deg C, phase pure compound formation occurred at 1100 deg C, under the conditions used. (author)
International Nuclear Information System (INIS)
Andoh, Nobuyuki; Sameshima, Toshiyuki; Andoh, Yasunori
2005-01-01
Phosphorus atoms implanted in laser crystallized polycrystalline silicon films were activated by a heat treatment in air at 260 deg. C for 1, 3 and 24 h. Analysis of ultraviolet reflectivity of phosphorus-doped silicon films implanted by ion doping method at 4 keV revealed that the thickness of the top disordered layer formed by ion bombardment was 6 nm. It is reduced to 4 nm by a 3 h heat treatment at 260 deg. C by recrystallization of disordered region. The electrical conductance of silicon films implanted increased to 1.7x10 5 S/sq after 3 h heat treatment
Estévez Cordero, Orlando Allende
2014-01-01
La Neutropenia Congénita Severa tipo 4 (SCN4 por sus siglas en ingles) está asociada a mutaciones en el gen que codifica la tercera sub-unidad catalítica de la glucose-6-fosfatasa (G6PC3). En la actualidad, todos los pacientes descritos portadores de la variante p.Gly260Arg en el gen G6PC3 muestran defectos cardíacos. En este trabajo presentamos el caso de una variante p.Gly260Arg en un paciente sin alteraciones funcionales ni estructurales en corazón. Por su parte, Interleuquina-21 (IL-21...
ASTP crewmen in Apollo Command Module Trainer during training session at JSC
1975-01-01
The three members of the American ASTP prime crew are photographed inside the Apollo Command Module (CM) trainer in a water tank in bldg 260 during water egress training at JSC. They are, left to right, Astronauts Thomas P. Stafford, commander; Vance D. Brand, command module pilot; and Donald K. Slayton, docking module pilot (23430); Slayton attaches his life preserver as he egresses an Apollo Command Module trainer in a water tank in bldg 260 during water egresss training at JSC. Astronauts Brand (on left) and Stafford have already egressed the trainer and are seated in a three-man life raft.
What Constitutes 'Failure to Notify' National Measures?
DEFF Research Database (Denmark)
Gáspár-Szilágyi, Szilárd
2013-01-01
“The inclusion of article 260(3) TFEU adopted as part of the Lisbon Treaty changed the landscape of infringement proceedings. The provision grants the Commission the power to propose monetary sanctions already during the initial Court litigation against a Member State that ‘failed to notify......’ national measures transposing a directive. This article analyses the concept of ‘failure to notify’ and points out that the current interpretation adopted by the Commission is only one of several possible interpretations. The author concludes that article 260(3) TFEU as it stands now is vaguely drafted...
Li, Jie; Xu, Ji-Feng; Suzuki, Katsuhiko; He, Bin; Xu, Yi-Gang; Ren, Zhong-Yuan
2010-09-01
A suite of picrites and basalts from the Muli area, in the northwestern part of the Emeishan continental flood basalt province, provides new and valuable information on the geochemistry of the Emeishan Large Igneous Province (LIP) and its source. The Muli picrites can be classified as type-1 or type-2. The former shows ocean-island basalt-like trace element characteristics, with γ Os (260 Ma) values and ɛ Nd (260 Ma) values ranging from + 7.5 to + 11.5 and from + 6.0 to + 7.8, respectively. This is the first time that picrites with highly radiogenic Os and high Os contents (up to 3.3 ppb) have been recognized in the Emeishan LIP. These characteristics probably reflect a relatively enriched component in the Emeishan LIP source. The type-2 picrites are characterized by non-radiogenic γ Os (260 Ma) values ranging from - 4.2 to - 0.3, and they may be further subdivided into type-2A and type-2B picrites. Type-2A picrites contain moderate amounts of the light rare earth elements (LREEs), have low Ce N/Yb N values (1.1-2.0), and a relatively high initial ɛ Nd (+ 5.0 to + 6.6). In terms of Os and Nd isotopes, the Muli type-2A picrites are similar to the Song Da komatiites of Vietnam and the Gorgona Island picrites, revealing the existence of a depleted mantle component in the Emeishan LIP source. In contrast with the type-2A picrites, type-2B lavas exhibit a negative Nb anomaly and relatively lower initial ɛ Nd and γ Os values (Nb/La > 1.8; ɛ Nd (260 Ma) = - 5.5 to + 6.4; γ Os (260 Ma) = - 4.2 to - 1.9), suggesting that the type-2B lavas have a depleted mantle source, similar to type-2A, but that the type-2B lavas are also influenced by various degrees of mixing of depleted plume-derived melt, sub-continental lithospheric mantle, and/or continental crust. Given that the basalts in the Muli area show similar geochemical features to those of the type-2B picrites, their origins are inferred to be similar.
Comparative Analysis of the Genomic DNA Isolation Methods on Inula sp. (Asteraceae
Directory of Open Access Journals (Sweden)
Emre SEVİNDİK
2016-12-01
Full Text Available Simple, fast, low-cost and high throughput protocols are required for DNA isolation of plant species. In this study, phenol chloroform isoamyl alcohol and commercial (Sigma DNA isolation kit methods were applied on some Inula species that belong to Asteraceae family. Genomic DNA amounts, A260, A280, A260/A230 and purity degrees (A260/A280 that were obtained through both methods were measured through electrophoresis and spectrophotometer. Additionally, PCR amplification was realized by primer pairs specific to nrDNA ITS, cpDNA ndhF (972F-1603R and trnL-F regions. Results showed that maximum genomic DNA in nanograms obtained by phenol chloroform isoamyl alcohol method. The study also revealed that I. macrocephala had the maximum DNA and I. heterolepis had the minimum DNA amount. A260/A280 purity degrees showed that the highest and lowest purity in gDNAs obtained through phenol-choloform isoamyl alcohol method were in I.aucheriana and I. salicina, respectively. The highest and lowest purity degrees of gDNAs obtained through commercial kit was observed in I. fragilis and I. macrocephala samples, respectively. PCR amplification results showed that while band profiles of each three regions (ITS, trnL-F and ndhF did not yield positive results in PCR amplifications using phenol-choloform isoamyl alcohol method; PCR band profiles obtained through commercial kit yielded positive results. As a result, it is fair to say that the relation of genomic DNA with PCR was found to be more efficient although the maximum amount of genomic DNA was obtained through phenol chloroform isoamyl alcohol method.
Directory of Open Access Journals (Sweden)
Hiroyuki Inoue
2016-04-01
Full Text Available The non-catalytic hydrothermal pretreatment of softwood is generally less effective for subsequent enzymatic hydrolysis. In this study, the efficacy of hot-compressed water (HCW treatment of Douglas fir was investigated between 180 °C and 260 °C, allowing solubilization of the cellulose components. The enzymatic digestibility of cellulosic residues increased significantly under HCW conditions > 250 °C, and the enhanced glucan digestibility was closely related to the decomposition of the cellulose component. Combination of the first-stage HCW treatment (220 °C, 5 min to recover hemicellulosic sugars with the second-stage HCW treatment (260 °C, 5 min to improve cellulose digestibility gave a total sugar recovery of 56.2% based on the dried raw materials. This yield was 1.4 times higher than that from the one-step HCW-treated sample (260 °C, 5 min. Additionally, an enzymatic hydrolysate from the two-step HCW-treated sample exceeded 90% of the ethanol fermentation yield based on the total sugars present in the hydrolysates. These results suggest the potential of the two-step HCW treatment of softwood as a pretreatment technology for efficient total sugar recovery and ethanol production.
Energy Technology Data Exchange (ETDEWEB)
Johnson, Nicole, E-mail: nejhnsn2@illinois.edu; Rockett, Angus [Department of Materials Science and Engineering, University of Illinois at Urbana-Champaign, 1304 W Green St., Urbana, Illinois 61801 (United States); Aydogan, Pinar; Suzer, Sefik [Department of Chemistry, Bilkent University, 06800 Ankara (Turkey)
2016-05-15
The photoresponse of Cd-doped CuInSe{sub 2} (CIS) epitaxial thin films on GaAs(100) was studied using x-ray photoelectron spectroscopy under illumination from a 532 nm laser between sample temperatures of 28–260 °C. The initial, air-exposed surface shows little to no photoresponse in the photoelectron binding energies, the Auger electron kinetic energies or peak shapes. Heating between 50 and 130 °C in the analysis chamber results in enhanced n-type doping at the surface and an increased light-induced binding energy shift, the magnitude of which persists when the samples are cooled to room temperature from 130 °C but which disappears when cooling from 260 °C. Extra negative charge trapped on the Cu and Se atoms indicates deep trap states that dissociate after cooling from 260 °C. Analysis of the Cd modified Auger parameter under illumination gives experimental verification of electron charging on Cd atoms thought to be shallow donors in CIS. The electron charging under illumination disappears at 130 °C but occurs again when the sample is cooled to room temperature.
Development of a methodology for simulation of gas cooled reactors with purpose of transmutation
International Nuclear Information System (INIS)
Silva, Clarysson Alberto da
2009-01-01
This work proposes a methodology of MHR (Modular Helium Reactor) simulation using the WIMSD-5B (Winfrith Improved Multi/group Scheme) nuclear code which is validated by MCNPX 2.6.0 (Monte Carlo N-Particle transport eXtend) nuclear code. The goal is verify the capability of WIMSD-5B to simulate a reactor type GT-MHR (Gas Turbine Modular Helium Reactor), considering all the fuel recharges possibilities. Also is evaluated the possibility of WIMSD-5B to represent adequately the fuel evolution during the fuel recharge. Initially was verified the WIMSD-5B capability to simulate the recharge specificities of this model by analysis of neutronic parameters and isotopic composition during the burnup. After the model was simulated using both WIMSD-5B and MCNPX 2.6.0 codes and the results of k eff , neutronic flux and isotopic composition were compared. The results show that the deterministic WIMSD-5B code can be applied to a qualitative evaluation, representing adequately the core behavior during the fuel recharges being possible in a short period of time to inquire about the burned core that, once optimized, can be quantitatively evaluated by a code type MCNPX 2.6.0. (author)
Industrial-Scale Processes For Stabilizing Radioactively Contaminated Mercury Wastes
International Nuclear Information System (INIS)
Broderick, T. E.; Grondin, R.
2003-01-01
This paper describes two industrial-scaled processes now being used to treat two problematic mercury waste categories: elemental mercury contaminated with radionuclides and radioactive solid wastes containing greater than 260-ppm mercury. The stabilization processes were developed by ADA Technologies, Inc., an environmental control and process development company in Littleton, Colorado. Perma-Fix Environmental Services has licensed the liquid elemental mercury stabilization process to treat radioactive mercury from Los Alamos National Laboratory and other DOE sites. ADA and Perma-Fix also cooperated to apply the >260-ppm mercury treatment technology to a storm sewer sediment waste collected from the Y-12 complex in Oak Ridge, TN
Construction of a high affinity zinc binding site in the metabotropic glutamate receptor mGluR1
DEFF Research Database (Denmark)
Jensen, Anders A.; Sheppard, P O; Jensen, L B
2001-01-01
a molecular model of the ATD of mGluR1 based on a weak amino acid sequence similarity with a bacterial periplasmic binding protein. The ATD consists of two globular lobes, which are speculated to contract from an "open" to a "closed" conformation following agonist binding. In the present study, we have...... created a Zn(2+) binding site in mGluR1b by mutating the residue Lys(260) to a histidine. Zinc acts as a noncompetitive antagonist of agonist-induced IP accumulation on the K260H mutant with an IC(50) value of 2 microm. Alanine mutations of three potential "zinc coligands" in proximity to the introduced...
ORF Alignment: NC_005071 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ADLGADLVLTPELSLWGYPPRDLLLSHNHLV 60 ... Query: 138 IYDVFDEKRYFRPAGTPAVLEFERDGRRWRLGLTICEDLWVEEALQGKRIAGPDPIAAXX ...197 ... IYDVFDEKRYFRPAGTPAVLEFERDGRRWRLGLTICEDLWVEEALQGKRIAGPDPIAA ... Sbjct...: 121 IYDVFDEKRYFRPAGTPAVLEFERDGRRWRLGLTICEDLWVEEALQGKRIAGPDPIAALL 180 ... Query: 258 EHAELALQLPSCREALAIWD 277 ... EHAELALQLPSCREALAIWD Sbjct: 241 EHAELALQLPSCREALAIWD 260
45 CFR 260.30 - What definitions apply under the TANF regulations?
2010-10-01
... with Dependent Children means the welfare program in effect under title IV-A of prior law. Assistance... under sections 403(a)(5) and 406(e) of prior law to provide short-term assistance to needy families with... household as the minor child. Prior law means the provisions of title IV-A and IV-F of the Act in effect as...
45 CFR 260.35 - What other Federal laws apply to TANF?
2010-10-01
... regulatory and enforcement authority at section 417 of the Act does not limit the effect of other Federal... Safety and Health Act (OSHA) and unemployment insurance (UI)) and nondiscrimination laws. These laws...
45 CFR 260.31 - What does the term “assistance” mean?
2010-10-01
... distributions from, Individual Development Accounts; (6) Services such as counseling, case management, peer...-term benefits that: (i) Are designed to deal with a specific crisis situation or episode of need; (ii...
: tous les projets | Page 260 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
Sujet: WOMEN'S PARTICIPATION, POLITICAL PARTICIPATION, WOMEN'S RIGHTS, GENDER DISCRIMINATION, GENDER EQUALITY. Région: Pakistan, Central Asia, Far East Asia, South Asia. Programme: Gouvernance et justice. Financement total : CA$ 125,700.00. Femmes et représentation au Pakistan : voix d'en ...
Unstable cyclic modulation during the main outburst of KS 1731-260
Czech Academy of Sciences Publication Activity Database
Šimon, Vojtěch
2012-01-01
Roč. 17, č. 8 (2012), s. 697-704 ISSN 1384-1076 R&D Projects: GA ČR GA205/08/1207 Institutional support: RVO:67985815 Keywords : X-rays * close binaries * circumstellar matter Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 1.850, year: 2012
Directory of Open Access Journals (Sweden)
Noor Adila, A. K.
2007-01-01
Full Text Available A number of protocols have been reported for efficient fungal DNA and RNA isolation. However, many of these methods are often designed for certain groups or morphological forms of fungi and, in some cases, are species dependent. In this report, we compared four published protocols for DNA isolation from a locally isolated oleaginous fungus, Cunninghamella bainieri strain 2a1. These protocols either involved the use of polyvinyl pyrrolidone (PVP, hexacetyltrimethylammonium bromide (CTAB or without using PVB or CTAB. For RNA isolation, we tested two published protocols, one of which is based on TRI REAGENT (Molecular Research Center, USA and another is simple method employing phenol for RNA extraction and LiCl for precipitation. We found that the protocol involving the use of CTAB produced the highest genomic DNA yield with the best quality compared to other protocols. In the presence of CTAB, unwanted polysaccharides were removed and this method yielded an average amount of 816 ± 12.2 µg DNA/g mycelia with UV absorbance ratios A260/280 and A260/230 of 1.67 ± 0.64 and 1.97 ± 0.23, respectively. The genomic DNA isolated via this protocol is also suitable for PCR amplification and restriction enzyme digestion. As for RNA isolation, the method involving phenol extraction and LiCl precipitation produced the highest yield of RNA with an average amount of 372 ± 6.0 µg RNA/g mycelia. The RNA appears to be relatively pure since it has UV absorbance ratios A260/280 and A260/230 of 1.89 ± 2.00 and 1.99 ± 0.03, respectively. Finally, we have demonstrated that this method could produce RNA of sufficient quality for RT-PCR that amplified a 600 bp fragment of ∆12-fatty acid desaturase gene in C. bainieri.
Pre-visual detection of stress in pine forests
Olson, C. E., Jr.
1977-01-01
Pre-visual, or early, detection of forest stress with particular reference to detection of attacks by pine bark beetles is discussed. Preliminary efforts to obtain early detection of attacks by pine bark beetles, using MSS data from the ERIM M-7 scanner, were not sufficiently successful to demonstrate an operational capability, but indicate that joint processing of the 0.71 to 0.73, 2.00 to 2.60, and 9.3 to 11.7 micrometer bands holds some promise. Ratio processing of transformed data from the 0.45 to 0.52, 1.55 to 2.60, and 4.5 to 5.5 or 9.3 to 11.7 micrometer regions appears even more promising.
Mn-AlInN: a new diluted magnetic semiconductor
International Nuclear Information System (INIS)
Majid, Abdul; Ali, Akbar; Sharif, Rehana; Zhu, J.J.
2009-01-01
Mn ions have been incorporated into MOCVD grown Al 1-x In x N/GaN thin films by ion implantation to achieve the room temperature ferromagnetism in the samples. Magnetic characterizations revealed the presence of two ferromagnetic transitions: one has Curie points at ∝260 K and the other above room temperature. In-diffusion of indium caused by the Mn implantation leads to the partition of AlInN epilayer into two diluted magnetic semiconductor sub-layers depending on the Mn concentration. The Curie temperature of 260 K is assigned to the layer having lower concentration, whereas T c above room temperature is assumed to be associated to the layer having higher Mn concentration. (orig.)
Directory of Open Access Journals (Sweden)
Mario Sanhueza
2013-12-01
Amyotrophic Lateral Sclerosis (ALS is a motor neuron degenerative disease characterized by a progressive, and ultimately fatal, muscle paralysis. The human VAMP-Associated Protein B (hVAPB is the causative gene of ALS type 8. Previous studies have shown that a loss-of-function mechanism is responsible for VAPB-induced ALS. Recently, a novel mutation in hVAPB (V234I has been identified but its pathogenic potential has not been assessed. We found that neuronal expression of the V234I mutant allele in Drosophila (DVAP-V260I induces defects in synaptic structure and microtubule architecture that are opposite to those associated with DVAP mutants and transgenic expression of other ALS-linked alleles. Expression of DVAP-V260I also induces aggregate formation, reduced viability, wing postural defects, abnormal locomotion behavior, nuclear abnormalities, neurodegeneration and upregulation of the heat-shock-mediated stress response. Similar, albeit milder, phenotypes are associated with the overexpression of the wild-type protein. These data show that overexpressing the wild-type DVAP is sufficient to induce the disease and that DVAP-V260I is a pathogenic allele with increased wild-type activity. We propose that a combination of gain- and loss-of-function mechanisms is responsible for VAPB-induced ALS.
ORF Alignment: NC_005788 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available gossypii ATCC 10895] ref|NP_986381.1| AGL286Cp ... [Eremothecium gossypii] ... Length = 122 ... Query: 201 ALNGFENTDPHTST...AFALGPEGPTQRNLDTHGXXXXXXXXXXXXXXXXXXXXLGLYSDMG 260 ... ALNGFENTDPHTSTAFALGPE...GPTQRNLDTHG ... LGLYSDMG Sbjct: 1 ... ALNGFENTDPHTSTAFALGPEGPTQRNLDT
National Research Council Canada - National Science Library
Hatch, Garrett L
2006-01-01
... -- $460 billion in grants, $360 billion in contracts, and $260 billion in direct and guaranteed loans -- accounting for nearly one-third of the federal government's total expenditures and obligations...
