WorldWideScience

Sample records for seaborgium 260

  1. First thermochemical property of Seaborgium determined

    Energy Technology Data Exchange (ETDEWEB)

    Tuerler, A. for a LBNL Berkeley - Univ. Bern - FLNR Dubna -GSI Darmstadt - TU Dresden - Chalmers Univ. of Technology Goeteborg - GH Kassel - ITS and LLNL Livermore - Univ. Mainz - Univ. Oslo - FZ Rossendorf - JAERI Tokai - PSI Villigen collaboration

    1997-09-01

    The chemical properties of SgO{sub 2}Cl{sub 2} (element 106 = Seaborgium, Sg) were successfully studied using the On-line Gas Chromatography Apparatus (OLGA III). After chemical separation of Sg the nuclides {sup 265}Sg and {sup 266}Sg were unambiguously identified and their half-lives were determined for the first time. The Sg nuclides were produced from the {sup 248}Cm({sup 22}Ne,4,5n){sup 266,265}Sg reaction at the GSI Darmstadt UNILAC accelerator. Simultaneously, short-lived W nuclides were produced from a small admixture of {sup 152}Gd to the Cm target material. As predicted by relativistic calculations and by extrapolations of chemical properties, it was demonstrated that Sg oxychlorides are indeed less volatile than their lighter homologue Mo- and equally or less volatile than W-oxychlorides. (author) 1 fig., 1 tab., 4 refs.

  2. First aqueous chemistry with Seaborgium (element 106)

    International Nuclear Information System (INIS)

    Schaedel, M.; Bruechle, W.; Schausten, B.; Schimpf, E.; Jaeger, E.; Wirth, G.; Guenther, R.; Gregorich, K.E.; Hoffman, D.C.; Lee, D.M.; Sylwester, E.R.; Nagame, Y.; Oura, Y.

    1996-11-01

    For the first time, chemical separations of element 106 (Seaborgium, Sg) were performed in aqueous solutions. The isotopes 265 Sg and 266 Sg were produced in the 248 Cm+ 22 Ne reaction at a beam energy of 121 MeV. The reaction products were continuously transported by a He(KCl)-jet to the computer-controlled liquid chromatography system ARCA. In 0.1 M HNO 3 /5 x 10 -4 M HF, Sg was found to be eluted within 10 s from 1.6 x 8 mm cation-exchange columns (Aminex A6, 17.5±2 μm) together with the hexavalent Mo- and W-ions, while hexavalent U-ions and tetravalent Zr-, Hf-, and element 104 ions were strongly retained on the column. Element 106 was detected by measuring correlated α-decays of the daughter isotopes 78-s 261 104 and 26-s 257 102. For the isotope 266 Sg, we have evidence for a spontaneous fission branch. It yields a partial spontaneous-fission half-life which is in agreement with recent theoretical predictions. The chemical results show that the most stable oxidation state of Sg in aqueous solution is +6, and that like its homologs Mo and W, Sg forms neutral or anionic oxo- or oxohalide-compounds under the present condition. In these first experiments, Sg exhibits properties very characteristic of group 6 elements, and does not show U-like properties. (orig.)

  3. Sorption behaviour of W, Hf, Lu, U, and Th on ion exchangers from HCl/H2O2 solutions. Model experiments for chemical studies of seaborgium (Sg)

    International Nuclear Information System (INIS)

    Schumann, D.; Andrassy, M.; Nitsche, H.; Misiak, R.; Schaedel, M.; Bruechle, W.; Schausten, B.; Kratz, J.V.

    1997-08-01

    In model experiments with W, Hf, Th, and U radionuclides, a chemical system was developed for the separation of seaborgium from element 104 and heavy actinides, i.e., cation exchange on DOWEX 50 x 8 from solutions containing 0.1-1.0 M HCl and 0.5-2.0 vol.% H 2 O 2 . The system should be suitable for fast on-line experiments if seaborgium exibits a non-uranium-like behaviour. Adding hydrogen peroxide to mixed HCl/HF solutions suppresses the partial sorption of W and, presumably seaborgium, on the cation exchanger. This way, the elution volume can be minimized. Prospects for anion exchange separations of group 6 from 4 elements are also briefly discussed. (orig.)

  4. 16 CFR 260.6 - General principles.

    Science.gov (United States)

    2010-01-01

    ... ENVIRONMENTAL MARKETING CLAIMS § 260.6 General principles. The following general principles apply to all environmental marketing claims, including, but not limited to, those described in § 260.7. In addition, § 260.7... 16 Commercial Practices 1 2010-01-01 2010-01-01 false General principles. 260.6 Section 260.6...

  5. 49 CFR 260.7 - Priority consideration.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Priority consideration. 260.7 Section 260.7... REHABILITATION AND IMPROVEMENT FINANCING PROGRAM Overview § 260.7 Priority consideration. When evaluating applications, the Administrator will give priority consideration (but not necessarily in the following order...

  6. 49 CFR 195.260 - Valves: Location.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Valves: Location. 195.260 Section 195.260... PIPELINE Construction § 195.260 Valves: Location. A valve must be installed at each of the following locations: (a) On the suction end and the discharge end of a pump station in a manner that permits isolation...

  7. 49 CFR 260.19 - Preapplication meeting.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Preapplication meeting. 260.19 Section 260.19 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Financial Assistance § 260.19 Preapplication meeting. Potential Applicants may request a meeting with the...

  8. 21 CFR 573.260 - Calcium silicate.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Calcium silicate. 573.260 Section 573.260 Food and... Listing § 573.260 Calcium silicate. Calcium silicate, including synthetic calcium silicate, may be safely used as an anticaking agent in animal feed, provided that the amount of calcium silicate does not...

  9. 50 CFR 260.100 - Facilities.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Facilities. 260.100 Section 260.100... Basis 1 § 260.100 Facilities. Each official establishment shall be equipped with adequate sanitary facilities and accommodations, including, but not being limited to, the following: (a) Containers approved...

  10. 49 CFR 260.13 - Credit reform.

    Science.gov (United States)

    2010-10-01

    ... appropriations, direct payment of a Credit Risk Premium by the Applicant or a non-Federal infrastructure partner... 49 Transportation 4 2010-10-01 2010-10-01 false Credit reform. 260.13 Section 260.13... REHABILITATION AND IMPROVEMENT FINANCING PROGRAM Overview § 260.13 Credit reform. The Federal Credit Reform Act...

  11. 50 CFR 260.88 - Political activity.

    Science.gov (United States)

    2010-10-01

    ... part in political management or in political campaigns. Political activities in city, county, State, or... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Political activity. 260.88 Section 260.88... Products for Human Consumption Miscellaneous § 260.88 Political activity. All inspectors and licensed...

  12. 7 CFR 1209.260 - Reports.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Reports. 1209.260 Section 1209.260 Agriculture... CONSUMER INFORMATION ORDER Rules and Regulations Reports § 1209.260 Reports. Each first handler shall be required to report monthly to the Council such information as may be required under § 1209.60(a) of this...

  13. 7 CFR 868.260 - Information.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Information. 868.260 Section 868.260 Agriculture... Governing Application of Standards § 868.260 Information. Requests for the Rice Inspection Handbook, Equipment Handbook, or for information concerning approved devices and procedures, criteria for approved...

  14. 49 CFR 260.9 - Loan terms.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Loan terms. 260.9 Section 260.9 Transportation... TRANSPORTATION REGULATIONS GOVERNING LOANS AND LOAN GUARANTEES UNDER THE RAILROAD REHABILITATION AND IMPROVEMENT FINANCING PROGRAM Overview § 260.9 Loan terms. The maximum repayment period for direct loans and guaranteed...

  15. 40 CFR 82.260 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 17 2010-07-01 2010-07-01 false Definitions. 82.260 Section 82.260... STRATOSPHERIC OZONE Halon Emissions Reduction § 82.260 Definitions. Halon-containing equipment means equipment.... This group consists of the three halogenated hydrocarbons known as Halon 1211, Halon 1301, and Halon...

  16. 46 CFR 401.260 - Reports.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Reports. 401.260 Section 401.260 Shipping COAST GUARD... Pilots § 401.260 Reports. (a) A marine accident which occurs while a U.S. Registered Pilot is in the service of a vessel in U.S. or Canadian waters of the Great Lakes shall be reported by the Registered...

  17. 9 CFR 319.260 - Luncheon meat.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Luncheon meat. 319.260 Section 319.260... ORGANIZATION AND TERMINOLOGY; MANDATORY MEAT AND POULTRY PRODUCTS INSPECTION AND VOLUNTARY INSPECTION AND CERTIFICATION DEFINITIONS AND STANDARDS OF IDENTITY OR COMPOSITION Luncheon Meat, Loaves and Jellied Products...

  18. 24 CFR 241.260 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... SUPPLEMENTARY FINANCING FOR INSURED PROJECT MORTGAGES Contract Rights and Obligations § 241.260 Definitions. All of the definitions contained in § 241.1 shall apply to this subpart. In addition, the term contract... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Definitions. 241.260 Section 241...

  19. 21 CFR 1271.260 - Storage.

    Science.gov (United States)

    2010-04-01

    ... TISSUE-BASED PRODUCTS Current Good Tissue Practice § 1271.260 Storage. (a) Control of storage areas. You... distribution. (b) Temperature. You must store HCT/Ps at an appropriate temperature. (c) Expiration date. Where...

  20. 49 CFR 260.35 - Environmental assessment.

    Science.gov (United States)

    2010-10-01

    ... REHABILITATION AND IMPROVEMENT FINANCING PROGRAM Applications for Financial Assistance § 260.35 Environmental... decision by the Administrator on the applicant's financial assistance request. FRA's “Procedures for...

  1. 21 CFR 172.260 - Oxidized polyethylene.

    Science.gov (United States)

    2010-04-01

    ... to 19. (b) The additive is used or intended for use as a protective coating or component of protective coatings for fresh avocados, bananas, beets, coconuts, eggplant, garlic, grapefruit, lemons, limes... Coatings, Films and Related Substances § 172.260 Oxidized polyethylene. Oxidized polyethylene may be safely...

  2. 16 CFR 260.8 - Environmental assessment.

    Science.gov (United States)

    2010-01-01

    ....8 Commercial Practices FEDERAL TRADE COMMISSION GUIDES AND TRADE PRACTICE RULES GUIDES FOR THE USE OF ENVIRONMENTAL MARKETING CLAIMS § 260.8 Environmental assessment. (a) National Environmental Policy... and analysis to determine whether issuing the Guides for the Use of Environmental Marketing Claims...

  3. Cern faces 260m euro budget cuts

    CERN Multimedia

    Banks, Michael

    2010-01-01

    "The Cern particle-physics lab near Geneva is to slash about 260m euro ($340m) from its budget for 2011-2015. The cut, which was approved by Cern's council last month, will require the lab to scale back research into future particles accelerators" (0.5 page)

  4. 50 CFR 260.104 - Personnel.

    Science.gov (United States)

    2010-10-01

    ... belongings, eat food, drink beverages, chew gum, or use tobacco in any form in areas where food or food... FOOD PRODUCTS INSPECTION AND CERTIFICATION Inspection and Certification of Establishments and Fishery... Basis 1 § 260.104 Personnel. The establishment management shall be responsible for taking all...

  5. 45 CFR 2541.260 - Non-Federal audit.

    Science.gov (United States)

    2010-10-01

    ... awards in a fiscal year, shall: (1) Determine whether State or local subgrantees have met the audit... 45 Public Welfare 4 2010-10-01 2010-10-01 false Non-Federal audit. 2541.260 Section 2541.260... GOVERNMENTS Post-Award Requirements § 2541.260 Non-Federal audit. (a) Basic rule. Grantees and subgrantees are...

  6. 46 CFR 107.260 - Rated load test for cranes.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Rated load test for cranes. 107.260 Section 107.260... INSPECTION AND CERTIFICATION Inspection and Certification § 107.260 Rated load test for cranes. (a) To meet the requirements in § 107.231(l), each crane must meet the following rated load test at both the...

  7. 36 CFR 2.60 - Livestock use and agriculture.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Livestock use and agriculture. 2.60 Section 2.60 Parks, Forests, and Public Property NATIONAL PARK SERVICE, DEPARTMENT OF THE INTERIOR RESOURCE PROTECTION, PUBLIC USE AND RECREATION § 2.60 Livestock use and agriculture. (a) The...

  8. 49 CFR 260.17 - Credit risk premium analysis.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Credit risk premium analysis. 260.17 Section 260... Financial Assistance § 260.17 Credit risk premium analysis. (a) When Federal appropriations are not available to cover the total subsidy cost, the Administrator will determine the Credit Risk Premium...

  9. 49 CFR 260.15 - Credit risk premium.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Credit risk premium. 260.15 Section 260.15... REHABILITATION AND IMPROVEMENT FINANCING PROGRAM Overview § 260.15 Credit risk premium. (a) Where available... pay to the Administrator a Credit Risk Premium adequate to cover that portion of the subsidy cost not...

  10. 40 CFR 260.3 - Use of number and gender.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Use of number and gender. 260.3... (CONTINUED) HAZARDOUS WASTE MANAGEMENT SYSTEM: GENERAL General § 260.3 Use of number and gender. As used in parts 260 through 265 and 268 of this chapter: (a) Words in the masculine gender also include the...

  11. 50 CFR 260.70 - Schedule of fees.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Schedule of fees. 260.70 Section 260.70... Products for Human Consumption Fees and Charges § 260.70 Schedule of fees. (a) Unless otherwise provided in a written agreement between the applicant and the Secretary, the fees to be charged and collected...

  12. 21 CFR 137.260 - Enriched corn meals.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Enriched corn meals. 137.260 Section 137.260 Food... Flours and Related Products § 137.260 Enriched corn meals. (a) Enriched corn meals are the foods, each of which conforms to the definition and standard of identity prescribed for a kind of corn meal by §§ 137...

  13. 46 CFR 28.260 - Electronic position fixing devices.

    Science.gov (United States)

    2010-10-01

    ... Trade § 28.260 Electronic position fixing devices. Each vessel 79 feet (24 meters) or more in length must be equipped with an electronic position fixing device capable of providing accurate fixes for the... 46 Shipping 1 2010-10-01 2010-10-01 false Electronic position fixing devices. 28.260 Section 28...

  14. 21 CFR 176.260 - Pulp from reclaimed fiber.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Pulp from reclaimed fiber. 176.260 Section 176.260 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION (CONTINUED) INDIRECT FOOD ADDITIVES: PAPER AND PAPERBOARD COMPONENTS Substances...

  15. 40 CFR 260.1 - Purpose, scope, and applicability.

    Science.gov (United States)

    2010-07-01

    ....1 Section 260.1 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) HAZARDOUS WASTE MANAGEMENT SYSTEM: GENERAL General § 260.1 Purpose, scope, and applicability. (a) This part provides definitions of terms, general standards, and overview information applicable to...

  16. 50 CFR 260.79 - Travel and other expenses.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Travel and other expenses. 260.79 Section... PROCESSED FOOD PRODUCTS INSPECTION AND CERTIFICATION Inspection and Certification of Establishments and Fishery Products for Human Consumption Fees and Charges § 260.79 Travel and other expenses. Charges may be...

  17. 50 CFR 260.58 - Accessibility for sampling.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Accessibility for sampling. 260.58 Section... Fishery Products for Human Consumption Sampling § 260.58 Accessibility for sampling. Each applicant shall cause the processed products for which inspection is requested to be made accessible for proper sampling...

  18. 7 CFR 1901.260 - Coordination with other agencies.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 12 2010-01-01 2010-01-01 false Coordination with other agencies. 1901.260 Section... AGRICULTURE PROGRAM REGULATIONS PROGRAM-RELATED INSTRUCTIONS Procedures for the Protection of Historical and Archeological Properties § 1901.260 Coordination with other agencies. (a) When other Agencies are directly...

  19. 30 CFR 206.260 - Allocation of washed coal.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Allocation of washed coal. 206.260 Section 206... MANAGEMENT PRODUCT VALUATION Federal Coal § 206.260 Allocation of washed coal. (a) When coal is subjected to washing, the washed coal must be allocated to the leases from which it was extracted. (b) When the net...

  20. 16 CFR 260.3 - Structure of the guides.

    Science.gov (United States)

    2010-01-01

    ... ENVIRONMENTAL MARKETING CLAIMS § 260.3 Structure of the guides. The guides are composed of general principles and specific guidance on the use of environmental claims. These general principles and specific...

  1. 16 CFR 260.1 - Statement of purpose.

    Science.gov (United States)

    2010-01-01

    ... of Section 5 of the FTC Act to environmental advertising and marketing practices. They provide the... ENVIRONMENTAL MARKETING CLAIMS § 260.1 Statement of purpose. The guides in this part represent administrative...

  2. 40 CFR 1065.260 - Flame-ionization detector.

    Science.gov (United States)

    2010-07-01

    .... For compression-ignition engines, two-stroke spark-ignition engines, and four-stroke spark-ignition... CONTROLS ENGINE-TESTING PROCEDURES Measurement Instruments Hydrocarbon Measurements § 1065.260 Flame... that has compensation algorithms that are functions of other gaseous measurements and the engine's...

  3. 16 CFR 260.2 - Scope of guides.

    Science.gov (United States)

    2010-01-01

    ... through any other means, including marketing through digital or electronic means, such as the Internet or... ENVIRONMENTAL MARKETING CLAIMS § 260.2 Scope of guides. (a) These guides apply to environmental claims included in labeling, advertising, promotional materials and all other forms of marketing, whether asserted...

  4. 23 CFR 260.407 - Implementation and reimbursement.

    Science.gov (United States)

    2010-04-01

    ...) exclusive of travel, subsistence, or salary of trainees. (c) As provided in 23 U.S.C. 321(c), education and... EDUCATION AND TRAINING PROGRAMS State Education and Training Programs § 260.407 Implementation and...-related training and education. The principal recipients of this training shall be employees who are...

  5. 42 CFR 440.260 - Methods and standards to assure quality of services.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Methods and standards to assure quality of services. 440.260 Section 440.260 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH... and Limits Applicable to All Services § 440.260 Methods and standards to assure quality of services...

  6. 40 CFR 260.31 - Standards and criteria for variances from classification as a solid waste.

    Science.gov (United States)

    2010-07-01

    ... from classification as a solid waste. 260.31 Section 260.31 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) HAZARDOUS WASTE MANAGEMENT SYSTEM: GENERAL Rulemaking Petitions § 260.31 Standards and criteria for variances from classification as a solid waste. (a) The...

  7. 40 CFR 260.2 - Availability of information; confidentiality of information.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Availability of information; confidentiality of information. 260.2 Section 260.2 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) HAZARDOUS WASTE MANAGEMENT SYSTEM: GENERAL General § 260.2 Availability of information; confidentiality of...

  8. 45 CFR 260.52 - What are the basic provisions of the Family Violence Option (FVO)?

    Science.gov (United States)

    2010-10-01

    ... Provisions Apply to Victims of Domestic Violence? § 260.52 What are the basic provisions of the Family... 45 Public Welfare 2 2010-10-01 2010-10-01 false What are the basic provisions of the Family Violence Option (FVO)? 260.52 Section 260.52 Public Welfare Regulations Relating to Public Welfare OFFICE...

  9. 45 CFR 260.51 - What definitions apply to this subpart?

    Science.gov (United States)

    2010-10-01

    ... of Domestic Violence? § 260.51 What definitions apply to this subpart? Family Violence Option (or FVO... 45 Public Welfare 2 2010-10-01 2010-10-01 false What definitions apply to this subpart? 260.51 Section 260.51 Public Welfare Regulations Relating to Public Welfare OFFICE OF FAMILY ASSISTANCE...

  10. 18 CFR 260.1 - FERC Form No. 2, Annual report for Major natural gas companies.

    Science.gov (United States)

    2010-04-01

    ... report for Major natural gas companies. 260.1 Section 260.1 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION, DEPARTMENT OF ENERGY APPROVED FORMS, NATURAL GAS ACT STATEMENTS AND REPORTS (SCHEDULES) § 260.1 FERC Form No. 2, Annual report for Major natural gas companies. (a...

  11. 40 CFR 725.260 - Submission of health and environmental effects data.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Submission of health and environmental effects data. 725.260 Section 725.260 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... for Research and Development Activities § 725.260 Submission of health and environmental effects data...

  12. 50 CFR 260.81 - Readjustment and increase in hourly rates of fees.

    Science.gov (United States)

    2010-10-01

    ... of fees. 260.81 Section 260.81 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL... Certification of Establishments and Fishery Products for Human Consumption Fees and Charges § 260.81 Readjustment and increase in hourly rates of fees. (a) When Federal Pay Act increases occur, the hourly rates...

  13. 16 CFR 260.5 - Interpretation and substantiation of environmental marketing claims.

    Science.gov (United States)

    2010-01-01

    ... deceptive or unsubstantiated environmental advertising claims. A current list of environmental marketing... environmental marketing claims. 260.5 Section 260.5 Commercial Practices FEDERAL TRADE COMMISSION GUIDES AND TRADE PRACTICE RULES GUIDES FOR THE USE OF ENVIRONMENTAL MARKETING CLAIMS § 260.5 Interpretation and...

  14. 30 CFR 260.3 - What is MMS's authority to collect information?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What is MMS's authority to collect information? 260.3 Section 260.3 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE OUTER CONTINENTAL SHELF OIL AND GAS LEASING General Provisions § 260.3 What is MMS's authority to...

  15. 17 CFR 260.0-11 - Liability for certain statements by issuers.

    Science.gov (United States)

    2010-04-01

    ... future economic performance contained in management's discussion and analysis of financial condition and... statements by issuers. 260.0-11 Section 260.0-11 Commodity and Securities Exchanges SECURITIES AND EXCHANGE... § 260.0-11 Liability for certain statements by issuers. (a) A statement within the coverage of paragraph...

  16. 12 CFR 250.260 - Miscellaneous interpretations; gold coin and bullion.

    Science.gov (United States)

    2010-01-01

    ... requirements? No. Section 19(c) of the Federal Reserve Act requires that reserve balances be satisfied either... bullion. 250.260 Section 250.260 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM MISCELLANEOUS INTERPRETATIONS Interpretations § 250.260 Miscellaneous...

  17. 17 CFR 260.7a-25 - Words relating to the future.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Words relating to the future. 260.7a-25 Section 260.7a-25 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... § 260.7a-25 Words relating to the future. Unless the context clearly shows otherwise, whenever words...

  18. 17 CFR 260.7a-24 - Words relating to periods of time in the past.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Words relating to periods of time in the past. 260.7a-24 Section 260.7a-24 Commodity and Securities Exchanges SECURITIES AND... Requirements As to Contents § 260.7a-24 Words relating to periods of time in the past. Unless the context...

  19. 24 CFR 203.260 - Amount of mortgage insurance premium (periodic MIP).

    Science.gov (United States)

    2010-04-01

    ... Mortgage Insurance Premiums-Periodic Payment § 203.260 Amount of mortgage insurance premium (periodic MIP... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Amount of mortgage insurance premium (periodic MIP). 203.260 Section 203.260 Housing and Urban Development Regulations Relating to...

  20. 40 CFR 260.32 - Variances to be classified as a boiler.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Variances to be classified as a boiler... be classified as a boiler. In accordance with the standards and criteria in § 260.10 (definition of “boiler”), and the procedures in § 260.33, the Administrator may determine on a case-by-case basis that...

  1. 50 CFR 260.97 - Conditions for providing fishery products inspection service at official establishments.

    Science.gov (United States)

    2010-10-01

    ... processed foods and/or components thereof; (10) Furnish and provide laundry service, as required by NMFS... inspection service at official establishments. 260.97 Section 260.97 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE PROCESSED FISHERY...

  2. 37 CFR 260.3 - Terms for making payment of royalty fees.

    Science.gov (United States)

    2010-07-01

    ... royalty fees. 260.3 Section 260.3 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF... Terms for making payment of royalty fees. (a) All royalty payments shall be made to a designated agent(s... the month succeeding the month in which the royalty fees are set. (c) The agent designated to receive...

  3. 18 CFR 260.401 - FERC Form No. 552, Annual Report of Natural Gas Transactions.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false FERC Form No. 552, Annual Report of Natural Gas Transactions. 260.401 Section 260.401 Conservation of Power and Water...) Prescription. The annual report for natural gas market participants, designated as FERC Form No. 552, is...

  4. 45 CFR 260.54 - Do States have flexibility to grant good cause domestic violence waivers?

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Do States have flexibility to grant good cause domestic violence waivers? 260.54 Section 260.54 Public Welfare Regulations Relating to Public Welfare OFFICE OF FAMILY ASSISTANCE (ASSISTANCE PROGRAMS), ADMINISTRATION FOR CHILDREN AND FAMILIES, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL TEMPORAR...

  5. 30 CFR 260.110 - What bidding systems may MMS use?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What bidding systems may MMS use? 260.110 Section 260.110 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE OUTER... MMS use? We will apply a single bidding system selected from those listed in this section to each...

  6. 30 CFR 260.111 - What conditions apply to the bidding systems that MMS uses?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What conditions apply to the bidding systems that MMS uses? 260.111 Section 260.111 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE... What conditions apply to the bidding systems that MMS uses? (a) For each of the bidding systems in...

  7. 49 CFR 260.31 - Execution and filing of the application.

    Science.gov (United States)

    2010-10-01

    ... Credit Risk Premium due from Applicant, if any, as provided in § 260.15. Applicant agrees to pay such Credit Risk Premium prior to the disbursement of direct or guaranteed loan, as appropriate. Such Credit Risk Premium may be refunded as provided in § 260.15. Respectfully submitted. Applicant(s) Seal(s) by...

  8. Nuclear structure studies in the seaborgium region at SHIP

    Energy Technology Data Exchange (ETDEWEB)

    Antalic, S., E-mail: Stanislav.Antalic@fmph.uniba.sk; Andel, B. [Comenius University in Bratislava, 84248 Bratislava (Slovakia); Heßberger, F. P.; Khuyagbaatar, J. [GSI - Helmhotzzentrum für Schwerionenforschung GmbH, 64291 Darmstadt (Germany); Helmholtz Institute in Mainz, 55099 Mainz (Germany); Ackermann, D. [GSI - Helmhotzzentrum für Schwerionenforschung GmbH, 64291 Darmstadt (Germany); GANIL, 14074 Caen (France); Heinz, S.; Hofmann, S.; Kindler, B.; Laatiaoui, M.; Lommel, B. [GSI - Helmhotzzentrum für Schwerionenforschung GmbH, 64291 Darmstadt (Germany); Kalaninová, Z. [Comenius University in Bratislava, 84248 Bratislava (Slovakia); Laboratory of Nuclear Problems, JINR, 141980 Dubna (Russian Federation); Piot, J.; Vostinar, M. [GANIL, 14074 Caen (France)

    2015-10-15

    New decay data for the isotopes {sup 259}Sg and {sup 255}Rf were obtained at the velocity filter SHIP using an α-decay spectroscopy measurement. Both isotopes were produced and studied via a one neutron evaporation channel in the compound fusion reaction {sup 54}Cr+{sup 208}Pb. New isomeric states were observed and the single-particle level systematics for isotones with 151 and 153 neutrons were extended. A change of the ground-state configuration for the heaviest N = 151 isotones was observed. Detailed Monte-Carlo simulation for the α decay of {sup 259}Sg applying the GEANT4 toolkit was performed and compared with experimental data.

  9. Synthesis and detection of a seaborgium carbonyl complex

    NARCIS (Netherlands)

    Even, J.; Yakushev, A.; Duellmann, Ch E.; Haba, H.; Asai, M.; Sato, T. K.; Brand, H.; Di Nitto, A.; Eichler, R.; Fan, F. L.; Hartmann, W.; Huang, M.; Jaeger, E.; Kaji, D.; Kanaya, J.; Kaneya, Y.; Khuyagbaatar, J.; Kindler, B.; Kratz, J. V.; Krier, J.; Kudou, Y.; Kurz, N.; Lommel, B.; Miyashita, S.; Morimoto, K.; Morita, K.; Murakami, M.; Nagame, Y.; Nitsche, H.; Ooe, K.; Qin, Z.; Schaedel, M.; Steiner, J.; Sumita, T.; Takeyama, M.; Tanaka, K.; Toyoshima, A.; Tsukada, K.; Tuerler, A.; Usoltsev, I.; Wakabayashi, Y.; Wang, Y.; Wiehl, N.; Yamaki, S.

    2014-01-01

    Experimental investigations of transactinoide elements provide benchmark results for chemical theory and probe the predictive power of trends in the periodic table. So far, in gas-phase chemical reactions, simple inorganic compounds with the transactinoide in its highest oxidation state have been

  10. Amplifier Module for 260-GHz Band Using Quartz Waveguide Transitions

    Science.gov (United States)

    Padmanabhan, Sharmila; Fung, King Man; Kangaslahti, Pekka P.; Peralta, Alejandro; Soria, Mary M.; Pukala, David M.; Sin, Seth; Samoska, Lorene A.; Sarkozy, Stephen; Lai, Richard

    2012-01-01

    Packaging of MMIC LNA (monolithic microwave integrated circuit low-noise amplifier) chips at frequencies over 200 GHz has always been problematic due to the high loss in the transition between the MMIC chip and the waveguide medium in which the chip will typically be used. In addition, above 200 GHz, wire-bond inductance between the LNA and the waveguide can severely limit the RF matching and bandwidth of the final waveguide amplifier module. This work resulted in the development of a low-loss quartz waveguide transition that includes a capacitive transmission line between the MMIC and the waveguide probe element. This capacitive transmission line tunes out the wirebond inductance (where the wire-bond is required to bond between the MMIC and the probe element). This inductance can severely limit the RF matching and bandwidth of the final waveguide amplifier module. The amplifier module consists of a quartz E-plane waveguide probe transition, a short capacitive tuning element, a short wire-bond to the MMIC, and the MMIC LNA. The output structure is similar, with a short wire-bond at the output of the MMIC, a quartz E-plane waveguide probe transition, and the output waveguide. The quartz probe element is made of 3-mil quartz, which is the thinnest commercially available material. The waveguide band used is WR4, from 170 to 260 GHz. This new transition and block design is an improvement over prior art because it provides for better RF matching, and will likely yield lower loss and better noise figure. The development of high-performance, low-noise amplifiers in the 180-to- 700-GHz range has applications for future earth science and planetary instruments with low power and volume, and astrophysics array instruments for molecular spectroscopy. This frequency band, while suitable for homeland security and commercial applications (such as millimeter-wave imaging, hidden weapons detection, crowd scanning, airport security, and communications), also has applications to

  11. 40 CFR 260.30 - Non-waste determinations and variances from classification as a solid waste.

    Science.gov (United States)

    2010-07-01

    ... from classification as a solid waste. 260.30 Section 260.30 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) HAZARDOUS WASTE MANAGEMENT SYSTEM: GENERAL Rulemaking Petitions § 260.30 Non-waste determinations and variances from classification as a solid waste. In...

  12. 20 CFR 645.260 - What health and safety provisions apply to participants in Welfare-to-Work programs?

    Science.gov (United States)

    2010-04-01

    ... Administrative Requirements § 645.260 What health and safety provisions apply to participants in Welfare-to-Work... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false What health and safety provisions apply to participants in Welfare-to-Work programs? 645.260 Section 645.260 Employees' Benefits EMPLOYMENT AND TRAINING...

  13. 18 CFR 260.2 - FERC Form No. 2-A, Annual report for Nonmajor natural gas companies.

    Science.gov (United States)

    2010-04-01

    ..., Annual report for Nonmajor natural gas companies. 260.2 Section 260.2 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION, DEPARTMENT OF ENERGY APPROVED FORMS, NATURAL GAS ACT STATEMENTS AND REPORTS (SCHEDULES) § 260.2 FERC Form No. 2-A, Annual report for Nonmajor natural gas...

  14. 18 CFR 260.300 - FERC Form No. 3-Q, Quarterly financial report of electric utilities, licensees, and natural gas...

    Science.gov (United States)

    2010-04-01

    ..., Quarterly financial report of electric utilities, licensees, and natural gas companies. 260.300 Section 260... ENERGY APPROVED FORMS, NATURAL GAS ACT STATEMENTS AND REPORTS (SCHEDULES) § 260.300 FERC Form No. 3-Q, Quarterly financial report of electric utilities, licensees, and natural gas companies. (a) Prescription...

  15. 17 CFR 260.7a-16 - Inclusion of items, differentiation between items and answers, omission of instructions.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Inclusion of items, differentiation between items and answers, omission of instructions. 260.7a-16 Section 260.7a-16 Commodity and... INDENTURE ACT OF 1939 Formal Requirements § 260.7a-16 Inclusion of items, differentiation between items and...

  16. 40 CFR 260.41 - Procedures for case-by-case regulation of hazardous waste recycling activities.

    Science.gov (United States)

    2010-07-01

    ... of hazardous waste recycling activities. 260.41 Section 260.41 Protection of Environment... Rulemaking Petitions § 260.41 Procedures for case-by-case regulation of hazardous waste recycling activities... hazardous waste recycling activities described in § 261.6(a)(2)(iii) under the provisions of § 261.6 (b) and...

  17. 33 CFR 162.260 - Channel leading to San Juan Harbor, P.R.; use, administration, and navigation.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Channel leading to San Juan Harbor, P.R.; use, administration, and navigation. 162.260 Section 162.260 Navigation and Navigable... WATERWAYS NAVIGATION REGULATIONS § 162.260 Channel leading to San Juan Harbor, P.R.; use, administration...

  18. 41 CFR 102-118.260 - Must my agency send all quotations, tenders, or contracts with a TSP to GSA?

    Science.gov (United States)

    2010-07-01

    ... quotations, tenders, or contracts with a TSP to GSA? 102-118.260 Section 102-118.260 Public Contracts and... REGULATION TRANSPORTATION 118-TRANSPORTATION PAYMENT AND AUDIT Use of Government Billing Documents Quotations, Tenders Or Contracts § 102-118.260 Must my agency send all quotations, tenders, or contracts with a TSP to...

  19. 30 CFR 250.260 - What Coastal Zone Management Act (CZMA) information must accompany the DPP or DOCD?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What Coastal Zone Management Act (CZMA) information must accompany the DPP or DOCD? 250.260 Section 250.260 Mineral Resources MINERALS MANAGEMENT... Operations Coordination Documents (docd) § 250.260 What Coastal Zone Management Act (CZMA) information must...

  20. 40 CFR 260.43 - Legitimate recycling of hazardous secondary materials regulated under § 260.34, § 261.2(a)(2)(ii...

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Legitimate recycling of hazardous... (CONTINUED) HAZARDOUS WASTE MANAGEMENT SYSTEM: GENERAL Rulemaking Petitions § 260.43 Legitimate recycling of... demonstrate that the recycling is legitimate. Hazardous secondary material that is not legitimately recycled...

  1. Nonlinkage of D6S260, a putative schizophrenia locus, to bipolar affective disorder

    Energy Technology Data Exchange (ETDEWEB)

    Adams, L.J.; Mitchell, P.B. [Univ. of South Wales (Australia); Salmon, J. [Garvan Institute of Medical Research, Sydney, New South Wales (Australia)] [and others

    1996-09-20

    To examine whether genes that predispose to schizophrenia also confer a predisposition to other psychiatric disorders such as bipolar affective disorder (BAD), we tested for linkage between the recently identified schizophrenia susceptibility locus D6S260 and the inheritance of BAD in 12 large Australian pedigrees. We found no evidence for linkage over a region of 12-27 cM from the D6S260 locus, depending on the model used. Our results therefore do not provide support for the continuum theory of psychosis. 13 refs., 2 tabs.

  2. 17 CFR 260.10a-4 - Consent of trustee to service of process.

    Science.gov (United States)

    2010-04-01

    ... § 260.10a-4 Consent of trustee to service of process. At the time of filing an application pursuant to... such suit, action or proceeding may be commenced by the service of process upon said agent for service of process, and that such service shall be taken and held in all courts to be as valid and binding as...

  3. 77 FR 1777 - 60-Day Notice of Proposed Information Collection: DS-260, Electronic Application for Immigration...

    Science.gov (United States)

    2012-01-11

    ... DEPARTMENT OF STATE [Public Notice: 7750] 60-Day Notice of Proposed Information Collection: DS-260, Electronic Application for Immigration Visa and Alien Registration, 1405-0185 ACTION: Notice of request for... for Immigration Visa and Alien Registration. OMB Control Number: 1405-0185. Type of Request: Extension...

  4. 20 CFR 1002.260 - What pension benefit plans are covered under USERRA?

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false What pension benefit plans are covered under... REEMPLOYMENT RIGHTS ACT OF 1994 Reemployment Rights and Benefits Pension Plan Benefits § 1002.260 What pension...) defines an employee pension benefit plan as a plan that provides retirement income to employees, or defers...

  5. 17 CFR 260.10a-5 - Eligibility of Canadian Trustees.

    Science.gov (United States)

    2010-04-01

    ... pursuant to the Trust Companies Act (Canada), R.S.C. 1985, or the Canada Deposit Insurance Corporation Act... (CONTINUED) GENERAL RULES AND REGULATIONS, TRUST INDENTURE ACT OF 1939 Rule Under Section 310 § 260.10a-5... trustee under an indenture qualified or to be qualified under the Act and filed in connection with...

  6. 29 CFR 1952.260 - Description of the plan as initially approved.

    Science.gov (United States)

    2010-07-01

    ... have full authority to administer and to enforce all laws, rules and orders protecting employee safety... Section 1952.260 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH... general safety and construction safety standards while the Department of Public Health will be responsible...

  7. 260 Gbit/s photonic-wireless link in the THz band

    DEFF Research Database (Denmark)

    Pang, X.; Jia, S.; Ozolins, O.

    2016-01-01

    A single-transmitter/single-receiver THz link (0.3-0.5 THz) with a record net data rate of 260 Gbit/s is experimentally demonstrated. Spectrally efficient multi-channel signal transmission is enabled by a novel frequency-band-allocation scheme with pre-and post- digital equalization....

  8. STABILIZATION OF A MIXED WASTE SLUDGE SURROGATE CONTAINING MORE THAN 260 PPM MERCURY

    International Nuclear Information System (INIS)

    Smith, W. J.; Feizollahi, F.; Brimley, R.

    2002-01-01

    In an earlier demonstration of an innovative mercury stabilization technology for the Department of Energy, ATG's full-scale process stabilized mercury in soils that initially contained more than 260 ppm of mercury of unknown speciation. The treated waste satisfied the leaching standards for mercury that qualify wastes containing less than 260 ppm for land disposal. This paper describes the extension of that work to demonstrate a full-scale process for the stabilization of a representative sludge that contained more than 260 ppm of Hg of several mercury species. RCRA (Resource Conservation and Recovery Act) regulations now require the recovery of mercury from any waste containing more than 260 ppm of mercury, usually with thermal retorts. The results of this work with a surrogate sludge, and of the previous work with an actual soil, support a proposal now before the U.S. EPA (Environmental Protection Agency) to allow such wastes to be stabilized without retorting. The full-scale demonstration with a sulfide reagent reduced the mercury concentrations in extracts of treated sludge below the relevant leaching standard, a Universal Treatment Standard (UTS) limit of 0.025 mg mercury per liter of leachate generated by the Toxicity Characteristic Leaching Procedure (TCLP). The sulfide formulation reduced the concentration to about onehalf the UTS limit

  9. 18 CFR 260.200 - Original cost statement of utility property.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Original cost statement...) § 260.200 Original cost statement of utility property. Any natural gas company becoming subject to the... of its predecessors: (1) The original cost (estimated only if not determinable from existing records...

  10. 40 CFR 260.22 - Petitions to amend part 261 to exclude a waste produced at a particular facility.

    Science.gov (United States)

    2010-07-01

    ... the manufacturing processes or other operations and feed materials producing the waste and an assessment of whether such processes, operations, or feed materials can or might produce a waste that is not... a waste produced at a particular facility. 260.22 Section 260.22 Protection of Environment...

  11. 50 CFR 260.103 - Operations and operating procedures shall be in accordance with an effective sanitation program.

    Science.gov (United States)

    2010-10-01

    ... be in accordance with an effective sanitation program. 260.103 Section 260.103 Wildlife and Fisheries... Operations and operating procedures shall be in accordance with an effective sanitation program. (a) All..., choppers, and containers which fail to meet appropriate and adequate sanitation requirements will be...

  12. 45 CFR 260.55 - What are the additional requirements for Federal recognition of good cause domestic violence...

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false What are the additional requirements for Federal recognition of good cause domestic violence waivers? 260.55 Section 260.55 Public Welfare Regulations Relating to Public Welfare OFFICE OF FAMILY ASSISTANCE (ASSISTANCE PROGRAMS), ADMINISTRATION FOR CHILDREN AND FAMILIES, DEPARTMENT OF HEALTH AND...

  13. Periodic Impact Cratering and Extinction Events Over the Last 260 Million Years

    Science.gov (United States)

    Rampino, Michael R.; Caldeira, Ken

    2015-01-01

    The claims of periodicity in impact cratering and biological extinction events are controversial. Anewly revised record of dated impact craters has been analyzed for periodicity, and compared with the record of extinctions over the past 260 Myr. A digital circular spectral analysis of 37 crater ages (ranging in age from 15 to 254 Myr ago) yielded evidence for a significant 25.8 +/- 0.6 Myr cycle. Using the same method, we found a significant 27.0 +/- 0.7 Myr cycle in the dates of the eight recognized marine extinction events over the same period. The cycles detected in impacts and extinctions have a similar phase. The impact crater dataset shows 11 apparent peaks in the last 260 Myr, at least 5 of which correlate closely with significant extinction peaks. These results suggest that the hypothesis of periodic impacts and extinction events is still viable.

  14. A comparative study of MONTEBURNS and MCNPX 2.6.0 codes in ADS simulations

    International Nuclear Information System (INIS)

    Barros, Graiciany P.; Pereira, Claubia; Veloso, Maria A.F.; Velasquez, Carlos E.; Costa, Antonella L.

    2013-01-01

    The possible use of the MONTEBURNS and MCNPX 2.6.0 codes in Accelerator-driven systems (ADSs) simulations for fuel evolution description is discussed. ADSs are investigated for fuel breeding and long-lived fission product transmutation so simulations of fuel evolution have a great relevance. The burnup/depletion capability is present in both studied codes. MONTEBURNS code links Monte Carlo N-Particle Transport Code (MCNP) to the radioactive decay burnup code ORIGEN2, whereas MCNPX depletion/ burnup capability is a linked process involving steady-state flux calculations by MCNPX and nuclide depletion calculations by CINDER90. A lead-cooled accelerator-driven system fueled with thorium was simulated and the results obtained using MONTEBURNS code and the results from MCNPX 2.6.0 code were compared. The system criticality and the variation of the actinide inventory during the burnup were evaluated and the results indicate a similar behavior between the results of each code. (author)

  15. Genomic validation of PB 260 clone of rubber (Hevea brasiliensis) at Cikumpay Plantation by SSR marker

    Science.gov (United States)

    Royani, J. I.; Safarrida, A.; Rachmawati, I.; Khairiyah, H.; Mustika, I. P.; Suyono, A.; Rudiyana, Y.; Kubil; Nurjaya; Arianto, A.

    2017-05-01

    Rubber from Hevea brasiliensis is the only commercial natural rubber in the world. Propagation of rubber trees usually done by grafting and seed germination. BPPT had been producing rubber tree by in vitro technique with embryo somatic methods. Validation of mother plant for in vitro propagation is important to compare between mother plant and propagated plants. The aim for this research was to validation of PB 260 clone that planted at Cikumpay Plantation by SSR marker. Sampling of 10 rubber leaves were done at Cikumpay Plantation based on GPS position from the area of PB 260 clone. Rubber leaves were isolated with CTAB modification method to obtained DNA. Four of SSR primers from rubber, i.e.: hmac 4, hmac 5, hmct 1, and hmct 5, were used as primers to amplification of rubber DNA. The result showed that no band that different from 10 rubber of PB 260 clone at Cikumpay Plantation. This research will continue to compare genomic validation between mother plant and propagated plants that had been produced from BPPT.

  16. 30 CFR 260.130 - What criteria does MMS use for selecting bidding systems and bidding system components?

    Science.gov (United States)

    2010-07-01

    ... in § 260.110 to tracts selected for any OCS lease sale, we may, at our discretion, consider the... denote a ranking. (a) Providing fair return to the Federal Government; (b) Increasing competition; (c... in OCS lease sales. ...

  17. 17 CFR 260.4d-9 - Exemption for Canadian Trust Indentures from Specified Provisions of the Act.

    Science.gov (United States)

    2010-04-01

    ...) The Canada Business Corporations Act, R. S. C. 1985; (b) The Bank Act, R. S. C. 1985; (c) The Business Corporations Act, 1982 (Ontario), S. O. 1982; or (d) The Company Act, R.S.B.C. 1979, C. 59. [56 FR 30077, July... Indentures from Specified Provisions of the Act. 260.4d-9 Section 260.4d-9 Commodity and Securities Exchanges...

  18. The discovery of 260Md and the decay properties of 258Fm, 258m,gMd and 259Md

    International Nuclear Information System (INIS)

    Lougheed, R.W.; Hulet, E.K.; Dougan, R.J.; Wild, J.F.; Dupzyk, R.J.; Henderson, C.M.; Moody, K.J.; Hahn, R.L.; Suemmerer, K.; Bethune, G.

    1986-01-01

    We have discovered a new neutron-rich isotope, 260 Md, from 18 O and 22 Ne bombardments of 254 Es. We observed a spontaneous-fission (SF) activity with a half-life of 32 days in electromagnetically separated fractions with mass number 260 from these bombardments and we measured the mass and kinetic energy distributions of this SF activity. The mass distribution was symmetric with the principal energy peak at a total kinetic energy (TKE) of 234 MeV, similar to previous observations for heavy fermium isotopes. Surprisingly, we also observed a smaller symmetric component with a TKE of 195 MeV. We interpret these two peaks in the TKE distribution as arising from two types of fission in the same nucleus, or bimodal fission. The observed fission activity may be either from the SF decay of 260 Md or from 260 Fm which would arise from electron-capture (EC) decay of 260 Md. We have eliminated the possible β - decay of 260 Md by measuring β - -SF time correlations for the decay of 260 Md and we plan to determine whether 260 Md decays by EC by measuring time correlations between fermium X-rays and SF events. We also measured various properties of the heavy fermium and mendelevium isotopes and obtained 1. more accurate cross-sections for the neutron-rich mendelevium isotopes which we use to predict the production rates of yet undiscovered nuclides, 2. improved half-life measurements for 258m,g Md and 259 Md, 3. confirmation of the EC decay of 258m Md by measurement of the fermium X-rays preceding the SF decay of 258 Fm and 4. very substantially improved mass and TKE distributions for the SF decay of 258 Fm and 259 Md. (orig.)

  19. Demonstration of New Technologies Required for the Treatment of Mixed Waste Contaminated with {ge}260 ppm Mercury

    Energy Technology Data Exchange (ETDEWEB)

    Morris, M.I.

    2002-02-06

    The Resource Conservation and Recovery Act (RCRA) defines several categories of mercury wastes, each of which has a defined technology or concentration-based treatment standard, or universal treatment standard (UTS). RCRA defines mercury hazardous wastes as any waste that has a TCLP value for mercury of 0.2 mg/L or greater. Three of these categories, all nonwastewaters, fall within the scope of this report on new technologies to treat mercury-contaminated wastes: wastes as elemental mercury; hazardous wastes with less than 260 mg/kg [parts per million (ppm)] mercury; and hazardous wastes with 260 ppm or more of mercury. While this report deals specifically with the last category--hazardous wastes with 260 ppm or more of mercury--the other two categories will be discussed briefly so that the full range of mercury treatment challenges can be understood. The treatment methods for these three categories are as follows: Waste as elemental mercury--RCRA identifies amalgamation (AMLGM) as the treatment standard for radioactive elemental mercury. However, radioactive mercury condensates from retorting (RMERC) processes also require amalgamation. In addition, incineration (IMERC) and RMERC processes that produce residues with >260 ppm of radioactive mercury contamination and that fail the RCRA toxicity characteristic leaching procedure (TCLP) limit for mercury (0.20 mg/L) require RMERC, followed by AMLGM of the condensate. Waste with <260 ppm mercury--No specific treatment method is specified for hazardous wastes containing <260 ppm. However, RCRA regulations require that such wastes (other than RMERC residues) that exceed a TCLP mercury concentration of 0.20 mg/L be treated by a suitable method to meet the TCLP limit for mercury of 0.025 mg/L. RMERC residues must meet the TCLP value of {ge}0.20 mg/L, or be stabilized and meet the {ge}0.025 mg/L limit. Waste with {ge}260 ppm mercury--For hazardous wastes with mercury contaminant concentrations {ge}260 ppm and RCRA

  20. Dual-resolution dose assessments for proton beamlet using MCNPX 2.6.0

    Science.gov (United States)

    Chao, T. C.; Wei, S. C.; Wu, S. W.; Tung, C. J.; Tu, S. J.; Cheng, H. W.; Lee, C. C.

    2015-11-01

    The purpose of this study is to access proton dose distribution in dual resolution phantoms using MCNPX 2.6.0. The dual resolution phantom uses higher resolution in Bragg peak, area near large dose gradient, or heterogeneous interface and lower resolution in the rest. MCNPX 2.6.0 was installed in Ubuntu 10.04 with MPI for parallel computing. FMesh1 tallies were utilized to record the energy deposition which is a special designed tally for voxel phantoms that converts dose deposition from fluence. 60 and 120 MeV narrow proton beam were incident into Coarse, Dual and Fine resolution phantoms with pure water, water-bone-water and water-air-water setups. The doses in coarse resolution phantoms are underestimated owing to partial volume effect. The dose distributions in dual or high resolution phantoms agreed well with each other and dual resolution phantoms were at least 10 times more efficient than fine resolution one. Because the secondary particle range is much longer in air than in water, the dose of low density region may be under-estimated if the resolution or calculation grid is not small enough.

  1. Association between CD14 gene C-260T polymorphism and inflammatory bowel disease: a meta-analysis.

    Directory of Open Access Journals (Sweden)

    Zhengting Wang

    Full Text Available BACKGROUND: The gene encoding CD14 has been proposed as an IBD-susceptibility gene with its polymorphism C-260T being widely evaluated, yet with conflicting results. The aim of this study was to investigate the association between this polymorphism and IBD by conducting a meta-analysis. METHODOLOGY/PRINCIPAL FINDINGS: Seventeen articles met the inclusion criteria, which included a total of 18 case-control studies, including 1900 ulcerative colitis (UC cases, 2535 Crohn's disease (CD cases, and 4004 controls. Data were analyzed using STATA software. Overall, association between C-260T polymorphism and increased UC risk was significant in allelic comparison (odds ratio [OR]  =1.21, 95% confidence interval [CI]: 1.02-1.43; P=0.027, homozygote model (OR  =1.44, 95% CI: 1.03-2.01; P=0.033, as well as dominant model (OR  =1.36, 95% CI: 1.06-1.75; P=0.016. However, there was negative association between this polymorphism and CD risk across all genetic models. Subgroup analyses by ethnicity suggested the risk-conferring profiles of -260T allele and -260 TT genotype with UC in Asians, but not in Caucasians. There was a low probability of publication bias. CONCLUSIONS/SIGNIFICANCE: Expanding previous results of individual studies, our findings demonstrated that CD14 gene C-260T polymorphism might be a promising candidate marker in susceptibility to UC, especially in Asians.

  2. The observation of the therapeutic effectiveness of 131I on 260 youngster with Grave's hyperthyroidism

    International Nuclear Information System (INIS)

    Liu Binwen; Gao Xiusheng; Zhang Yahua; Pu Dongli

    2003-01-01

    Objective: To study the therapeutic effect and find new ways on treatment of Grave's hyperthyroidism in youngsters. Methods: 260 Grave's hyperthyroidism patients (age under 21 years) treated with 131 I were followed up 1-16 years later. Results: 118 of all patients were cured and 55 cases improved, failed treatment 2 cases, subclinical hypothyroidism 9 cases, clinical hypothyroidism 6 cases. 35 cases were treated with 131 I two or three times. All the patients with subclinical hypothyroidism and clinical hypothyroidism caused by 131 I were cured with medicine. 131 I treatment had no effect on growth and mentality and didn't cause leukemia nor thyroid cancer. Conclusions: The therapy of youngsters with Grave's hyperthyroidism with 131 I has the same effectiveness as adult. To the youngster Grave's patients who failed medical treatment, therapy with 131 I is safe and effective. It leads to temporary hypothyroidism which can be cured with medicine, no delayed hypothyroidism has been found

  3. Dynamic nuclear polarization by frequency modulation of a tunable gyrotron of 260GHz.

    Science.gov (United States)

    Yoon, Dongyoung; Soundararajan, Murari; Cuanillon, Philippe; Braunmueller, Falk; Alberti, Stefano; Ansermet, Jean-Philippe

    2016-01-01

    An increase in Dynamic Nuclear Polarization (DNP) signal intensity is obtained with a tunable gyrotron producing frequency modulation around 260GHz at power levels less than 1W. The sweep rate of frequency modulation can reach 14kHz, and its amplitude is fixed at 50MHz. In water/glycerol glassy ice doped with 40mM TEMPOL, the relative increase in the DNP enhancement was obtained as a function of frequency-sweep rate for several temperatures. A 68 % increase was obtained at 15K, thus giving a DNP enhancement of about 80. By employing λ/4 and λ/8 polarizer mirrors, we transformed the polarization of the microwave beam from linear to circular, and achieved an increase in the enhancement by a factor of about 66% for a given power. Copyright © 2015 Elsevier Inc. All rights reserved.

  4. Review of adverse reactions, including anaphylaxis, in 4,260 intravenous bolus injections

    International Nuclear Information System (INIS)

    Kanal, E.; Applegate, G.R.; Gillen, C.P.

    1990-01-01

    This paper evaluates the incidence and type of adverse reactions to Gd-DTPA (Magnevist) after bolus administration in an active clinical MR setting. Between May 1988 and March 1990, 4,260 bolus intravenous injections of Gd-DTPA, 0.1 mmol/kg, were administered during clinical MR examinations. Patient tolerance and reactions were recorded in each instance. All cases of suspected local infiltration were excluded from this study. Review of this data revealed 15 instances of nausea and 12 of emesis following contrast administration. In addition, there were five or fewer cases of associated headaches, dizziness, odd tastes, seizures (with prior seizure histories) mild chest pain, palpitations, hives, or wheezing

  5. Structure-based engineering of steroidogenic CYP260A1 for stereo- and regioselective hydroxylation of progesterone

    NARCIS (Netherlands)

    Khatri, Yogan; Jóźwik, Ilona K; Ringle, Michael; Ionescu, Irina Alexandra; Litzenburger, Martin; Hutter, Michael Christopher; Thunnissen, Andy-Mark W H; Bernhardt, Rita

    The production of regio- and stereoselectively hydroxylated steroids is of high pharmaceutical interest and can be achieved by cytochrome P450-based biocatalysts. CYP260A1 from Sorangium cellulosum strain So ce56 catalyzes hydroxylation of C19 or C21 steroids at the very unique 1-position. However,

  6. 18 CFR 260.9 - Reports by natural gas pipeline companies on service interruptions and damage to facilities.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Reports by natural gas..., NATURAL GAS ACT STATEMENTS AND REPORTS (SCHEDULES) § 260.9 Reports by natural gas pipeline companies on service interruptions and damage to facilities. (a)(1) Every natural gas company must report to the...

  7. 47 CFR 25.260 - Time sharing between DoD meteorological satellite systems and non-voice, non-geostationary...

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Time sharing between DoD meteorological satellite systems and non-voice, non-geostationary satellite systems in the 400.15-401 MHz band. 25.260 Section 25.260 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES...

  8. Insertion of Balloon Retained Gastrostomy Buttons: A 5-Year Retrospective Review of 260 Patients

    International Nuclear Information System (INIS)

    Power, Sarah; Kavanagh, Liam N.; Shields, Mary C.; Given, Mark F.; Keeling, Aoife N.; McGrath, Frank P.; Lee, Michael J.

    2013-01-01

    Radiologically inserted gastrostomy (RIG) is an established way of maintaining enteral nutrition in patients who cannot maintain nutrition orally. The purpose of this study was to evaluate the safety and efficacy of primary placement of a wide bore button gastrostomy in a large, varied patient population through retrospective review. All patients who underwent gastrostomy placement from January 1, 2004 to January 1, 2009 were identified. 18-Fr gastrostomy buttons (MIC-Key G) were inserted in the majority. Follow-up ranged from 6 months to 4.5 years. A total of 260 patients (M:F 140:120, average age 59.2 years) underwent gastrostomy during the study period. Overall success rate for RIG placement was 99.6 %, with success rate of 95.3 % for primary button insertion. Indications included neurological disorders (70 %), esophageal/head and neck malignancy (21 %), and other indications (9 %). Major and minor complication rates were 1.2 and 12.8 %, respectively. Thirty-day mortality rate was 6.8 %. One third of patients underwent gastrostomy reinsertion during the study period, the main indication for which was inadvertent catheter removal. Patency rate was high at 99.5 %. The maximum number of procedures in any patient was 8 (n = 2), and the average tube dwell time was 125 days. Primary radiological insertion of a wide bore button gastrostomy is a safe technique, with high success rate, high patency rate, and low major complication rate. We believe that it is feasible to attempt button gastrostomy placement in all patients, once tract length is within limits of tube length. If difficulty is encountered, then a standard tube may simply be placed instead.

  9. Insertion of Balloon Retained Gastrostomy Buttons: A 5-Year Retrospective Review of 260 Patients

    Energy Technology Data Exchange (ETDEWEB)

    Power, Sarah, E-mail: sarahpower28@yahoo.co.uk; Kavanagh, Liam N.; Shields, Mary C.; Given, Mark F.; Keeling, Aoife N.; McGrath, Frank P.; Lee, Michael J., E-mail: mlee@rcsi.ie [Beaumont Hospital, Department of Radiology (Ireland)

    2013-04-15

    Radiologically inserted gastrostomy (RIG) is an established way of maintaining enteral nutrition in patients who cannot maintain nutrition orally. The purpose of this study was to evaluate the safety and efficacy of primary placement of a wide bore button gastrostomy in a large, varied patient population through retrospective review. All patients who underwent gastrostomy placement from January 1, 2004 to January 1, 2009 were identified. 18-Fr gastrostomy buttons (MIC-Key G) were inserted in the majority. Follow-up ranged from 6 months to 4.5 years. A total of 260 patients (M:F 140:120, average age 59.2 years) underwent gastrostomy during the study period. Overall success rate for RIG placement was 99.6 %, with success rate of 95.3 % for primary button insertion. Indications included neurological disorders (70 %), esophageal/head and neck malignancy (21 %), and other indications (9 %). Major and minor complication rates were 1.2 and 12.8 %, respectively. Thirty-day mortality rate was 6.8 %. One third of patients underwent gastrostomy reinsertion during the study period, the main indication for which was inadvertent catheter removal. Patency rate was high at 99.5 %. The maximum number of procedures in any patient was 8 (n = 2), and the average tube dwell time was 125 days. Primary radiological insertion of a wide bore button gastrostomy is a safe technique, with high success rate, high patency rate, and low major complication rate. We believe that it is feasible to attempt button gastrostomy placement in all patients, once tract length is within limits of tube length. If difficulty is encountered, then a standard tube may simply be placed instead.

  10. Global radiation damage at 300 and 260 K with dose rates approaching 1 MGy s{sup −1}

    Energy Technology Data Exchange (ETDEWEB)

    Warkentin, Matthew; Badeau, Ryan; Hopkins, Jesse B. [Cornell University, Ithaca, NY 14853 (United States); Mulichak, Anne M.; Keefe, Lisa J. [Argonne National Laboratory, Argonne, IL 60439 (United States); Thorne, Robert E., E-mail: ret6@cornell.edu [Cornell University, Ithaca, NY 14853 (United States)

    2012-02-01

    Approximately half of global radiation damage to thaumatin crystals can be outrun at 260 K if data are collected in less than 1 s. Global radiation damage to 19 thaumatin crystals has been measured using dose rates from 3 to 680 kGy s{sup −1}. At room temperature damage per unit dose appears to be roughly independent of dose rate, suggesting that the timescales for important damage processes are less than ∼1 s. However, at T = 260 K approximately half of the global damage manifested at dose rates of ∼10 kGy s{sup −1} can be outrun by collecting data at 680 kGy s{sup −1}. Appreciable sample-to-sample variability in global radiation sensitivity at fixed dose rate is observed. This variability cannot be accounted for by errors in dose calculation, crystal slippage or the size of the data sets in the assay.

  11. The Performance of PS400 Subjected to Sliding Contact at Temperatures from 260 to 927 deg C

    Science.gov (United States)

    2016-09-14

    bilities. Such candidate applications include process control valve stems, inlet guide vane bushings , butterfly valve stems, and waste gate valves for...cobalt-based superalloy bushings loaded against reciprocating PS400-coated shaft specimens in a flat-on-cylinder configuration at Hertz contact...contact at temperatures from 260 to 927C. The tests were performed on stationary, uncoated cobalt-based superalloy bushings loaded against

  12. Characterization and source apportionment of organic aerosol at 260 m on a meteorological tower in Beijing, China

    Science.gov (United States)

    Zhou, Wei; Wang, Qingqing; Zhao, Xiujuan; Xu, Weiqi; Chen, Chen; Du, Wei; Zhao, Jian; Canonaco, Francesco; Prévôt, André S. H.; Fu, Pingqing; Wang, Zifa; Worsnop, Douglas R.; Sun, Yele

    2018-03-01

    Despite extensive efforts toward the characterization of submicron aerosols at ground level in the megacity of Beijing, our understanding of aerosol sources and processes at high altitudes remains low. Here we conducted a 3-month real-time measurement of non-refractory submicron aerosol (NR-PM1) species at a height of 260 m from 10 October 2014 to 18 January 2015 using an aerosol chemical speciation monitor. Our results showed a significant change in aerosol composition from the non-heating period (NHP) to the heating period (HP). Organics and chloride showed clear increases during HP due to coal combustion emissions, while nitrate showed substantial decreases from 28 to 15-18 %. We also found that NR-PM1 species in the heating season can have average mass differences of 30-44 % under similar emission sources yet different meteorological conditions. Multi-linear engine 2 (ME-2) using three primary organic aerosol (OA) factors as constraints, i.e., fossil-fuel-related OA (FFOA) dominantly from coal combustion emissions, cooking OA (COA), and biomass burning OA (BBOA) resolved from ground high-resolution aerosol mass spectrometer measurements, was applied to OA mass spectra of ACSM. Two types of secondary OA (SOA) that were well correlated with nitrate and chloride-CO, respectively, were identified. SOA played a dominant role in OA during all periods at 260 m although the contributions were decreased from 72 % during NHP to 58-64 % during HP. The SOA composition also changed significantly from NHP to HP. While the contribution of oxygenated OA (OOA) was decreased from 56-63 to 32-40 %, less oxidized OOA (LO-OOA) showed a large increase from 9-16 to 24-26 %. COA contributed a considerable fraction of OA at high altitude, and the contribution was relatively similar across different periods (10-13 %). In contrast, FFOA showed a large increase during HP due to the influences of coal combustion emissions. We also observed very different OA composition between ground level

  13. Odd-Z Transactinide Compound Nucleus Reactions Including the Discovery of 260Bh

    Energy Technology Data Exchange (ETDEWEB)

    Nelson, Sarah L. [Univ. of California, Berkeley, CA (United States)

    2008-01-01

    Several reactions producing odd-Z transactinide compound nuclei were studiedwith the 88-Inch Cyclotron and the Berkeley Gas-Filled Separator at the Lawrence Berkeley National Laboratory. The goal was to produce the same compound nucleus ator near the same excitation energy with similar values of angular momentum via differentnuclear reactions. In doing so, it can be determined if there is a preference in entrancechannel, because under these experimental conditions the survival portion of Swiatecki, Siwek-Wilcznska, and Wilczynski's"Fusion By Diffusion" model is nearly identical forthe two reactions. Additionally, because the same compound nucleus is produced, theexit channel is the same. Four compound nuclei were examined in this study: 258Db, 262Bh, 266Mt, and 272Rg. These nuclei were produced by using very similar heavy-ion induced-fusion reactions which differ only by one proton in the projectile or target nucleus (e.g.: 50Ti + 209Bi vs. 51V + 208Pb). Peak 1n exit channel cross sections were determined for each reaction in each pair, and three of the four pairs' cross sections were identical within statistical uncertainties. This indicates there is not an obvious preference of entrancechannel in these paired reactions. Charge equilibration immediately prior to fusionleading to a decreased fusion barrier is the likely cause of this phenomenon. In addition to this systematic study, the lightest isotope of element 107, bohrium, was discovered in the 209Bi(52Cr,n) reaction. 260Bh was found to decay by emission of a 10.16 MeV alpha particle with a half-life of 35$+19\\atop{-9}$ ms. The cross section is 59 pb at an excitation energy of 15.0 MeV. The effect of the N = 152 shell is also seen in this isotope's alpha particle energy, the first evidence of such an effect in Bh. All reactions studied are also compared to model predictions by Swiatecki

  14. Odd-Z Transactinide Compound Nucleus Reactions Including the Discovery of 260Bh

    International Nuclear Information System (INIS)

    Nelson, Sarah L; Nelson, Sarah L

    2008-01-01

    Several reactions producing odd-Z transactinide compound nuclei were studied with the 88-Inch Cyclotron and the Berkeley Gas-Filled Separator at the Lawrence Berkeley National Laboratory. The goal was to produce the same compound nucleus at or near the same excitation energy with similar values of angular momentum via different nuclear reactions. In doing so, it can be determined if there is a preference in entrance channel, because under these experimental conditions the survival portion of Swiatecki, Siwek-Wilcznska, and Wilczynski's 'Fusion By Diffusion' model is nearly identical for the two reactions. Additionally, because the same compound nucleus is produced, the exit channel is the same. Four compound nuclei were examined in this study: 258Db, 262Bh, 266Mt, and 272Rg. These nuclei were produced by using very similar heavy-ion induced-fusion reactions which differ only by one proton in the projectile or target nucleus (e.g.: 50Ti + 209Bi vs. 51V + 208Pb). Peak 1n exit channel cross sections were determined for each reaction in each pair, and three of the four pairs; cross sections were identical within statistical uncertainties. This indicates there is not an obvious preference of entrance channel in these paired reactions. Charge equilibration immediately prior to fusion leading to a decreased fusion barrier is the likely cause of this phenomenon. In addition to this systematic study, the lightest isotope of element 107, bohrium, was discovered in the 209Bi(52Cr,n) reaction. 260Bh was found to decay by emission of a 10.16 MeV alpha particle with a half-life of 35 ms. The cross section is 59 pb at an excitation energy of 15.0 MeV. The effect of the N = 152 shell is also seen in this isotope's alpha particle energy, the first evidence of such an effect in Bh. All reactions studied are also compared to model predictions by Swiatecki, Siwek-Wilcznska, and Wilczynski's 'Fusion By Diffusion' theory

  15. Phase-shift analysis in pion-/sup 4/He elastic scattering. [60 to 260 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Falomkin, I V; Nichitiu, F; Sapozhnikov, M G; Shcherbakov, YU A [Joint Inst. for Nuclear Research, Dubna (USSR); Balestra, F; Bollini, E [Turin Univ. (Italy). Istituto di Fisica

    1978-02-21

    An energy-independent phase-shift analysis (PSA) of the elastic scattering of pions on /sup 4/He, in the energy range 60 to 260 MeV has been performed. All possible solutions, arising from the phase-shift analysis ambiguity, have been analyzed. Particular care has been taken in the choice of the physical solution. The calculated phase shifts have been compared with the results of the energy-dependent phase-shift analysis (EDPSA) and with the optical-model predictions.

  16. Nuclear Data Evaluations at Manipal University: A=260-265. Status Report: March 31, 2011 to March 31, 2013

    Energy Technology Data Exchange (ETDEWEB)

    Gupta, M. [Manipal University, Manipal (India); Burrows, T. W. [Brookhaven National Laboratory, National Nuclear Data Center, Upton, NY (United States)

    2013-08-15

    A=260-265: The evaluation methodology developed in 2005Gu33 (A=266-294) has been applied to the mass region A=260-265. While the evaluation technique is based on 1992Ba77, additional evaluation tools include using the approximations of 1984Sc13 for estimates of half-lives and an updated parameter set for the Viola-Seaborg phenomenology (1966Vi04). The nuclides which form the subject matter of the present evaluation were covered in 1999Ar21, 1999Ak02, and 2001Ak11 and 2000Fi12 ({sup 265}Rf). New data are available and an update is due. Also, some of the {alpha}-decay mass chains from heavier nuclei (A{>=}266) end in this region and it was felt that the same evaluation methodology adopted for (distant) ancestors could be usefully extended to descendants within a given {alpha}-decay chain for consistency and uniformity of treatment. In instances where no new data are available, a re-evaluation of existing data within this internally consistent framework also yields useful information. The current evaluation spans about 9 elements comprising about Almost-Equal-To 31 observed nuclides. Approximately 40% of these nuclides have been experimentally studied using chemical techniques which often provide increased statistics and could be used for independent verification of the data. Relevant experimental quantities such as information on cross-sections and atomic properties derived from chemical studies are also provided. Future plans are presented.

  17. Onset of surface stimulated emission at 260 nm from AlGaN multiple quantum wells

    KAUST Repository

    Li, Xiaohang

    2015-12-14

    We demonstrated onset of deep-ultraviolet (DUV) surface stimulated emission (SE) from c-plane AlGaNmultiple-quantum well(MQW)heterostructuresgrown on a sapphire substrate by optical pumping at room temperature. The onset of SE became observable at a pumping power density of 630 kW/cm2. Spectral deconvolution revealed superposition of a linearly amplified spontaneous emission peak at λ ∼ 257.0 nm with a full width at half maximum (FWHM) of ∼12 nm and a superlinearly amplified SE peak at λ ∼ 260 nm with a narrow FWHM of less than 2 nm. In particular, the wavelength of ∼260 nm is the shortest wavelength of surface SE from III-nitride MQWheterostructures to date. Atomic force microscopy and scanning transmission electron microscopy measurements were employed to investigate the material and structural quality of the AlGaNheterostructures, showing smooth surface and sharp layer interfaces. This study offers promising results for AlGaNheterostructuresgrown on sapphire substrates for the development of DUV vertical cavity surface emitting lasers(VCSELs).

  18. Onset of surface stimulated emission at 260 nm from AlGaN multiple quantum wells

    International Nuclear Information System (INIS)

    Li, Xiaohang; Xie, Hongen; Ponce, Fernando A.; Ryou, Jae-Hyun; Detchprohm, Theeradetch; Dupuis, Russell D.

    2015-01-01

    We demonstrated onset of deep-ultraviolet (DUV) surface stimulated emission (SE) from c-plane AlGaN multiple-quantum well (MQW) heterostructures grown on a sapphire substrate by optical pumping at room temperature. The onset of SE became observable at a pumping power density of 630 kW/cm 2 . Spectral deconvolution revealed superposition of a linearly amplified spontaneous emission peak at λ ∼ 257.0 nm with a full width at half maximum (FWHM) of ∼12 nm and a superlinearly amplified SE peak at λ ∼ 260 nm with a narrow FWHM of less than 2 nm. In particular, the wavelength of ∼260 nm is the shortest wavelength of surface SE from III-nitride MQW heterostructures to date. Atomic force microscopy and scanning transmission electron microscopy measurements were employed to investigate the material and structural quality of the AlGaN heterostructures, showing smooth surface and sharp layer interfaces. This study offers promising results for AlGaN heterostructures grown on sapphire substrates for the development of DUV vertical cavity surface emitting lasers (VCSELs)

  19. Liver biomarker and in vitro assessment confirm the hepatic origin of aminotransferase elevations lacking histopathological correlate in beagle dogs treated with GABAA receptor antagonist NP260

    International Nuclear Information System (INIS)

    Harrill, Alison H.; Eaddy, John S.; Rose, Kelly; Cullen, John M.; Ramanathan, Lakshmi; Wanaski, Stephen; Collins, Stephen; Ho, Yu; Watkins, Paul B.; LeCluyse, Edward L.