77 FR 26008 - Ocean Transportation Intermediary License; Applicants
2012-05-02
.... Forth-Matthews, President, Application Type: New OFF License. Azimuth Lines Inc. (OFF), 111 Ivy Lane.... (NVO), 1000 Lakes Drive, 260, West Covina, CA 91760, Officers: Larry Lee, Treasurer (Qualifying...
George, Asha S; Mehra, Vrinda; Scott, Kerry; Sriram, Veena
2015-01-01
Community participation is a major principle of people centered health systems, with considerable research highlighting its intrinsic value and strategic importance. Existing reviews largely focus on the effectiveness of community participation with less attention to how community participation is supported in health systems intervention research. To explore the extent, nature and quality of community participation in health systems intervention research in low- and middle-income countries. We searched for peer-reviewed, English language literature published between January 2000 and May 2012 through four electronic databases. Search terms combined the concepts of community, capability/participation, health systems research and low- and middle-income countries. The initial search yielded 3,092 articles, of which 260 articles with more than nominal community participation were identified and included. We further excluded 104 articles due to lower levels of community participation across the research cycle and poor description of the process of community participation. Out of the remaining 160 articles with rich community participation, we further examined 64 articles focused on service delivery and governance within health systems research. Most articles were led by authors in high income countries and many did not consistently list critical aspects of study quality. Articles were most likely to describe community participation in health promotion interventions (78%, 202/260), even though they were less participatory than other health systems areas. Community involvement in governance and supply chain management was less common (12%, 30/260 and 9%, 24/260 respectively), but more participatory. Articles cut across all health conditions and varied by scale and duration, with those that were implemented at national scale or over more than five years being mainstreamed by government. Most articles detailed improvements in service availability, accessibility and
Congenital broncho-oesophageal fistula
African Journals Online (AJOL)
1983-04-09
Apr 9, 1983 ... Rigid bronchoscopy performed under general anaesthesia .... Blackburn WR, Armour)' RA. Congenital esophago-pulmonary fistulas without esophageal atresia: an analysis of 260 fistulas in infants, children and adults.
76 FR 19119 - Agency Information Collection Activities: Certificate of Origin
2011-04-06
... keepers from the collection of information (total capital/startup costs and operations and maintenance... Respondent: 20. Estimated Number of Total Annual Responses: 2,260. Estimated Time per Response: 22 minutes...
Directory of Open Access Journals (Sweden)
Trzewik Aleksandra
2016-01-01
Full Text Available Among the numerous protocols that describe the extraction of DNA, those relating to the isolation of DNA from infected plants, are rare. This study describes a rapid and reliable method of extracting a high quality and quantity of DNA from rhododendron leaves artificially infected with Phytophthora cactorum, P. cambivora, P. cinnamomi, P. citrophthora, and P. plurivora. The use of the modified Doyle and Doyle protocol (1987 allowed us to obtain high quantity and quality DNA (18.26 μg from 100 mg of the fresh weight of infected leaves at the ratios of A260/280 and A260/230 - 1.83 and 1.72, respectively, suitable for conventional polymerase chain reaction (PCR and real-time PCR amplifications.
The NIKA2 Large Field-of-View Millimeter Continuum Camera for the 30-M IRAM Telescope
Monfardini, Alessandro
2018-01-01
We have constructed and deployed a multi-thousands pixels dual-band (150 and 260 GHz, respectively 2mm and 1.15mm wavelengths) camera to image an instantaneous field-of-view of 6.5arc-min and configurable to map the linear polarization at 260GHz. We are providing a detailed description of this instrument, named NIKA2 (New IRAM KID Arrays 2), in particular focusing on the cryogenics, the optics, the focal plane arrays based on Kinetic Inductance Detectors (KID) and the readout electronics. We are presenting the performance measured on the sky during the commissioning runs that took place between October 2015 and April 2017 at the 30-meter IRAM (Institute of Millimetric Radio Astronomy) telescope at Pico Veleta, and preliminary science-grade results.
Guo, Jian-Rong; Schnieder, F; Abd-Elsalam, K A; Verreet, J A
2005-01-01
A modified procedure using the commercial DNAzol reagent was successfully applied to extract genomic DNA from 25 fungal species. The DNA yield varied from 306 to 1,927 microg g(-1) dry mycelia and the A(260)/A(280) ratio from 1.59 to 1.93. Compared with the method of J.L. Cenis (Nucleic Acids Res. 1992, 20: 2380) this procedure generated a higher DNA yield from 17 species and a higher A(260)/A(280) ratio from 23 species. But for four species, Cenis (1992) method was more suitable. No inhibitor of polymerase chain reaction was evident for the DNA extracted by the modified procedure, whereas some inhibitors remained in DNA of eight species extracted by the previous method.
Mn-AlInN: a new diluted magnetic semiconductor
Energy Technology Data Exchange (ETDEWEB)
Majid, Abdul; Ali, Akbar [Quaid-i-Azam University, Advance Materials Physics Laboratory, Physics Department, Islamabad (Pakistan); Sharif, Rehana [University of Engineering and Technology, Department of Physics, Lahore (Pakistan); Zhu, J.J. [Chinese Academy of Sciences, State Key Laboratory on Integrated Optoelectronics, Institute of Semiconductors, Beijing (China)
2009-09-15
Mn ions have been incorporated into MOCVD grown Al{sub 1-x}In{sub x}N/GaN thin films by ion implantation to achieve the room temperature ferromagnetism in the samples. Magnetic characterizations revealed the presence of two ferromagnetic transitions: one has Curie points at {proportional_to}260 K and the other above room temperature. In-diffusion of indium caused by the Mn implantation leads to the partition of AlInN epilayer into two diluted magnetic semiconductor sub-layers depending on the Mn concentration. The Curie temperature of 260 K is assigned to the layer having lower concentration, whereas T{sub c} above room temperature is assumed to be associated to the layer having higher Mn concentration. (orig.)
Search Results | Page 19 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 181 - 190 of 260 ... Atlas of Islamic-World Science and Innovation. Historically, scholars and researchers from the Muslim world were leaders in the area of medicine, astronomy and mathematics. Project.
2013-02-11
... address: Atlanta Airports District Office, Attn: Aimee A. McCormick, Program Manager, 1701 Columbia Ave... McCormick, Program Manager, Atlanta Airports District Office, 1701 Columbia Ave., Suite 2-260, Atlanta, GA...
Magneto-plasmonics as a tool for magnetic field sensing
Czech Academy of Sciences Publication Activity Database
Vlček, J.; Lesňák, M.; Pištora, J.; Otipka, P.; Sobota, Jaroslav
2013-01-01
Roč. 58, č. 9 (2013), s. 260-264 ISSN 0447-6441 Institutional support: RVO:68081731 Keywords : plasmon resonance * magneto-optics * sensors * response factors Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering
Právnický elektronický slovník (PES)
Czech Academy of Sciences Publication Activity Database
Cvrček, František
2015-01-01
Roč. 154, č. 3 (2015), s. 247-260 ISSN 0231-6625 Institutional support: RVO:68378122 Keywords : legal language * legal dictionaries * linguistic analysis of legal texts Subject RIV: AG - Legal Sciences
75 FR 78617 - Final Flood Elevation Determinations
2010-12-16
.... Rockport Creek Approximately 2,300 feet +260 Unincorporated Areas of downstream of Martin Hot Spring County. Luther King Boulevard. Approximately 1,300 feet +263 downstream of Martin Luther King Boulevard. Town...
Search Results | Page 26 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 251 - 260 of 369 ... Corporate Social Responsibility in the Latin American Extractive Industry ... Its impact on national businesses, particularly micro, small and medium ... Experiment in Collaborative Learning Network for Enhanced ...
2012-08-20
...). Characterizing clients and how they found out about the CIS is essential to customer service, program planning...,123 Demographic 24,300 1 2/60 810 Questions. Smoking Cessation ``Quitline'' Clients: Reactive Service...
Tritium migration in the Twin Lake 260-metre natural-gradient dispersion test
International Nuclear Information System (INIS)
Killey, R.W.D.; Wills, C.A.; Moltyander, G.L.
1990-01-01
The experiment reported here is an expansion of studies of dispersive processes in an unconfined sand aquifer on the property of Chalk River Laboratories near Twin Lake, covering a 270 m flow path between the injection well and the groundwater discharge area. Previous experience had shown that the use of a non-reactive tracer that emits moderate-energy gamma rays provides much more information than can be gleaned from tracers that require actual water sample collection. At the time of this experiment non-reactive gamma-emitting tracers with half-life long enough to undertake the 270 m experiment had not been developed. Tritium was used so some information on large-scale dispersion phenomena could be collected and instrumentation would be properly placed for a subsequent experiment that would use a gamma-emitting tracer. Because of the scoping character of the experiment, only limited data were collected. The experiment involved the controlled injection of a relatively large (60 m 3 ) volume of water labelled with tritiated water, and the subsequent tracking of the slug during natural gradient convective transport to the discharge area. This paper describes the hydrogeologic setting and the experimental and analytical methods, and presents and discusses the findings. (L.L.) (8 refs., 11 figs., tab.)
Permian-Triassic Tethyan realm reorganization: Implications for the outward Pangea margin
Riel, Nicolas; Jaillard, Etienne; Martelat, Jean-Emmanuel; Guillot, Stéphane; Braun, Jean
2018-01-01
We present a new conceptual model to explain the first order Permian-Triassic evolution of the whole > 30 000 km long Pangea margin facing the Panthalassa ocean. Compilation of available geological, geochemical, geochronogical and paleomagnetic data all along this system allowed us to distinguish three part of the margin: western Laurentia, western Gondwana and eastern Gondwana. These segments record distinct tectonic and magmatic events, which all occur synchronously along the whole margin and correlate well with the main geodynamic events of this period, i.e. subduction of the Paleotethys mid-ocean ridge at 310-280 Ma, opening of the Neotethys at 280-260 Ma, counterclockwise rotation of Pangea at 260-230 Ma and closure of the Paleotethys at 230-220 Ma. Between 260 and 230 Ma, the reorganization of the Tethyan realm triggered the up to 35° rotation of Pangea around an Euler pole located in northernmost South America. This implied both an increase and a decrease of the convergence rate between the margin and the Panthalassa ocean, north and south of the Euler pole, respectively. Thus, the Permian-Triassic Pangean margin was marked: in western Laurentia by marginal sea closure, in western Gondwana by widespread bimodal magmatic and volcanic activity, in eastern Gondwana by transpressive orogenic phase. Therefore, we propose that the Permian-Triassic evolution of the outward margin of Pangea was controlled by the Tethyan realm reorganization.
Genomic comparison of virulent and non-virulent Streptococcus agalactiae in fish.
Delannoy, C M J; Zadoks, R N; Crumlish, M; Rodgers, D; Lainson, F A; Ferguson, H W; Turnbull, J; Fontaine, M C
2016-01-01
Streptococcus agalactiae infections in fish are predominantly caused by beta-haemolytic strains of clonal complex (CC) 7, notably its namesake sequence type (ST) 7, or by non-haemolytic strains of CC552, including the globally distributed ST260. In contrast, CC23, including its namesake ST23, has been associated with a wide homeothermic and poikilothermic host range, but never with fish. The aim of this study was to determine whether ST23 is virulent in fish and to identify genomic markers of fish adaptation of S. agalactiae. Intraperitoneal challenge of Nile tilapia, Oreochromis niloticus (Linnaeus), showed that ST260 is lethal at doses down to 10(2) cfu per fish, whereas ST23 does not cause disease at 10(7) cfu per fish. Comparison of the genome sequence of ST260 and ST23 with those of strains derived from fish, cattle and humans revealed the presence of genomic elements that are unique to subpopulations of S. agalactiae that have the ability to infect fish (CC7 and CC552). These loci occurred in clusters exhibiting typical signatures of mobile genetic elements. PCR-based screening of a collection of isolates from multiple host species confirmed the association of selected genes with fish-derived strains. Several fish-associated genes encode proteins that potentially provide fitness in the aquatic environment. © 2014 John Wiley & Sons Ltd.
Efficacy of Inactivation of Human Enteroviruses by Multiple ...
Ultraviolet (UV) light has been successfully used for treating a broad suite of pathogens without the concomitant formation of carcinogenic disinfection by-products (DBPs). However, conventional mercury UV lamps have some practical limitations in water treatment applications, such as the inefficiency of energy consumption and more importantly potential mercury contamination upon disposal of the lamps. The recent invention of a novel light-emitting-diodes (LED) device generating germicidal UV wavelengths could eliminate the aforementioned limitations. In this study, we investigated the efficacy of multiple-wavelength UV LEDs for inactivating USEPA contaminant candidate list (CCL) RNA enteroviruses. Of 12 enterovirus species, serotype representatives of the four human enteric species (enterovirus A-D) such as coxsackievirus A10 (CVA10), echovirus 30 (Echo30), poliovirus 1 (PV1), and enterovirus 70 (EV70) respectively were selected as testing RNA viruses. Bench-scale performance evaluation was conducted using a collimated beam (CB) apparatus with LEDs emitting at 260 nm, 280 nm, and the combination of 260|280 nm together, as well as a monochromatic low-pressure (LP) UV lamp at 254 nm for comparison. The CB tests were performed with mixed stocks of four viruses. Infectious virus concentrations were determined using an integrated cell culture reverse transcriptase quantitative PCR (ICC-RTqPCR). The 260 nm LED was most effective at inactivating all enteroviruses teste
TNFalpha -308 C-->t and -863 C-->a polymorphisms and spermiogram characteristics.
Kurz, Christine; Bentz, Eva-Katrin; Denschlag, Dominik; Berner, Isabel; Keck, Christoph; Tempfer, Clemens B; Pietrowski, Detlef
2008-01-01
Genetic factors may play a role in male infertility. In a prospective case-control study, we assessed the allele and genotype frequencies of the TNFalpha -308 C-->T and -863 C-->A polymorphisms, detected by PCR of sperm DNA, of 577 Caucasian men recruited in an infertility clinic. Semen sampling was performed and spermiogram results were correlated to genetic data. The allele frequencies of the TNFalpha -308 C-->T and -863 C-->A polymorphisms were not significantly different between non-normozoospermic (n = 447) and normozoospermic (n = 130) men [758/894 (85%) and 134/894 (15%) vs. 213/269 (82%) and 43/260 (18%), p = 0.5, odds ratio (OR) 1.1, 95% confidence interval (CI) 0.74-1.76, and 749/894 (84%) and 145/894 (16%) vs. 212/260 (82%) and 48/260 (18%), p = 0.4, OR 1.2, 95% CI 0.78-1.76, respectively]. The genotype frequencies of the TNFalpha -308 C-->T and -863 C-->A polymorphisms were also not significantly different between non-normozoospermic and normozoospermic men. In addition, mutant alleles were not overrepresented in subgroups of men with the oligoasthenoteratozoospermia syndrome and asthenozoospermia. The TNFalpha -308 C-->T and -863 C-->A polymorphisms are not associated with spermiogram characteristics and do not represent molecular markers for genetic susceptibility to male infertility. Copyright 2008 S. Karger AG, Basel.
International Nuclear Information System (INIS)
Suresh, K.; Poornachandra Rao, N.V.; Murthy, K.V.R.
2014-01-01
Powder phosphors of 1 mol% Eu 3+ - and Eu 2+ -doped strontium cerium oxide (Sr 2 CeO 4 ) were synthesized by standard solid-state reaction method. Eu 3+ - and Eu 2+ -doped Sr 2 CeO 4 phosphors fired at 1100 ℃ for 2 h were analysed by X-ray diffraction (XRD) and photoluminescence (PL) techniques. The XRD patterns confirm that the obtained phosphors are a single phase of Sr 2 CeO 4 composed of orthorhombic structure. Room temperature PL excitation spectrum of air-heated Sr 2 CeO 4 : Eu phosphor has exhibited bands at 260, 280 and 350 nm. Whereas the excitation spectrum of Sr 2 CeO 4 : Eu phosphor heated under reducing (carbon) atmosphere exhibited single broadband range from 260 to 390 nm. The (PL) emission peaks of both the phosphors at 467 (blue), 537 (green) and 616 nm (red) generate white light under 260, 280 and 350 nm excitation wavelengths. The Commission International de l'Eclairage (CIE) colour coordinates conforms that these phosphors emitting white light. The results reveal that these phosphors are multifunctional phosphors which emit white light under these excitations that they could be used as white components for display and lamp devices and as well as possible good light-conversion phosphor LEDs under near-ultraviolet (nUV) chip. (author)
Eating disorders: a hidden phenomenon in outpatient mental health?
Fursland, Anthea; Watson, Hunna J
2014-05-01
Eating disorders are common but underdiagnosed illnesses. Help-seeking for co-occurring issues, such as anxiety and depression, are common. To identify the prevalence of eating problems, using the SCOFF, and eating disorders when screening positive on the SCOFF (i.e., ≥2), among patients seeking help for anxiety and depression at a community-based mental health service. Patients (N = 260) consecutively referred and assessed for anxiety and depression treatment were administered the SCOFF screening questionnaire and a semi-structured standardized diagnostic interview during routine intake. 18.5% (48/260) scored ≥2 on the SCOFF, indicating eating problems. Of these, 41% (19/48) met criteria for an eating disorder. Thus, overall, 7.3% (19/260) of the sample met criteria for a DSM-IV eating disorder. Those scoring ≥2 on the SCOFF were more likely to: be female (p = 0.001), younger (p = 0.003), and have a history of self-harm (p eating disorders are a hidden phenomenon in general outpatient mental health. By using a standardized diagnostic interview to establish diagnosis rather than self- or staff-report, the study builds on limited previous findings. The naturalistic study setting shows that screening for eating disorders can be easily built into routine intake practice, and successfully identifies treatment need. Copyright © 2013 Wiley Periodicals, Inc.
Current research efforts with Bacillus thuringiensis
Normand R. Dubois
1991-01-01
The bioassay of 260 strains of Bacillus thuringiensis (Bt) and 70 commercial preparations show that regression coefficient estimates may be as critical as LC5O estimates when evaluating them for future consideration.
2011-06-28
... (HMB), North Monterey Bay (NMB; containing Santa Cruz/Soquel sites), South Monterey Bay (SMB... year number of events per year California sea lions Harbor seals HMB July 4 100 (400) 65 (260) NMB...