    2014-01-01

    NP260 was designed as a first-in-class selective antagonist of α4-subtype GABA A receptors that had promising efficacy in animal models of pain, epilepsy, psychosis, and anxiety. However, development of NP260 was complicated following a 28-day safety study in dogs in which pronounced elevations of serum aminotransferase levels were observed, although there was no accompanying histopathological indication of hepatocellular injury. To further investigate the liver effects of NP260, we assayed stored serum samples from the 28-day dog study for liver specific miRNA (miR-122) as well as enzymatic biomarkers glutamate dehydrogenase and sorbitol dehydrogenase, which indicate liver necrosis. Cytotoxicity assessments were conducted in hepatocytes derived from dog, rat, and human liver samples to address the species specificity of the liver response to NP260. All biomarkers, except ALT, returned toward baseline by Day 29 despite continued drug treatment, suggesting adaptation to the initial injury. In vitro analysis of the toxicity potential of NP260 to primary hepatocytes indicated a relative sensitivity of dog > human > rat, which may explain, in part, why the liver effects were not evident in the rodent safety studies. Taken together, the data indicate that a diagnostic biomarker approach, coupled with sensitive in vitro screening strategies, may facilitate interpretation of toxicity potential when an adaptive event masks the underlying toxicity. - Highlights: • NP260 caused ALT elevations in dogs without evidence of hepatocellular injury. • SDH, GLDH, and miRNA-122 elevations occurred, confirming hepatocellular necrosis. • NP260 toxicity is greater in dog and human hepatocytes than in rat hepatocytes. • Species sensitivity may explain why the rodent studies failed to indicate risk. • Diagnostic biomarkers and hepatocyte studies aid interpretation of hepatotoxicity

  20. Total internal conversion coefficient of the 260. 9 keV (7/sup +/->3/sup -/) transition in sup(198m)Tl

    Energy Technology Data Exchange (ETDEWEB)

    Venkateswara Rao, N.; Suryanarayana, C.; Narayana, D.G.S.; Bhuloka Reddy, S.; Satynarayana, G.; Sastry, D.L.; Chintalapudi, S.N.

    1986-02-21

    The 1.87 hours 543.7 keV (7/sup +/) isomeric state in /sup 198/Tl is produced via /sup 197/Au(..cap alpha.., 3n)sup(198m)Tl (Esub(..cap alpha..) = 35 MeV) reaction. The total conversion coefficient of 260.9 keV (7/sup +/ -> 3/sup -/) is determined for the first time by the intensity balance method. The value of ..cap alpha..sub(T)(260.9 keV) is found to be 40.1 +- 8.6 which is in good agreement with the theoretical value of Hager and Seltzer for pure M4 transition. The gamma transition probability of the 260.9 keV (M4) is calculated using the present value of ..cap alpha..sub(T) and compared with the single-particle estimate.

  1. Reliable measurement of the Seebeck coefficient of organic and inorganic materials between 260 K and 460 K

    Energy Technology Data Exchange (ETDEWEB)

    Beretta, D.; Lanzani, G. [Center for Nano Science and Technology @PoliMi, Istituto Italiano di Tecnologia, via Pascoli 70/3, 20133 Milano (MI) (Italy); Dipartimento di Fisica, P.zza Leonardo da Vinci 32, Politecnico di Milano, 20133 Milano (MI) (Italy); Bruno, P.; Caironi, M., E-mail: mario.caironi@iit.it [Center for Nano Science and Technology @PoliMi, Istituto Italiano di Tecnologia, via Pascoli 70/3, 20133 Milano (MI) (Italy)

    2015-07-15

    A new experimental setup for reliable measurement of the in-plane Seebeck coefficient of organic and inorganic thin films and bulk materials is reported. The system is based on the “Quasi-Static” approach and can measure the thermopower in the range of temperature between 260 K and 460 K. The system has been tested on a pure nickel bulk sample and on a thin film of commercially available PEDOT:PSS deposited by spin coating on glass. Repeatability within 1.5% for the nickel sample is demonstrated, while accuracy in the measurement of both organic and inorganic samples is guaranteed by time interpolation of data and by operating with a temperature difference over the sample of less than 1 K.

  2. New Sesquiterpene Oxidations with CYP260A1 and CYP264B1 from Sorangium cellulosum So ce56.

    Science.gov (United States)

    Schifrin, Alexander; Litzenburger, Martin; Ringle, Michael; Ly, Thuy T B; Bernhardt, Rita

    2015-12-01

    Sesquiterpenes are natural products derived from the common precursor farnesyl pyrophosphate (FPP) but are highly diverse in structure and function. Cytochrome P450 enzymes (P450s) exhibit the unique ability to introduce molecular oxygen into non-activated C-H bonds. In plant biosynthetic pathways, P450s commonly derivatize sesquiterpene hydrocarbons. However, the potential of bacterial P450s for terpene derivatization is still underinvestigated. This work compares the substrate specificities and regioselectivities of the sesquiterpene hydroxylases CYP260A1 and CYP264B1 from myxobacterium Sorangium cellulosum So ce56. Four tested substrate classes (eremophilanes, humulanes, caryophyllanes, and cedranes) were converted by both P450s. The achievable variety of oxidations is demonstrated on the model substrates (+)-nootkatone and zerumbone. Increasing the number of functionally investigated P450s, this study represents a step towards the selective derivatization of sesquiterpenes. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  3. Application of a diagnostic methodology by quantification of 26:0 lysophosphatidylcholine in dried blood spots for Japanese newborn screening of X-linked adrenoleukodystrophy

    Directory of Open Access Journals (Sweden)

    Chen Wu

    2017-09-01

    Full Text Available X-linked adrenoleukodystrophy (X-ALD is a rare inherited metabolic disease that results in the accumulation of very long chain fatty acids (VLCFA in plasma and all tissues. Recent studies regarding cerebral X-ALD (CALD treatment emphasize the importance of its early diagnosis. 26:0 lysophosphatidylcholine (LysoPC is a sensitive biomarker for newborn screening of X-ALD, while its application for Japanese DBS is unclear. Therefore, we evaluated the feasibility of 20:0 LysoPC and 24:0 LysoPC along with 26:0 LysoPC for diagnosing X-ALD in a cohort of newborns (n = 604, healthy adults (n = 50 and patients (n = 4. Results indicated that 26:0 LysoPC had strong significance for discrimination of patients by the amounts of 2.0 to 4.0 and 0.1 to 1.9 pmol/punch for patients and newborns/healthy adults, respectively. Based on these values, we recommend that further diagnostic confirmation is essential if the amount of 26:0 LysoPC in DBS is above 1.7 pmol/punch.

  4. Pulmonary gas exchange and acid-base state at 5,260 m in high-altitude Bolivians and acclimatized lowlanders

    DEFF Research Database (Denmark)

    Wagner, Hans Peter; Araoz, Mauricio; Boushel, Robert Christopher

    2002-01-01

    hyperoxic work, capacity was 73% greater in N. Buffering of lactic acid was greater in N, with 20% less increase in base deficit per millimole per liter rise in lactate. These data show in L persistent alkalosis even after 9 wk at 5,260 m. In N, the data show 1) insignificant reduction in exercise capacity...

  5. Neonatal detection of Aicardi Goutières Syndrome by increased C26:0 lysophosphatidylcholine and interferon signature on newborn screening blood spots.

    Science.gov (United States)

    Armangue, Thais; Orsini, Joseph J; Takanohashi, Asako; Gavazzi, Francesco; Conant, Alex; Ulrick, Nicole; Morrissey, Mark A; Nahhas, Norah; Helman, Guy; Gordish-Dressman, Heather; Orcesi, Simona; Tonduti, Davide; Stutterd, Chloe; van Haren, Keith; Toro, Camilo; Iglesias, Alejandro D; van der Knaap, Marjo S; Goldbach Mansky, Raphaela; Moser, Anne B; Jones, Richard O; Vanderver, Adeline

    2017-11-01

    Aicardi Goutières Syndrome (AGS) is a heritable interferonopathy associated with systemic autoinflammation causing interferon (IFN) elevation, central nervous system calcifications, leukodystrophy and severe neurologic sequelae. An infant with TREX1 mutations was recently found to have abnormal C26:0 lysophosphatidylcholine (C26:0 Lyso-PC) in a newborn screening platform for X-linked adrenoleukodystrophy, prompting analysis of this analyte in retrospectively collected samples from individuals affected by AGS. In this study, we explored C26:0 Lyso-PC levels and IFN signatures in newborn blood spots and post-natal blood samples in 19 children with a molecular and clinical diagnosis of AGS and in the blood spots of 22 healthy newborns. We used Nanostring nCounter™ for IFN-induced gene analysis and a high-performance liquid chromatography with tandem mass spectrometry (HPLC MS/MS) newborn screening platform for C26:0 Lyso-PC analysis. Newborn screening cards from patients across six AGS associated genes were collected, with a median disease presentation of 2months. Thirteen out of 19 (68%) children with AGS had elevations of first tier C26:0 Lyso-PC (>0.4μM), that would have resulted in a second screen being performed in a two tier screening system for X-linked adrenoleukodystrophy (X-ALD). The median (95%CI) of first tier C26:0 Lyso-PC values in AGS individuals (0.43μM [0.37-0.48]) was higher than that seen in controls (0.21μM [0.21-0.21]), but lower than X-ALD individuals (0.72μM [0.59-0.84])(p<0.001). Fourteen of 19 children had elevated expression of IFN signaling on blood cards relative to controls (Sensitivity 73.7%, 95%CI 51-88%, Specificity 95%, 95% CI 78-99%) including an individual with delayed disease presentation (36months of age). All five AGS patients with negative IFN signature at birth had RNASEH2B mutations. Consistency of agreement between IFN signature in neonatal and post-natal samples was high (0.85). This suggests that inflammatory markers

  6. Skeletal Muscle PGC1α -1 Nucleosome Position and -260 nt DNA Methylation Determine Exercise Response and Prevent Ectopic Lipid Accumulation in Men.

    Science.gov (United States)

    Bajpeyi, Sudip; Covington, Jeffrey D; Taylor, Erin M; Stewart, Laura K; Galgani, Jose E; Henagan, Tara M

    2017-07-01

    Endurance exercise has been shown to improve lipid oxidation and increase mitochondrial content in skeletal muscle, two features that have shown dependence on increased expression of the peroxisome proliferator-activated receptor-γ coactivator 1α (PGC1α). It is also hypothesized that exercise-related alterations in PGC1α expression occur through epigenetic regulation of nucleosome positioning in association with differential DNA methylation status within the PGC1α promoter. In this study, we show that when primary human myotubes from obese patients with type 2 diabetes are exposed to lipolytic stimulus (palmitate, forskolin, inomycin) in vitro, nucleosome occupancy surrounding the -260 nucleotide (nt) region, a known regulatory DNA methylation site, is reduced. This finding is reproduced in vivo in the vastus lateralis from 11 healthy males after a single, long endurance exercise bout in which participants expended 650 kcal. Additionally, we show a significant positive correlation between fold change of PGC1α messenger RNA expression and -1 nucleosome repositioning away from the -260 nt methylation site in skeletal muscle tissue following exercise. Finally, we found that when exercise participants are divided into high and low responders based on the -260 nt methylation status, the -1 nucleosome is repositioned away from the regulatory -260 nt methylation site in high responders, those exhibiting a significant decrease in -260 nt methylation, but not in low responders. Additionally, high but not low responders showed a significant decrease in intramyocellular lipid content after exercise. These findings suggest a potential target for epigenetic modification of the PGC1α promoter to stimulate the therapeutic effects of endurance exercise in skeletal muscle. Copyright © 2017 Endocrine Society.

  7. Southern African ancient genomes estimate modern human divergence to 350,000 to 260,000 years ago.

    Science.gov (United States)

    Schlebusch, Carina M; Malmström, Helena; Günther, Torsten; Sjödin, Per; Coutinho, Alexandra; Edlund, Hanna; Munters, Arielle R; Vicente, Mário; Steyn, Maryna; Soodyall, Himla; Lombard, Marlize; Jakobsson, Mattias

    2017-11-03

    Southern Africa is consistently placed as a potential region for the evolution of Homo sapiens We present genome sequences, up to 13x coverage, from seven ancient individuals from KwaZulu-Natal, South Africa. The remains of three Stone Age hunter-gatherers (about 2000 years old) were genetically similar to current-day southern San groups, and those of four Iron Age farmers (300 to 500 years old) were genetically similar to present-day Bantu-language speakers. We estimate that all modern-day Khoe-San groups have been influenced by 9 to 30% genetic admixture from East Africans/Eurasians. Using traditional and new approaches, we estimate the first modern human population divergence time to between 350,000 and 260,000 years ago. This estimate increases the deepest divergence among modern humans, coinciding with anatomical developments of archaic humans into modern humans, as represented in the local fossil record. Copyright © 2017 The Authors, some rights reserved; exclusive licensee American Association for the Advancement of Science. No claim to original U.S. Government Works.

  8. The psychological process of reintegration following a nine month/260 day solo sailboat circumnavigation of the globe.

    Science.gov (United States)

    Kjaergaard, Anders; Leon, Gloria R; Venables, Noah C

    2015-04-01

    The focus of this case report is on the psychological reintegration process following the achievement of a highly challenging long-duration and solitary endeavor. The participant was a 29 year old male who successfully circumnavigated the globe during a 260 day solo sailing expedition. We assessed the psychological aftermath in terms of stability and change in personality characteristics and personal beliefs prior to, and at 180 and 360 days after the completion of the journey. Overall, the personality configuration reflected adaptive personality functioning. A belief in an internal locus of control was consistent throughout, as were perceptions of personal growth as a result of the circumnavigation experience. NEO PI-R Neuroticism, Extraversion, Openness, and Triarchic Psychopathy Measure (Tri-PM) Boldness scores remained stable. Positive personality change was reflected by an elevation in Conscientiousness; negative change by a decline in Agreeableness and an increase in Tri-PM Disinhibition. While overall the participant exhibited positive change as a result of his journey, there were also some negative aspects of the reintegration phase in regard to interactions with other persons. This latter change may be related to the effects of isolation from usual social contacts over an extended period. © 2015 Scandinavian Psychological Associations and John Wiley & Sons Ltd.

  9. Hypothyrodism in male patients: a descriptive, observational and cross-sectional study in a series of 260 men.

    Science.gov (United States)

    Iglesias, Pedro; Díez, Juan J

    2008-10-01

    Several aspects of thyroid dysfunction have not been fully characterized in large series of male patients. Our aim was to investigate the etiology and clinical features of hypothyroidism and assess the adequacy of replacement therapy in men attending an endocrinology clinic. We studied a group of 260 men (mean (+/-standard deviation) age 58.3 +/- 16.1 years) periodically seen because of thyroid hypofunction. We evaluated the etiology of hypothyroidism, presence or absence of goiter, time of evolution from diagnosis, current thyroid autoimmunity and thyroid functional status, and adequacy of disease control. Overt hypothyroidism was found in 182 (70.0%) and subclinical hypothyroidism in 78 (30.0%) patients. Autoimmune thyroiditis was the most frequent etiology (n = 107, 41.2%). Of these, 96 (89.7%) showed no goiter. Thyroid peroxidase antibodies were measured in 238 patients, being positive in 129 (54.2%) and negative in 109 (45.8%) patients. After excluding patients with thyroid carcinoma and those with recently diagnosed hypothyroidism, we found an adequate control of thyroid function, ie, normal thyrotropin and free thyroxine levels, in 95 patients (64.2%). Adequacy of treatment did not show any relationship with age, age at diagnosis, etiology, and autoimmune status. However, adequacy was significantly related to the degree of thyroid hypofunction (P < 0.001) and to the duration of disease (P < 0.01). We conclude that autoimmune thyroiditis, mainly the nongoitrous form, and postoperative hypothyroidism are the foremost causes of thyroid hypofunction in male patients. Adequacy of replacement treatment seems to be mainly related to the degree of thyroid hypofunction and the time from starting therapy.

  10. Electron photon spectra at atmospheric depths 260 and 400 gm/cm2 derived from the Goddard primary proton spectrum using Fermilab data and usual cascade theory

    International Nuclear Information System (INIS)

    Bhattacharyya, D.P.; Gautam, V.P.

    1982-01-01

    The integral electron photon spectra of cosmic rays at airplane altitude and Lenin Peak (altitudes 260 and 400 g-cm -2 air) have been estimated from the primary proton spectrum of Goddard Space Flight Group using Fermilab data of pp→π +- +X and conventional cascade theory. The derived electron-photon spectra fits well the experimental data of Ohta et al. (1975) and Cherdyntseva and Nikol'skii (1976) for energies above 4 TeV

  11. K2-60b and K2-107b. A Sub-Jovian and a Jovian Planet from the K2 Mission

    Energy Technology Data Exchange (ETDEWEB)

    Eigmüller, Philipp; Csizmadia, Szilard; Smith, Alexis M. S.; Cabrera, Juan; Erikson, Anders [Institute of Planetary Research, German Aerospace Center, Rutherfordstrasse 2, D-12489 Berlin (Germany); Gandolfi, Davide; Barragán, Oscar [Dipartimento di Fisica, Universitá di Torino, via P. Giuria 1, I-10125 Torino (Italy); Persson, Carina M.; Fridlund, Malcolm [Department of Earth and Space Sciences, Chalmers University of Technology, Onsala Space Observatory, SE-439 92 Onsala (Sweden); Donati, Paolo; Cusano, Felice [INAF—Osservatorio Astronomico di Bologna, Via Ranzani, 1, I-40127, Bologna (Italy); Korth, Judith; Grziwa, Sascha [Rheinisches Institut für Umweltforschung an der Universität zu Köln, Aachener Strasse 209, D-50931 Köln (Germany); Prieto-Arranz, Jorge; Nespral, David; Deeg, Hans J. [Instituto de Astrofísica de Canarias, E-38205 La Laguna, Tenerife (Spain); Saario, Joonas [Nordic Optical Telescope, Apartado 474, E-38700, Santa Cruz de La Palma (Spain); Cochran, William D.; Endl, Michael [Department of Astronomy and McDonald Observatory, University of Texas at Austin, 2515 Speedway, Stop C1400, Austin, TX 78712 (United States); Guenther, Eike W. [Thüringer Landessternwarte Tautenburg, Sternwarte 5, D-07778 Tautenberg (Germany); and others

    2017-03-01

    We report the characterization and independent detection of K2-60b, as well as the detection and characterization of K2-107b, two transiting hot gaseous planets from the K2 space mission. We confirm the planetary nature of the two systems and determine their fundamental parameters combining the K2 time-series data with FIES@NOT and HARPS-N@TNG spectroscopic observations. K2-60b has a radius of 0.683 ± 0.037 R {sub Jup} and a mass of 0.426 ± 0.037 M {sub Jup} and orbits a G4 V star with an orbital period of 3.00267 ± 0.00006 days. K2-107b has a radius of 1.44 ± 0.15 R {sub Jup} and a mass of 0.84 ± 0.08 M {sub Jup} and orbits an F9 IV star every 3.31392 ± 0.00002 days. K2-60b is among the few planets at the edge of the so-called “desert” of short-period sub-Jovian planets. K2-107b is a highly inflated Jovian planet orbiting an evolved star about to leave the main sequence.

  12. K2-60b and K2-107b. A Sub-Jovian and a Jovian Planet from the K2 Mission

    International Nuclear Information System (INIS)

    Eigmüller, Philipp; Csizmadia, Szilard; Smith, Alexis M. S.; Cabrera, Juan; Erikson, Anders; Gandolfi, Davide; Barragán, Oscar; Persson, Carina M.; Fridlund, Malcolm; Donati, Paolo; Cusano, Felice; Korth, Judith; Grziwa, Sascha; Prieto-Arranz, Jorge; Nespral, David; Deeg, Hans J.; Saario, Joonas; Cochran, William D.; Endl, Michael; Guenther, Eike W.

    2017-01-01

    We report the characterization and independent detection of K2-60b, as well as the detection and characterization of K2-107b, two transiting hot gaseous planets from the K2 space mission. We confirm the planetary nature of the two systems and determine their fundamental parameters combining the K2 time-series data with FIES@NOT and HARPS-N@TNG spectroscopic observations. K2-60b has a radius of 0.683 ± 0.037 R Jup and a mass of 0.426 ± 0.037 M Jup and orbits a G4 V star with an orbital period of 3.00267 ± 0.00006 days. K2-107b has a radius of 1.44 ± 0.15 R Jup and a mass of 0.84 ± 0.08 M Jup and orbits an F9 IV star every 3.31392 ± 0.00002 days. K2-60b is among the few planets at the edge of the so-called “desert” of short-period sub-Jovian planets. K2-107b is a highly inflated Jovian planet orbiting an evolved star about to leave the main sequence.

  13. Characterization and source apportionment of organic aerosol at 260 m on a meteorological tower in Beijing, China

    Directory of Open Access Journals (Sweden)

    W. Zhou

    2018-03-01

    Full Text Available Despite extensive efforts toward the characterization of submicron aerosols at ground level in the megacity of Beijing, our understanding of aerosol sources and processes at high altitudes remains low. Here we conducted a 3-month real-time measurement of non-refractory submicron aerosol (NR-PM1 species at a height of 260 m from 10 October 2014 to 18 January 2015 using an aerosol chemical speciation monitor. Our results showed a significant change in aerosol composition from the non-heating period (NHP to the heating period (HP. Organics and chloride showed clear increases during HP due to coal combustion emissions, while nitrate showed substantial decreases from 28 to 15–18 %. We also found that NR-PM1 species in the heating season can have average mass differences of 30–44 % under similar emission sources yet different meteorological conditions. Multi-linear engine 2 (ME-2 using three primary organic aerosol (OA factors as constraints, i.e., fossil-fuel-related OA (FFOA dominantly from coal combustion emissions, cooking OA (COA, and biomass burning OA (BBOA resolved from ground high-resolution aerosol mass spectrometer measurements, was applied to OA mass spectra of ACSM. Two types of secondary OA (SOA that were well correlated with nitrate and chloride–CO, respectively, were identified. SOA played a dominant role in OA during all periods at 260 m although the contributions were decreased from 72 % during NHP to 58–64 % during HP. The SOA composition also changed significantly from NHP to HP. While the contribution of oxygenated OA (OOA was decreased from 56–63 to 32–40 %, less oxidized OOA (LO-OOA showed a large increase from 9–16 to 24–26 %. COA contributed a considerable fraction of OA at high altitude, and the contribution was relatively similar across different periods (10–13 %. In contrast, FFOA showed a large increase during HP due to the influences of coal combustion emissions. We also

  14. Simultaneous measurements of particle number size distributions at ground level and 260 m on a meteorological tower in urban Beijing, China

    Science.gov (United States)

    Du, Wei; Zhao, Jian; Wang, Yuying; Zhang, Yingjie; Wang, Qingqing; Xu, Weiqi; Chen, Chen; Han, Tingting; Zhang, Fang; Li, Zhanqing; Fu, Pingqing; Li, Jie; Wang, Zifa; Sun, Yele

    2017-06-01

    Despite extensive studies into the characterization of particle number size distributions at ground level, real-time measurements above the urban canopy in the megacity of Beijing have never been performed to date. Here we conducted the first simultaneous measurements of size-resolved particle number concentrations at ground level and 260 m in urban Beijing from 22 August to 30 September. Our results showed overall similar temporal variations in number size distributions between ground level and 260 m, yet periods with significant differences were also observed. Particularly, accumulation-mode particles were highly correlated (r2 = 0. 85) at the two heights, while Aitken-mode particles presented more differences. Detailed analysis suggests that the vertical differences in number concentrations strongly depended on particle size, and particles with a mobility diameter between 100 and 200 nm generally showed higher concentrations at higher altitudes. Particle growth rates and condensation sinks were also calculated, which were 3.2 and 3.6 nm h-1, and 2.8 × 10-2 and 2.9 × 10-2 s-1, at ground level and 260 m, respectively. By linking particle growth with aerosol composition, we found that organics appeared to play an important role in the early stage of the growth (09:00-12:00 LT) while sulfate was also important during the later period. Positive matrix factorization of size-resolved number concentrations identified three common sources at ground level and 260 m, including a factor associated with new particle formation and growth events (NPEs), and two secondary factors that represent photochemical processing and regional transport. Cooking emission was found to have a large contribution to small particles and showed much higher concentration at ground level than 260 m in the evening. These results imply that investigation of NPEs at ground level in megacities needs to consider the influences of local cooking emissions. The impacts of regional emission controls on

  15. Custodian for elderly with memory impairment in Sweden - a study of 260 physicians' statements to the court.

    Science.gov (United States)

    Björkstén, Karin S; Fälldin, Kerstin; Ulfvarson, Johanna

    2014-08-26

    In the modern world with new family structures, international migration and increased life expectancy, there is a growing need for legal ways of assisting elderly with impaired mental capacity to decide about their life and assets. There are few studies about the physician's role when a court appoints proxies for vulnerable elderly. Many doctors do not know how to assess mental capacity, and most lawyers and judges know little about medicine. Applications for a custodian sent to the Stockholm Chief Guardian' Office in Sweden were used. Physician's statements to the court for elderly with memory impairment were selected and 260 statements were scrutinized with regard to formal quality, the narrative content and the physician who wrote it. The quality of the statements varied from one sentence to excellent. Most statements were written by senior family practitioners or geriatricians. Seventeen % of the statements were handwritten and had more formal shortcomings than machine/computer written statements.The majority of patients needed massive help with daily life and economy. Median age was 84 years of age. MMSE score was given in 20% of the cases and varied from 6-27.A diagnosis of dementia was established in 57%. At the time of application, at least 48% were in a hospital or nursing home and at least 27% were in their private home. Only 5% were living with a spouse or a child. In 53% of the cases, the doctor knew the patient, but in 40% of the cases, the identity of the patient was not confirmed. The physician found that 54% were unable to understand the idea of getting a custodian, but out of those very vulnerable elderly, 20% had signed consent and 57% were considered able to be heard in court. There is a large variation in the quality of physicians' statements to the court concerning the mental capacity of elderly patients with cognitive impairment. Many statements have serious short-comings, and the system is not safe. There is a strong need for guide

  16. Correlation between Wavelength Dispersive X-ray Fluorescence (WDXRF) analysis of hardened concrete for chlorides vs. Atomic Absorption (AA) analysis in accordance with AASHTO T- 260; sampling and testing for chloride ion in concrete and concrete raw mater

    Science.gov (United States)

    2014-04-01

    A correlation between Wavelength Dispersive X-ray Fluorescence(WDXRF) analysis of Hardened : Concrete for Chlorides and Atomic Absorption (AA) analysis (current method AASHTO T-260, procedure B) has been : found and a new method of analysis has been ...

  17. The removal of toxic metals from liquid effluents by ion exchange resins. Part II: cadmium(II/ sulphate/Lewatit TP260

    Directory of Open Access Journals (Sweden)

    Alguacil, F. J.

    2002-10-01

    Full Text Available The adsorption of cadmium (II, from aqueous sulphate solutions, on Lewatit TP260 resin has been investigated in batch equilibrium experiments. The influence of pH and temperature on metal adsorption capacity have also been examined. The kinetic performance of the resin has been assesed and the results have been correlated by the pore diffusion model. The resin has been used in mini-columns to study its performance under dynamics conditions. The desorption of metal ion is achieved using sulphuric acid (0.25M and 0.5M.

    Se estudia la adsorción de cadmio(II, de disoluciones en medio sulfato, sobre la resina Lewatit TP260. La adsorción del metal se ha investigado en función del pH, la temperatura y el tiempo de contacto con la resina. Los estudios cinéticos permiten correlacionar el proceso de intercambio iónico con el modelo de difusión en poro. Se ha empleado el sistema en mini columnas para evaluar el comportamiento de la resina bajo condiciones dinámicas. La desorción del metal se lleva a cabo con disoluciones de ácido sulfúrico (0,25M y 0,5M.

  18. Liver biomarker and in vitro assessment confirm the hepatic origin of aminotransferase elevations lacking histopathological correlate in beagle dogs treated with GABA{sub A} receptor antagonist NP260

    Energy Technology Data Exchange (ETDEWEB)

    Harrill, Alison H., E-mail: ahharrill@uams.edu [College of Public Health, The University of Arkansas for Medical Sciences, Little Rock, AR 72205 (United States); The Hamner-University of North Carolina Institute for Drug Safety Sciences, The Hamner Institutes for Health Sciences, Research Triangle Park, NC 27709 (United States); Eaddy, John S. [The Hamner-University of North Carolina Institute for Drug Safety Sciences, The Hamner Institutes for Health Sciences, Research Triangle Park, NC 27709 (United States); Rose, Kelly [The Institute for Chemical Safety Sciences, The Hamner Institutes for Health Sciences, Research Triangle Park, NC 27709 (United States); Cullen, John M. [College of Veterinary Medicine, North Carolina State University, Raleigh, NC 27607 (United States); Ramanathan, Lakshmi [QPS, Newark, DE 19711 (United States); Wanaski, Stephen; Collins, Stephen; Ho, Yu [NeuroTherapeutics Pharma, Inc., Chicago, IL 60631 (United States); Watkins, Paul B. [The Hamner-University of North Carolina Institute for Drug Safety Sciences, The Hamner Institutes for Health Sciences, Research Triangle Park, NC 27709 (United States); Schools of Pharmacy and Medicine, The University of North Carolina at Chapel Hill, Chapel Hill, NC 27599 (United States); LeCluyse, Edward L. [The Institute for Chemical Safety Sciences, The Hamner Institutes for Health Sciences, Research Triangle Park, NC 27709 (United States)

    2014-06-01

    NP260 was designed as a first-in-class selective antagonist of α4-subtype GABA{sub A} receptors that had promising efficacy in animal models of pain, epilepsy, psychosis, and anxiety. However, development of NP260 was complicated following a 28-day safety study in dogs in which pronounced elevations of serum aminotransferase levels were observed, although there was no accompanying histopathological indication of hepatocellular injury. To further investigate the liver effects of NP260, we assayed stored serum samples from the 28-day dog study for liver specific miRNA (miR-122) as well as enzymatic biomarkers glutamate dehydrogenase and sorbitol dehydrogenase, which indicate liver necrosis. Cytotoxicity assessments were conducted in hepatocytes derived from dog, rat, and human liver samples to address the species specificity of the liver response to NP260. All biomarkers, except ALT, returned toward baseline by Day 29 despite continued drug treatment, suggesting adaptation to the initial injury. In vitro analysis of the toxicity potential of NP260 to primary hepatocytes indicated a relative sensitivity of dog > human > rat, which may explain, in part, why the liver effects were not evident in the rodent safety studies. Taken together, the data indicate that a diagnostic biomarker approach, coupled with sensitive in vitro screening strategies, may facilitate interpretation of toxicity potential when an adaptive event masks the underlying toxicity. - Highlights: • NP260 caused ALT elevations in dogs without evidence of hepatocellular injury. • SDH, GLDH, and miRNA-122 elevations occurred, confirming hepatocellular necrosis. • NP260 toxicity is greater in dog and human hepatocytes than in rat hepatocytes. • Species sensitivity may explain why the rodent studies failed to indicate risk. • Diagnostic biomarkers and hepatocyte studies aid interpretation of hepatotoxicity.

  19. Study of properties of the plastic scintillator EJ-260 under irradiation with 150 MeV protons and 1.2MeV gamma-rays

    Science.gov (United States)

    Dormenev, V.; Brinkmann, K.-T.; Korjik, M.; Novotny, R. W.

    2017-11-01

    One of the most critical aspects for the application of a scintillation material in high energy physics is the degradation of properties of the material in an environment of highly ionizing particles in particular due to hadrons. There are presently several detector concepts in consideration being based on organic scintillator material for fast timing of charged particles or sampling calorimeters. We have tested different samples of the organic plastic scintillator EJ-260 produced by the company Eljen Technology (Sweetwater, TX, USA). The ongoing activity has characterized the relevant parameters such as light output, kinetics and temperature dependence. The study has focused on the change of performance after irradiation with 150 MeV protons up to an integral fluence of 5·1013 protons/cm2 as well as with a strong 60Co γ-source accumulating an integral dose of 100 Gy. The paper will report on the obtained results.

  20. Achados cirúrgicos em 260 casos de impressão basilar e/ou malformação de Arnold-Chiari

    Directory of Open Access Journals (Sweden)

    José Alberto Gonçalves da Silva

    1994-09-01

    Full Text Available A impressão basilar é malformação frequentemente observada no Nordeste do Brasil. No período de 1971 a 1992 foram operados, em nosso Serviço, 260 pacientes com malformações occipitocervicais, sendo 29 (11,1% casos de impressão basilar pura, 18 (6,9% com malformação de Arnold-Chiari e 213 (81,9% com impressão basilar associada à malformação de Arnold-Chiari. São relatados os achados cirúrgicos do plano ósseo, da dura-máter, do tecido nervoso e dos vasos da fossa posterior.

  1. Instability and breakdown of the coral-algae symbiosis upon exceedence of the interglacial pCO2 threshold (>260 ppmv): the "missing" Earth-System feedback mechanism

    Science.gov (United States)

    Wooldridge, Scott A.

    2017-12-01

    Changes in the atmospheric partial pressure of CO2 ( pCO2) leads to predictable impacts on the surface ocean carbonate system. Here, the importance of atmospheric pCO2 <260 ppmv is established for the optimum performance (and stability) of the algal endosymbiosis employed by a key suite of tropical reef-building coral species. Violation of this symbiotic threshold is revealed as a prerequisite for major historical reef extinction events, glacial-interglacial feedback climate cycles, and the modern decline of coral reef ecosystems. Indeed, it is concluded that this symbiotic threshold enacts a fundamental feedback mechanism needed to explain the characteristic dynamics (and drivers) of the coupled land-ocean-atmosphere carbon cycle of the Earth System since the mid-Miocene, some 25 million yr ago.

  2. Diagnosis, symptoms, frequency and mortality of 260 patients with urea cycle disorders from a 21-year, multicentre study of acute hyperammonaemic episodes.

    Science.gov (United States)

    Summar, Marshall L; Dobbelaere, Dries; Brusilow, Saul; Lee, Brendan

    2008-10-01

    A large longitudinal interventional study of patients with a urea cycle disorder (UCD) in hyperammonaemic crisis was undertaken to amass a significant body of data on their presenting symptoms and survival. Between 1982 and 2003, as part of the FDA approval process, data were collected on patients receiving an intravenous combination of nitrogen scavenging drugs (Ammonul sodium phenylacetate and sodium benzoate (10%, 10%)) for the treatment of hyperammonaemic crises caused by urea cycle disorders. A final diagnosis of a UCD was made for 260 patients, representing 975 episodes of hospitalization. Only 34% of these patients presented within the first 30 days of life and had a mortality rate of 32%. The most common presenting symptoms were neurological (80%), or gastrointestinal (33%). This cohort is the largest collection of patients reported for these diseases and the first large cohort in the United States. Surprisingly, the majority (66%) of patients with heritable causes of hyperammonaemia present beyond the neonatal period (>30 days). Patients with late-onset presenting disorders exhibited prolonged survival compared to the neonatal-presenting group.

  3. A hypothesis linking sub-optimal seawater pCO2 conditions for cnidarian-Symbiodinium symbioses with the exceedence of the interglacial threshold (>260 ppmv

    Directory of Open Access Journals (Sweden)

    S. A. Wooldridge

    2012-05-01

    Full Text Available Most scleractinian corals and many other cnidarians host intracellular photosynthetic dinoflagellate symbionts ("zooxanthellae". The zooxanthellae contribute to host metabolism and skeletogenesis to such an extent that this symbiosis is well recognised for its contribution in creating the coral reef ecosystem. The stable functioning of cnidarian symbioses is however dependent upon the host's ability to maintain demographic control of its algal partner. In this review, I explain how the modern envelope of seawater conditions found within many coral reef ecosystems (characterised by elevated temperatures, rising pCO2, and enriched nutrient levels are antagonistic toward the dominant host processes that restrict excessive symbiont proliferation. Moreover, I outline a new hypothesis and initial evidence base, which support the suggestion that the additional "excess" zooxanthellae fraction permitted by seawater pCO2 levels beyond 260 ppmv significantly increases the propensity for symbiosis breakdown ("bleaching" in response to temperature and irradiance extremes. The relevance of this biological threshold is discussed in terms of historical reef extinction events, glacial-interglacial climate cycles and the modern decline of coral reef ecosystems.

  4. A hypothesis linking sub-optimal seawater pCO2 conditions for cnidarian-Symbiodinium symbioses with the exceedence of the interglacial threshold (>260 ppmv)

    Science.gov (United States)

    Wooldridge, S. A.

    2012-05-01

    Most scleractinian corals and many other cnidarians host intracellular photosynthetic dinoflagellate symbionts ("zooxanthellae"). The zooxanthellae contribute to host metabolism and skeletogenesis to such an extent that this symbiosis is well recognised for its contribution in creating the coral reef ecosystem. The stable functioning of cnidarian symbioses is however dependent upon the host's ability to maintain demographic control of its algal partner. In this review, I explain how the modern envelope of seawater conditions found within many coral reef ecosystems (characterised by elevated temperatures, rising pCO2, and enriched nutrient levels) are antagonistic toward the dominant host processes that restrict excessive symbiont proliferation. Moreover, I outline a new hypothesis and initial evidence base, which support the suggestion that the additional "excess" zooxanthellae fraction permitted by seawater pCO2 levels beyond 260 ppmv significantly increases the propensity for symbiosis breakdown ("bleaching") in response to temperature and irradiance extremes. The relevance of this biological threshold is discussed in terms of historical reef extinction events, glacial-interglacial climate cycles and the modern decline of coral reef ecosystems.

  5. Mental health benefits of neighbourhood green space are stronger among physically active adults in middle-to-older age: evidence from 260,061 Australians.

    Science.gov (United States)

    Astell-Burt, Thomas; Feng, Xiaoqi; Kolt, Gregory S

    2013-11-01

    While many studies report that green spaces promote mental health, some suggest the psychological benefits of physical activity are amplified if participation occurs within greener environs. We investigated whether this relationship could be observed among adults in middle-to-older age. Multilevel logit regression was used to investigate association between green space and psychological distress (Kessler scores of 22+) among 260,061 Australians over 45 years old living in New South Wales (2006-2009). Physical activity was measured using the Active Australia survey. Percentage green space was estimated within a 1-kilometre of residence. In comparison to residents of the least green areas, those in the greenest neighbourhoods were at a lower risk of psychological distress (Odds Ratio 0.83, 95% CI: 0.76, 0.92) and were less sedentary (0.81: 0.77, 0.87). An interaction was observed between physical activity and green space (p=0.0028). More green space did not appear to benefit mental health among the least active (0.99: 0.85, 1.15), but there was a protective association for the more physically active (0.82: 0.67, 0.99). For adults in middle-to-older age, green spaces are not only important for promoting physical activity, but the mental health benefits of greener environs appear contingent upon those active lifestyles. © 2013.

  6. LONG-TERM OPTICAL OBSERVATIONS OF TWO LMXBs: UW CrB (=MS 1603+260) AND V1408 Aql (=4U 1957+115)

    International Nuclear Information System (INIS)

    Mason, Paul A.; Robinson, Edward L.; Bayless, Amanda J.; Hakala, Pasi J.

    2012-01-01

    We present new optical photometry of two low-mass X-ray binary stars, UW CrB (MS 1603+260) and V1408 Aql (4U 1957+115). UW CrB is an eclipsing binary and we refine its eclipse ephemeris and measure an upper limit to the rate of change of its orbital period, | P-dot | -11 (unitless). The light curve of UW CrB shows optical counterparts of type I X-ray bursts. We tabulate the times, orbital phases, and fluences of 33 bursts and show that the optical flux in the bursts comes primarily from the accretion disk, not from the secondary star. The new observations are consistent with a model in which the accretion disk in UW CrB is asymmetric and precesses in the prograde direction with a period of ∼5.5 days. The light curve of V1408 Aql has a low-amplitude modulation at its 9.33 hr orbital period. The modulation remained a nearly pure sine curve in the new data as it was in 1984 and 2008, but its mean amplitude was lower, 18% against 23% in the earlier data. A model in which the orbital modulation is caused by the varying aspect of the heated face of the secondary star continues to give an excellent fit to the light curve. We derive a much improved orbital ephemeris for the system.

  7. Work efficiency in the operations of juvenile thinning of mixed stands of pedunculate oak with hornbeam, ash and other hard broadleaves with the Stihl MS 260 chainsaw

    Directory of Open Access Journals (Sweden)

    Danilović Milorad

    2015-01-01

    Full Text Available This paper presents the results of research of efficacy of the lightweight low power chainsaw Stihl MS 260 in the operations of juvenile thinning in preserved even-aged mixed stands of pedunculate oak with hornbeam, ash and other hard hardwoods. The investigations were carried out in the territory of FE “Sremska Mitrovica” in three sample plots of different ages. It is the first research of this kind based on the choice of optimal technological solution for the cleaning cuts of oak stands. Technology of work is based on cutting unwanted species at a certain height in order to favor pedunculate oak as the main species. In sample plot 1 the cutting through of undesirable species was carried out in one place and then third parties carried out their processing and transportation. In sample plots 2 and 3 workers cut the unwanted species in several places and stacked the timber on the ground so as not to interfere with the growth of pedunculate oak which does not tolerate shading. In this study, we applied time and work study. Group system of work was recorded. The group typically consisted of 4 workers and a foreman. Fuel consumption was recorded by the method of tank refuelling. The research results show that operating conditions have a significant impact on the effects of work with a chainsaw, as well as on the consumption of fuel and lubricants. The differences are mainly caused by different structures of cut timber.

  8. China Report, Agriculture, No. 260.

    Science.gov (United States)

    1983-06-09

    million poultry and 770,000 hives of honey bees in 1982. By the end of that year, the poultry on hand was three and a half times the number at the end of...transformation overnight. There must be a process of the combina- tion of things and the substitution of one for the other. And it is neces- sary to...nutritional analysis of fodder and did work on the concocting and screening of scientific preparation formulas. Its research unearthed a new protein feed

  9. Prevalence of hereditary factors predisposing to thrombosis in 260 patients diagnosed as thrombosis and investigated at Hospital Israelita Albert Einstein, São Paulo, Brazil

    Directory of Open Access Journals (Sweden)

    João Carlos de Campos Guerra

    2005-06-01

    Full Text Available Objective: To evaluate the prevalence of genetic polymorphism incoagulation factors in thromboembolic disease in patients withclinical suspicion of thrombosis. Methods: A retrospective casecollection was performed searching all patients with clinicalsuspicion of thrombosis who were submitted to coagulation factoranalysis at the Hospital Israelita Albert Einstein from November2003 to April 2004. We included 260 patients, 118 male and 142female, mean age of 46 years. Prothrombin mutation and Leiden Vfactor were evaluated with multiplex PCR. Protein C, S and lupusanticoagulant were studied in coagulation assays. AntithrombinIII was studied by chromogenic assay. Anticardiolipin was evaluatedthrough an immunoenzymatic method and homocysteine by animmunometric method. Results: Factor V Leiden was found in 22cases (8.3 %, one homozygote and 21 heterozygotes. Prothrombinmutation was found in 18 cases (6.8%, one homozygote and 17heterozygotes. Forty cases with genetic alteration showed 34 caseswith thrombosis (85%, 29 venous thrombosis and 4 arterialthrombosis. One hundred and seven patients were tested foranticardiolipin antibodies: 21 were anticardiolipin antibody positives(19.6%, and 15 of them had IgG antibodies, 3 IgM and 3 IgA. Sixteenof the 21 patients had thrombosis, 11 venous thrombosis and 5arterial thrombosis. Lupus anticoagulant was found in two patients,both with thrombosis. There was only one case ofhyperhomocystinemia, with thrombosis. Protein C, protein S andantithrombin III deficiencies were found in 63 cases (12%. Out of31 cases with thrombosis (49,2 %, 26 cases had venous thrombosisand 5 had arterial thrombosis. Conclusion: Thromboembolicdisease is clearly associated with genetic factors but there isconsensus its cause is multifactorial. Genetic alterations, however,should be studied when there is clinical evidence of thrombosis,at least in young patients.

  10. Safety and effectiveness of gemcitabine in 260 patients with biliary tract cancer in a Japanese clinical practice based on post-marketing surveillance in Japan.

    Science.gov (United States)

    Okubo, Sumiko; Nishiuma, Shinichi; Kobayashi, Noriko; Taketsuna, Masanori; Taniai, Hisashi

    2012-11-01

    Gemcitabine was approved for the treatment of biliary tract cancer in 2006 in Japan. While biliary tract cancer is usually associated with patients 70 years of age or older and/or those who tend to have underlying liver dysfunction, data on this population were limited in the Japanese Phase II study of gemcitabine. Thus, further evaluation of safety and effectiveness in this population was planned. This special post-marketing surveillance was conducted as an observational study on the use of gemcitabine in a clinical practice setting. Gemcitabine-naïve patients with biliary tract cancer were enrolled from 2006 to 2008 and observed over 12 months; one or more doses of gemcitabine were administered during the period. Data such as patient background, treatment details, adverse events occurring during the observational period, laboratory values of liver enzyme and survival status were collected 3 and 12 months after the start of therapy. Of the 285 patients registered for the study, 260 were included in the analysis. The mean age was 66.9 years. There were 120 patients (46.2%) classified as elderly (70 years or older). Haematotoxicities were the most common adverse drug reactions. In the elderly and the non-elderly, adverse drug reactions (serious) occurred in 48.3% (20.8%) and 50.7% (12.9%), respectively. The overall estimated 1-year survival rate was 52.5% (95% confidence interval, 45.9-58.7%). In line with previous clinical and post-marketing studies conducted in Japan, the results of this study suggest that gemcitabine could be used safely and effectively for biliary tract cancer patients including the elderly.

  11. [Is a patient's knowledge of cardiovascular risk factors better after the occurrence of a major ischemic event? Survey of 135 cases and 260 controls].

    Science.gov (United States)

    Lensel, A-S; Lermusiaux, P; Boileau, C; Feugier, P; Sérusclat, A; Zerbib, Y; Ninet, J

    2013-12-01

    We hypothezised that patients (cases) who are hospitalized for a major ischemic event--myocardial infarction, stroke, decompensation of peripheral arterial disease--acquire better knowledge than a control population--atheromatous patients without a major ischemic event, patients consulting for a vein disease or a diabetes evaluation, and accompanists--about cardiovascular risk factors (smoking, hypertension, diabetes, dyslipidemia, obesity) and have a better understanding of the usefulness of making changes in their lifestyle (quit smoking, regular exercise, Mediterranean diet, low salt diet, weight control, diabetes care). A questionnaire was proposed at vascular surgery consultations and vascular and cardiac functional explorations, at the M Pavillon of the Édouard-Herriot hospital, Lyon, France. In five months, 395 questionnaires (135 cases and 260 controls) were analyzed. The global knowledge score was statistically higher for cases than for controls (cases 3.23±1.81; controls 2.77±2.03; P=0.037). Cases did not abide by monitoring and dietary rules better, except as regards the management of diabetes. Regular physical activity was statistically more prevalent among controls than among cases. Cases mainly received their information from their doctors (general practitioner for 59% of controls and 78% of cases, cardiologist for 25% of controls and 57% of cases) while controls got their information more through magazines or advertising. Our results show that after a major ischemic event, cases' knowledge of risk factors is better than the rest of the population without improved rules lifestyle changes. This suggests the usefulness of evaluating a therapeutic education program for atheromatous disease. Copyright © 2013 Elsevier Masson SAS. All rights reserved.

  12. Accumulation of 24S-hydroxycholesterol in neuronal SK-N-BE cells treated with hexacosanoic acid (C26:0): argument in favor of 24S-hydroxycholesterol as a potential biomarker of neurolipotoxicity.

    Science.gov (United States)

    Zarrouk, A; Hammami, M; Moreau, T; Lizard, G

    2015-02-01

    Cholesterol oxide derivatives (oxysterols) are viewed as potential biomarkers of neurodegenerative diseases. 24S-hydroxycholesterol, an oxysterol produced only in brain neurons, is often found for unknown reasons in increased levels in the plasma in patients with neurodegenerative diseases. On human neuronal SK-N-BE cells treated with hexacosanoic acid (C26:0) identified at increased levels in the tissues and plasma of patients with peroxisomal leukodystrophies and Alzheimer's disease, we observed increased level of 24S-hydroxycholesterol associated with C26:0 induced lipotoxicity. This finding reinforces the hypothesis suggesting that 24S-hydroxycholesterol could constitute a biomarker of neurotoxicity. Copyright © 2014 Elsevier Masson SAS. All rights reserved.

  13. Induction of Mitochondrial Changes Associated with Oxidative Stress on Very Long Chain Fatty Acids (C22:0, C24:0, or C26:0-Treated Human Neuronal Cells (SK-NB-E

    Directory of Open Access Journals (Sweden)

    Amira Zarrouk

    2012-01-01

    Full Text Available In Alzheimer's disease, lipid alterations point towards peroxisomal dysfunctions. Indeed, a cortical accumulation of saturated very long chain fatty acids (VLCFAs: C22:0, C24:0, C26:0, substrates for peroxisomal β-oxidation, has been found in Alzheimer patients. This study was realized to investigate the effects of VLCFAs at the mitochondrial level since mitochondrial dysfunctions play crucial roles in neurodegeneration. On human neuronal SK-NB-E cells treated with C22:0, C24:0, or C26:0 (0.1–20 μM; 48 h, an inhibition of cell growth and mitochondrial dysfunctions were observed by cell counting with trypan blue, MTT assay, and measurement of mitochondrial transmembrane potential (Δψm with DiOC6(3. A stimulation of oxidative stress was observed with DHE and MitoSOX used to quantify superoxide anion production on whole cells and at the mitochondrial level, respectively. With C24:0 and C26:0, by Western blotting, lower levels of mitochondrial complexes III and IV were detected. After staining with MitoTracker and by transmission electron microscopy used to study mitochondrial topography, mass and morphology, major changes were detected in VLCFAs treated-cells: modification of the cytoplasmic distribution of mitochondria, presence of large mitochondria, enhancement of the mitochondrial mass. Thus, VLCFAs can be potential risk factors contributing to neurodegeneration by inducing neuronal damages via mitochondrial dysfunctions.

  14. Demonstration of GTS Duratek Process for Stabilizing Mercury Contaminated (<260 ppm) Mixed Wastes. Mixed Waste Focus Area. OST Reference No. 2409

    International Nuclear Information System (INIS)

    1999-01-01

    Mercury-contaminated wastes in many forms are present at various U. S. Department of Energy (DOE) sites. At least 26 different DOE sites have this type of mixed low-level waste in their storage facilities, totaling approximately 6,000 m 3 . Mercury contamination in the wastes at DOE sites presents a challenge because it exists in various forms, such as soil, sludges, and debris, as well as in different chemical species of mercury. Stabilization is of interest for radioactively contaminated mercury waste (<260 ppm Hg) because of its success with particular wastes, such as soils, and its promise of applicability to a broad range of wastes. However, stabilization methods must be proven to be adequate to meet treatment standards. They must also be proven feasible in terms of economics, operability, and safety. This report summarizes the findings from a stabilization technology demonstration conducted by GTS Duratek, Inc. Phase I of the study involved receipt and repackaging of the material, followed by preparations for waste tracking. Phase II examined the bench-scale performance of grouting at two different loadings of waste to grouted mass. Phase III demonstrated in-drum mixing and solidification using repackaged drums of sludge. Phase IV initially intended to ship final residues to Envirocare for disposal. The key results of the demonstration are as follows: (1) Solidification tests were performed at low and high waste loading, resulting in stabilization of mercury to meet the Universal Treatment Standard of 0.025 mg/L at the low loading and for two of the three runs at the high loading. The third high-loading run had a Toxicity Characteristic Leaching Procedure (TCLP) of 0.0314 mg/L. (2) Full-drum stabilization using the low loading formula was demonstrated. (3) Organic compound levels were discovered to be higher than originally reported, including the presence of some pesticides. Levels of some radionuclides were much higher than initially reported. (4

  15. The ATLAS3D project - I. A volume-limited sample of 260 nearby early-type galaxies: science goals and selection criteria

    Science.gov (United States)

    Cappellari, Michele; Emsellem, Eric; Krajnović, Davor; McDermid, Richard M.; Scott, Nicholas; Verdoes Kleijn, G. A.; Young, Lisa M.; Alatalo, Katherine; Bacon, R.; Blitz, Leo; Bois, Maxime; Bournaud, Frédéric; Bureau, M.; Davies, Roger L.; Davis, Timothy A.; de Zeeuw, P. T.; Duc, Pierre-Alain; Khochfar, Sadegh; Kuntschner, Harald; Lablanche, Pierre-Yves; Morganti, Raffaella; Naab, Thorsten; Oosterloo, Tom; Sarzi, Marc; Serra, Paolo; Weijmans, Anne-Marie

    2011-05-01

    The ATLAS3D project is a multiwavelength survey combined with a theoretical modelling effort. The observations span from the radio to the millimetre and optical, and provide multicolour imaging, two-dimensional kinematics of the atomic (H I), molecular (CO) and ionized gas (Hβ, [O III] and [N I]), together with the kinematics and population of the stars (Hβ, Fe5015 and Mg b), for a carefully selected, volume-limited (1.16 × 105 Mpc3) sample of 260 early-type (elliptical E and lenticular S0) galaxies (ETGs). The models include semi-analytic, N-body binary mergers and cosmological simulations of galaxy formation. Here we present the science goals for the project and introduce the galaxy sample and the selection criteria. The sample consists of nearby (D 15°) morphologically selected ETGs extracted from a parent sample of 871 galaxies (8 per cent E, 22 per cent S0 and 70 per cent spirals) brighter than MK statistically representative of the nearby galaxy population. We present the size-luminosity relation for the spirals and ETGs and show that the ETGs in the ATLAS3D sample define a tight red sequence in a colour-magnitude diagram, with few objects in the transition from the blue cloud. We describe the strategy of the SAURON integral field observations and the extraction of the stellar kinematics with the pPXF method. We find typical 1σ errors of ΔV≈ 6 km s-1, Δσ≈ 7 km s-1, Δh3≈Δh4≈ 0.03 in the mean velocity, the velocity dispersion and Gauss-Hermite (GH) moments for galaxies with effective dispersion σe≳ 120 km s-1. For galaxies with lower σe (≈40 per cent of the sample) the GH moments are gradually penalized by pPXF towards zero to suppress the noise produced by the spectral undersampling and only V and σ can be measured. We give an overview of the characteristics of the other main data sets already available for our sample and of the ongoing modelling projects.

  16. Study of the angular correlations of light charged particles for the reaction {sup 35}CI (260 MeV) + {sup 24}Mg; Etude des correlations angulaires de particules legeres chargees dans la reaction {sup 35}CI (260 MeV) + {sup 24}Mg

    Energy Technology Data Exchange (ETDEWEB)

    Mahboub, D.

    1996-10-30

    This work is focussed on the investigation of deformed nuclei. The asymmetric fusion-fission of light heavy-ions (A {<=}60) with a high excitation energy (T {approx} 4 MeV) had lead to a large deformation of the compound nucleus at the scission point. The angular correlations between light particles (LP) and their emitting fragments has been used to probe the deformation of nucleus. Exclusive measurements were performed for the {sup 35}Cl (260 MeV) + {sup 24}Mg system leading to the {sup 59}Cu compound nucleus (CN). The comparison between the energy spectra of LP`s and a statistical calculation carried out by a Monte-Carlo code CASCADE has suggested a deformation of 1.3 (for an oblate shape) of the CN within the frame work of fusion-evaporation process. The source velocity spectrum of {alpha} particles and angular correlations of LP`s have showed that pre-scission and pre-equilibrium emissions are negligible in the present reaction. Finally the confrontation of the data with the statistical code GEMINI has pointed out the sequential emission character of the LP`s from the fission fragments. (author). 175 refs.

  17. In-situ study of surface relief due to cubic-tetragonal martensitic transformation in Mn_6_9_._4Fe_2_6_._0Cu_4_._6 antiferromagnetic shape memory alloy

    International Nuclear Information System (INIS)

    Liu, C.; Yuan, F.; Gen, Z.; Wang, L.; Cui, Y.G.; Wan, J.F.; Zhang, J.H.; Rong, Y.H.

    2016-01-01

    Temperature-dependence surface relief during cubic↔tetragonal martensitic transformation (MT) in Mn_6_9_._4Fe_2_6_._0Cu_4_._6 antiferromegnetic shape memory alloy was studied by means of in-situ atomic force microscopy. The surface morphology memory effect was found and the crystallography reversibility of the transformation and its shearing characters were directly verified. Twin shearing is suggested as the main mechanism of formation of tent-type surface relief. The surface relief angle (θ_α|θ_β)<0.5° was firstly measured and might be the smallest compared with that in other shape memory alloys. A Landau model was proposed to consider the shearing strain related with surface relief of MT varying with the coupling effect between second-order antiferromagnetic transition and first-order MT. According to this model, the Mn_6_9_._4Fe_2_6_._0Cu_4_._6 alloy belongs to the weak coupling system and this kind of weak coupling effect makes the main contribution to the small relief angle. - Highlights: • Temperature-dependence surface relief in Mn-Fe-Cu alloy was firstly studied. • The surface morphology memory effect in Mn-Fe-Cu alloy was found. • Smallest surface relief angle (θ_α|θ_β).

  18. Estudio de la viabilidad de fabricación de un sistema codo (fundición inoxidable ferrítica, GX 260 Cr27-tubo composite (Incolloy 800 HT+Stal 2465 solidario por fusión

    Directory of Open Access Journals (Sweden)

    Gutiérrez de Solabarría, S.

    1995-10-01

    Full Text Available Flying ashes captured by ciclones in the experimental plant for combustion in pressure fluid bed, in Escatrón Power Plant (Zaragoza, Spain, circulate through the gas cleaning system and are evacuated by means of pneumatic transport. The temperature of these ashes is aprox. 800 °C and the relative pressure is up to 8 negative bars relating the outdoor pressure of the transport pipe. The configuration of the pneumatic transport lines is Incolloy 800 HT quality composite tubes lined with Stal 2465 in straight stretches. Regarding direction changes, ferritic stainless casting, quality GX 260 Cr 27 elbows are used. The aim of this work is to study the possibility of manufacturing a solidary system by means of melting between the ferritic stainless casting elbow and the composite pipe.

    Las cenizas volantes captadas por ciclones en la planta experimental de combustión en lecho fluido a presión, de la central térmica de Escatrón (Zaragoza, circulan por el sistema de depuración de gases y son evacuadas mediante transporte neumático. Estas cenizas se encuentran a una temperatura aproximada de 800 °C y a una presión relativa de hasta 8 bares negativos con respecto a la presión en el exterior de la tubería de transporte. Para configurar las líneas de transporte neumático, se utilizan en los tramos rectos tubos composite de calidad Incolloy 800 HT recubiertos interiormente de material Stal 2465. Para los cambios de dirección, se utilizan codos de fundición inoxidable ferrítica de calidad GX 260 Cr 27. El objetivo del presente trabajo es estudiar la viabilidad de fabricación de un sistema solidario por fusión entre el codo de fundición inoxidable ferrítica y la tubería composite.

  19. Publications | Page 260 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Wi-fi: a new bridge for the digital divide? Connecting to the Internet using a simple aluminum antenna and a wireless network card could be the best way to narrow ... Broadening the benefits of trade: The Latin American trade network. Limit the ...

  20. 32 CFR 260.6 - Procedures.

    Science.gov (United States)

    2010-07-01

    ..., signifying its agreement or alternate selection of a location and its selection of type of vending facility... owned building in which the lessor or any of its tenants have an existing restaurant or other food... substantial direct competition with such restaurant or other food operation, the requirement to provide a...

  1. 49 CFR 260.3 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... appropriations and which must be paid by Applicant or its non-Federal infrastructure partner before that direct... provisions of this part. (j) Including means including but not limited to. (k) Infrastructure partner means... subtitle IV of title 49, United States Code. (s) Subsidy cost of a direct loan means the net present value...

  2. 23 CFR 260.103 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... school including tuition, student fees, books, and expendable supplies but excluding travel expenses to and from the school. (c) Employing agency. The agency for which the candidate works. This may be either a State or local highway/transportation agency or the FHWA. (d) Fellowship. The grant presented to...

  3. 24 CFR 574.260 - Amendments.

    Science.gov (United States)

    2010-04-01

    ..., location, service area, or objectives of an activity or the number of eligible persons served must be... proposed use of funds. Funds may not be expended for the revised proposed use of funds until: (1) HUD... funds has been completed in accordance with § 574.510. (Approved by the Office of Management and Budget...

  4. Publications | Page 260 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Patronage or partnership: Local capacity building in humanitarian crises. It is early 1998, on the outskirts of Bujumbura, the capital of Burundi. "People are dying like flies," says an understandably emotional American missionary running a refugee camp for four thousand Hutus. Asked by a reporter about a.

  5. 7 CFR 1944.260 - Cost distribution.

    Science.gov (United States)

    2010-01-01

    ... limited to 10 percent of the 50 percent matching amount), such as the current market value of donated common or office space, utility costs, furniture, material, supplies, equipment and food used in direct...

  6. 50 CFR 260.6 - Terms defined.

    Science.gov (United States)

    2010-10-01

    .... “Establishment” means any premises, buildings, structures, facilities, and equipment (including vehicles) used in... United States (including, but not limited to, any corporate agencies thereof), any State, county, or municipal government, any common carrier, and any authorized agent of any of the foregoing. Plant. “Plant...

  7. 40 CFR 260.10 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... physical sciences and the principles of engineering and mathematics, acquired by a professional education... determined by an explosives or munitions emergency response specialist. Such situations may require immediate and expeditious action by an explosives or munitions emergency response specialist to control...

  8. 32 CFR 260.4 - Policy.

    Science.gov (United States)

    2010-07-01

    ... blind vending facilities. (d) Specified income from vending machines operated on DoD-controlled property... Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS VENDING... shall be given priority in the establishment and operation of vending facilities. (b) The blind shall be...

  9. 32 CFR 260.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... operations. Direct competition. The presence and operation of a DoD Component vending machine or a vending... machines or vending facilities operated in areas serving employees, the majority of whom normally do not... the United States. Vending facility. Automatic vending machines, cafeterias, snack bars, cart service...

  10. Echo outbursts in KS 1731-260

    Czech Academy of Sciences Publication Activity Database

    Šimon, Vojtěch

    2010-01-01

    Roč. 513, April (2010), A71/1-A71/10 ISSN 0004-6361 R&D Projects: GA ČR GA205/08/1207 Institutional research plan: CEZ:AV0Z10030501 Keywords : stars * accretion disks * X-rays binaries Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.410, year: 2010

  11. 77 FR 260 - Forest Resource Coordinating Committee

    Science.gov (United States)

    2012-01-04

    ... USDA and the broader forestry sector, with specific focus on owners of non-industrial private... Coordinator, by phone at (202) 205-1376 or by email at [email protected]us or Ted Beauvais, FRCC Designted Federal Officer, by phone (202) 205-1190 or by email at [email protected]us . Individuals who use...

  12. 38 CFR 21.260 - Subsistence allowance.

    Science.gov (United States)

    2010-07-01

    ... rehabilitation facility or sheltered workshop; independent instructor; institutional non-farm cooperative: Full...) VOCATIONAL REHABILITATION AND EDUCATION Vocational Rehabilitation and Employment Under 38 U.S.C. Chapter 31... rehabilitation program under 38 U.S.C. Chapter 31 will receive a monthly subsistence allowance at the rates in...

  13. 50 CFR 260.102 - Equipment.

    Science.gov (United States)

    2010-10-01

    ..., packaging, or storing any processed products or any ingredients used in the manufacture or production thereof, shall be of such design, material, and construction as will: (a) Enable the examination... with Good Manufacturing Practice Regulations, 21 CFR part 128. [36 FR 21041, Nov. 3, 1971] ...

  14. 50 CFR 260.86 - Approved identification.

    Science.gov (United States)

    2010-10-01

    ... assure compliance with the requirements for wholesomeness established for the raw product and of sanitation established for the preparation and processing operations, and (2) has been certified by an... part to assure compliance with the requirements for wholesomeness established for the raw product and...

  15. 40 CFR 260.11 - References.

    Science.gov (United States)

    2010-07-01

    ... Chromatography,” IBR approved for § 264.1063. (4) ASTM D 2382-83, “Standard Test Method for Heat of Combustion of Hydrocarbon Fuels by Bomb Calorimeter (High-Precision Method),” IBR approved for §§ 264.1033, 265.1033. (5..., “Standard Test Methods for Flash Point for Liquids by Setaflash Closed Tester,” IBR approved for § 261.21(a...

  16. 49 CFR 260.39 - Maintenance standards.

    Science.gov (United States)

    2010-10-01

    ... REHABILITATION AND IMPROVEMENT FINANCING PROGRAM Standards for Maintenance of Facilities Involved in the Project... the project. (b) When the proceeds of a direct loan or an obligation guaranteed by the Administrator...

  17. Absolute photoabsorption oscillator strengths by electron energy loss methods: the valence and S 2p and 2s inner shells of sulphur dioxide in the discrete and continuum regions (3.5-260 eV)

    International Nuclear Information System (INIS)

    Feng, R.; Cooper, G.; Burton, G.R.; Brion, C.E.; Avaldi, L.

    1999-01-01

    Absolute photoabsorption oscillator strengths (cross-sections) for the valence shell discrete and continuum regions of sulphur dioxide from 3.5 to 51 eV have been measured using high resolution (∼0.05 eV FWHM) dipole (e,e) spectroscopy. A wide-range spectrum, covering both the valence shell and the S 2p and 2s inner shells, has also been obtained from 5 to 260 eV at low resolution (∼1 eV FWHM), and this has been used to determine the absolute oscillator strength scale using valence shell TRK (i.e., S(0)) sum-rule normalization. The present measurements have been undertaken in order to investigate the recently discovered significant quantitative errors in our previously published low resolution dipole (e,e) work on sulphur dioxide (Cooper et al., Chem. Phys. 150 (1991) 237; 150 (1991) 251). These earlier measurements were also in poor agreement with other previously published direct photoabsorption measurements. We now report new absolute photoabsorption oscillator strengths using both high and low resolution dipole (e,e) spectroscopies. These new measurements cover a wider energy range and are much more consistent with the previously published direct photoabsorption measurements. The accuracy of our new measurements is confirmed by an S(-2) dipole sum-rule analysis which gives a static dipole polarizability for sulphur dioxide in excellent agreement (within 3.5%) with previously reported polarizability values. Other dipole sums S(u) (u=-1,-3 to -6,-8,-10) and logarithmic dipole sums L(u) (u=-1 to -6) are also determined from the presently reported absolute oscillator strength distributions. (Copyright (c) 1999 Elsevier Science B.V., Amsterdam. All rights reserved.)

  18. Retrograde lag screw placement in anterior acetabular column with regard to the anterior pelvic plane and midsagittal plane -- virtual mapping of 260 three-dimensional hemipelvises for quantitative anatomic analysis.

    Science.gov (United States)

    Ochs, Bjoern Gunnar; Stuby, Fabian Maria; Ateschrang, Atesch; Stoeckle, Ulrich; Gonser, Christoph Emanuel

    2014-10-01

    Percutaneous screw placement can be used for minimally invasive treatment of none or minimally displaced fractures of the anterior column. The complex pelvic geometry can pose a major challenge even for experienced surgeons. The present study examined the preformed bone stock of the anterior column in 260 hemipelvises (130 male and 130 female). Screws were virtually implanted using iPlan(®) CMF (BrainLAB AG, Feldkirchen, Germany); the maximal implant length and the maximal implant diameter were assessed. The study showed, that 6.5mm can generally be used in men; in women however individual planning is essential in regard to the maximal implant diameter since we found that in 15.4% of women, screws with a diameter less than 6.5mm were necessary. The virtual analysis of the preformed bone stock corridor of the anterior column showed two constrictions of crucial clinical importance. These can be found after 18% and 55% (men) respectively 16% and 55% (women) measured from the entry point along the axis of the implant. The entry point of the retrograde anterior column screw in our collective was located lateral of tuberculum pubicum at the level of the superior-medial margin of foramen obturatum. In female patients, the entry point was located significantly more lateral of symphysis and closer to the cranial margin of ramus superior ossis pubis. The mean angle between the screw trajectory and the anterior pelvic plane in sagittal section was 31.6 ± 5.5°, the mean angle between the screw trajectory and the midsagittal plane in axial section was 55.9 ± 4.6° and the mean angle between the screw trajectory and the midsagittal plane in coronal section was 42.1 ± 3.9° with no significant deviation between both sexes. The individual angles formed by the screw trajectory and the anterior pelvic and midsagittal plane are independent from anthropometric parameters sex, age, body length and weight. Therefore, they can be used for orientation in lag screw placement keeping

  19. 33 CFR 104.260 - Security systems and equipment maintenance.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Security systems and equipment... systems and equipment maintenance. (a) Security systems and equipment must be in good working order and... procedures for identifying and responding to security system and equipment failures or malfunctions. ...

  20. 50 CFR 260.99 - Buildings and structures.

    Science.gov (United States)

    2010-10-01

    ... each room and compartment thereof to prevent excessive condensation of moisture and to insure sanitary... condensation, the Director may require that suitable facilities be provided to prevent the condensate from...

  1. 37 CFR 260.6 - Verification of royalty payments.

    Science.gov (United States)

    2010-07-01

    ... verification of the payment of royalty fees to those parties entitled to receive such fees, according to terms... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Verification of royalty... COPYRIGHT ARBITRATION ROYALTY PANEL RULES AND PROCEDURES RATES AND TERMS FOR PREEXISTING SUBSCRIPTION...

  2. 29 CFR 779.260 - Trade-in allowances.

    Science.gov (United States)

    2010-07-01

    ... RETAILERS OF GOODS OR SERVICES Employment to Which the Act May Apply; Enterprise Coverage Annual Gross... is sold the amount of the sale will be included in the annual gross volume. Excise Taxes ...

  3. 49 CFR 260.27 - Additional information for loan guarantees.

    Science.gov (United States)

    2010-10-01

    ... history on that obligation; and (b) With respect to each existing Lender, Holder, or prospective Lender, a statement as to: (1) Full and correct name and principal business address; (2) Reference to applicable provisions of law and the charter or other governing instruments conferring authority to do business on the...

  4. 49 CFR 260.51 - Conditions of guarantee.

    Science.gov (United States)

    2010-10-01

    ... by the Lender or the Holder to the extent any loss is occasioned by the violation of usury laws... this part. In the event of material fraud, negligence or misrepresentation by the Lender or the Lender's participation in or condoning of such material fraud, negligence or misrepresentation, the Lender...

  5. 50 CFR 260.93 - Debarment and suspension.

    Science.gov (United States)

    2010-10-01

    ... conjunction with any application or request for an inspection contract, inspection service, inspection appeal... advertising of any processed product, when such product has not been inspected under the regulations of this..., or in the advertising of any processed product, when such product has not been inspected under the...

  6. 7 CFR 1493.260 - Facility payment guarantee.

    Science.gov (United States)

    2010-01-01

    ... event that the foreign bank fails to pay under the foreign bank letter of credit or related obligation... date of export. The final payments of principal and interest by the foreign bank must come due within... from Canada into the U.S. with a U.S. customs valuation of $20,000. 5. A U.S. citizen, will travel on a...