Roka, Margarita; Goñi, Pilar; Rubio, Encarnación; Clavel, Antonio
2012-08-15
The prevalence of intestinal parasitic diseases and their associated factors has been investigated in HIV populations from the Island of Bioko, Equatorial Guinea. The feces of 310 participants from the island of Bioko (260 HIV-positive and 50 HIV-negative) were analyzed by microscopic observation. Immunochromatography was also used to diagnose Giardia, Entamoeba histolytica and Cryptosporidium spp. In addition, patients were asked for sociodemographic, economic and academic status, and CD4+ T cell counts were recorded. For HIV-positive patients, the prevalence of infection by intestinal parasites was 81.5% (212/260), 83.8% (218/260) by pathogenic helminths and 55.4% (168/260) by pathogenic protozoa (E. histolytica/dispar and Giardia duodenalis). Gender association was found between the infection by Ascaris and Schistosoma, a higher proportion being found in women; and between Entamoeba and the place of residence, a higher proportion being observed in the urban belt. Strongyloides stercoralis and Chilomastix mesnili appeared only in the people of this group, all the cases of Chilomastix being in females. For HIV-negative participants, the prevalence of infection by intestinal parasites was 74.0% (37/50), 90.0% (45/50) by pathogenic helminths and 66.0% (43/50) by pathogenic protozoa. Gender, educational level and low hygiene were associated with intestinal parasitic infection. When comparing the two groups (HIV-positive and HIV-negative), statistical association between HIV co-infection and infection by Giardia and Entamoeba was found. Diarrhea was also associated with intestinal parasitic infection in the HIV-positive group. Not only do our findings reflect high rates of intestinal parasitic infections in HIV-positive people, but also in the HIV-negative group, suggesting a closer relationship between sanitary status and living conditions than with immune status, and thus they highlight the need to carry out health education policies in the population. In addition
Temperature and environmentally assisted cracking in low alloy steel
International Nuclear Information System (INIS)
Auten, T.A.; Monter, J.V.
1995-04-01
Environmental assisted cracking (EAC) can be defined as the propagation of fatigue cracks in water at rates from 3 to over 40 times the growth rates in air. For low alloy steels with sulfur contents > 0.0125% by weight, EAC is normal behavior in the 240 to 290C range. However, literature yields mixed results for low alloy steels with compositions just below this sulfur level; some reports indicate EAC while others do not. Also, several authors have reported an increased tendency toward EAC when the water temperatures were lowered. In the present work, five ASTM A 508 Class 2 forgings with ladle and check analyses that ranged from 0.010 to 0.019 wt% S were tested in high purity deaerated water in the temperature range of 93 to 260C. At 260C these forgings did not exhibit EAC, reinforcing earlier results for two similar forgings. This broad sampling indicates strong resistance to EAC for this class of forging at 260C. On the other hand, EAC occurred consistently in the three of these forgings that were tested below 204C, provided the test conditions (loading frequency, ΔK, and R) were high enough to produce a high baseline fatigue crack growth rate (FCGR), where the baseline FCGR is that expected in air. At 149C, EAC occurred at test conditions that combined to yield a baseline FCGR greater than ∼2E-6 mm/s. At 204, 121, and 93C, this critical crack growth rate appeared to shift to lower baseline values. The EAC that occurred at lower temperatures was a factor of 3 to 12 times higher than baseline air rates, which was not as strong as the effect for higher sulfur steels at 240 to 290C. Also, no plateau in the growth rates occurred as it does with the higher sulfur steels. In another approach, EAC was induced at 93 and at 260C by raising the dissolved oxygen content of the water from 15 ppb
Biochemical and clinical profiles of 52 Tunisian patients affected by Zellweger syndrome
Directory of Open Access Journals (Sweden)
Fahmi Nasrallah
2017-12-01
Full Text Available Background: Zellweger syndrome (ZS is a peroxisome biogenesis disorder attributed to a mutation of the PEX genes family. The incidence of this disease in Africa and the Arab world remains unknown. This contribution is aimed at describing the clinical phenotype and biochemical features in Tunisian patients with ZS in order to improve the detection and management of this severe disorder. Methods: A total of 52 patients diagnosed with ZS and 60 age- and sex-matched healthy controls were included in this study. Patients were recruited during the past 21 years, and the diagnosis of ZS was based on clinical and biochemical characteristics. Plasma very long chain fatty acids (VLCFA were analyzed using capillary gas chromatography. The estimated incidence of ZS was calculated using the HardyâWeinberg formula. Results: The estimated incidence of ZS is 1/15,898 in Tunisia. Age at diagnosis varied between 3 days and 18 months. Severe neurological syndrome, polymalformative features, and hepatodigestive signs were observed in 100%, 67.9%, and 32% of patients, respectively. Values for plasma C26:0 and C26:0/C22:0 and C24:0/C22:0 ratios were noticeably higher in ZS patients than in controls. Distributions of values were completely different for C26:0 (0.10â0.37 vs. 0.001â0.009, C26:0/C22:0 ratio (0.11â1.29 vs. 0.003â0.090, and C24:0/C22:0 ratio (1.03â3.18 vs. 0.4â0.90 in ZS patients versus controls, respectively. Conclusions: This study highlights the high incidence of ZS in Tunisia and the possibility of simple and reliable biochemical diagnosis, thus permitting early genetic counseling for families at risk. Key Words: gas chromatography, hypotonia, peroxisomal disorder, very long chain fatty acids, Zellweger syndrome
Temperature and environmentally assisted cracking in low alloy steel
International Nuclear Information System (INIS)
Auten, T.A.; Monter, J.V.
1995-01-01
Environmentally assisted cracking (EAC) can be defined as the propagation of fatigue cracks in water at rates that are anywhere from 3 to over 40 times the growth rates expected in air. In the present work, five ASTM A 508 Class 2 forgings with ladle and check analyses that ranged from 0.010 to 0.019 wt% S were tested in high purity deaerated water in the temperature range of 93 to 260 C. At 260 C these forgings did not undergo EAC, reinforcing earlier results for two similar forgings. This broad sampling indicates a strong resistance to EAC for this class of forging at 260 C. On the other hand, EAC occurred consistently in the three of these forgings that were tested below 204 C, provided the test conditions were high enough to produce a high baseline fatigue crack growth rate (FCGR), where the baseline FCGR is that expected in air. At 149 C, EAC occurred at test conditions that combined to yield a baseline FCGR greater than ∼2E-6 mm/s. At 204, 121, and 93 C, this ''critical crack growth rate'' appeared to shift to lower baseline values. The EAC that occurred at lower temperatures was a factor of 3 to 12 times higher than baseline air rates, which was not as strong as the effect for higher sulfur steels at 240 to 290 C. Also, no plateau in the growth rates occurred as it does with the higher sulfur steels. In another approach, EAC was induced at 93 and at 260 C by raising the dissolved oxygen content of the water from 15 ppb. In this case, the EAC growth rates decreased to non-EAC levels when the oxygen supply was shut off. The oxygen-related EAC occurred over a broader range of baseline growth rates than found for the EAC driven by the baseline crack tip speed. Again, this can be rationalized by the buildup of sulfur in the crack tip water, which can be associated with the higher corrosion potential of the bulk water
Hussain, Fahad Ahmed; Mail, Noor; Shamy, Abdulrahman M; Suliman, Alghamdi; Saoudi, Abdelhamid
2016-05-08
Image quality is a key issue in radiology, particularly in a clinical setting where it is important to achieve accurate diagnoses while minimizing radiation dose. Some computed tomography (CT) manufacturers have introduced algorithms that claim significant dose reduction. In this study, we assessed CT image quality produced by two reconstruction algorithms provided with GE Healthcare's Discovery 690 Elite positron emission tomography (PET) CT scanner. Image quality was measured for images obtained at various doses with both conventional filtered back-projection (FBP) and adaptive statistical iterative reconstruction (ASIR) algorithms. A stan-dard CT dose index (CTDI) phantom and a pencil ionization chamber were used to measure the CT dose at 120 kVp and an exposure of 260 mAs. Image quality was assessed using two phantoms. CT images of both phantoms were acquired at tube voltage (kV) of 120 with exposures ranging from 25 mAs to 400 mAs. Images were reconstructed using FBP and ASIR ranging from 10% to 100%, then analyzed for noise, low-contrast detectability, contrast-to-noise ratio (CNR), and modulation transfer function (MTF). Noise was 4.6 HU in water phantom images acquired at 260 mAs/FBP 120 kV and 130 mAs/50% ASIR 120 kV. The large objects (fre-quency ASIR, compared to 260 mAs/FBP. The application of ASIR for small objects (frequency >7 lp/cm) showed poor visibility compared to FBP at 260 mAs and even worse for images acquired at less than 130 mAs. ASIR blending more than 50% at low dose tends to reduce contrast of small objects (frequency >7 lp/cm). We concluded that dose reduction and ASIR should be applied with close attention if the objects to be detected or diagnosed are small (frequency > 7 lp/cm). Further investigations are required to correlate the small objects (frequency > 7 lp/cm) to patient anatomy and clinical diagnosis.
77 FR 46752 - Agency Information Collection Activities OMB Responses
2012-08-06
... Pollution Contingency Plan (NCP)(Renewal); Withdrawn from OMB on 07/19/ 2012 while existing approved... change. EPA ICR Number 2310.02; RCRA Definition of Solid Waste (Renewal); 40 CFR parts 260 and 261; was...
African Journal of Biotechnology - Vol 3, No 5 (2004)
African Journals Online (AJOL)
Improving bambara groundnut productivity using gamma irradiation and in vitro techniques · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. HK Adu-Dapaah, RS Sangwan, 260-265 ...
Search Results | Page 24 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 231 - 240 of 260 ... Economic Reform, Firm Survival and Competitiveness (Middle ... Release of BSR's "Child Labour in Myanmar's Garment Sector" Report ... However, data on entrepreneurship and the private enterprise sector in the ...
Search Results | Page 6 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
2009-01-01
Results 51 - 60 of 260 ... Job quality in Jordan : an analysis based on a job quality index (JQI). Published date. January 1, 2009. Papers. WAGES EGYPT LABOUR MARKET MANUFACTURING EXPORT ORIENTED INDUSTRIES TRADE LIBERALIZATION ...
Search Results | Page 26 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
2009-01-01
Results 251 - 260 of 1368 ... Job quality in Jordan : an analysis based on a job quality index (JQI). Published date. January 1, 2009. Papers. WAGES EGYPT LABOUR MARKET MANUFACTURING EXPORT ORIENTED INDUSTRIES TRADE LIBERALIZATION ...
Proposal of new Oβ oxidation criterion for new types of the Zr1Nb alloy of fuel claddings
Czech Academy of Sciences Publication Activity Database
Negyesi, M.; Klouček, V.; Lorinčík, Jan; Novotný, L.; Kabátová, J.; Linhart, S.; Adámek, J.; Siegl, J.; Vrtílková, V.
2013-01-01
Roč. 261, August (2013), s. 260-268 ISSN 0029-5493 Institutional support: RVO:67985882 Keywords : Oxygen * Experimental methods * Kinetics equation Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.972, year: 2013
Search Results | Page 26 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 251 - 260 of 875 ... ... "Planning and Managing Sustainable Cities: From Research to Practice," focused ... has contributed to the development of regional knowledge and ... of and recommendations for the functioning of the DIRSI Network.
2012-05-24
...). Characterizing clients and how they found out about the CIS is essential to customer service, program planning... 1/60 1,123 Demographic 24,300 1 2/60 810 Questions. Smoking Cessation ``Quitline'' Clients Reactive...
Search Results | Page 2 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 11 - 20 of 260 ... Health information systems or adolescent sexual and ... Real momentum is building around the Sustainable Development Goals (SDGs) as ... an opportunity to promote debate on key economic and development issues.
Ginger Essential Oil Ameliorates Cisplatin-Induced Nephrotoxicity in ...
African Journals Online (AJOL)
HP
Among multiple mechanisms of action, the induction of .... levels using a commercial kit (Gold Analisa®) for calculating the urinary ... ultraviolet light absorbance at 260 nm using a. Nanodrop .... ratio rose following GEO administration. These.
Ecotoxicity and genotoxicity assessment of cytotoxic antineoplastic drugs and their metabolites
Czech Academy of Sciences Publication Activity Database
Zounková, R.; Kovalová, L.; Bláha, Luděk; Dott, W.
2010-01-01
Roč. 81, č. 2 (2010), s. 253-260 ISSN 0045-6535 Institutional research plan: CEZ:AV0Z60050516 Keywords : cytotoxic drugs * ecotoxicity * metabolite Subject RIV: EF - Botanics Impact factor: 3.155, year: 2010
Dynamic scaling and kinetic roughening of poly(ethylene) islands grown by vapor phase deposition
Czech Academy of Sciences Publication Activity Database
Choukourov, A.; Melnichuk, I.; Gordeev, I.; Kylián, O.; Hanuš, J.; Kousal, J.; Solař, P.; Hanyková, L.; Brus, Jiří; Slavínská, D.; Biederman, H.
2014-01-01
Roč. 565, 28 August (2014), s. 249-260 ISSN 0040-6090 Institutional support: RVO:61389013 Keywords : poly(ethylene) * physical vapor deposition * island growth Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.759, year: 2014
Search Results | Page 25 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 241 - 250 of 260 ... ... although the brand of the bottled water and how it is stored affected its quality. ... Nigerian women reap benefits from indigenous vegetables ... methods: learning routes, learning alliances, and innovation contests.
Transformations of Aortic Arches During Metamorphosis of the Spade-Foot Toad, Pelobates fuscus
Czech Academy of Sciences Publication Activity Database
Majorová, H.; Roček, Zbyněk
2004-01-01
Roč. 260, č. 3 (2004), s. 309 ISSN 0362-2525. [International Congress of Vertebrate Morphology /7./. 27.07.2004-01.08.2004, Boca Raton] Keywords : Anura * Circulatory System * Metamorphosis Subject RIV: EA - Cell Biology
Studies on supramolecular gel formation using DOSY NMR
Czech Academy of Sciences Publication Activity Database
Nonappa, N.; Šaman, David; Kolehmainen, E.
2015-01-01
Roč. 53, č. 4 (2015), s. 256-260 ISSN 0749-1581 Institutional support: RVO:61388963 Keywords : DOSY * VT NMR * gel * diffusion coefficients Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.226, year: 2015
Search Results | Page 16 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 151 - 160 of 260 ... Women's economic empowerment can improve if globalization and ... Areas Network Phase III: Devolution to the American University of Beirut ... in advancing civic participation and collective action in the Arab region.
Afterparty Baselis / Maria-Kristiina Soomre
Soomre, Maria-Kristiina, 1978-
2001-01-01
Moodsa ja kaasaegse kunsti messist "Art 32 Basel" 13.-18. VI. Kutsutud esinejate näitusel "Art Unlimited" osalesid Ilja Kabakov, Richard Serra, James Turrell, Pipilotti Rist, Vanessa Beecroft, Atelier van Lieshout. Väljapanekud 260 galeriilt.
Search Results | Page 12 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
2008-01-01
Results 111 - 120 of 260 ... ... natural resources (NR) management that contribute to mitigated health risks and sustained agro-ecosystems in highland communities. Published date. January 1, 2008. Reports. COMMUNICATION POLICY COMPETITIVENESS TELECOMMUNICATIONS CONSUMER DEMAND PRICING AFRICA ...
Use of the industrial yeast Candida utilis for cadmium sorption
Czech Academy of Sciences Publication Activity Database
Kujan, Petr; Prell, Aleš; Šafář, Hynek; Sobotka, Miroslav; Řezanka, Tomáš; Holler, Pavel
2006-01-01
Roč. 51, č. 4 (2006), s. 257-260 ISSN 0015-5632 Institutional research plan: CEZ:AV0Z50200510 Keywords : candida utilis * cadmium * yeast Subject RIV: EE - Microbiology, Virology Impact factor: 0.963, year: 2006
Search Results | Page 26 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 251 - 260 of 439 ... Institutional Support to Policy Research Organizations in India ... In South Asia, people's social, political and cultural aspirations often get ... large numbers of Chinese migrants to Southeast Asia and the United States.
Commentary on the Discovery of the Beautiful Style Michigan Madonna
Czech Academy of Sciences Publication Activity Database
Hlobil, Ivo
2016-01-01
Roč. 64, 3/4 (2016), s. 256-260 ISSN 0049-5123 Institutional support: RVO:68378033 Keywords : gothic sculpture * Bohemian Beautiful Style * Madonna-torso * Museum Ann Arbor * Michigan ( USA ) Subject RIV: AL - Art, Architecture, Cultural Heritage
Czech Academy of Sciences Publication Activity Database
Chýlková, J.; Fadrná, Renata
2004-01-01
Roč. 98, č. 5 (2004), s. 260-263 ISSN 0009-2770 R&D Projects: GA AV ČR KSK4040110 Keywords : thiodiglykolic acid * TDGA * isotachophores Subject RIV: CG - Electrochemistry Impact factor: 0.348, year: 2004
2003 Reson 8101ER Multibeam Sonar Data from Cruise OES-03-07/AHI-03-07, Data Set Name Rota.
National Oceanic and Atmospheric Administration, Department of Commerce — Reson 8101ER multibeam Data were collected between 16-17 September 2003 (JD 259-260) aboard NOAA Survey Launch Acoustic Habitat Investigator (AHI) at Rota Island in...
Search Results | Page 8 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 71 - 80 of 260 ... Journal articles ... Charging for computer networks at higher educational institutions in developing countries ... support this important resource, as a viable tool for teaching and research, is undermined by lack of funding.
Search Results | Page 22 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 211 - 220 of 260 ... Strengthening CRTD-A's Organizational and Program Capacity (Lebanon) ... with a solid history of collaboration with IDRC at the project level. ... a major component of social structure throughout the Middle East, ...
Czech Academy of Sciences Publication Activity Database
Ettrich, Rüdiger
2004-01-01
Roč. 271, č. 19 (2004), s. 3923-3939 ISSN 0014-2956 Institutional research plan: CEZ:AV0Z5011922; MSM113100003 Keywords : phosphatase Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.260, year: 2004
Search Results | Page 5 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
2009-01-01
Results 41 - 50 of 260 ... Towards evidence-based policy in Africa : ICT access and usage in 17 African countries. Published date. January 1, 2009. Papers. WOMEN'S ADVANCEMENT SELF-EMPLOYMENT MIDDLE EAST BUSINESS MANAGEMENT WOMEN ENTREPRENEURSHIP Gender ...
Global Journal of Pure and Applied Sciences - Vol 17, No 3 (2011)
African Journals Online (AJOL)
BE Job, E Ekpenyong, NU Bassey, 255-260 ... A comparative study of direct and indirect solar drying of mango · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT ... Physico-chemical properties, energy, mineral, vitamin and sensory ...
2017-2018 Travel Expense Reports for Dominique Corti, Governor
International Development Research Centre (IDRC) Digital Library (Canada)
SD
07-11. Destination(s):. Kenya, Uganda and Tanzania. Airfare: $5,319.87. Other. Transportation: $82.43. Accommodation: $2,107.26. Meals and. Incidentals: $317.46. Other: $260.82. Total: $8,087.84. Comments: Residence in Milan, Italy.