  7. 21 CFR 520.260 - n-Butyl chloride capsules.

    Science.gov (United States)

    2010-04-01

    ... be followed in 1/2 to 1 hour with a teaspoonful to a tablespoonful of milk of magnesia or 1 or 2 milk of magnesia tablets. Normal rations may be resumed 4 to 8 hours after treatment. Puppies and kittens...

  8. Aerospace Technology Curriculum Guide. Invest in Success. Vo. Ed. #260.

    Science.gov (United States)

    Idaho State Dept. of Education, Boise. Div. of Vocational Education.

    This document contains standards for an articulated secondary and postsecondary curriculum in aerospace technology. The curriculum standards can be used to ensure that vocational programs meet the needs of local business and industry. The first part of the document contains a task list and student performance standards for the aerospace technology…

  9. Dicty_cDB: SSA260 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available RP11-626A3 map 2, WORKING DRAFT SEQUENCE, 29 unordered pieces. 42 6.4 1 AE014305 |AE014305.1 Homo sapiens chromosome 13q34 schizophre...nia region contig 1 section 2 of 11 of the complete sequence. 42 6.4 1 BZ851208 |BZ

  10. 16 CFR 260.7 - Environmental marketing claims.

    Science.gov (United States)

    2010-01-01

    ... pieces if left uncovered in sunlight.” The claim is supported by competent and reliable scientific... sunlight and into sufficiently small pieces to become part of the soil. The qualified claim is not... time. The claim is not deceptive. Example 4: A plastic six-pack ring carrier is marked with a small...

  11. 18 CFR 260.400 - Cash management programs.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Cash management... Cash management programs. Natural gas companies subject to the provisions of the Commission's Uniform... management programs must file these agreements with the Commission. The documentation establishing the cash...

  12. 49 CFR 260.53 - Lenders' functions and responsibilities.

    Science.gov (United States)

    2010-10-01

    ... that are eligible and financially feasible; (4) Obtaining valid evidence of debt and collateral in accordance with sound lending practices; (5) Supervising construction, where appropriate; (6) Distributing... environmental issues related to a proposed project or items that may require extensive environmental review...

  13. All projects related to | Page 260 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2011-08-26

    . Start Date: August 26, 2011. End Date: February 26, 2015. Topic: INFECTIOUS DISEASES, DISEASE VECTORS, PREVENTIVE MEDICINE, ENVIRONMENTAL ASPECTS. Region: Nepal, Central Asia, Far East Asia, South Asia. Program: ...

  14. 7 CFR 2.60 - Chief, Forest Service.

    Science.gov (United States)

    2010-01-01

    ... employee has probable cause to believe are being committed in that employee's presence or view, or for a..., Executive Order 12777, 3 CFR, 1991 Comp., p. 351, and the National Contingency Plan, 40 CFR Part 300. (36...

  15. 40 CFR Appendix Ix to Part 261 - Wastes Excluded Under §§ 260.20 and 260.22

    Science.gov (United States)

    2010-07-01

    ... manage industrial solid waste. This exclusion was published on April 6, 1999.1. The constituent... be taken from each hopper (or other container) of kiln residue generated during each 24-hour run; all... minimum of four grab samples must also be taken from each hopper (or other container) of spray dryer...

  16. 45 CFR 260.30 - What definitions apply under the TANF regulations?

    Science.gov (United States)

    2010-10-01

    ... with Dependent Children means the welfare program in effect under title IV-A of prior law. Assistance... under sections 403(a)(5) and 406(e) of prior law to provide short-term assistance to needy families with... household as the minor child. Prior law means the provisions of title IV-A and IV-F of the Act in effect as...

  17. Insertion of balloon retained gastrostomy buttons: a 5-year retrospective review of 260 patients.

    LENUS (Irish Health Repository)

    Power, Sarah

    2013-04-01

    Radiologically inserted gastrostomy (RIG) is an established way of maintaining enteral nutrition in patients who cannot maintain nutrition orally. The purpose of this study was to evaluate the safety and efficacy of primary placement of a wide bore button gastrostomy in a large, varied patient population through retrospective review.

  18. A Method for Field Calibration of the PA260 Phosphorus Analyzer Using Solid Adsorbent Materials

    Science.gov (United States)

    1989-12-01

    plant environment. The solid adsorbent approach has two major advantages over other traditional air sampling devices such as bubblers or impingers...GC (60/80 mesh) or Chromosorb 106 (80/100 mesh). Both adsorbents were supplied by Alltech Associates (Deerfield, IL). The adsorbents were packed in

  19. : tous les projets | Page 260 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: WOMEN'S PARTICIPATION, POLITICAL PARTICIPATION, WOMEN'S RIGHTS, GENDER DISCRIMINATION, GENDER EQUALITY. Région: Pakistan, Central Asia, Far East Asia, South Asia. Programme: Gouvernance et justice. Financement total : CA$ 125,700.00. Femmes et représentation au Pakistan : voix d'en ...

  20. 45 CFR 260.31 - What does the term “assistance” mean?

    Science.gov (United States)

    2010-10-01

    ... distributions from, Individual Development Accounts; (6) Services such as counseling, case management, peer...-term benefits that: (i) Are designed to deal with a specific crisis situation or episode of need; (ii...

  1. Tritium migration in the Twin Lake 260-metre natural-gradient dispersion test

    International Nuclear Information System (INIS)

    Killey, R.W.D.; Wills, C.A.; Moltyander, G.L.

    1990-01-01

    The experiment reported here is an expansion of studies of dispersive processes in an unconfined sand aquifer on the property of Chalk River Laboratories near Twin Lake, covering a 270 m flow path between the injection well and the groundwater discharge area. Previous experience had shown that the use of a non-reactive tracer that emits moderate-energy gamma rays provides much more information than can be gleaned from tracers that require actual water sample collection. At the time of this experiment non-reactive gamma-emitting tracers with half-life long enough to undertake the 270 m experiment had not been developed. Tritium was used so some information on large-scale dispersion phenomena could be collected and instrumentation would be properly placed for a subsequent experiment that would use a gamma-emitting tracer. Because of the scoping character of the experiment, only limited data were collected. The experiment involved the controlled injection of a relatively large (60 m 3 ) volume of water labelled with tritiated water, and the subsequent tracking of the slug during natural gradient convective transport to the discharge area. This paper describes the hydrogeologic setting and the experimental and analytical methods, and presents and discusses the findings. (L.L.) (8 refs., 11 figs., tab.)

  2. 12 CFR 550.260 - How may I invest funds of a fiduciary account?

    Science.gov (United States)

    2010-01-01

    ... CFR 9.18. (2) If you must file a document with the Comptroller of the Currency under 12 CFR 9.18, you...” and “national bank” as used in 12 CFR 9.18 shall be deemed to include a Federal savings association...

  3. 45 CFR 260.35 - What other Federal laws apply to TANF?

    Science.gov (United States)

    2010-10-01

    ... regulatory and enforcement authority at section 417 of the Act does not limit the effect of other Federal... Safety and Health Act (OSHA) and unemployment insurance (UI)) and nondiscrimination laws. These laws...

  4. 49 CFR 260.25 - Additional information for Applicants not having a credit rating.

    Science.gov (United States)

    2010-10-01

    ... statement setting forth the bases for such forecasts; and (iii) A spread sheet showing changes in financial..., based upon estimated and forecasted data; (c) Capital spending plans for the next five years; (d) Cash flow projections; (e) Contingency plans for termination of the project before completion, if necessary...

  5. Oral cavity squamous cell carcinoma in 260 patients aged 80 years or more

    International Nuclear Information System (INIS)

    Ortholan, Cecile; Lusinchi, Antoine; Italiano, Antoine; Bensadoun, Rene-Jean; Auperin, Anne; Poissonnet, Gilles; Bozec, Alexandre; Arriagada, Rodrigo; Temam, Stephane; Benezery, Karen; Thariat, Juliette; Tao Yungan; Janot, Francois; Mamelle, Gerard; Vallicioni, Jacques; Follana, Philippe; Peyrade, Frederic; Sudaka, Anne; Bourhis, Jean; Dassonville, Olivier

    2009-01-01

    Purpose: We report the experience of two French cancer centers in the treatment of oral cavity squamous cell carcinoma (SCC) in patients aged ≥80 years. Materials and methods: Two hundred and sixty patients aged ≥80 years with a primary oral cavity SCC were included in this retrospective analysis. Results: Sex ratio was near to 1. Tobacco or alcohol intoxication was the main risk factor for 66% of men and 16% of women and leukoplakia, lichen planus, or oral traumatism for 55% of women and 11% of men (p < 0.0001). Two hundred patients received a loco-regional (LR) treatment with a curative intent (surgery and/or radiotherapy), 29 with a palliative intent and 31 did not receive a LR treatment. Curative treatments were initially planned to be adapted to age in 118 patients (59%). The median disease-specific survival (DSS) was 29 months. In multivariate analysis, the independent prognostic factors for DSS were stage (HR = 0.42 [0.24-0.72]), age (HR = 0.43 [0.24-0.75]) and performance status (HR = 0.50 [0.27-0.95]). The median overall survival (OS) was 14 months. In multivariate analysis, the independent prognostic factors for OS were age (HR = 0.52 [0.35-0.79]), stage (HR = 0.56 [0.38-0.84]), tumor differentiation (HR = 0.60 [0.33-0.93]) and performance status (HR = 0.6 [0.37-0.97]). In patients treated with a curative intent, treatment adapted to age was not associated with a decreased overall survival or disease-specific survival as compared with the standard treatment. However, prophylactic lymph node treatment in stages I-II tumors decreased the rate of nodal recurrence from 38% to 6% (p = 0.01). Conclusion: This study emphasizes the need for prospective evaluation of standard and adapted schedules in elderly patients with oral cavity cancer.

  6. 49 CFR 260.23 - Form and content of application generally.

    Science.gov (United States)

    2010-10-01

    ... information: (a) Full and correct name and principal business address of the Applicant; (b) Date of Applicant... analyses and studies that have been performed to determine present and future demand for rail services or... how the project will contribute to, or enhance, the safe operation of the railroad, considering such...

  7. Unstable cyclic modulation during the main outburst of KS 1731-260

    Czech Academy of Sciences Publication Activity Database

    Šimon, Vojtěch

    2012-01-01

    Roč. 17, č. 8 (2012), s. 697-704 ISSN 1384-1076 R&D Projects: GA ČR GA205/08/1207 Institutional support: RVO:67985815 Keywords : X-rays * close binaries * circumstellar matter Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 1.850, year: 2012

  8. A theoretical analysis of the ultraviolet spectrum (180-260 nm) of pure liquid benzene

    International Nuclear Information System (INIS)

    Fernandez, M.; Tortajada, J.; Sese, L.M.

    1988-01-01

    This paper reports an attempt to understand theoretically the red shifts seen in the benzene ultraviolet spectrum upon changing from gas to the liquid phase. The theoretical analysis is performed through a framework which brings together Quantum Chemistry and Classical Statistical Mechanics of molecular liquids. As it is discussed herein, the influence of the liquid phase on the individual molecular properties is taken into account by means of a perturbation term included in the effective molecular Hamiltonian. Such a perturbation depends explicitly on both the chemical nature and the static structure of the liquid surrounding the molecule under study. In order to simulate the vibronic couplings, which make the benzene ''forbidden'' bands 1 L a and 1 L b have nonzero intensity, random displacements of the nuclei of benzene have been employed in this introductory work. The calculations involve the CNDO/S procedure and the atom-atom radial distribution functions of the liquid sample. The results account for the large red shift (≅ 20 nm) undergone by the band 1 L a . (orig.)

  9. 75 FR 260 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170...

    Science.gov (United States)

    2010-01-05

    ..., except Federal holidays. For service information identified in this proposed AD, contact Empresa... p.m., Monday through Friday, except Federal holidays. The AD docket contains this proposed AD, the..., and -200 SU airplanes, serial numbers 17000002, 17000004 through 17000013 inclusive, and 17000015...

  10. 45 CFR 260.34 - When do the Charitable Choice provisions of TANF apply?

    Science.gov (United States)

    2010-10-01

    ... ASSISTANCE (ASSISTANCE PROGRAMS), ADMINISTRATION FOR CHILDREN AND FAMILIES, DEPARTMENT OF HEALTH AND HUMAN... religion, a religious belief, a refusal to hold a religious belief, or a refusal to actively participate in...

  11. Extreme phenophase delays and their relationship with natural forcings in Beijing over the past 260 years

    Science.gov (United States)

    Liu, Yang; Zhang, Mingqing; Fang, Xiuqi

    2018-03-01

    By merging reconstructed phenological series from published articles and observations of China Phenology Observation Network (CPON), the first blooming date of Amygdalus davidiana (FBA) in Beijing between 1741 and 2000 is reconstructed. The Butterworth method is used to remove the multi-year variations for generating the phenological series of annual variations in the first blooming date of A. davidiana. The extreme delay years in the phenological series are identified using the percentage threshold method. The characteristics of the extreme delays and the correspondence of these events with natural forcings are analysed. The main results are as follows. In annual phenological series, the extreme delays appeared in single year as main feature, only A.D.1800-1801, 1816-1817 and 1983-1984 were the events of two consecutively extreme years. Approximately 85% of the extreme delays occurred during 1-2 years after the large volcanic eruptions (VEI ≥ 4) in the eastern rim or the western rim of the Pacific Ocean, as the same proportion of the extreme delays followed El Niño events. About 73% years of the extreme delays fall in the valleys of sunspot cycles or the Dalton minimum period in the year or the previous year. According to the certainty factor (CF), the large eruptions have the greatest influence to the extreme delays; sunspot activity is the second, and ENSO is the last one. The extreme phenological delayed year is most likely to occur after a large eruption, which particularly occurs during El Niño year and its previous several years were in the descending portion or valley of sunspot phase.

  12. 49 CFR 260.45 - Events of default for guaranteed loans.

    Science.gov (United States)

    2010-10-01

    ... reflect the fair market value and potential liquidation value. In order to formulate a liquidation plan... must continue to submit this information to the Administrator each month until such time as the loan is... and interest in accordance with the note. If the loan is brought current, the Lender will repay to the...

  13. Calibration of a Micronal flame photometer model B-260. Intercomparison of the analytical results for potassium

    International Nuclear Information System (INIS)

    Alencar, Lucia Maria Laboissiere; Dalston, Regina Celia Reboucas.

    1983-01-01

    In its environmental monitoring program, NUCLEBRAS analyzes systematically environmental samples in order to determine the total alpha and beta activities. In most of these samples, 40 K is present in measurable quantities and can therefore be used for measuring beta activity since it is almost a 100% beta emitter. A method using a flame photometer for measuring the potassium concentration in water is presented. 5 refs., 28 figs., 25 tabs

  14. 37 CFR 260.4 - Confidential information and statements of account.

    Science.gov (United States)

    2010-07-01

    ... Confidential information and statements of account. (a) For purposes of this part, confidential information shall include statements of account and any information pertaining to the statements of account... included on the statement of account. (d) Access to the confidential information pertaining to the royalty...

  15. 41 CFR 102-34.260 - May we replace a Government-owned motor vehicle sooner?

    Science.gov (United States)

    2010-07-01

    ... mechanical repairs that exceed the fair market value of the motor vehicle. Determine the fair market value by adding the current market value of the motor vehicle plus any capitalized motor vehicle additions (such...

  16. Fulltext PDF

    Indian Academy of Sciences (India)

    the discovery of new elements using particle accelerators. He con- cludes by stating that "we might have reached the limits of the periodic table as a predictive tool". The third article is by Butera on. Glenn Seaborg who holds the record for the discovery of the largest number of elements - one of them named Seaborgium.

  17. Calibration of a Micronal flame photometer model B-260. Intercomparison of the analytical results for potassium; Calibracao de um fotometro de chama micronal modelo B-260. Intercomparacao de resultados analiticos de potassio

    Energy Technology Data Exchange (ETDEWEB)

    Alencar, Lucia Maria Laboissiere; Dalston, Regina Celia Reboucas

    1983-12-31

    In its environmental monitoring program, NUCLEBRAS analyzes systematically environmental samples in order to determine the total alpha and beta activities. In most of these samples, {sup 40} K is present in measurable quantities and can therefore be used for measuring beta activity since it is almost a 100% beta emitter. A method using a flame photometer for measuring the potassium concentration in water is presented. 5 refs., 28 figs., 25 tabs.

  18. Onset of surface stimulated emission at 260 nm from AlGaN multiple quantum wells

    KAUST Repository

    Li, Xiaohang; Xie, Hongen; Ponce, Fernando A.; Ryou, Jae-Hyun; Detchprohm, Theeradetch; Dupuis, Russell D.

    2015-01-01

    We demonstrated onset of deep-ultraviolet (DUV) surface stimulated emission (SE) from c-plane AlGaNmultiple-quantum well(MQW)heterostructuresgrown on a sapphire substrate by optical pumping at room temperature. The onset of SE became observable at a

  19. Polarized proton induced pion production on 10B at 200, 225, 250 and 260 MeV incident energies

    International Nuclear Information System (INIS)

    Ziegler, W.; Auld, E.G.; Falk, W.R.; Giles, G.L.; Jones, G.; Lolos, G.J.; McParland, B.

    1985-02-01

    The angular distributions of both the differential cross-section and the analyzing power are presented for the 10 B(p,π) 11 B reaction leading to the ground and first excited states of 11 B. The differential cross-section shows very little angular structure or energy dependence, but the analyzing power exhibits a considerable energy dependence for both states. This dependence, similar to that observed for the 12 C(p,π + ) 13 C reaction, may be a signature of the fact that single-particle final states are involved

  20. 17 CFR 260.11b-4 - Definition of “cash transaction” in section 311(b)(4).

    Science.gov (United States)

    2010-04-01

    ... transaction”, as used in section 311(b)(4), means any transaction in which full payment for goods or securities sold is made within 7 days after delivery of the goods or securities in currency or in checks or...

  1. Epidemiologic features of von Willebrand's disease in Doberman pinschers, Scottish terriers, and Shetland sheepdogs: 260 cases (1984-1988)

    Science.gov (United States)

    Brooks, M; Dodds, W J; Raymond, S L

    1992-04-15

    During a study period from 1985 through 1988, plasma von Willebrand's factor antigen (vWF:Ag) concentration was measured as a marker for prevalence of the von Willebrand's disease (vWD) trait in Doberman Pinschers (doberman, n = 5,554), Scottish Terriers (scottie, n = 1,363), and Shetland Sheepdogs (sheltie, n = 4,279). Significant increase in prevalence of the trait was seen in scotties and shelties during this period. In 1988, 73% of dobermans, 30% of scotties, and 28% of shelties tested had abnormal vWF:Ag concentration (less than 50% vWF:Ag). We found significant differences between breeds with respect to age and vWF:Ag concentration of clinically affected dogs at time of diagnosis. The affected dobermans were older (doberman mean age, 4.6 years; scottie mean age, 1.7 years; sheltie mean age, 1.9 years) and had higher concentration of plasma vWF:Ag (doberman mean vWF:Ag, 15%; scottie mean vWF:Ag, 0%; sheltie mean vWF:Ag, 8%). Bleeding in affected dogs of all 3 breeds was observed predominantly from mucosal surfaces and from cutaneous sites of surgery or trauma. The most common site of mucosal bleeding in scotties and shelties was oral or nasal cavity, and in dobermans was the urogenital tract. Differences in clinical manifestations of vWD in purebred dogs may reflect heterogeneous defects within the vWF gene, causing a variety of abnormalities in production, structure, and function of vWF protein. Analogous to vWD in human beings, acquired deficiencies of vWF may also contribute to the clinical variability of vWD in dogs.

  2. Decision 2010-021 : TransAlta Wind Ardenville wind plant and substation : application no. 1604970, proceeding ID 260

    International Nuclear Information System (INIS)

    2010-01-01

    TransAlta Wind, a wholly owned subsidiary of TransAlta Corporation, filed an application in April 2009 to construct and operate the Ardenville wind farm and substation in Alberta. The wind farm consists of 23 wind turbines, each rated at 3 MW, for a total installed capacity of 69 MW. The wind farm would be connected to the Alberta Interconnected Electric System at the substation. TransAlta anticipates that a new 138-kV transmission line will be required and has contacted the transmission facilities for the future applications. The Alberta Utilities Commission issued a notice to all interested parties and landholders within 2 km of the proposed wind farm. Two residents raised concerns regarding the use of fossil fuels and alternative fuels, ecological impacts and aesthetic impacts of wind farms and land values. Upon review of information, the Commission was satisfied that approval of the application was in the public interest and that the wind farm complies with all regulatory requirements, including sound levels. Pursuant to sections 11, 14 and 15 of the Hydro and Electric Energy Act, the Commission approved the application and granted approval to TransAlta Wind to construct and operate the Ardenville wind power plant and substation.

  3. 37 CFR 260.2 - Royalty fees for the digital performance of sound recordings and the making of ephemeral...

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Royalty fees for the digital... Licensee's monthly royalty fee for the public performance of sound recordings pursuant to 17 U.S.C. 114(d..., 2007, a Licensee's monthly royalty fee for the public performance of sound recordings pursuant to 17 U...

  4. Review on the Book: Pochekaev R.Yu. The Golden Horde Law (Kazan, 2009. 260 p. » 231

    Directory of Open Access Journals (Sweden)

    E.G. Sayfetdinova

    2015-06-01

    Full Text Available This paper contains a review of the R.Yu. Pochekaev’s book “The Golden Horde Law”. The reviewer points out that the Pochekaev’s book is a significant academic research in both the study of the Golden Horde history and the law system of the Eurasian Turkic-Mongol peoples. This book is published by the Center for Research on the Golden Horde Civilization at the Sh.Marjani Institute of History of the Academy of Sciences of the Republic of Tatarstan. For several years, the author of this book, R.Yu. Pochekaev, has been concerned with the the history of the Golden Horde State and its law system. He has published a number of works on this topic, the main conclusions of which are reflected in this generalizing work. The study is based on a wide range of sources (annals and chronicles, memoirs of contemporaries, bureaucratic and numismatic materials and numerous studies including the works of foreign specialists in the original language. In his book, the author organically combines the latest achievements of research on both the Golden Horde history and theory and history of law. The book will be of interest to experts of the Golden Horde history and Orientalists, who are often faced with the legal aspects of the material under study.

  5. 33 CFR 207.260 - Yazoo Diversion Canal, Vicksburg, Miss., from its mouth at Kleinston Landing to Fisher Street...

    Science.gov (United States)

    2010-07-01

    ... fastened with chains or wire rope that it cannot be separated or bag out or materially change its shape... route. Rafts shall not be of greater dimensions than 50 feet wide by 600 feet long, and if longer than 300 feet they shall be handled by two tugs; and in all cases they must be handled by sufficient tug...

  6. Academic Achievement and Classification of Students from the Freely Associated States in Guam Schools. REL 2017-260

    Science.gov (United States)

    Stewart, Joshua; Stringer, Katie; Arens, Sheila A.; Cicchinelli, Louis F.; San Nicolas, Heidi; Flores, Nieves

    2017-01-01

    Guam is home to the largest population of migrants from the Freely Associated States (FAS): the Federated States of Micronesia, the Republic of the Marshall Islands, and the Republic of Palau. FAS students made up 22 percent of total student enrollment in Guam public schools in 2012. FAS students face a number of challenges when they enter Guam…

  7. Synthesis of Nanocrystalline RuO2(60%)-SnO2(40%)Powders by Amorphous Citrate Route

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Nanometer RuO2-SnO2was synthesized by the citrate-gel method using RuCl3, SnCl4 as cation sources, citric acid as complexing agent and anhydrous ethanol as solvent. The structures of the derived powders were characterized by thermogravimetric and differential thermal analysis, X-ray diffraction, transmission electron microscope, and Brunauer-Emmett-Teller surface area measurement. The pure, fine and amorphous powders was obtained at 160℃. The materials calcined at above 400 ℃ were composed of rutile-type oxide phases having particle sizes of fairly narrow distribution and good thermal resistant properties. By adding SnO2 to RUO2, the Ru metallic phase can be effectively controlled under a traditional temperature of preparation for dimensional stable anode.

  8. On the truth of Ksub(IC) values, taken from RD 50-260-81 methodical instructions

    International Nuclear Information System (INIS)

    Ivanova, V.S.

    1984-01-01

    Ways to evaluate correctness of Ksub(Ic) values, taking into account self-similarity of prefracture zone and stability of critical density of strain energy, as well as necessity to introduce corrections for plastic strain zone, are considered. Correctness of Ksub(Ic) values and temperature range of tough (hole) fracture mechanism realization, taking into account the effect of plastic strain compression degree for the Ksub(Ic) vaclue established in the basic experiment; necessity to introduce on the basis of similarity theory approaches the method of plastic strain compression degree during the development of state standard project, so as to decrease data spread and to increase information value of separate experiments, when studying crack resistance of plastic materials, have been confirmed

  9. 45 CFR 260.33 - When are expenditures on State or local tax credits allowable expenditures for TANF-related...

    Science.gov (United States)

    2010-10-01

    ... State or local tax credits allowable expenditures for TANF-related purposes? (a) To be an allowable expenditure for TANF-related purposes, any tax credit program must be reasonably calculated to accomplish one... credit to be an allowable expenditure. (2) Under a State Earned Income Tax Credit (EITC) program, the...

  10. Functional Expression of the Thiolase Gene thl from Clostridium beijerinckii P260 in Lactococcus lactis and Lactobacillus buchneri

    Science.gov (United States)

    The first step of the butanol pathway involves an acetyl-CoA acetyltransferase (ACoAAT), which controls the key branching point from acetyl-CoA to butanol. ACoAAT, also known as thiolase (EC 2.3.1.9), is encoded by the thl gene and catalyzes ligation of 2 acetyl-CoA into acetoacetyl-CoA. Bioinform...

  11. Intraoperative iodinated contrast swallow with CT-scan delayed control for detection of early complications in laparoscopic gastric bypass: A case series of 260 cases

    Directory of Open Access Journals (Sweden)

    Vincenzo Consalvo, M.D.

    2017-01-01

    Conclusions: This study gives a contribute to the existing issue of fast track in bariatric surgery for the early diagnosis of complications and patients' readmission or non-discharge. In conclusion, the use of intraoperative iodinated water soluble contrast swallow and abdominal CT-scan at 48 h was a safe and accurate test in order to detect and treat any potential early surgical complication in LRYGB.

  12. Age at puberty, ovulation rate, and reproductive tract traits of developing gilts fed two lysine levels and three metabolizable energy levels from 100 to 260 d of age

    Science.gov (United States)

    The objective of this study was to determine the effect of feeding different lysine and metabolizable energy (ME) levels to developing gilts on age at puberty and reproductive tract measurements. Crossbred Large White × Landrace gilts (n = 1221) housed in groups from 100 d of age until slaughter (ap...

  13. Age at puberty, ovulation rate, and uterine length of developing gilts fed two lysine and three metabolizable energy concentrations from 100 to 260 d of age

    Science.gov (United States)

    The objectives of this study were to determine the effect of feeding different lysine and metabolizable energy (ME) levels to developing gilts on age at puberty and reproductive tract measurements, and to determine relationships between these traits and growth trajectories. Crossbred Large White × L...

  14. Prospective multicenter observational study of 260 infants born to 259 opiate-dependent mothers on methadone or high-dose buprenophine substitution.

    Science.gov (United States)

    Lejeune, Claude; Simmat-Durand, Laurence; Gourarier, Laurent; Aubisson, Sandrine

    2006-05-20

    Specialized prenatal care and substitution programs improve the perinatal prognoses of pregnant drug-abusers and their infants. Although methadone is well documented, little is known about high-dose buprenorphine (HDB). This prospective, multicenter (n = 35) observational study included 259 women on maintenance during pregnancy: 39% on methadone and 61% on HDB. Major findings were: 46% of them received good prenatal care; 62% had peridural analgesia; 12.3% delivered prematurely (hydrochloride. No baby died. Newborns were discharged with their mothers (96%) or placed in foster care (4%). Comparing methadone with HDB, respectively, mean age at the maximum Lipsitz score was 81 h versus 66 h (P = 0.066). The perinatal medical and social prognoses for these 259 drug addicts and their infants appeared to be improved by specialized prenatal care and was similar for methadone or BHD substitution during pregnancy.

  15. 76 FR 36395 - Airworthiness Directives; Piper Aircraft, Inc. Models PA-24, PA-24-250, and PA-24-260 Airplanes

    Science.gov (United States)

    2011-06-22

    ...-0639; Directorate Identifier 2011-CE-016-AD] RIN 2120-AA64 Airworthiness Directives; Piper Aircraft... identified in this proposed AD, contact Piper Aircraft, Inc., 2926 Piper Drive, Vero Beach, Florida 32960... September 15, 2004. This SAIB alerted owners and operators of Piper Aircraft, Inc. (Piper) Models PA-23, PA...

  16. Sharing the slope: depth partitioning of agariciid corals and associated Symbiodinium across shallow and mesophotic habitats (2-60 m) on a Caribbean reef.

    NARCIS (Netherlands)

    Bongaerts, P.; Frade, P.R.; Ogier, J.J.; Hay, K.B.; van Bleijswijk, J.; Englebert, N.; Vermeij, M.J.A.; Bak, R.P.M.; Visser, P.M.; Hoegh-Guldberg, O

    2013-01-01

    Background Scleractinian corals and their algal endosymbionts (genus Symbiodinium) exhibit distinct bathymetric distributions on coral reefs. Yet, few studies have assessed the evolutionary context of these ecological distributions by exploring the genetic diversity of closely related coral species

  17. Effect of cellulosic sugar degradation products (furfural and hydroxymethylfurfural) on acetone-butanol-ethanol (ABE) fermentation using Clostridium beijerinckii P260

    Science.gov (United States)

    Studies were performed to identify chemicals present in wheat straw hydrolysate (WSH) that enhance acetone butanol ethanol (ABE) productivity. These chemicals were identified as furfural and hydroxymethyl furfural (HMF). Control experiment resulted in the production of 21.09-21.66 gL**-1 ABE with a ...

  18. SU-F-T-260: Using Portal Image Device for Pre-Treatment QA in Volumetric Modulated Arc Plans with Flattening Filter Free (FFF) Beams

    Energy Technology Data Exchange (ETDEWEB)

    Qu, H; Qi, P; Yu, N; Xia, P [The Cleveland Clinic Foundation, Cleveland, OH (United States)

    2016-06-15

    Purpose: To implement and validate a method of using electronic portal image device (EPID) for pre-treatment quality assurance (QA) of volumetric modulated arc therapy (VMAT) plans using flattering filter free (FFF) beams for stereotactic body radiotherapy (SBRT). Methods: On Varian Edge with 6MV FFF beam, open field (from 2×2 cm to 20×20 cm) EPID images were acquired with 200 monitor unit (MU) at the image device to radiation source distance of 150cm. With 10×10 open field and calibration unit (CU) provided by vendor to EPID image pixel, a dose conversion factor was determined by dividing the center dose calculated from the treatment planning system (TPS) to the corresponding CU readout on the image. Water phantom measured beam profile and the output factors for various field sizes were further correlated to those of EPID images. The dose conversion factor and correction factors were then used for converting the portal images to the planner dose distributions of clinical fields. A total of 28 VMAT fields of 14 SBRT plans (8 lung, 2 prostate, 2 liver and 2 spine) were measured. With 10% low threshold cutoff, the delivered dose distributions were compared to the reference doses calculated in water phantom from the TPS. A gamma index analysis was performed for the comparison in percentage dose difference/distance-to-agreement specifications. Results: The EPID device has a linear response to the open fields with increasing MU. For the clinical fields, the gamma indices between the converted EPID dose distributions and the TPS calculated 2D dose distributions were 98.7%±1.1%, 94.0%±3.4% and 70.3%±7.7% for the criteria of 3%/3mm, 2%/2mm and 1%/1mm, respectively. Conclusion: Using a portal image device, a high resolution and high accuracy portal dosimerty was achieved for pre-treatment QA verification for SBRT VMAT plans with FFF beams.

  19. Chemistry of the heaviest elements--one atom at a time

    International Nuclear Information System (INIS)

    Hoffman, Darleane C.; Lee, Diana M.

    2000-01-01

    In keeping with the goal of the Viewpoint series of the Journal of Chemical Education, this article gives a 75-year perspective of the chemistry of the heaviest elements, including a 50-year retrospective view of past developments, a summary of current research achievements and applications, and some predictions about exciting, new developments that might be envisioned within the next 25 years. A historical perspective of the importance of chemical separations in the discoveries of the transuranium elements from neptunium (Z=93) through mendelevium (Z=101) is given. The development of techniques for studying the chemical properties of mendelevium and still heavier elements on the basis of measuring the radioactive decay of a single atom (''atom-at-a-time'' chemistry) and combining the results of many separate experiments is reviewed. The influence of relativistic effects (expected to increase as Z 2 ) on chemical properties is discussed. The results from recent atom-at-a-time studies of the chemistry of the heaviest elements through seaborgium (Z=106) are summarized and show that their properties cannot be readily predicted based on simple extrapolation from the properties of their lighter homologues in the periodic table. The prospects for extending chemical studies to still heavier elements than seaborgium are considered and appear promising

  20. Implementación de trazados viales, según el uso y ocupación del suelo (COS – CUS), en ciudades del Ecuador con menos 260.000 habitantes

    OpenAIRE

    Ayabaca Cazar, Fabián Ramiro

    2014-01-01

    El objetivo de esta investigación es establecer un esquema básico de procedimientos para la implementación de un estudio que permita el desarrollo de una red vial aplicando la reglamentación de uso y ocupación del suelo, en relación con las nuevas leyes vigentes, así como, facilitar al técnico municipal con una guía para establecer los estudios necesarios previos a la aplicación de un diseño de un trazado vial. En la parte inicial de investigación permitió identificar las estructuras legal...

  1. Hamman Philippe, Blanc Christine, 2009, Sociologie du développement urbain durable. Projets et stratégies métropolitaines françaises, Bruxelles, P.I.E Peter Lang, 260p.

    Directory of Open Access Journals (Sweden)

    Bruno Villalba

    2009-10-01

    Full Text Available Cet ouvrage, réalisé en collaboration avec Flore Henninger, préfacé par Viviane Claude et postfacé par Corinne Larrue, est dirigé par Philippe Hamman (maître de conférences en sociologie au département d’urbanisme de l’UFR de sciences sociales, pratiques sociales et développement de l’université de Strasbourg ; il a dirigé, en 2008, Penser le développement durable urbain : regards croisés, Paris, L’Harmattan et Christine Blanc (sociologue et urbaniste, chargée d’études au Centre de recherche...