National Oceanic and Atmospheric Administration, Department of Commerce — A moored thermistor chain was deployed about a mile south of Honolulu Harbor in waters of about 260 feet depth. The instrument was in operation from August 1997 -...
Život se sourozencem s mentálním postižením: kritické momenty, zdroje zvládání a osobní růst
Czech Academy of Sciences Publication Activity Database
Štěpánová, M.; Blatný, Marek
2009-01-01
Roč. 53, č. 3 (2009), s. 241-260 ISSN 0009-062X Institutional research plan: CEZ:AV0Z70250504 Keywords : coping * life course * posttraumatic growth Subject RIV: AN - Psychology Impact factor: 0.226, year: 2009
20 CFR 641.535 - What services must grantees/subgrantees provide to participants?
2010-04-01
... been performed and an IEP developed under title I of WIA, the WIA IEP will satisfy the requirement for an SCSEP assessment and IEP (see § 641.260) and updating the IEPs as necessary to reflect information...
Search Results | Page 26 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 251 - 260 of 8491 ... ... to foster effective women's leadership for inclusive policymaking. “Women supporting Women” is an applied research project led by Fundación Democracia y ... Addressing the Barriers to Young Women's Economic ...
Energy Technology Data Exchange (ETDEWEB)
Mizandari, Malkhaz [Tbilisi State Medical University, Department of Radiology (Georgia); Pai, Madhava, E-mail: madhava.pai@imperial.ac.uk; Xi Feng [Imperial College, London, Hammersmith Hospital Campus, Department of Surgery (United Kingdom); Valek, Vlastimil; Tomas, Andrasina [University Hospital Brno Bohunice, Department of Radiology (Czech Republic); Quaretti, Pietro [IRCCS Policlinico San Matteo, Department of Radiology (Italy); Golfieri, Rita; Mosconi, Cristina [University of Bologna, Department of Radiology, Policlinico S. Orsola-Malpighi (Italy); Ao Guokun [The 309 Hospital of Chinese PLA, Department of Radiology (China); Kyriakides, Charis [Imperial College, London, Hammersmith Hospital Campus, Department of Surgery (United Kingdom); Dickinson, Robert [Imperial College London, Department of Bioengineering (United Kingdom); Nicholls, Joanna; Habib, Nagy, E-mail: nagy.habib@imperial.ac.uk [Imperial College, London, Hammersmith Hospital Campus, Department of Surgery (United Kingdom)
2013-06-15
Purpose. Previous clinical studies have shown the safety and efficacy of this novel radiofrequency ablation catheter when used for endoscopic palliative procedures. We report a retrospective study with the results of first in man percutaneous intraductal radiofrequency ablation in patients with malignant biliary obstruction. Methods. Thirty-nine patients with inoperable malignant biliary obstruction were included. These patients underwent intraductal biliary radiofrequency ablation of their malignant biliary strictures following external biliary decompression with an internal-external biliary drainage. Following ablation, they had a metal stent inserted. Results. Following this intervention, there were no 30-day mortality, hemorrhage, bile duct perforation, bile leak, or pancreatitis. Of the 39 patients, 28 are alive and 10 patients are dead with a median survival of 89.5 (range 14-260) days and median stent patency of 84.5 (range 14-260) days. One patient was lost to follow-up. All but one patient had their stent patent at the time of last follow-up or death. One patient with stent blockage at 42 days postprocedure underwent percutaneous transhepatic drain insertion and restenting. Among the patients who are alive (n = 28) the median stent patency was 92 (range 14-260) days, whereas the patients who died (n = 10) had a median stent patency of 62.5 (range 38-210) days. Conclusions. In this group of patients, it appears that this new approach is feasible and safe. Efficacy remains to be proven in future, randomized, prospective studies.
Assessment of digital literacy and use of smart phones among Central Indian dental students.
Saxena, Payal; Gupta, Saurabh Kumar; Mehrotra, Divya; Kamthan, Shivam; Sabir, Husain; Katiyar, Pratibha; Sai Prasad, S V
2018-01-01
Education has largely been digitalized. More so, for professional education, keeping updated in this fast paced world has become a necessary requisite and dentistry has not been left untouched. This cross sectional questionnaire based study aimed to assess the digital literacy and smartphone usage amongst the 260 Central Indian dental students including their perspicacity about smartphone/internet usage for learning purposes. The students' attitude for implementation of digital technology in study programs/education system was also evaluated. The questionnaire was distributed among total 260 dental students from different dental institutes of Central India. The data was collected and analyzed using SPSS software. Out of 260 students, 250 were internet users, out of which 56% had internet access all time. 94.23% students owned a smartphone. 46.53% (114/245) students had some app related to the dentistry in their smartphone device. The commonest site for surfing related to knowledge seeking was google scholar (72%) followed by Pubmed and others. Nearly 80% dental students believed that social media helps them in their professional course studies. Post graduate students showed statistitically significant difference from undergraduates and interns in terms of knowledge of keywords, dental apps and reading research journals. 89.23% students were keen for implementation of e-learning in their curriculum. This study reflects willingness of dental students to adopt digital revolution in dental education which in turn may present an opportunity for educators and policy makers to modify educational methods and thereby advance student's current learning approaches.
García-Ben, Antonio; Kamal-Salah, Radua; García-Basterra, Ignacio; Gonzalez Gómez, Ana; Morillo Sanchez, María José; García-Campos, Jose Manuel
2017-05-01
To investigate the posterior anatomical structure of pathologically myopic eyes with dome-shaped macula and inferior staphyloma using spectral domain optical coherence tomography (SD-OCT). Our database of 260 pathologically myopic eyes was analyzed retrospectively to identify patients with dome-shaped macula and inferior staphyloma. All patients underwent vertical and horizontal SD-OCT scans across the central fovea, with three-dimensional macular map reconstruction. Best-corrected visual acuity, axial length, and choroidal thickness measurements were recorded. The macular bulge height was also analyzed in eyes with dome-shaped macula. In the three-dimensional images, the symmetry and orientation of the main plane of the inward incurvation of the macula were examined. Twenty-eight (10.7%) of the 260 pathologically myopic eyes had dome-shaped macula of one of three different types: a round radially symmetrical dome (eight eyes, 28.5%), a horizontal axially symmetrical oval-shaped dome (15 eyes, 53.5%), or a vertical axially symmetrical oval-shaped dome (five eyes, 17.8%). The macular bulge height was significantly greater in horizontal oval-shaped dome eyes (p = 0.01, for each comparison). Inferior posterior staphylomas were observed in ten (3.8%) of the 260 pathologically myopic eyes with asymmetrical macular bends. Vertical and horizontal OCT sectional scanning in combination with three-dimensional macular map reconstruction provides important information for understanding the posterior anatomical structure of dome-shaped macula and inferior staphyloma in pathologically myopic eyes.
The new MCNP6 depletion capability
International Nuclear Information System (INIS)
Fensin, M. L.; James, M. R.; Hendricks, J. S.; Goorley, J. T.
2012-01-01
The first MCNP based in-line Monte Carlo depletion capability was officially released from the Radiation Safety Information and Computational Center as MCNPX 2.6.0. Both the MCNP5 and MCNPX codes have historically provided a successful combinatorial geometry based, continuous energy, Monte Carlo radiation transport solution for advanced reactor modeling and simulation. However, due to separate development pathways, useful simulation capabilities were dispersed between both codes and not unified in a single technology. MCNP6, the next evolution in the MCNP suite of codes, now combines the capability of both simulation tools, as well as providing new advanced technology, in a single radiation transport code. We describe here the new capabilities of the MCNP6 depletion code dating from the official RSICC release MCNPX 2.6.0, reported previously, to the now current state of MCNP6. NEA/OECD benchmark results are also reported. The MCNP6 depletion capability enhancements beyond MCNPX 2.6.0 reported here include: (1) new performance enhancing parallel architecture that implements both shared and distributed memory constructs; (2) enhanced memory management that maximizes calculation fidelity; and (3) improved burnup physics for better nuclide prediction. MCNP6 depletion enables complete, relatively easy-to-use depletion calculations in a single Monte Carlo code. The enhancements described here help provide a powerful capability as well as dictate a path forward for future development to improve the usefulness of the technology. (authors)
The New MCNP6 Depletion Capability
International Nuclear Information System (INIS)
Fensin, Michael Lorne; James, Michael R.; Hendricks, John S.; Goorley, John T.
2012-01-01
The first MCNP based inline Monte Carlo depletion capability was officially released from the Radiation Safety Information and Computational Center as MCNPX 2.6.0. Both the MCNP5 and MCNPX codes have historically provided a successful combinatorial geometry based, continuous energy, Monte Carlo radiation transport solution for advanced reactor modeling and simulation. However, due to separate development pathways, useful simulation capabilities were dispersed between both codes and not unified in a single technology. MCNP6, the next evolution in the MCNP suite of codes, now combines the capability of both simulation tools, as well as providing new advanced technology, in a single radiation transport code. We describe here the new capabilities of the MCNP6 depletion code dating from the official RSICC release MCNPX 2.6.0, reported previously, to the now current state of MCNP6. NEA/OECD benchmark results are also reported. The MCNP6 depletion capability enhancements beyond MCNPX 2.6.0 reported here include: (1) new performance enhancing parallel architecture that implements both shared and distributed memory constructs; (2) enhanced memory management that maximizes calculation fidelity; and (3) improved burnup physics for better nuclide prediction. MCNP6 depletion enables complete, relatively easy-to-use depletion calculations in a single Monte Carlo code. The enhancements described here help provide a powerful capability as well as dictate a path forward for future development to improve the usefulness of the technology.
Psychiatric symptoms among an HIV positive Urban Population in ...
African Journals Online (AJOL)
RICHY
frequently psychiatric symptoms in an HIV positive adult ... affect the outcome of HIV disease. Firstly ... ignoring the serious consequences and impact the have on ... separated. 10. 5.4 divorced. 19. 10.3 widowed. 48. 26.0. Educational level.
40 CFR 63.110 - Applicability.
2010-07-01
... of 40 CFR parts 260 through 272. The owner or operator shall keep a record of the information used to... 272. (f) Overlap with the Vinyl Chloride NESHAP. (1) After the compliance dates specified in § 63.100...
Search Results | Page 26 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 251 - 260 of 292 ... Filter by type .... As the region most affected by conflict, Africa needs to acquire knowledge and expertise in the field of peace and security. Project ... Armed Conflict in Colombia : Different Resources Different Conflicts?
Institutional Factors Influencing Crop Farmers Adoption of ...
African Journals Online (AJOL)
E M IGBOKWE
recommended agrochemical practices (RAPs) among crop farmers in Nigeria. A total of 260 ... It would neither be logical nor ethical to expect poor people to forego the benefits of ..... Credit use is expected to assist farmers purchase necessary.
Cytokinin oxidase/dehydrogenase genes in barley and wheat. Cloning and heterologous expression
Czech Academy of Sciences Publication Activity Database
Galuszka, P.; Frébortová, Jitka; Werner, T.; Yamada, M.; Strnad, Miroslav; Schmülling, T.; Frébort, I.
2004-01-01
Roč. 271, č. 20 (2004), s. 3990-4002 ISSN 0014-2956 Institutional research plan: CEZ:AV0Z5038910 Keywords : cereals * cloning * cytokinin oxidase/dehydrogenase Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.260, year: 2004
Azorella compacta Infusion Activates Human Immune Cells and Scavenges Free Radicals In vitro
Czech Academy of Sciences Publication Activity Database
Tůmová, L.; Dučaiová, Z.; Cheel, José; Vokřál, I.; Sepúlveda, B.; Vokurková, D.
2017-01-01
Roč. 13, č. 50 (2017), s. 260-264 ISSN 0973-1296 Institutional support: RVO:61388971 Keywords : Azorella compacta * immune cells * CD69 expression Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 1.069, year: 2016
Savanna woody vegetation classification – now in 3-D
CSIR Research Space (South Africa)
Fisher, JT
2013-05-01
Full Text Available for Scientific and Industrial Research (CSIR)-Meraka Institute, P.O. Box 395, Pretoria, 0001, South Africa 5Department of Global Ecology, Carnegie Institution for Science, 260 Panama Street, Stanford, CA, 94305, USA *corresponding author, jolenefisher...
Search Results | Page 21 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 201 - 210 of 260 ... ... in the South for a mechanism for exchanging research data and local experien ... Services : a Comparative Analysis of Tripoli (Lebanon) and Irbid (Jordan) ... Fair Access to and Benefit Sharing of Genetic Resources ...
Fauna Europaea - all European animal species on the web
DEFF Research Database (Denmark)
de Jong, Yde; Verbeek, Melina; Michelsen, Verner
2014-01-01
Abstract Fauna Europaea is Europe's main zoological taxonomic index, making the scientific names and distributions of all living, currently known, multicellular, European land and freshwater animals species integrally available in one authoritative database. Fauna Europaea covers about 260...
Contraceptive Use: Implication for Completed Fertility, Parity ...
African Journals Online (AJOL)
Erah
NDHS, 2008 dataset on married women aged 45-49 was used. Chi-square ... About 26.0% of the women ever used contraception, while 9.0% of the women were underweight. Parity ..... Working Paper, Labour and Population, 2004. 2.
Czech Academy of Sciences Publication Activity Database
Blindauer, C. A.; Sigel, A.; Operschall, B. P.; Griesser, R.; Holý, Antonín; Sigel, H.
2016-01-01
Roč. 103, Jan 8 (2016), s. 248-260 ISSN 0277-5387 Institutional support: RVO:61388963 Keywords : anticancer activity * antivirals * aromatic-ring stacking * isomeric equilibria * nucleotide analogues Subject RIV: CC - Organic Chemistry Impact factor: 1.926, year: 2016
Mercury content in Hot Springs
Energy Technology Data Exchange (ETDEWEB)
Nakagawa, R
1974-01-01
A method of determination of mercury in hot spring waters by flameless atomic absorption spectrophotometry is described. Further, the mercury content and the chemical behavior of the elementary mercury in hot springs are described. Sulfide and iodide ions interfered with the determination of mercury by the reduction-vapor phase technique. These interferences could, however, be minimized by the addition of potassium permanganate. Waters collected from 55 hot springs were found to contain up to 26.0 ppb mercury. High concentrations of mercury have been found in waters from Shimoburo Springs, Aomori (10.0 ppb), Osorezan Springs, Aomori (1.3 approximately 18.8 ppb), Gosyogake Springs, Akita (26.0 ppb), Manza Springs, Gunma (0.30 approximately 19.5 ppb) and Kusatu Springs, Gunma (1.70 approximately 4.50 ppb). These hot springs were acid waters containing a relatively high quantity of chloride or sulfate.
Tar bases in low-temperature coal tar
Energy Technology Data Exchange (ETDEWEB)
Sugiura, S; Ueno, H; Yokoyama, H
1951-01-01
Tar bases were extracted from three fractions, that boil below 260/sup 0/ at 260/sup 0/ to 280/sup 0/, and 280/sup 0/ to 330/sup 0/, respectively, of the low-temperature tar obtained by the carbonization of Ube coal in a Koppers' vertical retort at approximately 750/sup 0/. These were divided, respectively, into three groups, acetate-forming amine, HCl salt-forming bases (I), and CHCl/sub 3/-soluble bases (II), and further fractionally distilled. From the physical and chemical properties of the fractions thus obtained, it was concluded that low-temperature coal tar contained no low boiling pyridine homologues and that, besides higher homologues of pyridine, nonaromatic, more saturated, and less basic compounds of larger atomic weight and smaller refractive index, such as derivatives of pyrrole and indole, also existed as in crude petroleum.
Implementation of a Worksite Wellness Program Targeting Small Businesses
Stinson, Kaylan E.; Metcalf, Dianne; Fang, Hai; Brockbank, Claire vS.; Jinnett, Kimberly; Reynolds, Stephen; Trotter, Margo; Witter, Roxana; Tenney, Liliana; Atherly, Adam; Goetzel, Ron Z.
2015-01-01
Objective: To assess small business adoption and need for a worksite wellness program in a longitudinal study of health risks, productivity, workers' compensation rates, and claims costs. Methods: Health risk assessment data from 6507 employees in 260 companies were examined. Employer and employee data are reported as frequencies, with means and standard deviations reported when applicable. Results: Of the 260 companies enrolled in the health risk management program, 71% continued more than 1 year, with 97% reporting that worker wellness improves worker safety. Of 6507 participating employees, 34.3% were overweight and 25.6% obese. Approximately one in five participants reported depression. Potentially modifiable conditions affecting 15% or more of enrollees include chronic fatigue, sleeping problems, headaches, arthritis, hypercholesterolemia, and hypertension. Conclusions: Small businesses are a suitable target for the introduction of health promotion programs. PMID:25563536
Search Results | Page 26 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 251 - 260 of 8494 ... ... demand for health service delivery in the Middle East and North Africa. ... Strengthening response capacity to African infectious disease outbreaks. The 2014 Ebola outbreak in West Africa claimed the lives of tens of ...
Vliv pivovarského procesu na profil proteinů ječmene
Czech Academy of Sciences Publication Activity Database
Benkovská, Dagmar; Flodrová, Dana; Psota, V.; Bobálová, Janette
2011-01-01
Roč. 57, 7-8 (2011), 260-265 ISSN 0023-5830 R&D Projects: GA MŠk 1M0570 Institutional research plan: CEZ:AV0Z40310501 Keywords : barley * proteins * brewing process Subject RIV: CB - Analytical Chemistry, Separation
National Research Council Canada - National Science Library
Petty, J
1997-01-01
...., 1 ng/L, 10 ng/L, and 100 ng/L) at water temperatures ranging from I 00C to 260C. The data are indicative of concentration independent sampling rates for the 23 OC pesticides employed in this research...
Determination of cordycepin content of Cordyceps militaris ...
African Journals Online (AJOL)
was determined by reversed-phase HPLC with water:acetonitrile (95:5, v/v) as mobile phase, detection wavelength of 260 nm, and flow rate of 1.0 mL/min. ... Keywords: Recombinant rice, Cordycepin, Chinese caterpillar fungus, Aweto, ...
Search Results | Page 23 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 221 - 230 of 260 ... Gender, International Law and Justice : Access to Gender Equality ... on the Elimination of All Forms of Discrimination against Women (CEDAW) and the ... Palestinian women and girls account for over half of the Arab ...
Potential Navy Force Structure and Shipbuilding Plans: Background and Issues for Congress
National Research Council Canada - National Science Library
O'Rourke, Ronald
2005-01-01
In February 2005, the Navy testified that the Navy in future years may require a total of 260 to 325 ships, or possibly 243 to 302 ships, depending on how much the Navy uses new technologies and a new...
76 FR 71116 - Proposed Agency Information Collection Activities; Comment Request
2011-11-16
..., mechanical, or other technological collection techniques or other forms of information technology (e.g.... Affected Public: State and local governments, government sponsored authorities and corporations, railroads... Content of 75,635 potential 18 applications...... 20 360 Application. applicants. 260.25--Additional...