  2. Neumonía adquirida en la comunidad en lactantes y preescolares del municipio de Turbo, Antioquia Community acquired neumonia in chil- children dren aged 2-60 months in Colombia

    Directory of Open Access Journals (Sweden)

    Ana Eugenia Arango

    2004-09-01

    Full Text Available Se estudiaron 110 niños entre los 2 y los 60 meses de edad, con diagnóstico de neumonía adquirida en la comunidad, en el Hospital Francisco Valderrama del municipio de Turbo, Antioquia, pertenecientes al programa Vida Infantil de la Universidad de Antioquia. Los criterios de inclusión fueron la taquipnea y el tiraje de acuerdo con las normas de la OMS para el diagnóstico de la infección respiratoria baja en lactantes y preescolares en países en vías de desarrollo. Los pacientes se estudiaron microbiológicamente mediante hemocultivos, prueba de látex para antígenos bacterianos en la orina, prueba de Elisa para Micoplasma pneumoniae y panel respiratorio para los virus que causan más frecuentemente dicha enfermedad. Se hicieron además hemoleucogramas y radiografías pulmonares. Todas las muestras se tomaron bajo criterios protocolizados y se trasladaron por vía aérea a la ciudad de Medellín bajo normas estrictas de conservación, para ser procesadas en el Laboratorio de Investigaciones en Infectología Pediátrica de la Universidad de Antioquia. Los exámenes más adecuados para la comprobación del diagnóstico fueron las radiografías de tórax con 77%; los hemocultivos con una positividad de 11.1%, el panel respiratorio con 3.7%, la prueba de látex para los antígenos bacterianos con 7.4% y la prueba de ELISA con 0.9%. Los hemoleucogramas tuvieron un amplio margen de variabilidad. No se encontró relación estadística entre las variables epidemiológicas estudiadas y la gravedad de la infección. El estudio confirma la escasa sensibilidad de los exámenes paraclínicos y reafirma la importancia del diagnóstico clínico temprano como base para iniciar la terapia. One hundred and ten children aged between 2 and 60 months with the diagnosis of communityacquired pneumoniae, were studied at Francisco Valderrama Hospital in the city of Turbo, Colombia; they belonged to the University of Antioquia Child Life program. Admission criteria were tachypnea and retraction according to the WHO guidelines for lower respiratory tract infection diagnosis in infants and preschool children in developing countries. Patients were studied microbiologically by means of blood cultures, urine latex aggutination test for bacterial antigens, ELISA test for Mycoplasma pneumoniae, and a panel for respiratory viruses that frequently cause this disease. Blood specimens and pulmonary radiographies were also taken under protocolized criteria and the former were transported by plane to Medellín under strict measures of preservation, in order to be processed at the Pediatric Investigation and Infectology Laboratory of the University of Antioquia. Radiographies were positive in 77% of cases, blood cultures in 11.1%, latex agglutination for bacterial antigens in 7.4%, respiratory viruses panel in 3.7%, and ELISA test in 0.9%. Hemoleucograms had a wide range of variability. Relationships between epidemiological variables and the severity of the infection were not found. The study confirms the scarce positivity of paraclinical tests and reaffirms the importance of early clinical diagnosis as the basis for starting therapy.

  3. Fenicias de Eurípides: Concepción agonal de espacio y tiempo en prólogo y párodos (vv.1-260

    Directory of Open Access Journals (Sweden)

    Graciela N. Hamamé

    2013-09-01

    Nos proponemos demostrar que el diseño espacio-temporal de prólogo y párodos construye una suerte de agón en el nivel espacial que se evidencia en el trazado de los personajes de Yocasta, Antígona y el Pedagogo en el prólogo y de las mujeres fenicias en la párodos. De modo que también resulte agonal la confrontación entre propio y ajeno, ya mencionada, como característica de la composición teatral euripidea, acorde con las realidades comunicativas de la época de representación de la tragedia y con la propuesta poética del autor.

  4. Conformance to Regulatory Guide 1.97 Browns Ferry Nuclear Plant, Unit Nos. 1, 2 and 3 (Docket Nos. 50-259, 50-260, and 50-296)

    International Nuclear Information System (INIS)

    Udy, A.C.

    1985-07-01

    This EG and G Idaho, Inc., report reviews the submittals for Regulatory Guide 1.97, Revision 3, for Unit Nos. 1, 2 and 3 of the Browns Ferry Nuclear Plant and identifies areas of nonconformance to the regulatory guide. Exceptions to Regulatory Guide 1.97 are evaluated and those areas where sufficient basis for acceptability is not provided are identified

  5. 75 FR 36538 - Arkansas: Final Authorization of State-initiated Changes and Incorporation by Reference of State...

    Science.gov (United States)

    2010-06-28

    ... regulation by the close of business July 28, 2010. If the EPA receives such comments, it will publish a... the comment includes information claimed to be Confidential Business Information or other information... analog. or ``SWMU''''. 260.20(b) intro 260.20(b) intro. 260.20(b)(3) 260.20(b)(3). 260.20(c)-(f) 260.20(c...

  6. Glenn Seaborg's Contributions to Heavy Element Science and the Periodic Table

    International Nuclear Information System (INIS)

    Hobart, David E.

    2012-01-01

    In celebrating the centennial anniversary of the birth of Glenn T. Seaborg it is fitting that we recount and pay tribute to his legacy. Many know of the scientific accomplishments of this man who became a legend and anyone who has attended his lectures can attest to how informative, educational, and entertaining he was. He had a beguiling and whimsical sense of humor and used this to drive home his points and share his passion and quest for discovery. The periodic table is a fundamental cornerstone of science and remains a central unifying principal. Seaborg was the architect of the actinide series of elements and their proper placement in the periodic table and co-discoverer of ten transuranium elements - one of which bears his name, element 106, seaborgium. The work and achievements of this Nobel laureate have touched the lives of many and his legacy will continue for generations to come.

  7. Glann Seaborg's Contributions to Heavy Element Science and the Periodic Table

    Energy Technology Data Exchange (ETDEWEB)

    Hobart, David E. [Los Alamos National Laboratory

    2012-08-17

    In celebrating the centennial anniversary of the birth of Glenn T. Seaborg it is fitting that we recount and pay tribute to his legacy. Many know of the scientific accomplishments of this man who became a legend and anyone who has attended his lectures can attest to how informative, educational, and entertaining he was. He had a beguiling and whimsical sense of humor and used this to drive home his points and share his passion and quest for discovery. The periodic table is a fundamental cornerstone of science and remains a central unifying principal. Seaborg was the architect of the actinide series of elements and their proper placement in the periodic table and co-discoverer of ten transuranium elements - one of which bears his name, element 106, seaborgium. The work and achievements of this Nobel laureate have touched the lives of many and his legacy will continue for generations to come.

  8. ORF Alignment: NC_003424 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available HRTRARTESSVFVIDKKTSQCVHYQANERGKHYV 180 ... Query: 260 KIHCHVAKENYAARVRSLQTYDAISKDVLS...RWVYPFVPDSNLLNQTFSYQRHQIYKEEDV 319 ... KIHCHVAKENYAARVRSLQTYDAISKDVLSRWVYPFVPDSNLLNQTFSYQRHQIYKEEDV Sbjct: 241 KIHCHVAKENYA

  9. ORF Alignment: NC_001133 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available STPDHGYVLVCTVHTKHPNIIIVGTSKGWLDFYKFH 180 ... Query: 260 YQDVINKLQWNCILFSNNTAEYLVASTHGSSAHEL...YIWETTSGTLVRVLEGAEEELIDIN 319 ... YQDVINKLQWNCILFSNNTAEYLVASTHGSSAHELYIWETTSGTLVRVLEGAEEELIDIN... Sbjct: 241 YQDVINKLQWNCILFSNNTAEYLVASTHGSSAHELYIWETTSGTLVRVLEGAEEELIDIN 300 ...

  10. ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available KVELILYKPGNKFKCDILYQCILRNQLIWINDWDLYSIATVFKRILS 260 ... LYQIFKIVENNGNKVELILYKPGNKFKCDILYQCILRNQLIWIND...WDLYSIATVFKRILS Sbjct: 1 ... LYQIFKIVENNGNKVELILYKPGNKFKCDILYQCILRNQLIWINDWDLYSIATV

  11. Carlos Alberto González Sánchez, Los mundos del libro. Medios de difusión de la cultura occidental en las Indias de los siglos XVI y XVII, (Séville, Universidad de Sevilla, Diputación de Sevilla, 2001, 260p.)

    OpenAIRE

    Gruzinski, Serge

    2005-01-01

    La colonisation ibérique a transformé l'imprimé européen en un moyen de diffusion à l'échelle planétaire. Plus qu'en Afrique ou qu'en Asie c'est au Nouveau Monde, avec les conquistadores, les missionnaires, les fonctionnaires et les marchands que sont arrivés les livres et les libraires de la Renaissance. Des imprimeurs et des imprimeries se sont même implantés à Mexico puis à Lima au cours du XVIe siècle. Très tôt s'est constitué un premier public "américain", composé d'Européens immigrés ou...

  12. Technical evaluation of the electrical, instrumentation, and control design aspects of the proposed license amendment Revision 1 for single-loop operation of Browns Ferry Nuclear Plants (Docket No. 50-259, Unit 1; Docket No. 50-260, Unit 2; Docket No. 50-296, Unit 3)

    International Nuclear Information System (INIS)

    Donich, T.R.

    1983-01-01

    This report documents the technical evaluation of the proposed changes to the plant reactor protection system by the licensee of Browns Ferry Nuclear Power Station, Units 1, 2, and 3, to account for single-loop plant operation. This evaluation is restricted to only the electrical, instrumentation and control design aspects of proposed changes to the plant technical specifications for single-loop operation beyond 24 hours. Conclusion is that the license amendment for single-loop operation has met the review criteria provided sufficient administrative controls are in effect, and any anomalous control room indicators are corrected or warning-tagged for the duration of single-loop operation

  13. Reseña de Conquistando el fin del mundo. La Misión La Candelaria y la salud de la población Selkman, Tierra del fuego 1895-1931 de Romina Casali. Prohistoria, Rosario, 2014, 260 páginas

    OpenAIRE

    Ramacciotti, Karina Inés

    2016-01-01

    Romina Casali aborda de una manera atenta, a la vez que sofisticada, los cruces entre la enfermedad, los discursos científicos y políticos en la misión salesiana La Candelaria (Río Grande) entre 1895-1931. Este estudio de caso permite reflexionar sobre fenómenos de larga duración y pasibles de ser estudiados en historia de la sociedad Selk’nam, comunidad cazadora-recolectora. La propuesta no queda atrapada en la descripción de lo local sino que de una manera madura aventura hipótesis sobre lo...

  14. Microbial raw data for UV-C LED disinfection study

    Data.gov (United States)

    U.S. Environmental Protection Agency — This study evaluated ultraviolet (UV) light emitting diodes (LEDs) emitting at 260 nm, 280 nm, and the combination of 260|280 nm together for their efficacy at...

  15. Geranium molle L

    Czech Academy of Sciences Publication Activity Database

    Šumberová, Kateřina; Ducháček, M.

    2009-01-01

    Roč. 44, č. 2 (2009), s. 260-260 ISSN 1211-5258 Institutional research plan: CEZ:AV0Z60050516 Keywords : strongly endangered species * flora of fish storage pond complexes * ruderal grasslands Subject RIV: EF - Botanics

  16. ORF Alignment: NC_002696 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available GRSGRPETGRQGYSISAVNEFDAL 180 ... Query: 260 ATFMAKPMANEPGSAMHIHQSIVDKKGRNLFSDEDGAESAMFHGFIAGQQTYLPAIMAIL 319 ... ... ... ATFMAKPMANEPGSAMHIHQSIVDKKGRNLFSDEDGAESAMFHGFIAGQQTYLPAIMAIL Sbjct: 241 ...ATFMAKPMANEPGSAMHIHQSIVDKKGRNLFSDEDGAESAMFHGFIAGQQTYLPAIMAIL 300 ... Query: 380 SLAAGYLGMVQGLKPSEPVSIDAGARGIELP

  17. 77 FR 41292 - Louisiana: Final Authorization of State-Initiated Changes and Incorporation by Reference of...

    Science.gov (United States)

    2012-07-13

    ... 11, 2012, unless the EPA receives adverse written comment on this regulation by the close of business... waste management system: General) 105.I.1 260.21(a). 105.I.2.c 260.21(b)(3). 105.O.1 intro 260.30 intro... analogs to 40 CFR Part 261 provisions (Identification and listing of hazardous waste) 105.D.2.l intro 261...

  18. Theoretical predictions of properties and gas-phase chromatography behaviour of carbonyl complexes of group-6 elements Cr, Mo, W, and element 106, Sg.

    Science.gov (United States)

    Pershina, V; Anton, J

    2013-05-07

    Fully relativistic, four-component density functional theory electronic structure calculations were performed for M(CO)6 of group-6 elements Cr, Mo, W, and element 106, Sg, with an aim to predict their adsorption behaviour in the gas-phase chromatography experiments. It was shown that seaborgium hexacarbonyl has a longer M-CO bond, smaller ionization potential, and larger polarizability than the other group-6 molecules. This is explained by the increasing relativistic expansion and destabilization of the (n - 1)d AOs with increasing Z in the group. Using results of the calculations, adsorption enthalpies of the group-6 hexacarbonyls on a quartz surface were predicted via a model of physisorption. According to the results, -ΔHads should decrease from Mo to W, while it should be almost equal--within the experimental error bars--for W and Sg. Thus, we expect that in the future gas-phase chromatography experiments it will be almost impossible--what concerns ΔHads--to distinguish between the W and Sg hexacarbonyls by their deposition on quartz.

  19. Superheavy element chemistry. Achievements and perspectives

    International Nuclear Information System (INIS)

    Schaedel, M.

    2007-01-01

    Superheavy elements have been synthesized and chemically characterized one-atom-at-a-time up to element 108. Presently, the quest for element 112 is one of the hottest topics in this field. The transactinide elements 104 to 108 are members of group 4 to 8 of the Periodic Table and element 112 belongs into group 12. Chemical properties of some of these elements, like elements 104 and 105, show stunning deviations from simple extrapolations within their respective group while others exhibit great similarities with their lighter homologues elements. First experiments to investigate seaborgium (Sg, element 106) in aqueous solution were performed. Again, in large international collaborations at the GSI, several gas-phase chemistry experiments were performed with hassium (Hs, element 108). Recently, the highly efficient and very clean separation of Hs was applied for nuclear studies of various Hs nuclides investigating their cross section and their nuclear decay properties in the region of the doubly-magic 270 Hs (Z=108, N=162). To overcome certain limitations of the presently used on-line chemical separations the new TransActinide Separation and Chemistry Apparatus (TASCA) - with a gas-filled recoil separator as a front-end tool - was designed and built at the GSI in a collaborative effort. Presently in its commissioning phase, TASCA shall be a key instrument for a big leap into quantitatively and qualitatively new experiments in the region of superheavy elements. (author)

  20. Chemistry of superheavy elements

    International Nuclear Information System (INIS)

    Schaedel, M.

    2012-01-01

    The chemistry of superheavy elements - or transactinides from their position in the Periodic Table - is summarized. After giving an overview over historical developments, nuclear aspects about synthesis of neutron-rich isotopes of these elements, produced in hot-fusion reactions, and their nuclear decay properties are briefly mentioned. Specific requirements to cope with the one-atom-at-a-time situation in automated chemical separations and recent developments in aqueous-phase and gas-phase chemistry are presented. Exciting, current developments, first applications, and future prospects of chemical separations behind physical recoil separators ('pre-separator') are discussed in detail. The status of our current knowledge about the chemistry of rutherfordium (Rf, element 104), dubnium (Db, element 105), seaborgium (Sg, element 106), bohrium (Bh, element 107), hassium (Hs, element 108), copernicium (Cn, element 112), and element 114 is discussed from an experimental point of view. Recent results are emphasized and compared with empirical extrapolations and with fully-relativistic theoretical calculations, especially also under the aspect of the architecture of the Periodic Table. (orig.)

  1. Chemistry of the superheavy elements.

    Science.gov (United States)

    Schädel, Matthias

    2015-03-13

    The quest for superheavy elements (SHEs) is driven by the desire to find and explore one of the extreme limits of existence of matter. These elements exist solely due to their nuclear shell stabilization. All 15 presently 'known' SHEs (11 are officially 'discovered' and named) up to element 118 are short-lived and are man-made atom-at-a-time in heavy ion induced nuclear reactions. They are identical to the transactinide elements located in the seventh period of the periodic table beginning with rutherfordium (element 104), dubnium (element 105) and seaborgium (element 106) in groups 4, 5 and 6, respectively. Their chemical properties are often surprising and unexpected from simple extrapolations. After hassium (element 108), chemistry has now reached copernicium (element 112) and flerovium (element 114). For the later ones, the focus is on questions of their metallic or possibly noble gas-like character originating from interplay of most pronounced relativistic effects and electron-shell effects. SHEs provide unique opportunities to get insights into the influence of strong relativistic effects on the atomic electrons and to probe 'relativistically' influenced chemical properties and the architecture of the periodic table at its farthest reach. In addition, they establish a test bench to challenge the validity and predictive power of modern fully relativistic quantum chemical models. © 2015 The Author(s) Published by the Royal Society. All rights reserved.

  2. Transuranium elements: Past, present, and future

    International Nuclear Information System (INIS)

    Seaborg, G.T.

    1995-01-01

    In this illustrative Account the authors shall concentrate on four of these elements, chosen for their current interest or pivotal role. The story of plutonium is one of the most dramatic in the history of science, and today, plutonium is at the focus of an extraordinary dilemma. Mendelevium (element 101) has played a pivotal role in blazing the trail for the discovery of the heaviest elements on the basis of open-quotes one atom at a timeclose quotes production. Seaborgium (element 106) was recently named in my honor by the discoverers and may be the last element, at least for some time, for which it will be possible to determine many chemical properties. And element 110 represents recent evidence, after a lapse of 10 years, for the discovery of a chemical element. Recent (1994) recommendations of the IUPAC Commission on the Nomenclature of Inorganic Chemistry for the renaming of elements 104-108 have met with widespread rejection. The author is using the names proposed by the acknowledged discoverers (elements 106-109) or, in the case of the disputed elements 104 and 105, the most logical names. 21 refs., 5 figs

  3. Aqueous chemistry of transactinides

    International Nuclear Information System (INIS)

    Schaedel, M.

    2001-01-01

    The aqueous chemistry of the first three transactinide elements is briefly reviewed with special emphasis given to recent experimental results. Short introductory remarks are discussing the atom-at-a-time situation of transactinide chemistry as a result of low production cross-sections and short half-lives. In general, on-line experimental techniques and, more specifically, the automated rapid chemistry apparatus, ARCA, are presented. Present and future developments of experimental techniques and resulting perspectives are outlined at the end. The central part is mainly focussing on hydrolysis and complex formation aspects of the superheavy group 4, 5, and 6 transition metals with F - and Cl - anions. Experimental results are compared with the behaviour of lighter homologous elements and with relativistic calculations. It will be shown that the chemical behaviour of the first superheavy elements is already strongly influenced by relativistic effects. While it is justified to place rutherfordium, dubnium and seaborgium in the Periodic Table of the Elements into group 4, 5 and 6, respectively, it is no more possible to deduce from this position in detail the chemical properties of these transactinide or superheavy elements. (orig.)

  4. ORF Alignment: NC_005071 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ADLGADLVLTPELSLWGYPPRDLLLSHNHLV 60 ... Query: 138 IYDVFDEKRYFRPAGTPAVLEFERDGRRWRLGLTICEDLWVEEALQGKRIAGPDPIAAXX ...197 ... IYDVFDEKRYFRPAGTPAVLEFERDGRRWRLGLTICEDLWVEEALQGKRIAGPDPIAA ... Sbjct...: 121 IYDVFDEKRYFRPAGTPAVLEFERDGRRWRLGLTICEDLWVEEALQGKRIAGPDPIAALL 180 ... Query: 258 EHAELALQLPSCREALAIWD 277 ... EHAELALQLPSCREALAIWD Sbjct: 241 EHAELALQLPSCREALAIWD 260

  5. Nuclear Science Division 1994 annual report

    International Nuclear Information System (INIS)

    Myers, W.D.

    1995-06-01

    This report describes the activities of the Nuclear Science Division for the period of January 1, 1994, to December 31, 1994. This was a time of significant accomplishment for all of the programs in the Division. Assembly of the solar neutrino detector at the Sudbury Neutrino Observatory is well under way. All of the components fabricated by LBL were shipped to Sudbury early in the year and our efforts are now divided between assisting the assembly of the detector and preparing software for data analysis once the detector is operational in 1996. Much of the activity at the 88-Inch Cyclotron centered on Gammasphere. The open-quotes early implementationclose quotes phase of the detector ended in September. This phase was extremely successful, involving over 60 experiments with nearly 200 users from 37 institutions worldwide. The mechanical structure was installed and the final electronic system is expected to operate in March 1995. The Division concurrently hosted a conference on physics for large γ-ray detector arrays at the Clark Kerr Campus at UC Berkeley in August. This was a very successful meeting, reflecting the enthusiasm for this field worldwide. Also at the Cyclotron, the progress toward weak interaction experiments using ultra-thin sources passed a major milestone with the trapping of radioactive 21 Na atoms. We are now engaged in a major upgrade of the experimental area and the outlook is very promising for these novel experiments. Another highlight of research at the Cyclotron was the confirmation of element 106. This development allowed the original LLNL/LBL discovery team to move forward with their proposal to name this element seaborgium

  6. Nuclear Science Division 1994 annual report

    Energy Technology Data Exchange (ETDEWEB)

    Myers, W.D. [ed.

    1995-06-01

    This report describes the activities of the Nuclear Science Division for the period of January 1, 1994, to December 31, 1994. This was a time of significant accomplishment for all of the programs in the Division. Assembly of the solar neutrino detector at the Sudbury Neutrino Observatory is well under way. All of the components fabricated by LBL were shipped to Sudbury early in the year and our efforts are now divided between assisting the assembly of the detector and preparing software for data analysis once the detector is operational in 1996. Much of the activity at the 88-Inch Cyclotron centered on Gammasphere. The {open_quotes}early implementation{close_quotes} phase of the detector ended in September. This phase was extremely successful, involving over 60 experiments with nearly 200 users from 37 institutions worldwide. The mechanical structure was installed and the final electronic system is expected to operate in March 1995. The Division concurrently hosted a conference on physics for large {gamma}-ray detector arrays at the Clark Kerr Campus at UC Berkeley in August. This was a very successful meeting, reflecting the enthusiasm for this field worldwide. Also at the Cyclotron, the progress toward weak interaction experiments using ultra-thin sources passed a major milestone with the trapping of radioactive {sup 21}Na atoms. We are now engaged in a major upgrade of the experimental area and the outlook is very promising for these novel experiments. Another highlight of research at the Cyclotron was the confirmation of element 106. This development allowed the original LLNL/LBL discovery team to move forward with their proposal to name this element seaborgium.

  7. 75 FR 57686 - Hazardous Waste Management System; Identification and Listing of Hazardous Waste Amendment

    Science.gov (United States)

    2010-09-22

    ... Waste Management System; Identification and Listing of Hazardous Waste Amendment AGENCY: Environmental...) 260.20 and 260.22 allows facilities to demonstrate that a specific waste from a particular generating facility should not be regulated as a hazardous waste. Based on waste-specific information provided by the...

  8. 77 FR 31513 - Patient Protection and Affordable Care Act; Establishment of Exchanges and Qualified Health Plans...

    Science.gov (United States)

    2012-05-29

    ..., because the privacy and security principles from which the rule derives its language applies specifically... paragraph (a) of Sec. 155.260, which also applies to the creation of personally identifiable information. In this notice, we are adding the word ``creation'' to Sec. 155.260(d). On page 18456, we presented...

  9. 700 kg jern med de smukkeste krystaller

    DEFF Research Database (Denmark)

    Pedersen, Jens Olaf Pepke

    2017-01-01

    Anmeldelse af Holger Pedersen, “Pallas Iron – Russia’s first meteorite”, 260 sider, 190 kr. BoD 2017 (www.bod.dk/bog/).......Anmeldelse af Holger Pedersen, “Pallas Iron – Russia’s first meteorite”, 260 sider, 190 kr. BoD 2017 (www.bod.dk/bog/)....

  10. profitability of groundnut-based cropping systems among farmers in ...

    African Journals Online (AJOL)

    accounting for all cost. The rate of return on investment (RRI) analysis shows that groundnut/sorghum enterprise has RRI of. 232%, while sole groundnut enterprise has RRI of. 260%. This implies that an average farmer earns N232 profit for every naira invested in groundnut/sorghum production, while N260 is earned for ...

  11. Evaluation of drought tolerance indices among some winter ...

    African Journals Online (AJOL)

    Administrator

    2011-09-14

    Sep 14, 2011 ... double low. 280-260. Cold and Mild-Cold. 7. Talaye. Germany. Open- pollination. 43-40 double low. 280-260. Cold and Mild-Cold. 1GSL: Growing season length, 2“double low”: low erucic acid and low glucosinolate. Table 2. Physical and chemical properties of experimental soil before planting. Available k.

  12. Evaluating UV-C LED disinfection performance and investigating potential dual-wavelength synergy

    Science.gov (United States)

    This study evaluated ultraviolet (UV) light emitting diodes (LEDs) emitting at 260 nm, 280 nm, and the combination of 260|280 nm together for their efficacy at inactivating Escherichia. coli, MS2 coliphage, human adenovirus type 2 (HAdV2), and Bacillus pumilus spores; research in...

  13. 75 FR 61356 - Hazardous Waste Management System; Identification and Listing of Hazardous Waste; Correction

    Science.gov (United States)

    2010-10-05

    ... Waste Management System; Identification and Listing of Hazardous Waste; Correction AGENCY: Environmental... thermal desorber residual solids with Hazardous Waste Numbers: F037, F038, K048, K049, K050, and K051. In... and correcting it in Table 1 of appendix IX to part 261--Waste Excluded Under Sec. Sec. 260.20 and 260...

  14. Reaching the superlinear convergence phase of the CG method

    Czech Academy of Sciences Publication Activity Database

    Axelsson, Owe; Karátson, J.

    2014-01-01

    Roč. 260, č. 260 (2014), s. 244-257 ISSN 0377-0427 R&D Projects: GA MŠk ED1.1.00/02.0070 Institutional support: RVO:68145535 Keywords : superlinear convergence * conjugate gradient method * eigenvalues Subject RIV: BA - General Mathematics Impact factor: 1.266, year: 2014 http://www.sciencedirect.com/science/article/pii/S0377042713005451

  15. Landing Zone and Drop Zone Criteria

    Science.gov (United States)

    2017-05-01

    Points of Impact (RPI) ............................................................................................. 75 6.5.5 Multiple Points of Impact ...Helicopter IFR runway (UFC 3-260-01, Fig. 4-2) ....................................................................... 48 11 IFR airspace imaginary...surfaces: IFR Helicopter runways and helipad (UFC 3- 260-01, Fig. 4-3

  16. Landing-Zone and Drop-Zone Criteria

    Science.gov (United States)

    2017-05-01

    Points of Impact (RPI) ............................................................................................. 75 6.5.5 Multiple Points of Impact ...Helicopter IFR runway (UFC 3-260-01, Fig. 4-2) ....................................................................... 48 11 IFR airspace imaginary...surfaces: IFR Helicopter runways and helipad (UFC 3- 260-01, Fig. 4-3

  17. Congenital broncho-oesophageal fistula

    African Journals Online (AJOL)

    1983-04-09

    Apr 9, 1983 ... Rigid bronchoscopy performed under general anaesthesia .... Blackburn WR, Armour)' RA. Congenital esophago-pulmonary fistulas without esophageal atresia: an analysis of 260 fistulas in infants, children and adults.

  18. Search Results | Page 26 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 251 - 260 of 8494 ... ... demand for health service delivery in the Middle East and North Africa. ... Strengthening response capacity to African infectious disease outbreaks. The 2014 Ebola outbreak in West Africa claimed the lives of tens of ...

  19. ORF Alignment: NC_005788 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available gossypii ATCC 10895] ref|NP_986381.1| AGL286Cp ... [Eremothecium gossypii] ... Length = 122 ... Query: 201 ALNGFENTDPHTST...AFALGPEGPTQRNLDTHGXXXXXXXXXXXXXXXXXXXXLGLYSDMG 260 ... ALNGFENTDPHTSTAFALGPE...GPTQRNLDTHG ... LGLYSDMG Sbjct: 1 ... ALNGFENTDPHTSTAFALGPEGPTQRNLDT

  20. Search Results | Page 25 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 241 - 250 of 260 ... ... although the brand of the bottled water and how it is stored affected its quality. ... Nigerian women reap benefits from indigenous vegetables ... methods: learning routes, learning alliances, and innovation contests.

  1. Search Results | Page 26 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 251 - 260 of 439 ... Institutional Support to Policy Research Organizations in India ... In South Asia, people's social, political and cultural aspirations often get ... large numbers of Chinese migrants to Southeast Asia and the United States.

  2. Global Journal of Pure and Applied Sciences - Vol 17, No 3 (2011)

    African Journals Online (AJOL)

    BE Job, E Ekpenyong, NU Bassey, 255-260 ... A comparative study of direct and indirect solar drying of mango · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT ... Physico-chemical properties, energy, mineral, vitamin and sensory ...

  3. 78 FR 9771 - Notice of Opportunity for Public Comment on Surplus Property Release at Brunswick-Golden Isles...

    Science.gov (United States)

    2013-02-11

    ... address: Atlanta Airports District Office, Attn: Aimee A. McCormick, Program Manager, 1701 Columbia Ave... McCormick, Program Manager, Atlanta Airports District Office, 1701 Columbia Ave., Suite 2-260, Atlanta, GA...

  4. Dynamic scaling and kinetic roughening of poly(ethylene) islands grown by vapor phase deposition

    Czech Academy of Sciences Publication Activity Database

    Choukourov, A.; Melnichuk, I.; Gordeev, I.; Kylián, O.; Hanuš, J.; Kousal, J.; Solař, P.; Hanyková, L.; Brus, Jiří; Slavínská, D.; Biederman, H.

    2014-01-01

    Roč. 565, 28 August (2014), s. 249-260 ISSN 0040-6090 Institutional support: RVO:61389013 Keywords : poly(ethylene) * physical vapor deposition * island growth Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.759, year: 2014

  5. Ecotoxicity and genotoxicity assessment of cytotoxic antineoplastic drugs and their metabolites

    Czech Academy of Sciences Publication Activity Database

    Zounková, R.; Kovalová, L.; Bláha, Luděk; Dott, W.

    2010-01-01

    Roč. 81, č. 2 (2010), s. 253-260 ISSN 0045-6535 Institutional research plan: CEZ:AV0Z60050516 Keywords : cytotoxic drugs * ecotoxicity * metabolite Subject RIV: EF - Botanics Impact factor: 3.155, year: 2010

  6. 76 FR 19119 - Agency Information Collection Activities: Certificate of Origin

    Science.gov (United States)

    2011-04-06

    ... keepers from the collection of information (total capital/startup costs and operations and maintenance... Respondent: 20. Estimated Number of Total Annual Responses: 2,260. Estimated Time per Response: 22 minutes...

  7. Search Results | Page 23 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 221 - 230 of 260 ... Gender, International Law and Justice : Access to Gender Equality ... on the Elimination of All Forms of Discrimination against Women (CEDAW) and the ... Palestinian women and girls account for over half of the Arab ...

  8. 40 CFR 63.110 - Applicability.

    Science.gov (United States)

    2010-07-01

    ... of 40 CFR parts 260 through 272. The owner or operator shall keep a record of the information used to... 272. (f) Overlap with the Vinyl Chloride NESHAP. (1) After the compliance dates specified in § 63.100...

  9. Search Results | Page 26 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 251 - 260 of 292 ... Filter by type .... As the region most affected by conflict, Africa needs to acquire knowledge and expertise in the field of peace and security. Project ... Armed Conflict in Colombia : Different Resources Different Conflicts?

  10. Ginger Essential Oil Ameliorates Cisplatin-Induced Nephrotoxicity in ...

    African Journals Online (AJOL)

    HP

    Among multiple mechanisms of action, the induction of .... levels using a commercial kit (Gold Analisa®) for calculating the urinary ... ultraviolet light absorbance at 260 nm using a. Nanodrop .... ratio rose following GEO administration. These.

  11. 77 FR 46752 - Agency Information Collection Activities OMB Responses

    Science.gov (United States)

    2012-08-06

    ... Pollution Contingency Plan (NCP)(Renewal); Withdrawn from OMB on 07/19/ 2012 while existing approved... change. EPA ICR Number 2310.02; RCRA Definition of Solid Waste (Renewal); 40 CFR parts 260 and 261; was...

  12. African Journal of Biotechnology - Vol 3, No 5 (2004)

    African Journals Online (AJOL)

    Improving bambara groundnut productivity using gamma irradiation and in vitro techniques · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. HK Adu-Dapaah, RS Sangwan, 260-265 ...

  13. Search Results | Page 24 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 231 - 240 of 260 ... Economic Reform, Firm Survival and Competitiveness (Middle ... Release of BSR's "Child Labour in Myanmar's Garment Sector" Report ... However, data on entrepreneurship and the private enterprise sector in the ...

  14. Search Results | Page 6 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2009-01-01

    Results 51 - 60 of 260 ... Job quality in Jordan : an analysis based on a job quality index (JQI). Published date. January 1, 2009. Papers. WAGES EGYPT LABOUR MARKET MANUFACTURING EXPORT ORIENTED INDUSTRIES TRADE LIBERALIZATION ...

  15. Search Results | Page 26 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2009-01-01

    Results 251 - 260 of 1368 ... Job quality in Jordan : an analysis based on a job quality index (JQI). Published date. January 1, 2009. Papers. WAGES EGYPT LABOUR MARKET MANUFACTURING EXPORT ORIENTED INDUSTRIES TRADE LIBERALIZATION ...

  16. Search Results | Page 5 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2009-01-01

    Results 41 - 50 of 260 ... Towards evidence-based policy in Africa : ICT access and usage in 17 African countries. Published date. January 1, 2009. Papers. WOMEN'S ADVANCEMENT SELF-EMPLOYMENT MIDDLE EAST BUSINESS MANAGEMENT WOMEN ENTREPRENEURSHIP Gender ...

  17. Current research efforts with Bacillus thuringiensis

    Science.gov (United States)

    Normand R. Dubois

    1991-01-01

    The bioassay of 260 strains of Bacillus thuringiensis (Bt) and 70 commercial preparations show that regression coefficient estimates may be as critical as LC5O estimates when evaluating them for future consideration.

  18. Search Results | Page 26 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 251 - 260 of 369 ... Corporate Social Responsibility in the Latin American Extractive Industry ... Its impact on national businesses, particularly micro, small and medium ... Experiment in Collaborative Learning Network for Enhanced ...

  19. Magneto-plasmonics as a tool for magnetic field sensing

    Czech Academy of Sciences Publication Activity Database

    Vlček, J.; Lesňák, M.; Pištora, J.; Otipka, P.; Sobota, Jaroslav

    2013-01-01

    Roč. 58, č. 9 (2013), s. 260-264 ISSN 0447-6441 Institutional support: RVO:68081731 Keywords : plasmon resonance * magneto-optics * sensors * response factors Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

  20. Variation of Optical Quenching of Photoconductivity with Resistivity in Unintentional Doped GaN

    International Nuclear Information System (INIS)

    Qi-Feng, Hou; Xiao-Liang, Wang; Hong-Ling, Xiao; Cui-Mei, Wang; Cui-Bai, Yang; Jin-Min, Li

    2010-01-01

    The optical quenching of photoconductivity under dual illumination in GaN samples with different resistivity is investigated to reveal the variation of deep levels. The samples are grown by metal organic chemical vapour deposition without intentional doping. Quenching bands centered at 1.35eV, 1.55eV, 1.98eV, and 2.60eV are observed. It is found that the 1.98eV quenching band is dominated in all the samples and the 2.60eV band is observed only in the high-resistivity samples. The possible defect levels responsible for the quenching bands and the origin of different quenching behaviour at 2.60eV are discussed. It is suggested that the defect level responsible for quenching at 2.60eV plays an important role for the enhancement of resistivity

  1. The Federal Funding Accountability and Transparency Act: Background, Overview, and Implementation Issues

    National Research Council Canada - National Science Library

    Hatch, Garrett L

    2006-01-01

    ... -- $460 billion in grants, $360 billion in contracts, and $260 billion in direct and guaranteed loans -- accounting for nearly one-third of the federal government's total expenditures and obligations...

  2. Afterparty Baselis / Maria-Kristiina Soomre

    Index Scriptorium Estoniae

    Soomre, Maria-Kristiina, 1978-

    2001-01-01

    Moodsa ja kaasaegse kunsti messist "Art 32 Basel" 13.-18. VI. Kutsutud esinejate näitusel "Art Unlimited" osalesid Ilja Kabakov, Richard Serra, James Turrell, Pipilotti Rist, Vanessa Beecroft, Atelier van Lieshout. Väljapanekud 260 galeriilt.

  3. Search Results | Page 19 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 181 - 190 of 260 ... Atlas of Islamic-World Science and Innovation. Historically, scholars and researchers from the Muslim world were leaders in the area of medicine, astronomy and mathematics. Project.