Fort Hood Building and Landscape Inventory with WWII and Cold War Context
2007-03-01
barracks, 1970s (NARA)........................................................... 112 Figure 37. Palmer Movie Theater (NARA...revised 1953) showing layout of Hood Village and trailer park (Fort Hood...arms ammunition storage building #92012 (ERDC-CERL, 2004). ......... 260 Figure 163: Radio reception building #92063 (ERDC-CERL, 2004
Percutaneous transhepatic self-expanding metal stents for palliation ...
African Journals Online (AJOL)
placement within 2 - 23 days of biliary drainage as a two-stage procedure because of .... TJF-260; Olympus, Tokyo, Japan) with a 4.2 mm working channel using a .... increased owing to fewer long-term complications than occur with smaller ...
Historik Josef Vítězslav Šimák a Johana Husáková, dcera semilského lékárníka
Czech Academy of Sciences Publication Activity Database
Kábová, Hana
2012-01-01
Roč. 25, č. 0 (2012), s. 251-260, 280 ISSN 1211-975X Institutional support: RVO:67985921 Keywords : Šimák, Josef Vítězslav * Husáková, Johana * Semily, Czech Republic) Subject RIV: AB - History
Breeman, Linda D.; Jaekel, Julia; Baumann, Nicole; Bartmann, Peter; Wolke, Dieter
2016-01-01
Background: Very preterm (VP; gestational age attention problems in childhood and adulthood. The stability of these problems into adulthood is not known. Methods: The Bavarian Longitudinal Study is a prospective cohort study that followed 260 VP/VLBW and 229 term-born…
Mexico's Program for Science and Technology, 1978 to 1982.
Flores, Edmundo
1979-01-01
Describes briefly the National Council for Science and Technology (CONACYT) of Mexico, and outlines Mexico's Program for Science and Technology which includes 2,489 projects in basic and applied sciences at a cost of $260 million from 1978 to 1982. (HM)
African Journals Online (AJOL)
ATTAMAH C. O
female ̅=3.50; difference in mean{dm} = -0.70). Male entrepreneurs ... with the variance more on lack of information facilities (male ̅= 2.28; female. ̅= 2.60; dm = -0.32). ..... Issa R. (2009). Climate Change and Livestock Production Frontier.
Metabolic Gene Variants Associated with Chromosomal Aberrations in Healthy Humans
Czech Academy of Sciences Publication Activity Database
Hemminki, K.; Frank, Ch.; Försti, A.; Musak, L.; Kazimírová, A.; Barančoková, M.; Horská, A.; Vymetálková, Veronika; Smerhovský, Z.; Naccarati, Alessio; Souček, P.; Vodičková, Ludmila; Buchancová, J.; Smolková, B.; Dusinska, M.; Vodička, Pavel
2015-01-01
Roč. 54, č. 4 (2015), s. 260-266 ISSN 1045-2257 Institutional support: RVO:68378041 Keywords : DNA-damage * cancer * polymorphisms * risk * lymphocytes * exposure * repair * susceptibility * markers * GSTT1 Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.960, year: 2015
International Journal of Natural and Applied Sciences - Vol 7, No 3 ...
African Journals Online (AJOL)
Effects of spent engine oil pollution on arable soil of Nekede Mechanic Village Owerri, Nigeria · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. AC Udebuani, CI Okoli, H Nwigwe, PTE Ozoh, 257 – 260 ...
Marie Underi luule : mõnest tõlkeprobleemist / Ilse Lehiste ; inglise k. tlk. Ene-Reet Soovik
Lehiste, Ilse, 1922-2010
2000-01-01
Orig.: Marie Under's poetry: some problems of translation. Varem ilmunud: Lituanus, 1983, nr. 3. Kaasautor: Rimvydas Shilbajoris. M. Underi luuletuse "Täiskuu" tekst eesti k., tõlge inglise keelde (tlk. I. Lehiste) ja reaalune tõlge inglise keelde, lk. 256-260
Suiformes conservation: a study case of strategies for DNA utilization
Indian Academy of Sciences (India)
However, the amount and quality of DNA obtained is a major concern and compar- .... and an improvement of the DNA purity observable in the. A260/280 ratio (the purity ratio ... facilities at The University of Arizona, Tucson, USA. Thanks also.
Czech Academy of Sciences Publication Activity Database
Zajícová, Alena; Javorková, Eliška; Trošan, Peter; Chudíčková, Milada; Krulová, Magdaléna; Holáň, Vladimír
2014-01-01
Roč. 60, č. 6 (2014), s. 253-260 ISSN 0015-5500 R&D Projects: GA MŠk LO1309 Institutional support: RVO:68378041 Keywords : enzyme-linked immunosorbent assay * interferon * interleukin Subject RIV: EC - Immunology Impact factor: 1.000, year: 2014
Search Results | Page 26 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 251 - 260 of 8491 ... Filter by region ... Centre of Excellence for Civil Registration and Vital Statistics Systems ... This project aims to use nanomaterials (a nanometer is one ... Four key findings to promote good health and well-being for all.
DNA marker characterization for allele mining of blast and bacterial ...
African Journals Online (AJOL)
admiistrator
2013-05-01
May 1, 2013 ... very useful for the analysis and detection of QTLs (Sabouri et al., 2011). ... Rice blast disease caused by the fungus Magnaporthae grisea (Ou ... The DNA was quantified at 260 nm wavelength using a UV spectro- photometer ...
African Journals Online (AJOL)
sulaiman.adebowale
2007-09-10
Sep 10, 2007 ... that the oil industry is confronted with a crisis arising from the actions and in- ..... The World Bank report on Nigeria (cited .... national average of $260, and unemployment in Port Harcourt is more than ..... ia's Niger Delta.
Properties of Soils and Plants Uptake within the Vicinity of Selected ...
African Journals Online (AJOL)
`123456789jkl''''#
nutrients. So, as the soil is being contaminated with all manner of pollutants, the life process is being ... food chain (Ademoroti, 1996). Animals ... range of 260-300 m above the sea level in Ife ... thoroughly washed with de-ionized water dried.
African Journals Online (AJOL)
KEY WORDS: Phenanthroline, H-bonding, X-ray structure, π- π stacking .... Density(calc) g/cm3. 1.281. 1.507. 1.167. Absorption coefficient mm-1. 0.260 ... in Figure 3, where an unprotonated neutral molecule co-crystallizes along with the.
Leisure-time physical inactivity among healthcare workers
Directory of Open Access Journals (Sweden)
Saulo Vasconcelos Rocha
2018-01-01
adherence to physical activity during leisure time among workers, especially among the most vulnerable groups (people with higher education and women, given the benefits of this behavior to health. Int J Occup Med Environ Health 2018;31(3:251–260
Ovoce, koření a léčiva z raně novověké jímky hradčanského špitálu
Czech Academy of Sciences Publication Activity Database
Čulíková, Věra
2008-01-01
Roč. 60, č. 2 (2008), s. 229-260 ISSN 0323-1267 Institutional research plan: CEZ:AV0Z80020508 Keywords : Prague-Hradčany * post-Medieval * carpological analyse * xylotomical analyse * imported species * introduced species Subject RIV: AC - Archeology, Anthropology, Ethnology
Oral cavity squamous cell carcinoma in 260 patients aged 80 years or more
International Nuclear Information System (INIS)
Ortholan, Cecile; Lusinchi, Antoine; Italiano, Antoine; Bensadoun, Rene-Jean; Auperin, Anne; Poissonnet, Gilles; Bozec, Alexandre; Arriagada, Rodrigo; Temam, Stephane; Benezery, Karen; Thariat, Juliette; Tao Yungan; Janot, Francois; Mamelle, Gerard; Vallicioni, Jacques; Follana, Philippe; Peyrade, Frederic; Sudaka, Anne; Bourhis, Jean; Dassonville, Olivier
2009-01-01
Purpose: We report the experience of two French cancer centers in the treatment of oral cavity squamous cell carcinoma (SCC) in patients aged ≥80 years. Materials and methods: Two hundred and sixty patients aged ≥80 years with a primary oral cavity SCC were included in this retrospective analysis. Results: Sex ratio was near to 1. Tobacco or alcohol intoxication was the main risk factor for 66% of men and 16% of women and leukoplakia, lichen planus, or oral traumatism for 55% of women and 11% of men (p < 0.0001). Two hundred patients received a loco-regional (LR) treatment with a curative intent (surgery and/or radiotherapy), 29 with a palliative intent and 31 did not receive a LR treatment. Curative treatments were initially planned to be adapted to age in 118 patients (59%). The median disease-specific survival (DSS) was 29 months. In multivariate analysis, the independent prognostic factors for DSS were stage (HR = 0.42 [0.24-0.72]), age (HR = 0.43 [0.24-0.75]) and performance status (HR = 0.50 [0.27-0.95]). The median overall survival (OS) was 14 months. In multivariate analysis, the independent prognostic factors for OS were age (HR = 0.52 [0.35-0.79]), stage (HR = 0.56 [0.38-0.84]), tumor differentiation (HR = 0.60 [0.33-0.93]) and performance status (HR = 0.6 [0.37-0.97]). In patients treated with a curative intent, treatment adapted to age was not associated with a decreased overall survival or disease-specific survival as compared with the standard treatment. However, prophylactic lymph node treatment in stages I-II tumors decreased the rate of nodal recurrence from 38% to 6% (p = 0.01). Conclusion: This study emphasizes the need for prospective evaluation of standard and adapted schedules in elderly patients with oral cavity cancer.
49 CFR 260.25 - Additional information for Applicants not having a credit rating.
2010-10-01
... statement setting forth the bases for such forecasts; and (iii) A spread sheet showing changes in financial..., based upon estimated and forecasted data; (c) Capital spending plans for the next five years; (d) Cash flow projections; (e) Contingency plans for termination of the project before completion, if necessary...
12 CFR 550.260 - How may I invest funds of a fiduciary account?
2010-01-01
... CFR 9.18. (2) If you must file a document with the Comptroller of the Currency under 12 CFR 9.18, you...” and “national bank” as used in 12 CFR 9.18 shall be deemed to include a Federal savings association...
45 CFR 260.34 - When do the Charitable Choice provisions of TANF apply?
2010-10-01
... ASSISTANCE (ASSISTANCE PROGRAMS), ADMINISTRATION FOR CHILDREN AND FAMILIES, DEPARTMENT OF HEALTH AND HUMAN... religion, a religious belief, a refusal to hold a religious belief, or a refusal to actively participate in...
The effect of neutron irradiation on the mechanical properties of welded zircaloy-2
Energy Technology Data Exchange (ETDEWEB)
Evans, D G
1962-07-15
Zircaloy-2 tensile specimens, subsize impact bars and representative spigot welds were subjected to three NRX cycles in the X-5 loop. Average loop temperature was 260{sup o}C over the three cycles. One group of tensile specimens was heat-treated in vacuum at 900{sup o}C for 40 minutes, another group contained welded areas in the centre of the gauge length and a third group was hydrided after welding. Notches of the impact specimens were located in the fusion zone of the weld, Spigot welds were made on autoclaved and unautoclaved simulated production assemblies. The transition temperature of Zircaloy-2 increased appreciably upon welding. This was accompanied by a decrease in absorbed energy values for all temperatures between 0{sup o} and 300{sup o}C. Neutron irradiation had no effect on the impact properties of welded. Zircaloy-2. Welding decreased the uniform and total elongation at room temperature and at 260{sup o}C, and increased the 260{sup o}C PL, YS and UTS. Hydriding to a nominal 100 ppm hydrogen had no effect on the unirradiated tensile properties at either test temperature. The heat treatment decreased the strength properties but did not affect the ductility. Neutron irradiation increased the YS of the welded and hydrided material by 20% and the heat treated YS by 40%. Irradiation also increased the 260{sup o}C strength properties of the as-welded material. It was found that the unautoclaved spigot welds had a generally higher tensile strength than the autoclaved and welded specimens. For specimens welded in either condition, the outer welds of the 19-element bundle had a lower average breaking load than the inner welds. Neutron irradiation had no effect on the tensile strength of these welds. It was also demonstrated that a cup-and-cone type of fracture could be produced in a bend test. These fractures were similar to those observed in irradiated fuel bundles which had been damaged during transfer operations. A large amount of scatter rendered some
Energy Technology Data Exchange (ETDEWEB)
Yang, Yi-Shan; Yang, Chia-Jung; Ouyang, Fan-Yi, E-mail: fyouyang@ess.nthu.edu.tw
2016-07-25
The growth of Ni{sub 3}Sn{sub 4} intermetallic compound (IMC) between liquid–solid interface in micro-scale Ni/SnAg/Ni system was investigated under a temperature gradient of 160 °C/cm at 260 °C on a hot plate. In contrast to a symmetrical growth of Ni{sub 3}Sn{sub 4} on both interfaces under isothermally annealed at 260 °C, the interfacial Ni{sub 3}Sn{sub 4} IMC exhibited asymmetric growth under a temperature gradient; the growth of Ni{sub 3}Sn{sub 4} at cold interface was faster than that at hot side because of temperature gradient induced mass migration of Ni atoms from the hot end toward the cold end. It was found that two-stage growth behavior of Ni{sub 3}Sn{sub 4} IMC under a temperature gradient. A growth model was established and growth kinetic analysis suggested that the chemical potential gradient controlled the growth of Ni{sub 3}Sn{sub 4} at stage I (0–120 min) whereas the dynamic equilibrium between chemical potential gradient and temperature gradient forces was attained at the hot end at stage II (120–210 min). When dynamic equilibrium was achieved at 260 °C, the critical length-temperature gradient product at the hot end was experimentally estimated to be 489.18 μm × °C/cm and the moving velocity of Ni{sub 3}Sn{sub 4} interface due to Ni consumption was calculated to be 0.134 μm/h. The molar heat of transport (Q*) of Ni atoms in molten SnAg solder was calculated to be +0.76 kJ/mol. - Highlights: • Interfacial reaction in Ni/SnAg solder/Ni system under thermal gradient. • Growth rate of Ni{sub 3}Sn{sub 4} at cold end is faster than that at hot end. • Critical length-temperature gradient product at hot end is 489.2 μm°C/cm at 260 °C. • Velocity of Ni{sub 3}Sn{sub 4} moving interface is 0.134 μm/h during dynamic equilibrium. • Molar heat of transport (Q*) of Ni in molten SnAg was +0.76 kJ/mol.
Observation of new spontaneous fission activities from elements 100 to 105
International Nuclear Information System (INIS)
Somerville, L.P.
1982-03-01
Several new Spontaneous Fission (SF) activities have been found. No definite identification could be made for any of the new SF activities; however, half-lives and possible assignments to element-104 isotopes consistent with several cross bombardments include 257 Rf(3.8 s, 14% SF), 258 Rf(13 ms), 259 Rf(approx. 3 s, 8% SF), 260 Rf(approx. 20 ms), and 262 Rf(approx. 50 ms). The 80-ms SF activity claimed by the Dubna group for the discovery of element 104 ( 260 104) was not observed. A difficulty exists in the interpretation that 260 Rf is a approx. 20-ms SF activity: in order to be correct, for example, the SF activities with half-lives between 14 and 24 ms produced in the reactions 109- to 119-MeV 18 O + 248 Cm, 88- to 100-MeV 15 N + 249 Bk, and 96-MeV 18 O + 249 Cf must be other nuclides due to their large production cross sections, or the cross sections for production of 260 Rf must be enhanced by unknown mechanisms. Based on calculated total production cross sections a possible approx. 1% electron-capture branch in 258 Lr(4.5 s) to the SF emitter 258 No(1.2 ms) and an upper limit of 0.05% for SF branching in 254 No(55 s) were determined. Other measured half-lives from unknown nuclides produced in respective reactions include approx. 1.6 s ( 18 O + 248 CM), indications of a approx. 47-s SF activity (75-MeV 12 C + 249 Cf), and two or more SF activities with 3 s less than or equal to T/sub 1/2/ less than or equal to 60 s ( 18 O + 249 Bk). The most exciting conclusion of this work is that if the tentative assignments to even-even element 104 isotopes are correct, there would be a sudden change in the SF half-life systematics at element 104 which has been predicted theoretically and attributed to the disappearance of the second hump of the double-humped fission barrier
75 FR 63551 - Guides for the Use of Environmental Marketing Claims
2010-10-15
... general principles that apply to all environmental marketing claims and provide specific guidance... Part II Federal Trade Commission 16 CFR Part 260 Guides for the Use of Environmental Marketing... Marketing Claims AGENCY: Federal Trade Commission. ACTION: Proposed revisions to guidelines. SUMMARY: The...
Synthesis of Electron-Rich Thiamacrocycles
Czech Academy of Sciences Publication Activity Database
Holý, Petr; Buchta, Michal; Rybáček, Jiří; Hodačová, J.; Císařová, I.
-, č. 24 (2010), s. 4169-4176 ISSN 0039-7881 R&D Projects: GA AV ČR IAA400550704 Institutional research plan: CEZ:AV0Z40550506 Keywords : alkylation * atropoisomerism * macrocycles * arenes * thiols Subject RIV: CC - Organic Chemistry Impact factor: 2.260, year: 2010
van Geel, B. M.; Assies, J.; Haverkort, E. B.; Koelman, J. H.; Verbeeten, B.; Wanders, R. J.; Barth, P. G.
1999-01-01
OBJECTIVES: X-linked adrenoleukodystrophy (X-ALD) is an inherited disorder of peroxisomal fatty acid oxidation, biochemically characterised by the accumulation of saturated very long chain fatty acids (VLCFAs), particularly hexacosanoic acid (C26:0). Dietary treatment with a 4:1 mixture of
European Birth Cohorts for Environmental Health Research
Czech Academy of Sciences Publication Activity Database
Vrijheid, M.; Casas, M.; Bergström, A.; Carmichael, A.; Cordier, S.; Eggesbø, M.; Eller, E.; Fantini, M. P.; Fernández, M. F.; Fernández-Somoano, A.; Gehring, U.; Grazuleviciene, R.; Hohmann, C.; Karvonen, A. M.; Keil, T.; Kogevinas, M.; Koppen, G.; Krämer, U.; Kuehni, C. E.; Magnus, P.; Majewska, R.; Andersen, A. M. N.; Patelarou, E.; Petersen, M. S.; Pierik, F. H.; Polanska, K.; Porta, D.; Richiardi, L.; Santos, A. C.; Slama, R.; Šrám, Radim; Thijs, C.; Tischer, C.; Toft, G.; Trnovec, T.; Vandentorren, S.; Vrijkotte, T. G. M.; Wilhelm, M.; Wright, J.; Nieuwenhuijsen, M.
2012-01-01
Roč. 120, č. 1 (2012), s. 29-37 ISSN 0091-6765 Institutional research plan: CEZ:AV0Z50390703 Keywords : environment pollution * child health * European birth cohorts Subject RIV: DN - Health Impact of the Environment Quality Impact factor: 7.260, year: 2012
High temperature microcalorimetry. Study of metal-oxygen systems
International Nuclear Information System (INIS)
Tetot, R.; Picard, C.; Boureau, G.; Gerdanian, P.
1981-01-01
Determination of partial molar enthalpy in metal-oxygen systems at 1050 0 C. Three representative systems are studied: the solution of oxygen in titanium, the titanium-oxygen system and the uranium-oxygen system from UOsub(2.00) to UOsub(2.60) [fr
Czech Academy of Sciences Publication Activity Database
Belkina, T.V.; Khojiev, D.S.; Tillyashaykhov, M.N.; Tigay, Z.N.; Kudenov, M.U.; Duintjer Tebbens, Jurjen; Vlček, J.
2014-01-01
Roč. 14, November (2014), article 624 ISSN 1471-2334 Grant - others:SVV UK(CZ) 260 066 Institutional support: RVO:67985807 Keywords : cross-sectional study * pulmonary tuberculosis * self-medication * Uzbekistan Subject RIV: FR - Pharmacology ; Medidal Chemistry Impact factor: 2.613, year: 2014
Book Review: The Drug Effect | Kriegler | South African Crime ...
African Journals Online (AJOL)
Title: The Drug Effect: Health, Crime and Society Editors: Suzanne Fraser and David Moore Publisher: Cambridge University Press Price: R500.00 (incl. VAT and postage) Pages: 260. Availability: Published. Available through all academic bookstores. ISBN: 978-0-521-15605-9 ...
Gender and entrepreneurial intentions in a transition economy context: case of the Czech Republic
Czech Academy of Sciences Publication Activity Database
Branchet, B.; Křížková, Alena
2015-01-01
Roč. 25, č. 3 (2015), s. 260-281 ISSN 1476-1297 R&D Projects: GA TA ČR(CZ) TD020134; GA ČR GAP404/10/0021 Institutional support: RVO:68378025 Keywords : entrepreneurship * gender * entrepreneurial intentions Subject RIV: AO - Sociology, Demography
Constitutive Negative Regulation of R Proteins in Arabidopsis also via Autophagy Related Pathway?
Czech Academy of Sciences Publication Activity Database
Pečenková, Tamara; Sabol, P.; Kulich, I.; Ortmannová, Jitka; Žárský, Viktor
2016-01-01
Roč. 7, MAR 4 (2016), s. 260 ISSN 1664-462X R&D Projects: GA ČR(CZ) GA15-14886S Institutional support: RVO:61389030 Keywords : resistance * autophagy * R Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.298, year: 2016
Czech Academy of Sciences Publication Activity Database
Roubalová, L.; Biedermann, David; Papoušková, B.; Vacek, J.; Kuzma, Marek; Křen, Vladimír; Ulrichová, J.; Dinkova-Kostova, A.T.; Vrba, J.
2016-01-01
Roč. 260, 25 December (2016), s. 58-66 ISSN 0009-2797 R&D Projects: GA MZd(CZ) NV16-27317A Institutional support: RVO:61388971 Keywords : Heme oxygenase-1 * Metabolism * Methyl gallate Subject RIV: CE - Biochemistry Impact factor: 3.143, year: 2016
2011-03-17
....209, 53.211, and 53.213, Accounting Safeguards and Sections 260 and 271-276 of the Communications Act... reporting requirements, third party disclosure requirement, and recordkeeping requirement. Obligation to... party disclosure requirements). There is no change in the Commission's burden estimates. A Bell...
Selective biotransformation of substituted alicyclic nitriles by Rhodococcus equi A4
Czech Academy of Sciences Publication Activity Database
Martínková, Ludmila; Klempier, N.; Preiml, M.; Ovesná, Mária; Kuzma, Marek; Mylerová, Veronika; Křen, Vladimír
2002-01-01
Roč. 80, - (2002), s. 724-727 ISSN 0008-4042 R&D Projects: GA ČR GA524/00/1275; GA AV ČR IAA4020802 Keywords : nitrile hydratase * substituted cyclohexanecarbonitriles * cyclopentanecarbonitriles Subject RIV: EE - Microbiology, Virology Impact factor: 1.260, year: 2002
2013-12-18
... understand what activities are feasible in specific settings, participants' willingness to complete requested..., Primary Caregiver, Secondary Residence Caregiver. Validation Interview (Pre- Pregnant Woman, 850 1 2/60 28 Pregnancy to 60M). Father/Father Figure, Biological Mother, Primary Caregiver, Secondary Residence Caregiver...
Disgust domains in the prediction of contamination fear : A comparison of Dutch and US samples
Sawchuk, Craig N.; Olatunji, Bunmi O.; De Jong, Peter J.
2006-01-01
The present study examines the disgust-contamination fear relationship among Dutch (N =260) and US (N =292) participants. US participants reported higher levels of disgust sensitivity across the majority of disgust domains and also endorsed stronger contamination fear than their Dutch counterparts.
Klijn, Annemieke; Homburg, Ernst; Bastiaens, Ellen; Tilburg, van Jonathan; Merriënboer, van Jeroen
2017-01-01
The Jesuit Collection of the University Library in Maastricht houses a collection of over 260.000 volumes, including several hundreds of often lavishly illustrated travel books. The international mindset of the Jesuits seems to be suitable for the international student population in Maastricht
"Scientific Creationism"--A New Inquisition Brewing?
Cloud, Preston
1977-01-01
In light of the recent revival of the creationism versus evolution issue, the author briefly summarizes both positions, defends evolution on the basis of fossils and rock ages, and refutes six creationist arguments against evolution. For journal availability, see SO 505 260. (AV)
Directory of Polish Officials: A Reference Aid
1989-04-01
Jan 86 Deputy Director Mondalski, Janusz Aug 83 Polish Steamship Company (Polski Zegluga Morska ) (PZM) Director Andruczyk, Mieczyslaw Jan...2<> Polski Kosciol Chrzescijan Baptystow 12° Polski Linie Oceaniczne ’"- Polski Towarzystwo Ekonomiczne ’’° Polski Zegluga Morska 102 Polski
African Journals Online (AJOL)
Synthese
économique des services rendus par les écosystèmes marins. La richesse ... croissance plus rapide que la moyenne de l‟économie ...... services and natural capital. Nature. 387, 253-260. .... d‟interactions où l‟humain est partie prenante. In.
Inflation, investment and growth: a money and banking approach
Czech Academy of Sciences Publication Activity Database
Gillman, M.; Kejak, Michal
2011-01-01
Roč. 78, č. 310 (2011), s. 260-282 ISSN 0013-0427 R&D Projects: GA MŠk LC542 Institutional research plan: CEZ:AV0Z70850503 Keywords : inflation * investments * economic development Subject RIV: AH - Economics Impact factor: 1.152, year: 2011
Job resources and employee engagement : A cross-national study
Farndale, E.; Murrer, I.N.J.
2015-01-01
Purpose In light of increasing globalization of workforces, the purpose of this paper is to explore the moderating effect of country on the relationship between job resources and employee engagement. Design/methodology/approach Questionnaire responses from 19,260 employees of a large multinational
2012-09-20
... Education Services.. Los Fresnos, TX..... 2,260,821 International Education Services.. Los Fresnos, TX..... 638,042 International Education Services.. Los Fresnos, TX..... 192,577 Lutheran Immigration and... Austin, TX 18,615,410 US Conference of Catholic Bishops Washington, DC...... 182,855 (USCCB). US...
Czech Academy of Sciences Publication Activity Database
Nestola, E.; Calfapietra, Carlo; Emmerton, C. A.; Wrong, Ch. Y. S.; Thayer, D. R.; Gamon, J. A.
2016-01-01
Roč. 8, č. 3 (2016), č. článku 260. ISSN 2072-4292 Institutional support: RVO:67179843 Keywords : grassland * NDVI * CO2 flux * optical remote sensing * LUE model * gap filling Subject RIV: EH - Ecology, Behaviour Impact factor: 3.244, year: 2016
Zmenšení dynamických účinků na předpjatých mostech
Czech Academy of Sciences Publication Activity Database
Frýba, Ladislav
2005-01-01
Roč. 14, č. 9 (2005), s. 257-260 ISSN 1210-4027 R&D Projects: GA MDS (CZ) 1F45D/013/120 Institutional research plan: CEZ:AV0Z20710524 Keywords : prestressed bridges * dynamics * prestressed strings Subject RIV: JM - Building Engineering
CSIR Research Space (South Africa)
Oberholster, Paul J
2014-02-01
Full Text Available Botany 55, 247-260. Mitchell, P., 1990. The Enviromental Conditions of Victoria Streams, Department of Water Resources, Melbourne, Victoria. Mitsch, W.J., Gosselink, J.G., 2000. Wetlands 3 third edition, John Wiley& Sons Inc, New York. Morant, P.D., 1983...
Lampkowska, J.; Feld, L.; Monaghan, A.; Toomey, N.; Schjørring, S.; Jacobsen, B.; Voet, van der H.; Andersen, S.R.; Bolton, D.; Aarts, H.J.M.; Krogfelt, K.A.; Wilcks, A.; Bardowski, J.K.
2008-01-01
Optimal conditions and a standardized method for conjugation between two model lactococcal strains, Lactococcus lactis SH4174 (pAMbeta1-containing, erythromycin resistant donor) and L. lactis Bu2-60 (plasmid-free, erythromycin sensitive recipient), were developed and tested in a inter-laboratory
Czech Academy of Sciences Publication Activity Database
Romano, S. S.; Brix, M. R.; Dörr, K.; Fiala, Jiří; Krenn, E.; Zulauf, G.
2006-01-01
Roč. 260, - (2006), s. 69-90 ISSN 0375-6440 Institutional research plan: CEZ:AV0Z30130516 Keywords : tectonic-evolution * Carboniferous * Jurassic * uranium-lead-dating * orthogneiss * fission-track-dating * zircon * structural-geology * petrology * metamorphism * high-temperature Subject RIV: DB - Geology ; Mineralogy
76 FR 35468 - Star-Spangled Banner National Historic Trail Advisory Council
2011-06-17
... DEPARTMENT OF THE INTERIOR National Park Service Star-Spangled Banner National Historic Trail... the Advisory Committee on the Star-Spangled Banner National Historic Trail will hold a meeting... Council is John Maounis, Superintendent, Chesapeake Bay Office, telephone: (410) 260-2471. DATES: The Star...
Diffusionless bonding of aluminum to Zircaloy-2
International Nuclear Information System (INIS)
Watson, R.D.
1965-04-01
Aluminum can be bonded to zirconium without difficulty even when a thin layer of oxide is present on the surface of the zirconium . No detectable diffusion takes place during the bonding process. The bond layer can be stretched as much. as 8% without affecting the bond. The bond can be heated for 1000 hours at 260 o C (500 o F), and can be water quenched from 260 o C (500 o F) without any noticeable change in the bond strength. An extrusion technique has been devised for making transition sections of aluminum bonded to zirconium which can then be used to join these metals by conventional welding. Welding can be done close to the bond zone without seriously affecting the integrity of the bond. This method of bonding aluminum to Zircaloy-2 is covered by Canadian patent 702,438 January 26, 1965. (author)
Li, Jing-En; Nie, Shao-Ping; Xie, Ming-Yong; Huang, Dan-Fei; Wang, Yu-Ting; Li, Chang
2013-10-01
Polysaccharide MP was isolated from Mosla chinensis Maxim cv. jiangxiangru. It was composed of rhamnose, arabinose, xylose, mannose, glucose and galactose in a molar ratio of 5.364:12.260:3.448:12.260:32.567:30.651, with 11.00%±0.24% uronic acid and 9.046%±0.04% protein. Its antioxidant activity on the cyclophosphamide-induced immunosuppressed mice was investigated. The spleen and the thymus indices were investigated, and the biochemical parameters were evaluated in three organs (liver, heart and kidney). MP was able to overcome the cyclophosphamide-induced immunosuppression and can significantly raise the T-AOC, CAT, SOD and GSH-PX level. It also raised the spleen and thymus indices and decreased the MDA level in mice. MP could play an important role during the prevention process of oxidative damage in immunological system. Copyright © 2013 Elsevier B.V. All rights reserved.
Hydrogenating oils. [British patent
Energy Technology Data Exchange (ETDEWEB)
1938-08-31
A safety fuel boiling within the limits 130/sup 0/ to 260/sup 0/C, is obtained by treating hydrocarbon mixtures boiling below 260/sup 0/C, and for the most part above 130/sup 0/C according to the process described in the parent Specification. A fraction boiling from 140/sup 0/ to 250/sup 0/ C, which has been distilled off from the liquefaction product obtained by the destructive hydrogenation of coal soaked with ferrous sulphate, is passed at 485/sup 0/C under a partial pressure of 1.5 atmos. and a hydrogen pressure of 50 atmos. over a catalyst consisting of nickel and tungsten sulphides. The gasification is only 2 to 5 percent and from the reaction product a fraction of the same boiling range as the initial material is distilled off with a yield of 85 percent and an octane number of 97.
DEFF Research Database (Denmark)
Sokoli, Hülya U.; Beauson, Justine; Simonsen, Morten E.
2017-01-01
on the resin degradation efficiency and the quality of the recovered glass and carbon fibers. Supercritical acetone at 260 ºC, 60 bar and a c/s ratio up to 2.1 g/mL could achieve nearly complete degradation of the resin. The glass fibers were recovered with up to 89% retained tensile strength compared...... to the virgin glass fibers. The use of near-critical water reduced the tensile strength of the glass fibers by up to 65%, whereas the carbon fibers were recovered with retained tensile strength compared to the virgin carbon fibers using water or acetone.......Degradation of hybrid fiber composites using near-critical water or supercritical acetone has been investigated in this study. Process parameters such as temperature (T= 260-300 ºC), pressure (p = 60-300 bar) and composite/solvent (c/s = 0.29-2.1 g/mL) ratio were varied to determine the effect...
DEFF Research Database (Denmark)
Roar Eriksen, Malte; Illes, Zsolt; Sejbaek, Tobias
2016-01-01
OBJECTIVES: How practice effect influences cognitive testing measured by monthly Symbol Digit Modalities Test (SDMT) during natalizumab treatment, and what factors confound such effect. METHODS: Eighty patients were examined monthly with SDMT for 26.2±8.4 months. After 26.0±8.1 months, SDMT...... and the rearranged key, respectively. We also explored if natalizumab applied before regular monthly SDMT may influence practice effect and cognition. RESULTS: SDMT performance improved by 1.2 points/test during the first six months and by 0.4 points/test thereafter. Rearranging the symbols of the key after 26.......0±8.1 months returned SDMT scores to baseline indicating a practice effect. Such practice effect was more significant after longer testing period, but was not influenced by gender, age, relapses, disability progression and prior natalizumab treatment. Although the change from baseline to 2.5 years...
Scintillation and optical properties of Pb-doped YCa{sub 4}O(BO{sub 3}){sub 3} crystals
Energy Technology Data Exchange (ETDEWEB)
Fujimoto, Yutaka, E-mail: fuji-you@tagen.tohoku.ac.jp [IMRAM, Tohoku University, 2-1-1 Katahira, Aoba-ku, Sendai 980-8577 (Japan); JSPS, 8 Ichibanmachi, Chiyoda-ku, Tokyo 102-8472 (Japan); Yanagida, Takayuki; Yokota, Yuui [IMRAM, Tohoku University, 2-1-1 Katahira, Aoba-ku, Sendai 980-8577 (Japan); Kawaguchi, Noriaki [Tokuyama Corporation, 3 Shibuya Shibuya-ku, Tokyo 150-8383 (Japan); Fukuda, Kentaro [IMRAM, Tohoku University, 2-1-1 Katahira, Aoba-ku, Sendai 980-8577 (Japan); Tokuyama Corporation, 3 Shibuya Shibuya-ku, Tokyo 150-8383 (Japan); Totsuka, Daisuke [Nihon Kessho Kogaku Co., Ltd., 810-5 Nobe-cho Tatebayashi Gunma (Japan); Watanabe, Kenichi; Yamazaki, Atsushi [Nagoya University, Furo-cho, Chikusa-ku, Nagoya 464-8603 (Japan); Chani, Valery [IMRAM, Tohoku University, 2-1-1 Katahira, Aoba-ku, Sendai 980-8577 (Japan); Yoshikawa, Akira [IMRAM, Tohoku University, 2-1-1 Katahira, Aoba-ku, Sendai 980-8577 (Japan); NICHe, Tohoku University, 6-6-10 Aoba, Aramaki, Aoba-ku, Sendai 980-8579 (Japan)
2011-10-01
This communication reports optical properties and radiation responses of Pb{sup 2+} 0.5 and 1.0 mol%-doped YCa{sub 4}O(BO{sub 3}){sub 3} (YCOB) single crystals grown by the micro-pulling-down ({mu}-PD) method for neutron scintillator applications. The crystals had no impurity phases according to the results of X-ray powder diffraction. These Pb{sup 2+}-doped crystals demonstrated blue-light luminescence at 330 nm because of Pb{sup 2+1}S{sub 0}-{sup 3}P{sub 0,1} transition in the photoluminescence spectra. The main emission decay component was determined to be about 250-260 ns under 260 nm excitation wavelength. When irradiated by a {sup 252}Cf source, the relative light yield of 0.5% Pb{sup 2+}-doped crystal was about 300 ph/n that was determined using the light yield of a reference Li-glass scintillator.
Comparison of RNA Extraction Methods for the Identification of Grapevine fan leaf virus
Directory of Open Access Journals (Sweden)
Z. Gholampour
2016-06-01
isolate of the virus (Zakiaghl and Izadpanah 2003. The RNA isolation protocols of Triazol extraction, high salt phenol-chloroform extraction (Rowhani et al. 1993, RNA extraction using silicon dioxide, Silica (Boom et al 1990, CTAB-PVPP extraction and a commercial RNA isolation kit were used in the study. In all protocols, 50 mg leaf samples were used. The quality and purity of the extracted RNA were determined using spectrophotometry. For purity assessment, the absorbance for the A260/280 and A260/230 ratios was taking in water. RT-PCR was performed using DetF (5´-CGGCAGACTGGCAAGCTGT-3´ and DetR (5´-GGTCCAGTTTAATTGCCATCCA-3´ specific primer pair amplified 1000 bp of the coat protein gene of GFLV. PCR products were run on 1% agarose gel containing 0.5 µg/ml DNA Green Viewer, and visualized under UV irradiation. Results: There were large differences in the amount of RNA extracted per gram of tissue depending on the protocol used. The commercial kit, CTAB-PVPP and TRIzol methods gave the highest yields in micrograms RNA per gram fresh weight (235-300 μg/g. In contrast, the application of Silica gave the lowest yield (11 μg/g. The high salt phenol-chloroform method gave a moderate yield of over 77 μg/g. In this respect, the CTAB-PVPP method provides the highest yield of RNA. RNA quality was assessed by three methods: A260/280, A260/230 and ability to produce RT-PCR products. A260/280 ratios indicate the level of protein contamination in the preparation. The commercial kit, CTAB-PVPP, TRIzol and high salt phenol-chloroform methods gave RNA with very low amounts of protein contamination. In contrast, RNA isolated by the Silica showed more protein contamination, as indicated by the lower A260/280 ratios. A260/230 ratios are used to assess the level of contamination by polysaccharides and polyphenols. The high salt phenol-chloroform method yielded RNA that was contaminated with polysaccharides. In contrast, the CTAB-PVPP, TRIzol methods yielded RNA with very little
The impact of postpartum cervical tear on the occurrence of preterm birth in subsequent pregnancy.