  4. Search Results | Page 12 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2008-01-01

    Results 111 - 120 of 260 ... ... natural resources (NR) management that contribute to mitigated health risks and sustained agro-ecosystems in highland communities. Published date. January 1, 2008. Reports. COMMUNICATION POLICY COMPETITIVENESS TELECOMMUNICATIONS CONSUMER DEMAND PRICING AFRICA ...

  5. Institutional Factors Influencing Crop Farmers Adoption of ...

    African Journals Online (AJOL)

    E M IGBOKWE

    recommended agrochemical practices (RAPs) among crop farmers in Nigeria. A total of 260 ... It would neither be logical nor ethical to expect poor people to forego the benefits of ..... Credit use is expected to assist farmers purchase necessary.

  6. Savanna woody vegetation classification – now in 3-D

    CSIR Research Space (South Africa)

    Fisher, JT

    2013-05-01

    Full Text Available for Scientific and Industrial Research (CSIR)-Meraka Institute, P.O. Box 395, Pretoria, 0001, South Africa 5Department of Global Ecology, Carnegie Institution for Science, 260 Panama Street, Stanford, CA, 94305, USA *corresponding author, jolenefisher...

  7. 77 FR 26008 - Ocean Transportation Intermediary License; Applicants

    Science.gov (United States)

    2012-05-02

    .... Forth-Matthews, President, Application Type: New OFF License. Azimuth Lines Inc. (OFF), 111 Ivy Lane.... (NVO), 1000 Lakes Drive, 260, West Covina, CA 91760, Officers: Larry Lee, Treasurer (Qualifying...

  8. Search Results | Page 8 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 71 - 80 of 260 ... Journal articles ... Charging for computer networks at higher educational institutions in developing countries ... support this important resource, as a viable tool for teaching and research, is undermined by lack of funding.

  9. Studies on supramolecular gel formation using DOSY NMR

    Czech Academy of Sciences Publication Activity Database

    Nonappa, N.; Šaman, David; Kolehmainen, E.

    2015-01-01

    Roč. 53, č. 4 (2015), s. 256-260 ISSN 0749-1581 Institutional support: RVO:61388963 Keywords : DOSY * VT NMR * gel * diffusion coefficients Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.226, year: 2015

  10. Transformations of Aortic Arches During Metamorphosis of the Spade-Foot Toad, Pelobates fuscus

    Czech Academy of Sciences Publication Activity Database

    Majorová, H.; Roček, Zbyněk

    2004-01-01

    Roč. 260, č. 3 (2004), s. 309 ISSN 0362-2525. [International Congress of Vertebrate Morphology /7./. 27.07.2004-01.08.2004, Boca Raton] Keywords : Anura * Circulatory System * Metamorphosis Subject RIV: EA - Cell Biology

  11. Proposal of new Oβ oxidation criterion for new types of the Zr1Nb alloy of fuel claddings

    Czech Academy of Sciences Publication Activity Database

    Negyesi, M.; Klouček, V.; Lorinčík, Jan; Novotný, L.; Kabátová, J.; Linhart, S.; Adámek, J.; Siegl, J.; Vrtílková, V.

    2013-01-01

    Roč. 261, August (2013), s. 260-268 ISSN 0029-5493 Institutional support: RVO:67985882 Keywords : Oxygen * Experimental methods * Kinetics equation Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.972, year: 2013

  12. Search Results | Page 22 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 211 - 220 of 260 ... Strengthening CRTD-A's Organizational and Program Capacity (Lebanon) ... with a solid history of collaboration with IDRC at the project level. ... a major component of social structure throughout the Middle East, ...

  13. Právnický elektronický slovník (PES)

    Czech Academy of Sciences Publication Activity Database

    Cvrček, František

    2015-01-01

    Roč. 154, č. 3 (2015), s. 247-260 ISSN 0231-6625 Institutional support: RVO:68378122 Keywords : legal language * legal dictionaries * linguistic analysis of legal texts Subject RIV: AG - Legal Sciences

  14. Search Results | Page 26 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 251 - 260 of 875 ... ... "Planning and Managing Sustainable Cities: From Research to Practice," focused ... has contributed to the development of regional knowledge and ... of and recommendations for the functioning of the DIRSI Network.

  15. 1. Owolabi.pmd

    African Journals Online (AJOL)

    sulaiman.adebowale

    2007-09-10

    Sep 10, 2007 ... that the oil industry is confronted with a crisis arising from the actions and in- ..... The World Bank report on Nigeria (cited .... national average of $260, and unemployment in Port Harcourt is more than ..... ia's Niger Delta.

  16. 76 FR 37788 - Takes of Marine Mammals Incidental to Specified Activities; Taking Marine Mammals Incidental to...

    Science.gov (United States)

    2011-06-28

    ... (HMB), North Monterey Bay (NMB; containing Santa Cruz/Soquel sites), South Monterey Bay (SMB... year number of events per year California sea lions Harbor seals HMB July 4 100 (400) 65 (260) NMB...

  17. 2003 Reson 8101ER Multibeam Sonar Data from Cruise OES-03-07/AHI-03-07, Data Set Name Rota.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Reson 8101ER multibeam Data were collected between 16-17 September 2003 (JD 259-260) aboard NOAA Survey Launch Acoustic Habitat Investigator (AHI) at Rota Island in...

  18. 20 CFR 641.535 - What services must grantees/subgrantees provide to participants?

    Science.gov (United States)

    2010-04-01

    ... been performed and an IEP developed under title I of WIA, the WIA IEP will satisfy the requirement for an SCSEP assessment and IEP (see § 641.260) and updating the IEPs as necessary to reflect information...

  19. Search Results | Page 2 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 11 - 20 of 260 ... Health information systems or adolescent sexual and ... Real momentum is building around the Sustainable Development Goals (SDGs) as ... an opportunity to promote debate on key economic and development issues.

  20. Fauna Europaea - all European animal species on the web

    DEFF Research Database (Denmark)

    de Jong, Yde; Verbeek, Melina; Michelsen, Verner

    2014-01-01

    Abstract Fauna Europaea is Europe's main zoological taxonomic index, making the scientific names and distributions of all living, currently known, multicellular, European land and freshwater animals species integrally available in one authoritative database. Fauna Europaea covers about 260...

  1. Temperature measurements from a moored thermistor chain in Mamala Bay, Oahu, Hawaii during 1997-1998 (NODC Accession 0000625)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A moored thermistor chain was deployed about a mile south of Honolulu Harbor in waters of about 260 feet depth. The instrument was in operation from August 1997 -...

  2. 77 FR 50138 - Submission for OMB Review; Comment Request: Collection of Customer Service, Demographic, and...

    Science.gov (United States)

    2012-08-20

    ...). Characterizing clients and how they found out about the CIS is essential to customer service, program planning...,123 Demographic 24,300 1 2/60 810 Questions. Smoking Cessation ``Quitline'' Clients: Reactive Service...

  3. 77 FR 31028 - Proposed Collection; Comment Request; Collection of Customer Service, Demographic, and Smoking...

    Science.gov (United States)

    2012-05-24

    ...). Characterizing clients and how they found out about the CIS is essential to customer service, program planning... 1/60 1,123 Demographic 24,300 1 2/60 810 Questions. Smoking Cessation ``Quitline'' Clients Reactive...

  4. Search Results | Page 21 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 201 - 210 of 260 ... ... in the South for a mechanism for exchanging research data and local experien ... Services : a Comparative Analysis of Tripoli (Lebanon) and Irbid (Jordan) ... Fair Access to and Benefit Sharing of Genetic Resources ...

  5. Potential Navy Force Structure and Shipbuilding Plans: Background and Issues for Congress

    National Research Council Canada - National Science Library

    O'Rourke, Ronald

    2005-01-01

    In February 2005, the Navy testified that the Navy in future years may require a total of 260 to 325 ships, or possibly 243 to 302 ships, depending on how much the Navy uses new technologies and a new...

  6. 75 FR 78617 - Final Flood Elevation Determinations

    Science.gov (United States)

    2010-12-16

    .... Rockport Creek Approximately 2,300 feet +260 Unincorporated Areas of downstream of Martin Hot Spring County. Luther King Boulevard. Approximately 1,300 feet +263 downstream of Martin Luther King Boulevard. Town...

  7. Search Results | Page 26 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 251 - 260 of 8491 ... ... to foster effective women's leadership for inclusive policymaking. “Women supporting Women” is an applied research project led by Fundación Democracia y ... Addressing the Barriers to Young Women's Economic ...

  8. Search Results | Page 16 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 151 - 160 of 260 ... Women's economic empowerment can improve if globalization and ... Areas Network Phase III: Devolution to the American University of Beirut ... in advancing civic participation and collective action in the Arab region.

  9. Review: Katja Werthmann, Bitteres Gold: Bergbau, Land und Geld in Westafrika (2009 Buchbesprechung: Katja Werthmann, Bitteres Gold: Bergbau, Land und Geld in Westafrika (2009

    Directory of Open Access Journals (Sweden)

    Jana Hönke

    2011-01-01

    Full Text Available Review of the monograph: Katja Werthmann, Bitteres Gold: Bergbau, Land und Geld in Westafrika, Köln: Rüdiger Köppe Verlag, 2009, ISBN 978-3-89645-821-6, 260 pp.Besprechung der Monographie: Katja Werthmann, Bitteres Gold: Bergbau, Land und Geld in Westafrika, Köln: Rüdiger Köppe Verlag, 2009, ISBN 978-3-89645-821-6, 260 Seiten.

  10. Synergic effect of n-3 polyunsaturated fatty acids and rosiglitazone in the amelioration of insulin resistance and adipose tissue inflammatinon

    Czech Academy of Sciences Publication Activity Database

    Kuda, Ondřej; Jílková, Zuzana; Rossmeisl, Martin; Flachs, Pavel; Ogston, N. C.; Mohamed-Ali, V.; Cinti, S.; Kopecký, Jan

    2007-01-01

    Roč. 50, Suppl.1 (2007), S260-S260 ISSN 0012-186X. [Annual Meeting of the European Association for the Study of Diabetes /43./. 18.09.2007-21.09.2007, Amsterdam] R&D Projects: GA ČR(CZ) GD303/03/H065 Institutional research plan: CEZ:AV0Z50110509 Keywords : cpo1 * insulin * rosiglitazone * PUFA Subject RIV: FB - Endocrinology, Diabetology, Metabolism, Nutrition

  11. A Method to Achieve High Fidelity in Internet-Distributed Hardware-in-the-Loop Simulation

    Science.gov (United States)

    2012-08-01

    Terrain Vehicle (M-ATV) Weight 14,403 kg Payload 1814 kg Frontal Area 5.72 m 2 Engine 6.4L V8 turbo - diesel : 260 kW Generator Permanent Magnet: 265 kW...6.4L V8 diesel engine with 260 kW rated power at 3000 rpm and a rated torque of 880 Nm at 2000 rpm. It is intended for a variety of medium-duty truck

  12. A PCR method targeting internal transcribed spacers: the simultaneous detection of Babesia bigemina and Babesia bovis in cattle.

    Science.gov (United States)

    Liu, Junlong; Guan, Guiquan; Liu, Aihong; Li, Youquan; Yin, Hong; Luo, Jianxun

    2014-03-01

    In this study, two pairs of oligonucleotide primers were designed according to the nucleotide sequence of the internal transcribed spacers (ITSs) of Babesia bigemina and B. bovis isolates from China. The primers were used in a multiplex PCR to detect parasite DNA in blood samples from cattle. There was no cross reactions with B. ovata, B. major, B. sp. Kashi, Theileria annulata, T. sergenti, T. sinensis or normal bovine DNA. The sensitivity of multiplex PCR assay was 1 pg and 10 pg DNA for B. bigemina and B. bovis, respectively. A total of 260 field blood samples collected from cattle in five provinces of China were analyzed by multiplex PCR and light microscopy. PCR testing revealed that 7.3% (19/260) and 5.8% (15/260) of cattle were positive for B. bigemina and B. bovis and 1.2% (3/260) of cattle were co-infected with B. bigemina and B. bovis. Using light microscopy, 2.3% (6/260) and 1.5% (4/260) of cattle were infected by B. bigemina and B. bovis, respectively, and no co-infection was found. The results showed that the multiplex PCR developed in the present study could be an alternative diagnostic tool for the detection of B. bovis and B. bigemina infection in cattle.

  13. Developments for transactinide chemistry experiments behind the gas-filled separator TASCA

    Energy Technology Data Exchange (ETDEWEB)

    Even, Julia

    2011-12-13

    synthesised carbonyl complexes were identified by nuclear decay spectroscopy. Some complexes were studied with isothermal chromatography or thermochromatography methods. The chromatograms were compared with Monte Carlo Simulations to determine the adsorption enthalpyrnon silicon dioxide and on gold. These simulations based on existing codes, that were modified for the different geometries of the chromatography channels. All observed adsorption enthalpies (on silcon oxide as well as on gold) are typical for physisorption. Additionally, the thermalstability of some of the carbonyl complexes was studied. This showed that at temperatures above 200 C therncomplexes start to decompose. It was demonstrated that carbonyl-complex chemistry is a suitable method to study rutherfordium, dubnium, seaborgium, bohrium, hassium, and meitnerium. Until now, only very simple, thermally stable compounds have been synthesized in the gas-phase chemistry of the transactindes. With the synthesis of transactinide-carbonyl complexes a new compound class would be discovered. Transactinide chemistry would reach the border between inorganic and metallorganic chemistry. Furthermore, the in-situ synthesised carbonyl complexes would allow nuclear spectroscopy studies under low background conditions making use of chemically prepared samples. [German] Die vorliegende Arbeit befasst sich mit der Entwicklung von Experimenten hinter dem gasgefuellten Separator TASCA (TransActinide Separator and Chemistry Apparatus) zur Studie des chemischen Verhaltens der Transactinide. Zum einen wurde die Moeglichkeit der elektrochemischen Abscheidung kurzlebiger Isotope der Elemente Ruthenium und Osmium auf Goldelektroden im Hinblick auf ein Experiment mit Hassium untersucht. Aus der Literatur ist bekannt, dass bei der elektrochemischen Abscheidung einzelner Atome das Abscheidepotential signifikant vom Nernst-Potential abweicht. Die Verschiebung des Potentials haengt von der Adsorptionsenthalpie des abzuscheidenden Elements

  14. Differential survival among sSOD-1* genotypes in Chinook Salmon

    Science.gov (United States)

    Hayes, Michael C.; Reisenbichler, Reginald R.; Rubin, Stephen P.; Wetzel, Lisa A.; Marshall , Anne R.

    2011-01-01

    Differential survival and growth were tested in Chinook salmon Oncorhynchus tshawytscha expressing two common alleles, *–100 and *–260, at the superoxide dismutase locus (sSOD-1*). These tests were necessary to support separate studies in which the two alleles were used as genetic marks under the assumption of mark neutrality. Heterozygous adults were used to produce progeny with –100/–100, –100/–260, and –260/–260 genotypes that were reared in two natural streams and two hatcheries in the states of Washington and Oregon. The latter also were evaluated as returning adults. In general, the genotype ratios of juveniles reared at hatcheries were consistent with high survival and little or no differential survival in the hatchery. Adult returns at one hatchery were significantly different from the expected proportions, and the survival of the –260/–260 genotype was 0.56–0.89 times that of the –100/–100 genotype over four year-classes. Adult returns at a second hatchery (one year-class) were similar but not statistically significant: survival of the –260/–260genotype relative to the –100/–100 genotype was 0.76. The performance of the heterozygote group was intermediate at both hatcheries. Significant differences in growth were rarely observed among hatchery fish (one year-class of juveniles and one age-class of adult males) but were consistent with greater performance for the –100/–100 genotype. Results from two groups of juveniles reared in streams (one year-class from each stream) suggested few differences in growth, but the observed genotype ratios were significantly different from the expected ratios in one stream. Those differences were consistent with the adult data; survival for the –260/–260 genotype was 76% of that of the –100/–100 genotype. These results, which indicate nonneutrality among sSOD-1* genotypes, caused us to modify our related studies and suggest caution in the interpretation of results and analyses in

  15. Evidence for bimodal fission in the heaviest elements

    International Nuclear Information System (INIS)

    Hulet, E.K.; Wild, J.F.; Lougheed, R.W.

    1987-08-01

    We have measured the mass and kinetic-energy partitioning in the spontaneous fission of five heavy nuclides: 258 Fm, 259 Md, 260 Md 258 No, and 260 [104]. Each was produced by heavy-ion reactions with either 248 Cm, 249 Bk, or 254 Es targets. Energies of correlated fragments from the isotopes with millisecond half lives, 258 No and 260 [104], were measured on-line by a special rotating-wheel instrument, while the others were determined off-line after mass separation. All fissioned with mass distributions that were symmetric. Total-kinetic-energy distributions peaked near either 200 or 235 MeV. Surprisingly, because only a single Gaussian energy distribution had been observed previously in actinide fission, these energy distributions were skewed upward or downward from the peak in each case, except for 260 [104], indicating a composite of two energy distributions. We were able to fit accurately two Gaussian curves to the gross energy distributions from the four remaining nuclides. From the multiple TKE distributions and the shapes of the mass distributions, we conclude that there is a low-energy fission component with liquid-drop characteristics which is admixed with a much higher-energy component due to closed fragment shells. We now have further evidence for this conclusion from measurements of the neutron multiplicity in the spontaneous fission of 260 Md. 25 refs., 9 figs

  16. Prevalence of C. botulinum and C. perfringens spores in food products available on Polish market

    Directory of Open Access Journals (Sweden)

    Grenda Tomasz

    2017-09-01

    Full Text Available Introduction: The aim of this study was to evaluate the prevalence of Clostridium botulinum and Clostridium perfringens in food samples purchased from Polish producers. Material and Methods: The analyses were performed on 260 food samples collected in Lublin and Subcarpathian regions: 56 of smoked meat, 21 of pork meat, 20 of dairy products, 26 of vegetable and fruit preserves, 40 of ready-to-eat meals, 27 of fish preserves, and 70 of honey collected directly from apiaries. Results: C. botulinum strains were isolated from 2.3% (6/260 of samples and the isolates were classified as toxin types A (4/260 and B (2/260. C. perfringens strains were isolated from 14% (37/260 of samples. All the isolates were classified as toxin type A, 28 of them were able also to produce α toxin and 9 - β2 toxin. Conclusion: On the basis of the obtained results it could be suggested that risk assessment, especially regarding the entire honey harvesting process, should be provided in order to ensure the microbiological safety of the products to be consumed by infants and people with a weakened immune system.

  17. Evaluation of novel micronized encapsulated essential oil-containing phosphate and lactate blends for growth inhibition of Listeria monocytogenes and Salmonella on poultry bologna, pork ham, and roast beef ready-to-eat deli loaves.

    Science.gov (United States)

    Casco, G; Taylor, T M; Alvarado, C

    2015-04-01

    Essential oils and their constituents are reported to possess potent antimicrobial activity, but their use in food processing is limited because of low solubility in aqueous systems and volatilization during processing. Two proprietary noncommercial essential oil-containing phosphate blends were evaluated for antimicrobial activity against Salmonella enterica cocktail (SC)-and Listeria monocytogenes (Lm)-inoculated deli meat products made from pork, poultry, or beef. Four treatments were tested on restructured cured pork ham, emulsified chicken bologna, and restructured beef loaf: nonencapsulated essential oil with phosphate version 1 at 0.45% of final batch (EOV145; chicken and pork, or EEOV245 beef), micronized encapsulated essential oil with phosphate version 2 at 0.60% of final batch (EEOV260), a 2.0% potassium lactate (PL) control, and a negative control (CN) with no applied antimicrobial agent. Compared with the CN, none of the antimicrobial agents (EEOV260, EOV145, PL) successfully limited Lm or SC growth to deli loaves, the EEOV260 inhibited growth of SC at days 21 and 28 to the same level of efficacy as PL (0.5 log cycle). In roast beef samples, on day 35, the SC growth was inhibited ca. 0.5 log CFU/g by EEOV260 when compared with the CN. In conclusion the EEOV260 can function to replace PL to limit Salmonella and Lm growth in ready-to-eat deli products. Further testing is needed to ensure consumer acceptability.

  18. Ft. Lewis/Gray, Washington. Revised Uniform Summary of Surface Weather Observations. Parts A-F.

    Science.gov (United States)

    1987-07-27

    75.9 75.9 76.1 76.2 GE 30001 5.3 66.8 70.6 73.0 75.6 7.7 76.4 76.9 77.0 78.0 78.0 78.0 78.4 78.4 7R.7 78.8 IE 27001 5.3 69.3 73.1 75.7 78.2 78.3 79.1...25.1 25.2 25.2 25.6 25.6 25.7 26.0 26.0 26.0 26.0 26.0 2b.2 6.E ISO DO 16.8 25.9 26.S 26.9 27.0 27.2 27.3 27.7 27.7 27.9 26.1 28.1 28.1 28.1 ip.1 28.1...3.259 3.596 5.103 6.164 8.878 9.563 T.O7 ITO! 0BSf 309 282 310 299 310 300 310 310 300 309 300 298 3632 22 ISO 1 9.724 9.333 8.111 6.610 5.262 9.228

  19. Using LEDs to stimulate the recovery of radiation damage to plastic scintillators

    Energy Technology Data Exchange (ETDEWEB)

    Wetzel, J., E-mail: james-wetzel@uiowa.edu [The University of Iowa, Iowa City, IA (United States); Tiras, E. [The University of Iowa, Iowa City, IA (United States); Bilki, B. [The University of Iowa, Iowa City, IA (United States); Beykent University, Istanbul (Turkey); Onel, Y. [The University of Iowa, Iowa City, IA (United States); Winn, D. [Fairfield University, Fairfield, CT (United States)

    2017-03-15

    In this study, we consider using LEDs to stimulate the recovery of scintillators damaged from radiation in high radiation environments. We irradiated scintillating tiles of polyethylene naphthalate (PEN), Eljen brand EJ-260 (EJN), an overdoped EJ-260 (EJ2P), and a lab-produced elastomer scintillator (ES) composed of p-terphenyl (ptp) in epoxy. Two different high-dose irradiations took place, with PEN dosed to 100 kGy, and the others to 78 kGy. We found that the ‘blue’ scintillators (PEN and ES) recovered faster and maximally higher with LEDs than without. Conversely exposing the ‘green’ scintillators (EJ-260) to LED light had a nearly negligible effect on the recovery. We hypothesize that the ‘green’ scintillators require wavelengths that match their absorption and emission spectra for LED stimulated recovery.

  20. Evaluating UV-C LED disinfection performance and ...

    Science.gov (United States)

    This study evaluated ultraviolet (UV) light emitting diodes (LEDs) emitting at 260 nm, 280 nm, and the combination of 260|280 nm together for their efficacy at inactivating Escherichia. coli, MS2 coliphage, human adenovirus type 2 (HAdV2), and Bacillus pumilus spores; research included an evaluation of genomic damage. Inactivation by the LEDs was compared with the efficacy of conventional UV sources, the low-pressure (LP) and medium-pressure (MP) mercury vapor lamps. The work also calculated the electrical energy per order of reduction of the microorganisms by the five UV sources.For E. coli, all five UV sources yielded similar inactivation rates. For MS2 coliphage, the 260 nm LED was most effective. For HAdV2 and B. pumilus, the MP UV lamp was significantly more effective than the LP UV and UVC LED sources. When considering electrical energy per order of reduction, the LP UV lamp was the most efficient for E. coli and MS2, and the MPUV and LPUV were equally efficient for HAdV2 and B. pumilus spores. Among the UVC LEDs, the 280 nm LED unit required the least energy per log reduction of E. coli and HAdV2. The 280 nm and 260|280 nm LED units were equally efficient per log reduction of B. pumilus spores, and the 260 nm LED unit required the lowest energy per order of reduction of MS2 coliphage. The combination of the 260 nm and 280 nm UV LED wavelengths was also evaluated for potential synergistic effects. No dual-wavelength synergy was detected for inactivation of

  1. New aspects of magnetocaloric effect in NiMn{sub 0.89}Cr{sub 0.11}Ge

    Energy Technology Data Exchange (ETDEWEB)

    Jaworska-Gołąb, T., E-mail: teresa.jaworska-golab@uj.edu.pl [Institute of Physics, Jagiellonian University, Łojasiewicza 11, 30-348 Kraków (Poland); Baran, S. [Institute of Physics, Jagiellonian University, Łojasiewicza 11, 30-348 Kraków (Poland); Duraj, R. [Institute of Physics, Cracow University of Technology, Podchorążych 1, 30-084 Kraków (Poland); Marzec, M. [Institute of Physics, Jagiellonian University, Łojasiewicza 11, 30-348 Kraków (Poland); Dyakonov, V. [Institute of Physics, Polish Academy of Sciences, al. Lotników 32/46, 02-668 Warszawa (Poland); A.A. Galkin Donetsk Physico-Technical Institute, 83-114 Donetsk (Ukraine); Sivachenko, A. [A.A. Galkin Donetsk Physico-Technical Institute, 83-114 Donetsk (Ukraine); Tyvanchuk, Yu. [Chemistry Department, Ivan Franko National University of Lviv, 79-005 Lviv (Ukraine); Szymczak, H. [Institute of Physics, Polish Academy of Sciences, al. Lotników 32/46, 02-668 Warszawa (Poland); Szytuła, A. [Institute of Physics, Jagiellonian University, Łojasiewicza 11, 30-348 Kraków (Poland)

    2015-07-01

    Investigations of structural and magnetic phase transitions in the NiMn{sub 0.89}Cr{sub 0.11}Ge half-Heusler alloy were carried out by DSC, XRD (80–400 K), magnetic susceptibility and magnetization (1.9–400 K, magnetic field up to 9.0 T, pressure up to 5.25 kbar) measurements. At high temperatures the sample is a single phase crystallizing in the hexagonal crystal structure (Ni{sub 2}In-type, space group P6{sub 3}/mmc) while below 260 K, down to 100 K, some amount of the hexagonal phase coexists with the orthorhombic (TiNiSi-type, space group Pnma) one. Strong magnetostructural coupling is observed. Magnetic data indicate that with increasing temperature magnetic properties of the sample change from antiferro- to ferro- and then to paramagnetic ones. The latter magnetic phase transition is associated with the crystal structure change and results in large magnetic entropy change equal to −51 J/kg K at μ{sub 0}H= 9.0 T near 260 K. Application of external pressure shifts T{sub C} towards lower temperatures. - Highlights: • # Pnma below 210 K, # P6{sub 3}/mmc above 260 K, for 210 K 260 K both phases coexist. • Magnetic transitions from antiferro- to ferro- and to paramagnetic phase detected. • Significant magnetocaloric effect observed about 260 K at ambient pressure. • Magnetostructural effect observed at 260 K (ΔV/V= 2.4%) at ambient pressure. • Magnetic measurements under hydrostatic pressure up to 5.25 kbar; (p, T) diagram.

  2. Developments for transactinide chemistry experiments behind the gas-filled separator TASCA

    International Nuclear Information System (INIS)

    Even, Julia

    2011-01-01

    synthesised carbonyl complexes were identified by nuclear decay spectroscopy. Some complexes were studied with isothermal chromatography or thermochromatography methods. The chromatograms were compared with Monte Carlo Simulations to determine the adsorption enthalpyrnon silicon dioxide and on gold. These simulations based on existing codes, that were modified for the different geometries of the chromatography channels. All observed adsorption enthalpies (on silcon oxide as well as on gold) are typical for physisorption. Additionally, the thermalstability of some of the carbonyl complexes was studied. This showed that at temperatures above 200 C therncomplexes start to decompose. It was demonstrated that carbonyl-complex chemistry is a suitable method to study rutherfordium, dubnium, seaborgium, bohrium, hassium, and meitnerium. Until now, only very simple, thermally stable compounds have been synthesized in the gas-phase chemistry of the transactindes. With the synthesis of transactinide-carbonyl complexes a new compound class would be discovered. Transactinide chemistry would reach the border between inorganic and metallorganic chemistry. Furthermore, the in-situ synthesised carbonyl complexes would allow nuclear spectroscopy studies under low background conditions making use of chemically prepared samples. [de

  3. Activation of boron and phosphorus atoms implanted in polycrystalline silicon films at low temperatures

    International Nuclear Information System (INIS)

    Andoh, Nobuyuki; Sameshima, Toshiyuki; Andoh, Yasunori

    2005-01-01

    Phosphorus atoms implanted in laser crystallized polycrystalline silicon films were activated by a heat treatment in air at 260 deg. C for 1, 3 and 24 h. Analysis of ultraviolet reflectivity of phosphorus-doped silicon films implanted by ion doping method at 4 keV revealed that the thickness of the top disordered layer formed by ion bombardment was 6 nm. It is reduced to 4 nm by a 3 h heat treatment at 260 deg. C by recrystallization of disordered region. The electrical conductance of silicon films implanted increased to 1.7x10 5 S/sq after 3 h heat treatment

  4. Inmunodeficiencias primarias celulares en la infancia: nuevas aportaciones a su diversidad, patogenia, diagnóstico y tratamiento

    OpenAIRE

    Estévez Cordero, Orlando Allende

    2014-01-01

    La Neutropenia Congénita Severa tipo 4 (SCN4 por sus siglas en ingles) está asociada a mutaciones en el gen que codifica la tercera sub-unidad catalítica de la glucose-6-fosfatasa (G6PC3). En la actualidad, todos los pacientes descritos portadores de la variante p.Gly260Arg en el gen G6PC3 muestran defectos cardíacos. En este trabajo presentamos el caso de una variante p.Gly260Arg en un paciente sin alteraciones funcionales ni estructurales en corazón. Por su parte, Interleuquina-21 (IL-21...

  5. Development of a One-Handed, Environmental Surface-Sampling Device

    Science.gov (United States)

    2016-05-01

    individual packaging, an operator can generate a large amount of waste that needs to be managed during a sampling mission. The U.S. Army Edgewood...prepared and spore spotting was performed in a biological safety cabinet. For the spore- spotting procedures, the surfaces were spotted with 1 mL of...260 nm (A260) and 280 nm (A280). To determine the DNA concentration for each sample, the NanoDrop software used a modified Beer –Lambert equation and

  6. Industrial-Scale Processes For Stabilizing Radioactively Contaminated Mercury Wastes

    International Nuclear Information System (INIS)

    Broderick, T. E.; Grondin, R.

    2003-01-01

    This paper describes two industrial-scaled processes now being used to treat two problematic mercury waste categories: elemental mercury contaminated with radionuclides and radioactive solid wastes containing greater than 260-ppm mercury. The stabilization processes were developed by ADA Technologies, Inc., an environmental control and process development company in Littleton, Colorado. Perma-Fix Environmental Services has licensed the liquid elemental mercury stabilization process to treat radioactive mercury from Los Alamos National Laboratory and other DOE sites. ADA and Perma-Fix also cooperated to apply the >260-ppm mercury treatment technology to a storm sewer sediment waste collected from the Y-12 complex in Oak Ridge, TN

  7. Occupational Survey Report. Food Service Career Ladder AFSC 622X0

    Science.gov (United States)

    1980-09-01

    FRY MEATS, SEAFOODS, OR POULTRY 47 G212 COOK CEREALS SUCH AS OATMEAL OR CORNMEAL 47 G209 BRAISE MEATS, SEAFOODS, OR POULTRY 47 G253 PREPARE MEATS...OATMEAL OR CORNMEAL 62 G210 BREW COFFEE OR TEA 62 G259 PREPARE SANDWICHES 61 G245 PREPARE GARNISHES 61 G260 PREPARE SOUPS 61 1341 CLEAN WORK TABLES 61 H288...EGGS FOR COOKING 80 G260 PREPARE SOUPS 80 G257 PREPARE RICE OR PASTA 80 G212 COOK CEREALS, SUCH AS OATMEAL OR CORNMEAL 77 H288 PREPARE GRIDDLES FOR USE

  8. Yeast cells lacking all known ceramide synthases continue to make complex sphingolipids and to incorporate ceramides into glycosylphosphatidylinositol (GPI) anchors

    DEFF Research Database (Denmark)

    Vionnet, Christine; Roubaty, Carole; Ejsing, Christer S.

    2010-01-01

    In yeast, the inositolphosphorylceramides mostly contain C26:0 fatty acids. Inositolphosphorylceramides were considered to be important for viability, since the inositolphosphorylceramide synthase AUR1 is essential. Yet, lcb1 cells, unable to make sphingoid bases and inositolphosphorylceramides......, are viable if they harbor SLC1-1, a gain of function mutation in the 1-acyl-glycerol-3-phosphate acyltransferase SLC1. SLC1-1 allows to incorporate C26:0 fatty acids into phosphatidylinositol (PI), thus generating PIii, an abnormal, C26-containing PI, presumably acting as surrogate...

  9. ASTP crewmen in Apollo Command Module Trainer during training session at JSC

    Science.gov (United States)

    1975-01-01

    The three members of the American ASTP prime crew are photographed inside the Apollo Command Module (CM) trainer in a water tank in bldg 260 during water egress training at JSC. They are, left to right, Astronauts Thomas P. Stafford, commander; Vance D. Brand, command module pilot; and Donald K. Slayton, docking module pilot (23430); Slayton attaches his life preserver as he egresses an Apollo Command Module trainer in a water tank in bldg 260 during water egresss training at JSC. Astronauts Brand (on left) and Stafford have already egressed the trainer and are seated in a three-man life raft.

  10. 75 FR 44144 - Washington: Final Authorization of State Hazardous Waste Management Program Revisions

    Science.gov (United States)

    2010-07-28

    ...)(c)(ix)(K), 400(3)(c)(ix)(L), 400(3)(c)(x), 400(3)(c)(xi)(A), 400(3)(c)(xii)(B), 400(3)(a)(xiii), 400.... definition--Upda ted to match Federal rule. 040 Staging Pile 260.10. definition--Upda ted to match Federal... test methods to latest revision date. 110(3)(g)(x) Duplicate deleted 260.11(15). [see 110(3)(g)(vii...

  11. Effect of chronic administration of Tamoxifen on fertility in male bonnet monkeys (Macaca radiata).

    Science.gov (United States)

    Rao, A J; Ramachandra, S G; Ramesh, V; Krishnamurthy, H N; Jayaraman, S; Gopalakrishnan, K; Juneja, H S

    1998-01-01

    Administration of Tamoxifen via the Alzet pump at a rate of 50 micrograms hr-1 for 90 days in the adult male bonnet monkeys Macaca radiata had no effect on the serum testosterone concentration determined at 10 AM and 10 PM as well as total sperm count determined at 15-day intervals over a period of 260 days. However, a significant reduction in sperm motility was observed beyond 90 days up until the 225th day. Breeding studies conducted from day 90 to 260 revealed that these males were infertile.

  12. What Constitutes 'Failure to Notify' National Measures?

    DEFF Research Database (Denmark)

    Gáspár-Szilágyi, Szilárd

    2013-01-01

    “The inclusion of article 260(3) TFEU adopted as part of the Lisbon Treaty changed the landscape of infringement proceedings. The provision grants the Commission the power to propose monetary sanctions already during the initial Court litigation against a Member State that ‘failed to notify......’ national measures transposing a directive. This article analyses the concept of ‘failure to notify’ and points out that the current interpretation adopted by the Commission is only one of several possible interpretations. The author concludes that article 260(3) TFEU as it stands now is vaguely drafted...

  13. Identification of new susceptibility loci for type 2 diabetes and shared etiological pathways with coronary heart disease

    DEFF Research Database (Denmark)

    Zhao, Wei; Rasheed, Asif; Tikkanen, Emmi

    2017-01-01

    To evaluate the shared genetic etiology of type 2 diabetes (T2D) and coronary heart disease (CHD), we conducted a genome-wide, multi-ancestry study of genetic variation for both diseases in up to 265,678 subjects for T2D and 260,365 subjects for CHD. We identify 16 previously unreported loci for ...