Zafran, Noah; Gerszman, Eden; Garmi, Gali; Zuaretz-Easton, Sivan; Salim, Raed
2017-08-01
To examine the occurrence of subsequent preterm birth (PTB) among women who experienced a cervical tear during prior delivery. A retrospective study conducted at a single teaching hospital on data from January 1994 to March 2014. The study group included all women who had a cervical tear detected at uterine and cervical examination, performed due to early postpartum hemorrhage. The control group consisted of women who delivered vaginally, experienced an early postpartum hemorrhage, and had an intact cervix at uterine and cervical examination. The control group was matched for maternal age and ethnicity at a ratio of 1:2. Women who had a cervical tear but then did not have a subsequent delivery, or had multiple fetal gestations or cervical cerclage at subsequent pregnancies were excluded. Primary outcome was spontaneous PTB rate (PTBs in other subsequent pregnancies. Overall, 389 women were included. Of all cases of cervical tear, 129 were identified eligible and included in the final analysis. The control group included 260 women with an intact cervix. No significant differences were found between the study and control groups in the incidence of spontaneous PTB in the immediate subsequent pregnancy [1.6% (2/129) vs. 3.8% (10/260), respectively, p = 0.35]. The incidence of any spontaneous PTBs in all subsequent pregnancies did not differ also [4.7% (6/129) vs. 7.3% (19/260), respectively, p = 0.31]. Cervical tear detected after delivery does not increase the risk of spontaneous PTB in subsequent pregnancies.
International Nuclear Information System (INIS)
Mattos, J.C.P. de; Bernardo-Filho, M.; Leitao, A.C.; Caldeira-de-Araujo, A.; Lage, C.; Leitao, A.C.
1997-01-01
Full text. Stannous chloride (Sn Cl 2 ) is a reducing agent widely used to reduce 99m Tc in several radio pharmaceuticals compounds. In spite of being used in nuclear medicine, its genotoxic effects are under investigation in our laboratory. In E. coli, Sn Cl 2 has been shown to have lethal and mutagenic effects, which are thought to occur mainly via active oxygen species. In order to detect some possible direct influence of Sn Cl 2 on nucleic acid, DNA, nucleotides and isolated bases were allowed to react with S N Cl 2 in an in vitro system and the effects analyzed spectro photometrically. Since Sn Cl 2 absorbs light in the UV region, we expected that UV could modify the Sn Cl 2 effects on DNA. Our results indicate that: a. Sn Cl 2 or UV (312 nm, 10 5 J/m 2 ) alone caused only slight alterations in the 260-nm absorption peak of supercoiled plasmid DNA (p U C 9.1); b. Sn Cl 2 + UV (312 nm, 10 5 J/m 2 ) led DNA (p U C 9.1) to a complete loss of its characteristic absorption in the 260-nm region; and c. when reacting with isolated A T P or T T P, Sn Cl 2 + UV (312 nm, 5 x 10 4 J/m 2 ) caused a significant decrease in their 260-nm absorption peaks, as compared to Sn CL 2 alone. Put together, our results indicate that Sn Cl 2 effects are potentiated by the action of solar UV light
Thermal Conductivity of Ethylene Vinyl Acetate Copolymer/Nanofiller Blends
Ghose, S.; Watson, K. A.; Working, D. C.; Connell, J. W.; Smith, J. G., Jr.; Lin, Y.; Sun, Y. P.
2007-01-01
To reduce weight and increase the mobility, comfort, and performance of future spacesuits, flexible, thermally conductive fabrics and plastic tubes are needed for the Liquid Cooling and Ventilation Garment. Such improvements would allow astronauts to operate more efficiently and safely for extended extravehicular activities. As an approach to raise the thermal conductivity (TC) of an ethylene vinyl acetate copolymer (Elvax 260), it was compounded with three types of carbon based nanofillers: multi-walled carbon nanotubes (MWCNTs), vapor grown carbon nanofibers (CNFs), and expanded graphite (EG). In addition, other nanofillers including metallized CNFs, nickel nanostrands, boron nitride, and powdered aluminum were also compounded with Elvax 260 in the melt at various loading levels. In an attempt to improve compatibility between Elvax 260 and the nanofillers, MWCNTs and EG were modified by surface coating and through noncovalent and covalent attachment of organic molecules containing alkyl groups. Ribbons of the nanocomposites were extruded to form samples in which the nanofillers were aligned in the direction of flow. Samples were also fabricated by compression molding to yield nanocomposites in which the nanofillers were randomly oriented. Mechanical properties of the aligned samples were determined by tensile testing while the degree of dispersion and alignment of nanoparticles were investigated using high-resolution scanning electron microscopy. TC measurements were performed using a laser flash (Nanoflash ) technique. TC of the samples was measured in the direction of, and perpendicular to, the alignment direction. Additionally, tubing was also extruded from select nanocomposite compositions and the TC and mechanical flexibility measured.
Thermal Conductivity of Ethylene Vinyl Acetate Copolymer/Carbon Nanofiller Blends
Ghose, S.; Watson, K. A.; Working, D. C.; Connell, J. W.; Smith, J. G., Jr.; Lin, Y.; Sun, Y. P.
2007-01-01
To reduce weight and increase the mobility, comfort, and performance of future spacesuits, flexible, thermally conductive fabrics and plastic tubes are needed for the Liquid Cooling and Ventilation Garment. Such improvements would allow astronauts to operate more efficiently and safely for extended extravehicular activities. As an approach to raise the thermal conductivity (TC) of an ethylene vinyl acetate copolymer (Elvax 260), it was compounded with three types of carbon based nanofillers: multi-walled carbon nanotubes (MWCNTs), vapor grown carbon nanofibers (CNFs), and expanded graphite (EG). In addition, other nanofillers including metallized CNFs, nickel nanostrands, boron nitride, and powdered aluminum were also compounded with Elvax 260 in the melt at various loading levels. In an attempt to improve compatibility between Elvax 260 and the nanofillers, MWCNTs and EG were modified by surface coating and through noncovalent and covalent attachment of organic molecules containing alkyl groups. Ribbons of the nanocomposites were extruded to form samples in which the nanofillers were aligned in the direction of flow. Samples were also fabricated by compression molding to yield nanocomposites in which the nanofillers were randomly oriented. Mechanical properties of the aligned samples were determined by tensile testing while the degree of dispersion and alignment of nanoparticles were investigated using high-resolution scanning electron microscopy. TC measurements were performed using a laser flash (Nanoflash ) technique. TC of the samples was measured in the direction of, and perpendicular to, the alignment direction. Additionally, tubing was also extruded from select nanocomposite compositions and the TC and mechanical flexibility measured.
Endocrine Dysfunctions in Patients with Inherited Metabolic Diseases.
Erdöl, Şahin; Sağlam, Halil
2016-09-01
Inherited metabolic diseases (IMDs) can affect many organ systems, including the endocrine system. There are limited data regarding endocrine dysfunctions related to IMDs in adults, however, no data exist in pediatric patients with IMDs. The aim of this study was to investigate endocrine dysfunctions in patients with IMDs by assessing their demographic, clinical, and laboratory data. Data were obtained retrospectively from the medical reports of patients with IMDs who were followed by the division of pediatric metabolism and nutrition between June 2011 and November 2013. In total, 260 patients [139 males (53%) and 121 females (47%)] with an IMD diagnosis were included in the study. The mean age of the patients was 5.94 (range; 0.08 to 49) years and 95.8% (249 of 260 patients) were in the pediatric age group. Growth status was evaluated in 258 patients and of them, 27 (10.5%) had growth failure, all cases of which were attributed to non-endocrine reasons. There was a significant correlation between growth failure and serum albumin levels below 3.5 g/dL (p=0.002). Only three of 260 (1.1%) patients had endocrine dysfunction. Of these, one with lecithin-cholesterol acyltransferase deficiency and another with Kearns-Sayre syndrome had diabetes, and one with glycerol kinase deficiency had glucocorticoid deficiency. Endocrine dysfunction in patients with IMDs is relatively rare. For this reason, there is no need to conduct routine endocrine evaluations in most patients with IMDs unless a careful and detailed history and a physical examination point to an endocrine dysfunction.
Nechifor-Boilă, Adela Corina; Loghin, Andrada; Vacariu, Victor; Halaţiu, Vasile Bogdan; Borda, Angela
2015-01-01
Optimal recovery of nucleic acids from formalin-fixed paraffin-embedded (FFPE) tissues is highly dependent on a series of pre-extraction steps, mainly related (but not limited) to fixation. The aim of our study was to investigate if the storage period of the FFPE blocks had a significant effect on the isolated DNA. We examined the quantity and purity of the isolated DNA from 83 FFPE blocks, corresponding to malignant thyroid (n=28) and renal (n=55) carcinomas that had been stored in our department for up to eight years. The DNA extraction protocol was based on a precipitation method (MasterPure™ DNA Purification Kit, Epicentre), in accordance to the manufacturer instructions, optimized in our laboratory. A spectrophotometer was used to determine the yield (A260) and purity (A260/A280 ratio) of the isolated DNA. We successfully isolated good DNA quantity and purity from all our study cases (mean concentration: 223.4 ± 104.16 ng/μL; mean A260/A280 ratio: 1.68 ± 0.09). Moreover, no statistically significant differences were observed between tumor blocks stored for 2-3 years and 7-8 years, respectively, both in terms of DNA quantity (p=0.196) and purity (p=0.663). In conclusion, we successfully validated an efficient, reproducible DNA extraction technique that provided a good range of DNA concentrations and purity, regardless the type of tissue (thyroid or kidney). Moreover, we demonstrated that the storage period of the FFPE blocks does not have a significant influence on the DNA quantity and purity.
Directory of Open Access Journals (Sweden)
Mohammad A. Alqahtani
2015-01-01
Full Text Available Congenital adrenal hyperplasia (CAH due to steroid 11β-hydroxylase deficiency is the second most common form of CAH, resulting from a mutation in the CYP11B1 gene. Steroid 11β-hydroxylase deficiency results in excessive mineralcorticoids and androgen production leading to hypertension, precocious puberty with acne, enlarged penis, and hyperpigmentation of scrotum of genetically male infants. In the present study, we reported 3 male cases from a Saudi family who presented with penile enlargement, progressive darkness of skin, hypertension, and cardiomyopathy. The elder patient died due to heart failure and his younger brothers were treated with hydrocortisone and antihypertensive medications. Six months following treatment, cardiomyopathy disappeared with normal blood pressure and improvement in the skin pigmentation. The underlying molecular defect was investigated by PCR-sequencing analysis of all coding exons and intron-exon boundary of the CYP11B1 gene. A novel biallelic mutation c.780 G>A in exon 4 of the CYP11B1 gene was found in the patients. The mutation created a premature stop codon at amino acid 260 (p.W260∗, resulting in a truncated protein devoid of 11β-hydroxylase activity. Interestingly, a somatic mutation at the same codon (c.779 G>A, p.W260∗ was reported in a patient with papillary thyroid cancer (COSMIC database. In conclusion, we have identified a novel nonsense mutation in the CYP11B1 gene that causes classic steroid 11β-hydroxylase deficient CAH. Cardiomyopathy and cardiac failure can be reversed by early diagnosis and treatment.
40 CFR 273.81 - Factors for petitions to include other wastes under 40 CFR part 273.
2010-07-01
... AGENCY (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR UNIVERSAL WASTE MANAGEMENT Petitions To Include... generic name to identify the waste category (e.g., batteries), the definition of universal waste in § 260..., and specific management standards proposed or referenced by the petitioner (e.g., waste management...
Book Review :The Essential Guide to Rocky Mountain Mushrooms by Habitat
A mushroom guide book, 'The Essential Guide to Rocky Mountain Mushrooms by Habitat' by Cathy L. Cripps, Vera S. Evenson, and Michael Kou (University of Illinois Press, 260 pages), is reviewed in non-technical fashion from the standpoints of format, comprehensiveness, and clarity. Postive features (...
Nikkaji Dictionary: メタンイミン [MeCab user dictionary for science technology term[Archive
Lifescience Database Archive (English)
Full Text Available MeCab user dictionary for science technology term メタンイミン 名詞 一般 * * * * メタンイミン ... Nikkaji J260.357H 200906004407959940 C CA06 UNKNOWN_1 メタンイミン
Neonatal Predictors of Cognitive Ability in Adults Born Very Preterm : A Prospective Cohort Study
Breeman, L.D.; Jaekel, Julia; Baumann, Nicole; Bartmann, Peter; Wolke, Dieter
Aim To identify neonatal predictors to allow a developmental prognosis of very preterm / very-low birthweight (VP/VLBW) survivors' cognitive abilities into adult life. Method The Bavarian Longitudinal Study is a prospective whole population study that followed 260 VP/VLBW infants from birth to
El tiempo y la sabiduría en Poxoyëm. Un calendario sagrado entre los Ayook de Oaxaca
Rojas Martínez Gracida, Araceli
2012-01-01
The specific time-count made up of the combination of 20 signs and 13 numbers (260 days), was one of the essential traits of ancient Mesoamerican civilisations. Interestingly, this calendar system persists in some contemporary communities of Southern Mexico and Guatemala, where “daykeepers”,
South African Medical Journal - Vol 105, No 4 (2015)
African Journals Online (AJOL)
Basic and comprehensive emergency obstetric and neonatal care in 12 South African health districts · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. RC Pattinson, JD Makin, Y Pillay, N van den Broek, J Moodley, 256-260 ...
Novel Nucleophilic Compounds with Oxime Group as Reactivators of Paraoxon-Inhibited Cholinesterases
Czech Academy of Sciences Publication Activity Database
Musilová, L.; Jun, D.; Paleček, J.; Církva, Vladimír; Musílek, K.; Paar, M.; Hrabinová, M.; Pohanka, M.; Kuca, K.
2010-01-01
Roč. 7, č. 4 (2010), s. 260-264 ISSN 1570-1808 Grant - others:GA MO(CZ) OVUOFVZ200902 Program:OV Institutional research plan: CEZ:AV0Z40720504 Keywords : acetylcholinesterase * butyrylcholinesterase * nerve agent Subject RIV: CC - Organic Chemistry Impact factor: 0.668, year: 2010
The strength of frustration and quantum fluctuations in LiVCuO.sub.4./sub..
Czech Academy of Sciences Publication Activity Database
Nishimoto, S.; Drechsler, S.L.; Kuzian, R.; Richter, J.; Málek, Jiří; Schmitt, M.; van den Brink, J.; Rösner, H.
2012-01-01
Roč. 98, č. 3 (2012), "37007-p1"-"37007-p6" ISSN 0295-5075 Institutional research plan: CEZ:AV0Z10100520 Keywords : cuprate superconductors * neutron inelastic scattering * spin waves Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.260, year: 2012
Analysis of the essential spectrum of singular matrix differential operators
Czech Academy of Sciences Publication Activity Database
Ibrogimov, O. O.; Siegl, Petr; Tretter, C.
2016-01-01
Roč. 260, č. 4 (2016), s. 3881-3926 ISSN 0022-0396 Institutional support: RVO:61389005 Key words : essential spectrum * system of singular differential equations * operator matrix * Schur complement * magnetohydrodynamics * Stellar equilibrium model Subject RIV: BE - Theoretical Physics Impact factor: 1.988, year: 2016
Search Results | Page 15 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 141 - 150 of 260 ... The Arab Awakening, which started in Tunisia and swept through Egypt, has triggered profound transformation both within Arab states and in the region. These changes will ultimately shape the nature of state-society relations in the Arab world. Project.
A STUDY OF TWO DIRECTORIAL APPROACHES TO J. P. CLARK ...
African Journals Online (AJOL)
Mitch
Clark- Bekederemo is influenced by the Greeks in his creation of his Song of a Goat and ... figures making their actions seem unnecessarily arbitrary. (260). ..... as a person who does not feel any sense of guilt for the decision he takes. He does ...
Czech Academy of Sciences Publication Activity Database
Hubert, J.; Stejskal, V.; Münzbergová, Zuzana; Hajšlová, J.; Arthur, H. F.
2007-01-01
Roč. 42, č. 4 (2007), s. 283-290 ISSN 0168-8162 Grant - others:GA MŠk(CZ) 2B06099 Institutional research plan: CEZ:AV0Z60050516 Keywords : allergens * pesticide s * food Subject RIV: EF - Botanics Impact factor: 1.260, year: 2007
Biosorption of mercury on magnetically modified yeast cells
Czech Academy of Sciences Publication Activity Database
Yavuz, H.; Denizli, A.; Gungunes, H.; Šafaříková, Miroslava; Šafařík, Ivo
2006-01-01
Roč. 52, - (2006), s. 253-260 ISSN 1383-5866 R&D Projects: GA MŠk(CZ) OC 108 Institutional research plan: CEZ:AV0Z60870520 Keywords : mercury removal * magnetic biosorbents * yeast Subject RIV: EI - Biotechnology ; Bionics Impact factor: 2.497, year: 2006
Czech Academy of Sciences Publication Activity Database
Krištofíková, Z.; Kopecký, V. Jr.; Hofbauerová, Kateřina; Hovorková, P.; Řípová, D.
2008-01-01
Roč. 33, č. 3 (2008), s. 412-421 ISSN 0364-3190 Grant - others:GA Mšk(CZ) MZOPCP2005 Institutional research plan: CEZ:AV0Z50200510 Keywords : aging * hippocampus * choline carriers Subject RIV: EE - Microbiology, Virology Impact factor: 2.260, year: 2008
Journal of Obstetrics and Gynaecology of Eastern and Central Africa ...
African Journals Online (AJOL)
... of reproductive age die each year due to pregnancy-related complications. ... On a scale of 1 to 4 where for is very urgent need and 1 not urgent the scores were ... mellitus, 2.60 for preeclampsia and 3.04 for urinary tract infection symptoms.
76 FR 50436 - Kentucky Regulatory Program
2011-08-15
... instructions; or Mail/Hand Delivery/Courier: Joseph L. Blackburn, Field Office Director, Lexington Field Office... Office. Joseph L. Blackburn, Field Office Director, Lexington Field Office, Office of Surface Mining Reclamation and Enforcement, 2675 Regency Road, Lexington, Kentucky 40503, (859) 260-3900. Carl E. Campbell...
Digital Repository Service at National Institute of Oceanography (India)
Mazumdar, A.; Kocherla, M.; Carvalho, M.A.; Peketi, A.; Joshi, R.K.; Mahalaxmi, P.; Joao, H.M.; Jisha, R.
and further extends offshore into the Bay of Bengal (Fig. 1). It is a passive pericratonic basin covering an area of 260,000 km2 with water depth exceeding 3000 m (including deep offshore) (Singh, 2008). The Mahanadi offshore area represents a pull...
BioRadBase: A database for bioremediation of radioactive waste
African Journals Online (AJOL)
Windows User
2012-05-01
May 1, 2012 ... 16(3): 254-260. Llyod JR, Chesnes J, Glasauer S, Bunker DJ, Livens FR, Lovely DR ... Macaskie LE, Lloyd JR, Thomas RAP, Tolley MR (1996). The use of ... Carroll S, He Z, Gu B, Luo J, Criddle CS, Watson DB, Jardine PM,.
Search Results | Page 20 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 191 - 200 of 260 ... ... and Child Health filter · Climate Change 11 Apply Climate Change filter ... Palestinian Refugee Research Policy Papers ... Health Care Access for Migrant Domestic Workers (Philippines) ... to conduct social and gender analysis in environment and natural resource management (ENRM) research.
Radiation cross-linked PVC and its applications
International Nuclear Information System (INIS)
Lan Junming; Chen Ruyan; Jia Chaoxing; Li Min; Li Chengxin
1990-04-01
The radiation cross-linking technique is adopted for improving the polyvinyl chloride (PVC) heat-resistance and reducing its thermocontractibility. For examining its properties a small insulation sheath made from modified PVC material has been tested at 260 0 5 seconds. The results obtained were satisfactory
Multicultural personality questionnaire : Development of a short form
Van Der Zee, Karen; Van Oudenhoven, Jan Pieter; Ponterotto, Joseph G.; Fietzer, Alexander W.
2013-01-01
This study reports on the development of the Multicultural Personality Questionnaire-Short Form among 511 participants. Using a split-sample scale validation design, Study 1 (N = 260) employed a principal component analysis and rigorous item selection criteria to extract a 40-item short form
The Next Wave. Volume 19, Number 2
2012-01-01
Kong © 2.60% Q ^Vietnam Malaysia -^ °-10% 0.550/0 ^ J~ Singapore 0.34% © South Africa 0.16% / > Percentage of Malware Sources...defenses like dynamic reputation systems. Security researchers are currently debating whether personalization online could become a form of censorship
The Relationship of Visual Evoked Potential Asymmetries to the Performance of Sonar Operators
1981-08-11
also been related to EP variability. Schizophrenic adults and patients with Korsakoff’s Syndrome have shown higher evoked potential variability than...average evoked response in Korsakoff patients. J. Psychiatry Res. 6: 253-260, 1969. Santoro, T. and D. Fender. Rules for the perception of
Digital Repository Service at National Institute of Oceanography (India)
Balachandran, K.K.; Joseph, T.; Nair, K.K.C.; Nair, M.; Joseph, P.S.
The largest backwater system on the western coast of India is the Cochin Backwaters to which 16 major industries discharge nearly 0.104 M m super(3) d super(-1) of wastes containing organic wastes at 260 t d super(-1). The backwater receives...
hp-FEM electromechanical transduction model of ionic polymer metal composites
Czech Academy of Sciences Publication Activity Database
Pugal, D.; Šolín, Pavel; Kim, K.; Aabloo, A.
2014-01-01
Roč. 260, April (2014), s. 135-148 ISSN 0377-0427 R&D Projects: GA ČR(CZ) GAP102/11/0498 Institutional support: RVO:61388998 Keywords : hp-FEM * Nernst-Planck * Poisson Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 1.266, year: 2014
DEFF Research Database (Denmark)
Lampkowska, Joanna; Feld, Louise; Monaghan, Aine
2008-01-01
Optimal conditions and a standardized method for conjugation between two model lactococcal strains, Lactococcus lactis SH4174 (pAM beta 1-containing, erythromycin resistant donor) and L. lactis Bu2-60 (plasmid-free, erythromycin sensitive recipient), were developed and tested in a inter-laborator...
Scharf, Miri
2014-01-01
The associations between self-perception and attachment orientations and three aspects of children's competence within friendships were examined: "Managing conflict", "seeking support", and "giving support". Questionnaires were completed by 260 4th- and 5th-grade students. Homeroom teachers reported on the children's…
FY 1984 scientific and technical reports, articles, papers and presentations
Turner, J. E. (Compiler)
1984-01-01
This bibliography lists formal NASA technical reports, papers published in technical journals, and presentations by MSFC personnel. Abstracts are presented for 56 technical memorandum, and 13 technical papers. Six publications, over 260 contractor reports, and more than 300 papers cleared for publication are cited.
SEROTYPES AND ANTIMICROBIAL RESISTANCE OF SALMONELLA ENTERICA SSP IN CENTRAL THAILAND, 2001-2006
DEFF Research Database (Denmark)
Pantip, Sirichote; Aroon, B.; Kanokwan, Tienmanee
2010-01-01
This study was carried out to elucidate the epidemiological trends and antimicrobial susceptibilities against Salmonella serovars among Thai patients and asymptomatic carriers during 2001-2006 in central Thailand. A total of 1,401 human and 260 non-human isolates from various sources were include...
The work-home interface : The role of home-based predictors of burnout among mothers
Missler, M.A.; Stroebe, M.S.; van der Laan, G.
2014-01-01
Research into the work–home interface has mainly focused on work-related variables, leaving aspects associated with the home domain relatively understudied. This investigation examined both facilitation and conflict between home and work in a sample of 260 working mothers with children up to four
Pinelli, Thomas E.; And Others
1991-01-01
Reports on results from 260 aerospace engineers and scientists in United States, Europe, and Japan regarding their opinions about professional importance of technical communications; generation and utilization of technical communications; and relevant content of an undergraduate course in technical communications. The fields of cryogenics,…
Two convergent approaches toward novel carbocyclic C-nucleosides
Czech Academy of Sciences Publication Activity Database
Nencka, Radim; Šála, Michal; Dejmek, Milan; Dračínský, Martin; Holý, Antonín; Hřebabecký, Hubert
-, č. 23 (2010), s. 4119-4130 ISSN 0039-7881 R&D Projects: GA MŠk 1M0508 Institutional research plan: CEZ:AV0Z40550506 Keywords : carbocyclic C-nucleosides * convergent approach * uracil * pyrimidines Subject RIV: CC - Organic Chemistry Impact factor: 2.260, year: 2010
HERVd: the Human Endogenous Retrovirus Database: update
Czech Academy of Sciences Publication Activity Database
Pačes, Jan; Pavlíček, A.; Zíka, Radek; Jurka, J.; Pačes, Václav
2004-01-01
Roč. 32, č. 1 (2004), s. 50-50 ISSN 0305-1048 R&D Projects: GA MŠk LN00A079 Institutional research plan: CEZ:AV0Z5052915 Keywords : human * endogenous retrovirus * database Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 7.260, year: 2004
Hydrogen Sorption Performance of Pure Magnesium during Continued Cycling
DEFF Research Database (Denmark)
Vigeholm, B.; Kjøller, John; Larsen, B.
1983-01-01
Preliminary investigations of the hydrogen absorption - desorption by commercially pure magnesium powder under continuous operation show little or no reduction in hydrogen capacity up to 70 cycles and high temperature exposure exceeding 1200 h. Absorption was studied at 260°–425°C and hydrogen...
Search Results | Page 9 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 81 - 90 of 260 ... Towards evidence based ICT policy and regulation : e-skills. Evaluations. -. Because gender matters : strengthening social and gender analysis in ENRM in the Middle East and North Africa; project evaluation ... Gender and work in MENA : research capacity building activities; mid-term evaluation.
Czech Academy of Sciences Publication Activity Database
Zíka, Radek; Pačes, Jan; Pavlíček, A.; Pačes, Václav
2004-01-01
Roč. 32, suppl 2 (2004), s. 48-49 ISSN 0305-1048 R&D Projects: GA MŠk LN00A079 Institutional research plan: CEZ:AV0Z5052915 Keywords : server * alignment * vizualization Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 7.260, year: 2004
Iodometric determination of ampicillin in proprietary capsules | Ejele ...
African Journals Online (AJOL)
The concentration of ampicillin in ampicillin capsule preparations purchased in Owerri main market, Imo State of Nigeria, was determined using the iodometric titration method. The results showed that the ampicillin concentrations in the capsules contained between 250 and 260 mg/cap of ampicillin trihydrate. Statistical ...
Search Results | Page 26 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 251 - 260 of 374 ... Environmental and Health Impacts of Small-scale Gold Mining in Ecuador - Phase III ... based on the Ethnobotanical Garden and Traditional Medicine Concept ... where there is wide disparity in health services access and delivery. ... Corporate Social Responsibility in the Latin American Extractive ...
Levitsky, Adrian; Brismar, Kerstin; Hafström, Ingiäld; Hambardzumyan, Karen; Lourdudoss, Cecilia; van Vollenhoven, Ronald F.; Saevarsdottir, Saedis
2017-01-01
The aim of this paper was to analyse the impact of obesity, in addition to known predictors, on disease outcome in early rheumatoid arthritis (RA). Body mass index (BMI) was available in 260 patients from the Swedish pharmacotherapy trial (SWEFOT). Differences in disease activity (DAS28), functional
Digital Repository Service at National Institute of Oceanography (India)
Murty, V.S.N.; Sarma, Y.V.B.; Babu, M.T.; Rao, D.P.
(limited to the upper 40 m) inducEd. by the local winds. Waters of higher surface salinity near the coast characterize the upwelling. The freshwater influx near the head of the Bay diluted the surface salinity to as low as 26.0 x 10/3. The surface...
Ghoneim, Mohamed T.; Hussain, Muhammad Mustafa
2015-01-01
mono-crystalline silicon (100). The experimented devices show a bending radius down to 1.25 cm corresponding to 0.16% nominal strain (high pressure of ∼260 MPa), and full functionality up to 225 °C high temperature in ambient gas composition (21% oxygen
2016-04-30
partnership between the Army and Lockheed Martin, and the cost benefits that derive from economies of scale, the Marines sought to support its launchers...Between System Abort MTBEFF - Mean Time Between Essential Function Failure Overall Operational Time Avg. of 26.0 Hrs/Launcher/Month Deployed
Czech Academy of Sciences Publication Activity Database
Plášil, Jakub
2017-01-01
Roč. 62, č. 4 (2017), s. 253-260 ISSN 1802-6222 R&D Projects: GA ČR GA17-09161S Institutional support: RVO:68378271 Keywords : kamitugaite * uranyl phosphate * crystal structure * topology Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Geology Impact factor: 0.609, year: 2016
Androgen receptor expression as a prognostic and predictive ...
African Journals Online (AJOL)
Fatma Zakaria
2015-10-30
Oct 30, 2015 ... predictive marker in triple-negative breast cancer patients ... In univariate and multivariate anal- ... big markers and/or targets in breast cancer. .... Sex. Female. 74. 96.10. Male. 3. 3.90. PS. 0. 54. 70.13. 1. 21. 27.27. 2. 2. 2.60.
2012-05-22
... function), immune-related problems such as allergies and asthma, congenital malformations, infections, and... validated stress measures), physiological measures (heart rate and self-reported stress), and several types.../60 1,680 16,800 population (not NCS participants). Heart Monitoring Members of NCS target 700 1 2/60...
National Oceanic and Atmospheric Administration, Department of Commerce — This is calibrated CTD downcast data from five Alpha Helix cruises: HX235, 8/1/2000 - 9/30/2000 HX250, 9/1/2001 - 9/30/2001 HX260, 6/1/2002 - 6/30/2002 HX274,...
Modelling of Continual Induction Hardening in Quasi-Coupled Formulation
Czech Academy of Sciences Publication Activity Database
Barglik, J.; Doležel, Ivo; Karban, P.; Ulrych, B.
2005-01-01
Roč. 24, č. 1 (2005), s. 251-260 ISSN 0332-1649 Grant - others:PSRC(PL) 4T08C 04823 Institutional research plan: CEZ:AV0Z20570509 Keywords : mathematical modelling * electromagnetism * induction Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.188, year: 2005
2010-09-30
... Welding Wire Containers and Components Thereof and Welding Wire; Notice of Commission Determination To... within the United States after importation of certain bulk welding wire containers, components thereof, and welding wire by reason of infringement of certain claims of United States Patent Nos. 6,260,781; 6...
Magnetic alginate microparticles for purification of .alpha.-amylases
Czech Academy of Sciences Publication Activity Database
Šafaříková, Miroslava; Roy, I.; Gupta, M. N.; Šafařík, Ivo
2003-01-01
Roč. 105, - (2003), s. 255-260 ISSN 0168-1656 R&D Projects: GA MŠk OC 523.80; GA AV ČR IBS6087204 Institutional research plan: CEZ:AV0Z6087904 Keywords : alginate * ferrofluid * amalyses Subject RIV: CE - Biochemistry Impact factor: 2.543, year: 2003
Van Yperen, N.W.; Snijders, T.A.B.
2000-01-01
This study explored the extent to which negative health-related outcomes are associated with differences between work groups and with differences between individuals within work groups using R. A. Karasek's (1979) demands-control model. The sample consisted of 260 employees in 31 working groups of a
Nonsuicidal Self-Injury among Adolescents: A Training Priority for Primary Care Providers
Taliaferro, Lindsay A.; Muehlenkamp, Jennifer J.; Hetler, Joel; Edwall, Glenace; Wright, Catherine; Edwards, Anne; Borowsky, Iris W.
2013-01-01
Primary care providers were surveyed to determine how prepared they feel to address nonsuicidal self-injury (NSSI) among adolescents, their interest in training on NSSI, and factors associated with routinely asking about NSSI when providing health supervision. Participants included family medicine physicians ("n" = 260), pediatricians…
Alternative Methods in Laboratory Diagnosis of Equine Piroplasmosis
African Journals Online (AJOL)
Similar observation was made when such DNA material was examined in 1.5% agarose gel electrophoresis. Polymerase chain reaction of these cultures and purified genomic DNA yielded 260 base pair fragments diagnostic of B. equi infection. Spectrophotometry and agarose gel electrophoresis only indicate presence of ...
One-dimensional modeling of concentration distribution in pipe flow of combined-load slurry
Czech Academy of Sciences Publication Activity Database
Matoušek, Václav; Krupička, Jan
2014-01-01
Roč. 260, July (2014), s. 42-51 ISSN 0032-5910 R&D Projects: GA ČR GA103/09/0383 Institutional support: RVO:67985874 Keywords : hydraulic transport * sediment transport * two-phase flow * experiment * bed shear Subject RIV: BK - Fluid Dynamics Impact factor: 2.349, year: 2014
Czech Academy of Sciences Publication Activity Database
Bertaso, F.; Lill, Y.; Airas, J.M.; Espeut, J.; Blahoš, Jaroslav; Bockaert, J.; Fagni, L.; Betz, H.; Far, O.E.
2006-01-01
Roč. 99, - (2006), s. 288-298 ISSN 0022-3042 R&D Projects: GA ČR GA204/05/0920 Institutional research plan: CEZ:AV0Z50390512 Keywords : calmodulin * metabotropic glutamate receptor * calcium channel Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.260, year: 2006
Outbreaks of gastroenteritis linked to lettuce, Denmark, January 2010
DEFF Research Database (Denmark)
Ethelberg, S.; Lisby, M.; Bottiger, B.
2010-01-01
At least 11 linked outbreaks of gastroenteritis with a total of 260 cases have occurred in Denmark in mid January 2010. Investigations showed that the outbreaks were caused by norovirus of several genotypes and by enterotoxigenic Escherichia coli. Lettuce of the lollo bionda type grown in France...
Czech Academy of Sciences Publication Activity Database
Moreira, J.; Scholz, Tomáš; Luque, J.L.
2015-01-01
Roč. 60, č. 2 (2015), s. 254-260 ISSN 1230-2821 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Monogenea * Dactylogyridae * Urocleidoides * Erythrinidae * Hoplias aimara * Xingu River * Brazil Subject RIV: EG - Zoology Impact factor: 1.293, year: 2015
McDermid, Richard M.; Cappellari, Michele; Alatalo, Katherine; Bayet, Estelle; Blitz, Leo; Bois, Maxime; Bournaud, Frédéric; Bureau, Martin; Crocker, Alison F.; Davies, Roger L.; Davis, Timothy A.; de Zeeuw, P. T.; Duc, Pierre-Alain; Emsellem, Eric; Khochfar, Sadegh; Krajnović, Davor; Kuntschner, Harald; Morganti, Raffaella; Naab, Thorsten; Oosterloo, Tom; Sarzi, Marc; Scott, Nicholas; Serra, Paolo; Weijmans, Anne-Marie; Young, Lisa M.
We report on empirical trends between the dynamically determined stellar initial mass function (IMF) and stellar population properties for a complete, volume-limited sample of 260 early-type galaxies from the ATLAS3D project. We study trends between our dynamically derived IMF normalization αdyn ≡
Gutiierrez, Gabriel; Vanderwood, Mike L.
2013-01-01
The literacy growth of 260 second-grade English learners (ELs) with varying degrees of English language proficiency (e.g., Beginning, Early Intermediate, Intermediate, Early Advanced and Advanced English language proficiency) was assessed with English literacy skill assessments. Dynamic Indicators of Basic Early Literacy Skills measures were…
Nehm, Ross H.; Ha, Minsu; Mayfield, Elijah
2012-01-01
This study explored the use of machine learning to automatically evaluate the accuracy of students' written explanations of evolutionary change. Performance of the Summarization Integrated Development Environment (SIDE) program was compared to human expert scoring using a corpus of 2,260 evolutionary explanations written by 565 undergraduate…
Search Results | Page 26 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 251 - 260 of 8492 ... Women supporting women: Networked civic engagement to foster effective women's leadership for inclusive policymaking. “Women supporting Women” is an applied ... Transitions in Sub-Saharan Africa. What limits women's ability to become financially self-sufficient from an early age in Africa?
Search Results | Page 26 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 251 - 260 of 8491 ... To sustain democratization in Myanmar, IDRC and Global Affairs Canada are launching a ... and engagement in the transition process and to promote economic growth th ... The man revamping Brazil's approach to water quality ... Women's Early Labour Market Transitions in Sub-Saharan Africa.
Tekieli Koay, Mary Ellen; Lass, Norman J.; Parrill, Madaline; Naeser, Danielle; Babin, Kelly; Bayer, Olivia; Cook, Megan; Elmore, Madeline; Frye, Rachel; Kerwood, Samantha
2016-01-01
An extensive Internet search was conducted to obtain pre-admission information and acceptance statistics from 260 graduate programmes in speech-language pathology accredited by the American Speech-Language-Hearing Association (ASHA) in the United States. ASHA is the national professional, scientific and credentialing association for members and…