  14. El tiempo y la sabiduría en Poxoyëm. Un calendario sagrado entre los Ayook de Oaxaca

    NARCIS (Netherlands)

    Rojas Martínez Gracida, Araceli

    2012-01-01

    The specific time-count made up of the combination of 20 signs and 13 numbers (260 days), was one of the essential traits of ancient Mesoamerican civilisations. Interestingly, this calendar system persists in some contemporary communities of Southern Mexico and Guatemala, where “daykeepers”,

  15. Tropism ablation and stealthing of oncolytic adenovirus enhances systemic delivery to tumors and improves virotherapy of cancer

    Czech Academy of Sciences Publication Activity Database

    Green, N. K.; Hale, A.; Cawood, R.; Illingworth, S.; Herbert, C.; Hermiston, T.; Šubr, Vladimír; Ulbrich, Karel; van Rooijen, N.; Seymour, L. W.; Fisher, K. D.

    2012-01-01

    Roč. 7, č. 11 (2012), s. 1683-1695 ISSN 1743-5889 R&D Projects: GA AV ČR IAAX00500803 Institutional research plan: CEZ:AV0Z40500505 Institutional support: RVO:61389013 Keywords : clodronate liposomes * polymer-coated adenovirus * predosing strategy Subject RIV: CD - Macromolecular Chemistry Impact factor: 5.260, year: 2012

  16. Study of harsh environment operation of flexible ferroelectric memory integrated with PZT and silicon fabric

    KAUST Repository

    Ghoneim, Mohamed T.; Hussain, Muhammad Mustafa

    2015-01-01

    mono-crystalline silicon (100). The experimented devices show a bending radius down to 1.25 cm corresponding to 0.16% nominal strain (high pressure of ∼260 MPa), and full functionality up to 225 °C high temperature in ambient gas composition (21% oxygen

  17. Optical properties and electronic transitions of DNA oligonucleotides as a function of composition and stacking sequence.

    Science.gov (United States)

    Schimelman, Jacob B; Dryden, Daniel M; Poudel, Lokendra; Krawiec, Katherine E; Ma, Yingfang; Podgornik, Rudolf; Parsegian, V Adrian; Denoyer, Linda K; Ching, Wai-Yim; Steinmetz, Nicole F; French, Roger H

    2015-02-14

    The role of base pair composition and stacking sequence in the optical properties and electronic transitions of DNA is of fundamental interest. We present and compare the optical properties of DNA oligonucleotides (AT)10, (AT)5(GC)5, and (AT-GC)5 using both ab initio methods and UV-vis molar absorbance measurements. Our data indicate a strong dependence of both the position and intensity of UV absorbance features on oligonucleotide composition and stacking sequence. The partial densities of states for each oligonucleotide indicate that the valence band edge arises from a feature associated with the PO4(3-) complex anion, and the conduction band edge arises from anti-bonding states in DNA base pairs. The results show a strong correspondence between the ab initio and experimentally determined optical properties. These results highlight the benefit of full spectral analysis of DNA, as opposed to reductive methods that consider only the 260 nm absorbance (A260) or simple purity ratios, such as A260/A230 or A260/A280, and suggest that the slope of the absorption edge onset may provide a useful metric for the degree of base pair stacking in DNA. These insights may prove useful for applications in biology, bioelectronics, and mesoscale self-assembly.

  18. Prevalent Diseases Identified in Semi-Industrial Poultry Farming in ...

    African Journals Online (AJOL)

    This study was conducted in 2003-2007 with the aim of identifying prevalent diseases in modern poultry farming in Mali. It covered 22 modern layer farms located in the suburban areas of Bamako District and of Sikasso and Segou towns. Analyses focused on a total of 536 samples, 260 sera, 254 eggs, 149 organ samples, ...

  19. Use of the industrial yeast Candida utilis for cadmium sorption

    Czech Academy of Sciences Publication Activity Database

    Kujan, Petr; Prell, Aleš; Šafář, Hynek; Sobotka, Miroslav; Řezanka, Tomáš; Holler, Pavel

    2006-01-01

    Roč. 51, č. 4 (2006), s. 257-260 ISSN 0015-5632 Institutional research plan: CEZ:AV0Z50200510 Keywords : candida utilis * cadmium * yeast Subject RIV: EE - Microbiology, Virology Impact factor: 0.963, year: 2006

  20. Staying in Tune with Music Education: Policy Awareness among Music Education Majors

    Science.gov (United States)

    Burton, Suzanne L.; Knaster, Jenna; Knieste, Maria

    2015-01-01

    A nationwide sample of undergraduate music education majors (N = 260; 69% completion rate) completed an electronic survey to determine awareness of music and general education policy and advocacy efforts. Students reported concern with the impact of policy on school music programs and their future careers. They were informed about music education…

  1. Obesity is a strong predictor of worse clinical outcomes and treatment responses in early rheumatoid arthritis: results from the SWEFOT trial

    NARCIS (Netherlands)

    Levitsky, Adrian; Brismar, Kerstin; Hafström, Ingiäld; Hambardzumyan, Karen; Lourdudoss, Cecilia; van Vollenhoven, Ronald F.; Saevarsdottir, Saedis

    2017-01-01

    The aim of this paper was to analyse the impact of obesity, in addition to known predictors, on disease outcome in early rheumatoid arthritis (RA). Body mass index (BMI) was available in 260 patients from the Swedish pharmacotherapy trial (SWEFOT). Differences in disease activity (DAS28), functional

  2. Search Results | Page 26 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 251 - 260 of 8494 ... ... of the demand for health service delivery in the Middle East and North Africa. ... As the agriculture community in Africa converges at the African Green ... Strengthening response capacity to African infectious disease outbreaks. The 2014 Ebola outbreak in West Africa claimed the lives of tens of ...

  3. Hydrography and circulation in the northwestern Bay of Bengal during the retreat of southwest monsoon

    Digital Repository Service at National Institute of Oceanography (India)

    Murty, V.S.N.; Sarma, Y.V.B.; Babu, M.T.; Rao, D.P.

    (limited to the upper 40 m) inducEd. by the local winds. Waters of higher surface salinity near the coast characterize the upwelling. The freshwater influx near the head of the Bay diluted the surface salinity to as low as 26.0 x 10/3. The surface...

  4. Coastal currents and temperatures along the eastern region of ...

    African Journals Online (AJOL)

    Net monthly displacement in the midwater layer (10 m) ranged between 60 km and 260 km, with eastward advection in seven of the eight months under study. Net monthly displacement in the bottom layer (19 m) was eastwards for all study months, and ranged from 8 km to 296 km. These results imply a strong likelihood that ...

  5. 78 FR 69855 - Agency Forms Undergoing Paperwork Reduction Act Review

    Science.gov (United States)

    2013-11-21

    ... groups, online focus groups, computer-assisted, in-person, or telephone interviews, and online surveys... revision will adjust for screening and recruitment by allocating 20,000 additional respondents, and 667... Public and Special Populations Screening and 20,000 1 2/60 Recruitment. In-depth Interviews (In 67 1 1...

  6. Percutaneous transhepatic self-expanding metal stents for palliation ...

    African Journals Online (AJOL)

    placement within 2 - 23 days of biliary drainage as a two-stage procedure because of .... TJF-260; Olympus, Tokyo, Japan) with a 4.2 mm working channel using a .... increased owing to fewer long-term complications than occur with smaller ...

  7. The Practice of Information Processing Model in the Teaching of Cognitive Strategies

    Science.gov (United States)

    Ozel, Ali

    2009-01-01

    In this research, the differentiation condition of teaching the learning strategies depending on the time which the first grade of primary school teachers carried out to form an information-process skeleton on student is tried to be found out. This process including the efforts of 260 teachers in this direction consists of whether the adequate…

  8. Depressionary Effect of Proximity of Residential Properties to Waste ...

    African Journals Online (AJOL)

    Past studies have researched these impacts using a variety of hedonic models and Marginal Implicit Pricing, however, this study takes a special focus on the resident's perspective based on the linear proximity to waste disposal sites. 260 questionnaires were distributed to residents within 1km to the site and Estate ...

  9. Complex of amyloid beta peptides with 24-hydroxycholesterol and its effect on hemicholinium-3 sensitive carriers

    Czech Academy of Sciences Publication Activity Database

    Krištofíková, Z.; Kopecký, V. Jr.; Hofbauerová, Kateřina; Hovorková, P.; Řípová, D.

    2008-01-01

    Roč. 33, č. 3 (2008), s. 412-421 ISSN 0364-3190 Grant - others:GA Mšk(CZ) MZOPCP2005 Institutional research plan: CEZ:AV0Z50200510 Keywords : aging * hippocampus * choline carriers Subject RIV: EE - Microbiology, Virology Impact factor: 2.260, year: 2008

  10. Journal of Obstetrics and Gynaecology of Eastern and Central Africa ...

    African Journals Online (AJOL)

    ... of reproductive age die each year due to pregnancy-related complications. ... On a scale of 1 to 4 where for is very urgent need and 1 not urgent the scores were ... mellitus, 2.60 for preeclampsia and 3.04 for urinary tract infection symptoms.

  11. 75 FR 60480 - In the Matter of Certain Bulk Welding Wire Containers and Components Thereof and Welding Wire...

    Science.gov (United States)

    2010-09-30

    ... Welding Wire Containers and Components Thereof and Welding Wire; Notice of Commission Determination To... within the United States after importation of certain bulk welding wire containers, components thereof, and welding wire by reason of infringement of certain claims of United States Patent Nos. 6,260,781; 6...

  12. Toxicity and efficacy of selected pesticides and new acaricides to stored product mites (Acari : Acaridida)

    Czech Academy of Sciences Publication Activity Database

    Hubert, J.; Stejskal, V.; Münzbergová, Zuzana; Hajšlová, J.; Arthur, H. F.

    2007-01-01

    Roč. 42, č. 4 (2007), s. 283-290 ISSN 0168-8162 Grant - others:GA MŠk(CZ) 2B06099 Institutional research plan: CEZ:AV0Z60050516 Keywords : allergens * pesticide s * food Subject RIV: EF - Botanics Impact factor: 1.260, year: 2007

  13. Analyzing Anti-Asian Prejudice from a Racial Identity and Color-Blind Perspective

    Science.gov (United States)

    Kohatsu, Eric L.; Victoria, Rodolfo; Lau, Andrew; Flores, Michelle; Salazar, Andrea

    2011-01-01

    The purpose of this study was to examine to what extent both racial identity and color-blind racial attitudes help explain anti-Asian prejudice across different socioracial groups. Participants of color from a culturally diverse West Coast university were surveyed (N = 260). Hierarchical regression analyses showed that resistance racial identity…

  14. Magnetic alginate microparticles for purification of .alpha.-amylases

    Czech Academy of Sciences Publication Activity Database

    Šafaříková, Miroslava; Roy, I.; Gupta, M. N.; Šafařík, Ivo

    2003-01-01

    Roč. 105, - (2003), s. 255-260 ISSN 0168-1656 R&D Projects: GA MŠk OC 523.80; GA AV ČR IBS6087204 Institutional research plan: CEZ:AV0Z6087904 Keywords : alginate * ferrofluid * amalyses Subject RIV: CE - Biochemistry Impact factor: 2.543, year: 2003

  15. Biosorption of mercury on magnetically modified yeast cells

    Czech Academy of Sciences Publication Activity Database

    Yavuz, H.; Denizli, A.; Gungunes, H.; Šafaříková, Miroslava; Šafařík, Ivo

    2006-01-01

    Roč. 52, - (2006), s. 253-260 ISSN 1383-5866 R&D Projects: GA MŠk(CZ) OC 108 Institutional research plan: CEZ:AV0Z60870520 Keywords : mercury removal * magnetic biosorbents * yeast Subject RIV: EI - Biotechnology ; Bionics Impact factor: 2.497, year: 2006

  16. Fractal-like dimension of nanometer Diesel soot particles

    Energy Technology Data Exchange (ETDEWEB)

    Skillas, G.; Baltensperger, U. [Paul Scherrer Inst. (PSI), Villigen (Switzerland); Siegmann, K. [Eidgenoessische Technische Hochschule, Zurich (Switzerland)

    1997-11-01

    Measurements with a low-pressure impactor and a differential mobility analyser were conducted for Diesel soot at various engine loads. By means of these measurements a fractal-like dimension of Diesel soot particles, with diameters ranging from 55 up to 260 nm, was established. (author) 2 figs., 7 refs.

  17. Numerical Solution of the Time-Dependent Navier–Stokes Equation for Variable Density–Variable Viscosity. Part I

    Czech Academy of Sciences Publication Activity Database

    Axelsson, Owe; Xin, H.; Neytcheva, M.

    2015-01-01

    Roč. 20, č. 2 (2015), s. 232-260 ISSN 1392-6292 Institutional support: RVO:68145535 Keywords : variable density * phase-field model * Navier-Stokes equations * preconditioning * variable viscosity Subject RIV: BA - General Mathematics Impact factor: 0.468, year: 2015 http://www.tandfonline.com/doi/abs/10.3846/13926292.2015.1021395

  18. Attention Problems in Very Preterm Children from Childhood to Adulthood: The Bavarian Longitudinal Study

    Science.gov (United States)

    Breeman, Linda D.; Jaekel, Julia; Baumann, Nicole; Bartmann, Peter; Wolke, Dieter

    2016-01-01

    Background: Very preterm (VP; gestational age attention problems in childhood and adulthood. The stability of these problems into adulthood is not known. Methods: The Bavarian Longitudinal Study is a prospective cohort study that followed 260 VP/VLBW and 229 term-born…

  19. 75 FR 80665 - Sixty-Seventh Report of the TSCA Interagency Testing Committee to the Administrator of the...

    Science.gov (United States)

    2010-12-22

    ... chemicals and you may be identified by the North American Industrial Classification System (NAICS) codes 325.... SUMMARY: The Toxic Substances Control Act (TSCA) Interagency Testing Committee (ITC) transmitted its Sixty... identified. II. Background The Toxic Substances Control Act (TSCA) (15 U.S.C. 260l et seq.) authorizes the...

  20. Search Results | Page 26 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 251 - 260 of 272 ... Urban agriculture could boost food security in Arab countries ... Despite reforms, labour markets in the Middle East and North Africa (MENA) have been unable ... the brand of the bottled water and how it is stored affected its quality. ... Copyright · Open access policy · Privacy policy · Research ethics ...

  1. Tamazight Basic Course: Ait Mgild Dialect.

    Science.gov (United States)

    Harries, Jeanette

    The materials for this course in the Ait Mgild dialect of Tamazight, one of the three main languages into which the Berber dialects of Morocco are grouped, include this textbook, 32 tape recordings, and 260 colored slides keyed to the lessons. Lesson material on each tape does not exceed 26 minutes. The remaining four to eight minutes of the tape…

  2. Marital and Family Satisfaction as a Function of Work-Family Demands and Community Resources: Individual- and Couple-Level Analyses

    Science.gov (United States)

    Hostetler, Andrew J.; Desrochers, Stephan; Kopko, Kimberly; Moen, Phyllis

    2012-01-01

    This study uses individual- and couple-level analyses to examine the influence of work-family demands and community resources on marital and family satisfaction within a sample of dual-earner parents with dependent children (N = 260 couples, 520 individuals). Total couple work hours were strongly negatively associated with marital satisfaction for…

  3. A STUDY OF TWO DIRECTORIAL APPROACHES TO J. P. CLARK ...

    African Journals Online (AJOL)

    Mitch

    Clark- Bekederemo is influenced by the Greeks in his creation of his Song of a Goat and ... figures making their actions seem unnecessarily arbitrary. (260). ..... as a person who does not feel any sense of guilt for the decision he takes. He does ...

  4. Constitutive Negative Regulation of R Proteins in Arabidopsis also via Autophagy Related Pathway?

    Czech Academy of Sciences Publication Activity Database

    Pečenková, Tamara; Sabol, P.; Kulich, I.; Ortmannová, Jitka; Žárský, Viktor

    2016-01-01

    Roč. 7, MAR 4 (2016), s. 260 ISSN 1664-462X R&D Projects: GA ČR(CZ) GA15-14886S Institutional support: RVO:61389030 Keywords : resistance * autophagy * R Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.298, year: 2016

  5. A novel benzodipyrrolidone-based low band gap polymer for organic solar cells

    DEFF Research Database (Denmark)

    Yue, Wei; Huang, Xiaodong; Yuan, Jianyu

    2013-01-01

    A low band gap polymer PBDPDP-DTP, with alternating benzodipyrrolidone (BDP) unit and dithienopyrrole, was synthesized and characterized. A PCE of 2.60%and a Voc of up to 0.74 V were realized in PSCs, which demonstrated the strong potential of BDP as the electron deficient unit in the design of d...... of donor–acceptor conjugated polymers for PSCs....

  6. Acaulospora papillosa, a new mycorrhizal fungus from NE Brazil, and Acaulospora rugosa from Norway

    Czech Academy of Sciences Publication Activity Database

    Pereira, C. M. R.; Maia, L. C.; Sánchez-Castro, I.; Palenzuela, J.; Silva, D. K. A.; Sudová, Radka; Kolaříková, Zuzana; Rydlová, Jana; Čtvrtlíková, Martina; Goto, B. T.; Silva, G.A.; Oehl, F.

    2016-01-01

    Roč. 260, č. 1 (2016), s. 14-24 ISSN 1179-3155 R&D Projects: GA ČR GAP504/10/0781 Institutional support: RVO:67985939 ; RVO:60077344 Keywords : Acaulosporaceae * rainforest * arbuscular mycorrhiza Subject RIV: EF - Botanics; EH - Ecology, Behaviour (BC-A) Impact factor: 1.240, year: 2016

  7. 76 FR 54075 - Pears Grown in Oregon and Washington; Assessment Rate Decrease for Fresh Pears

    Science.gov (United States)

    2011-08-31

    ... production research and market development, $6,355,000 for promotion and paid advertising for winter pears, and $1,260,000 for promotion and paid advertising for summer/ fall pears. In comparison, major... advertising for winter pears, and $1,410,000 for promotion and paid advertising for summer/fall pears. The...

  8. A multilevel analysis of the demands-control model: Is stress at work determined by factors at the group level or the individual level?

    NARCIS (Netherlands)

    Van Yperen, N.W.; Snijders, T.A.B.

    2000-01-01

    This study explored the extent to which negative health-related outcomes are associated with differences between work groups and with differences between individuals within work groups using R. A. Karasek's (1979) demands-control model. The sample consisted of 260 employees in 31 working groups of a

  9. Temperature, salinity and transmissivity data from the Alpha Helix in the Arctic Ocean, 2000 - 2004 (NODC Accession 0059005)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This is calibrated CTD downcast data from five Alpha Helix cruises: HX235, 8/1/2000 - 9/30/2000 HX250, 9/1/2001 - 9/30/2001 HX260, 6/1/2002 - 6/30/2002 HX274,...

  10. Book Review: The Drug Effect | Kriegler | South African Crime ...

    African Journals Online (AJOL)

    Title: The Drug Effect: Health, Crime and Society Editors: Suzanne Fraser and David Moore Publisher: Cambridge University Press Price: R500.00 (incl. VAT and postage) Pages: 260. Availability: Published. Available through all academic bookstores. ISBN: 978-0-521-15605-9 ...

  11. Edward U Lorenz

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. Edward U Lorenz. Articles written in Resonance – Journal of Science Education. Volume 20 Issue 3 March 2015 pp 260-263 Classics. Predictability: Does the Flap of a Butterfly's Wings in Brazil Set off a Tornado in Texas? Edward U Lorenz · More Details Fulltext ...

  12. The Challenge of Utilizing Information and Communication ...

    African Journals Online (AJOL)

    This paper, The Challenge of Utilizing Information and Communication Technology in Book Editing: A Study of Select Publishing Houses in Nigeria is a survey research. Two hundred and sixty (260) book editors working in the 87 NPA member firms within Ibadan and Ikeja, Lagos metropolis in Southwest Nigeria constituted ...

  13. 77 FR 37051 - Agency Forms Undergoing Paperwork Reduction Act Review

    Science.gov (United States)

    2012-06-20

    ... Year 1 and Year 2. Informed Consent Form... 4,404 1 2/60 Non-Responder Interview. 792 1 5/60 Kimberly S...] Agency Forms Undergoing Paperwork Reduction Act Review The Centers for Disease Control and Prevention...-minute interview will be conducted with a 10% sample of non-responders (up to 792 individuals). In order...

  14. 77 FR 12594 - Agency Forms Undergoing Paperwork Reduction Act Review

    Science.gov (United States)

    2012-03-01

    ... Script. Refusal Questions Form.. 62 1 2/60 Individual Consent Form. 250 1 3/60 Contact Information Form... Screening 92 1 5/60 Survey. Informed Consent........ 50 1 1/60 Interview Questionnaire. 50 1 1 Network Size...-12-12BL] Agency Forms Undergoing Paperwork Reduction Act Review The Agency for Toxic Substances and...

  15. Metabolic Gene Variants Associated with Chromosomal Aberrations in Healthy Humans

    Czech Academy of Sciences Publication Activity Database

    Hemminki, K.; Frank, Ch.; Försti, A.; Musak, L.; Kazimírová, A.; Barančoková, M.; Horská, A.; Vymetálková, Veronika; Smerhovský, Z.; Naccarati, Alessio; Souček, P.; Vodičková, Ludmila; Buchancová, J.; Smolková, B.; Dusinska, M.; Vodička, Pavel

    2015-01-01

    Roč. 54, č. 4 (2015), s. 260-266 ISSN 1045-2257 Institutional support: RVO:68378041 Keywords : DNA-damage * cancer * polymorphisms * risk * lymphocytes * exposure * repair * susceptibility * markers * GSTT1 Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.960, year: 2015

  16. Alternative Methods in Laboratory Diagnosis of Equine Piroplasmosis

    African Journals Online (AJOL)

    Similar observation was made when such DNA material was examined in 1.5% agarose gel electrophoresis. Polymerase chain reaction of these cultures and purified genomic DNA yielded 260 base pair fragments diagnostic of B. equi infection. Spectrophotometry and agarose gel electrophoresis only indicate presence of ...

  17. Commentary on the Discovery of the Beautiful Style Michigan Madonna

    Czech Academy of Sciences Publication Activity Database

    Hlobil, Ivo

    2016-01-01

    Roč. 64, 3/4 (2016), s. 256-260 ISSN 0049-5123 Institutional support: RVO:68378033 Keywords : gothic sculpture * Bohemian Beautiful Style * Madonna-torso * Museum Ann Arbor * Michigan ( USA ) Subject RIV: AL - Art, Architecture, Cultural Heritage

  18. Mexico's Program for Science and Technology, 1978 to 1982.

    Science.gov (United States)

    Flores, Edmundo

    1979-01-01

    Describes briefly the National Council for Science and Technology (CONACYT) of Mexico, and outlines Mexico's Program for Science and Technology which includes 2,489 projects in basic and applied sciences at a cost of $260 million from 1978 to 1982. (HM)

  19. First mm-wave generation in the FOM free electron maser

    NARCIS (Netherlands)

    Verhoeven, A. G. A.; Bongers, W. A.; Bratman, V. L.; Caplan, M.; Denisov, G. G.; van der Geer, C. A. J.; Manintveld, P.; Poelman, A. J.; Plomp, J.; Savilov, A. V.; Smeets, P. H. M.; Sterk, A. B.; Urbanus, W. H.

    1999-01-01

    A free electron maser (FEM) has been built as a pilot mm-wave source for applications on future fusion research devices such as international tokamak experimental reactor (ITER), A unique feature of the Dutch FEM is the possibility to tune the frequency over the entire range from 130 to 260 GHz at

  20. Abstract

    African Journals Online (AJOL)

    ATTAMAH C. O

    female ̅=3.50; difference in mean{dm} = -0.70). Male entrepreneurs ... with the variance more on lack of information facilities (male ̅= 2.28; female. ̅= 2.60; dm = -0.32). ..... Issa R. (2009). Climate Change and Livestock Production Frontier.

  1. The Role of the Pharmacist in Animal Health Care: Case Study in ...

    African Journals Online (AJOL)

    In this cross-sectional study, the role of pharmacists in animal health care, particularly in the distribution of veterinary medicines in community pharmacies in Dar es Salaam was investigated. Using a semi-structured questionnaire a total of 260 pharmacists were interviewed. The study revealed that majority of the ...

  2. Nonsuicidal Self-Injury among Adolescents: A Training Priority for Primary Care Providers

    Science.gov (United States)

    Taliaferro, Lindsay A.; Muehlenkamp, Jennifer J.; Hetler, Joel; Edwall, Glenace; Wright, Catherine; Edwards, Anne; Borowsky, Iris W.

    2013-01-01

    Primary care providers were surveyed to determine how prepared they feel to address nonsuicidal self-injury (NSSI) among adolescents, their interest in training on NSSI, and factors associated with routinely asking about NSSI when providing health supervision. Participants included family medicine physicians ("n" = 260), pediatricians…

  3. A Feasibility Study for Solar Technology.

    Science.gov (United States)

    Texas State Technical Inst., Waco. Research Div.

    Job opportunities in the field of solar energy will increase steadily in Texas during the next few years as indicated by a survey of ninety-nine businesses currently involved in the solar industry. In 1979 the industry will need 108 installers/repairman and 17 technicians, while by 1983 it will need 260 installers/repairmen and 114 technicians.…

  4. Hydrolysis of nitriles and amides by filamentous fungi

    Czech Academy of Sciences Publication Activity Database

    Kaplan, Ondřej; Nikolaou, Konstantia; Charvátová, Andrea; Martínková, Ludmila

    2006-01-01

    Roč. 38, - (2006), s. 260-264 ISSN 0141-0229 R&D Projects: GA AV ČR IAA4020213; GA MŠk OC D25.001 Institutional research plan: CEZ:AV0Z5020903 Keywords : biotransformation * fusarium solani * penicillium multicolor Subject RIV: EE - Microbiology, Virology Impact factor: 1.897, year: 2006

  5. Game-playing in interdisciplinary design and planning teams : A role-play simulation as a learning method

    NARCIS (Netherlands)

    Bruil, A.W.; Van der Toorn Vrijthoff, W.

    2011-01-01

    In this paper we present our experiences in setting up and fulfilling a role-play simulation in an academic context. This simulation was set up for the first time in February 2010 to teach 260 students in their final semester in the Bachelor, the bachelor 6, of the Faculty of Architecture how to

  6. On Expedition – Travels Into the Unknown : A Research-based Learning Project at the Faculty of Arts and Social Sciences

    NARCIS (Netherlands)

    Klijn, Annemieke; Homburg, Ernst; Bastiaens, Ellen; Tilburg, van Jonathan; Merriënboer, van Jeroen

    2017-01-01

    The Jesuit Collection of the University Library in Maastricht houses a collection of over 260.000 volumes, including several hundreds of often lavishly illustrated travel books. The international mindset of the Jesuits seems to be suitable for the international student population in Maastricht

  7. 77 FR 30294 - National Institute of Child Health and Human Development; Submission for OMB Review; Comment...

    Science.gov (United States)

    2012-05-22

    ... function), immune-related problems such as allergies and asthma, congenital malformations, infections, and... validated stress measures), physiological measures (heart rate and self-reported stress), and several types.../60 1,680 16,800 population (not NCS participants). Heart Monitoring Members of NCS target 700 1 2/60...

  8. Delay in the Diagnosis and Treatment of Pulmonary Tuberculosis in Uzbekistan: A Cross-Sectional Study

    Czech Academy of Sciences Publication Activity Database

    Belkina, T.V.; Khojiev, D.S.; Tillyashaykhov, M.N.; Tigay, Z.N.; Kudenov, M.U.; Duintjer Tebbens, Jurjen; Vlček, J.

    2014-01-01

    Roč. 14, November (2014), article 624 ISSN 1471-2334 Grant - others:SVV UK(CZ) 260 066 Institutional support: RVO:67985807 Keywords : cross-sectional study * pulmonary tuberculosis * self-medication * Uzbekistan Subject RIV: FR - Pharmacology ; Medidal Chemistry Impact factor: 2.613, year: 2014

  9. Helminth parasites of the tropical gar, Atractosteus tropicus Gill, from Tabasco, Mexico

    Czech Academy of Sciences Publication Activity Database

    Salgado-Maldonado, G.; Moravec, František; Cabanas-Carranza, G.; Aguilar-Aguilar, R.; Sánchez-Nava, P.; Báez-Valé, R.; Scholz, Tomáš

    2004-01-01

    Roč. 90, č. 2 (2004), s. 260-265 ISSN 0022-3395 Grant - others:Consejo Nacional de Ciencia y Tecnología (MX) 27668N Institutional research plan: CEZ:AV0Z6022909 Keywords : Helminths * fish parasites * communities Subject RIV: EG - Zoology Impact factor: 1.439, year: 2004

  10. Novel Nucleophilic Compounds with Oxime Group as Reactivators of Paraoxon-Inhibited Cholinesterases

    Czech Academy of Sciences Publication Activity Database

    Musilová, L.; Jun, D.; Paleček, J.; Církva, Vladimír; Musílek, K.; Paar, M.; Hrabinová, M.; Pohanka, M.; Kuca, K.

    2010-01-01

    Roč. 7, č. 4 (2010), s. 260-264 ISSN 1570-1808 Grant - others:GA MO(CZ) OVUOFVZ200902 Program:OV Institutional research plan: CEZ:AV0Z40720504 Keywords : acetylcholinesterase * butyrylcholinesterase * nerve agent Subject RIV: CC - Organic Chemistry Impact factor: 0.668, year: 2010

  11. Androgen receptor expression as a prognostic and predictive ...

    African Journals Online (AJOL)

    Fatma Zakaria

    2015-10-30

    Oct 30, 2015 ... predictive marker in triple-negative breast cancer patients ... In univariate and multivariate anal- ... big markers and/or targets in breast cancer. .... Sex. Female. 74. 96.10. Male. 3. 3.90. PS. 0. 54. 70.13. 1. 21. 27.27. 2. 2. 2.60.

  12. Analysis of Attitude and Achievement Using the 5E Instructional Model in an Interactive Television Environment

    Science.gov (United States)

    Cherry, Gamaliel R.

    2011-01-01

    The purpose of this quasi-experimental study was to examine attitude and achievement among fifth grade students participating in inquiry and lecture-based forms of instruction through interactive television. Participants (N = 260) were drawn from registered users of NASA's Digital Learning Network[TM]. The first three levels of Bloom's Revised…

  13. Reliable Evaluation of Temperature-Independent Parameters in Correlation of Vapour–Liquid Equilibrium Data.

    Czech Academy of Sciences Publication Activity Database

    Pavlíček, Jan; Wichterle, Ivan

    2007-01-01

    Roč. 260, 1 (2007) , s. 70-73 ISSN 0378-3812 R&D Projects: GA ČR(CZ) GA104/03/1555 Institutional research plan: CEZ:AV0Z40720504 Keywords : temperature dependence of parameters * isometric pentanols * correlation Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.506, year: 2007

  14. Wet oxidation of quinoline

    DEFF Research Database (Denmark)

    Thomsen, A.B.; Kilen, H.H.

    1998-01-01

    The influence of oxygen pressure (0.4 and 2 MPa). reaction time (30 and 60 min) and temperature (260 and 280 degrees C) on the wet oxidation of quinoline has been studied. The dominant parameters for the decomposition of quinoline were oxygen pressure and reaction temperature. whereas the reactio...

  15. Aplikace nízkých teplot pro zvýšení katodoluminiscenčního signálu v rastrovacím elektronovém mikroskopu

    Czech Academy of Sciences Publication Activity Database

    Vaškovicová, Naděžda; Skoupý, Radim; Krzyžánek, Vladislav

    2017-01-01

    Roč. 62, č. 10 (2017), s. 260-263 ISSN 0447-6441 R&D Projects: GA MŠk(CZ) LO1212 Institutional support: RVO:68081731 Keywords : scanning electron microscopy * cathodoluminescence * diamonds * CL spectrums * cryo-SEM * contamination Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering OBOR OECD: Electrical and electronic engineering

  16. Modelling of Continual Induction Hardening in Quasi-Coupled Formulation

    Czech Academy of Sciences Publication Activity Database

    Barglik, J.; Doležel, Ivo; Karban, P.; Ulrych, B.

    2005-01-01

    Roč. 24, č. 1 (2005), s. 251-260 ISSN 0332-1649 Grant - others:PSRC(PL) 4T08C 04823 Institutional research plan: CEZ:AV0Z20570509 Keywords : mathematical modelling * electromagnetism * induction Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.188, year: 2005

  17. The strength of frustration and quantum fluctuations in LiVCuO.sub.4./sub..

    Czech Academy of Sciences Publication Activity Database

    Nishimoto, S.; Drechsler, S.L.; Kuzian, R.; Richter, J.; Málek, Jiří; Schmitt, M.; van den Brink, J.; Rösner, H.

    2012-01-01

    Roč. 98, č. 3 (2012), "37007-p1"-"37007-p6" ISSN 0295-5075 Institutional research plan: CEZ:AV0Z10100520 Keywords : cuprate superconductors * neutron inelastic scattering * spin waves Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.260, year: 2012

  18. L130-million cut to grants hits UK physical scientists

    CERN Multimedia

    Cressey, Daniel

    2008-01-01

    "UK physicists, still reeling from massive funding cuts announced earlier this year, have learnt of worse to come. Roughly L130 million (US$260 million)is being slashed from research grants awarded by the Engineering and Physical Scienes Research Council (EPSRC), it announced on 17 March." (2 pages)

  19. Lifelong Learning at the Technion: Graduate Students' Perceptions of and Experiences in Distance Learning

    Science.gov (United States)

    Hussein-Farraj, Rania; Barak, Miri; Dori, Yehudit Judy

    2012-01-01

    This study examined the development of two Distance Learning (DL) courses and their effect on students' perceptions and learning experiences. Our study included about 260 science and engineering graduate students. Among them, 105 students were divided into two research groups: on-campus students (N=70) and DL students (N=35). These two groups…

  20. phenanthrolinium cation

    African Journals Online (AJOL)

    KEY WORDS: Phenanthroline, H-bonding, X-ray structure, π- π stacking .... Density(calc) g/cm3. 1.281. 1.507. 1.167. Absorption coefficient mm-1. 0.260 ... in Figure 3, where an unprotonated neutral molecule co-crystallizes along with the.

  1. Search Results | Page 7 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 61 - 70 of 260 ... ... REGULATIONS 7 Apply REGULATIONS filter · WOMEN 7 Apply WOMEN filter · YOUTH 7 Apply ... family : impact on the wife left behind; an Arab families working group policy brief ... Namibian telecommunication sector performance review ... South African ICT sector performance review, 2009/2010.

  2. Prevalence of obesity and elevated blood pressure among bankers ...

    African Journals Online (AJOL)

    The aim of this study was to determine the prevalence of obesity and hypertension among bankers in Lagos State, Nigeria. Methods: Blood pressure, body mass index (BMI) and waist circumference were measured in 260 professional bankers from 56 bank branches in Lagos. Results: The mean age of the respondents was ...

  3. 77 FR 58403 - Announcing the Award of 24 Single-Source Program Expansion Supplement Grants Under the...

    Science.gov (United States)

    2012-09-20

    ... Education Services.. Los Fresnos, TX..... 2,260,821 International Education Services.. Los Fresnos, TX..... 638,042 International Education Services.. Los Fresnos, TX..... 192,577 Lutheran Immigration and... Austin, TX 18,615,410 US Conference of Catholic Bishops Washington, DC...... 182,855 (USCCB). US...

  4. The Army Budget Amended Fiscal Year 1990-91

    Science.gov (United States)

    1989-05-01

    Station -PERS: Personnel -PGTS: Precision Gunnery Target System -PHIL: Phillipines -PIP: Product Improvement Program -PL: Public Law -PM TRADE : Program...COMANDS 24.174 24.884 27,092 37,280 FOREIGN CURRECY FLUCTUATION 453,848 73,260 0 0 009 BASE INFORMATION MANAGEMENT 72,028 68.967 78,953 80,323 056 BASE

  5. Self-Sustained Oscillations of Temperature and Conversion in a Packed Bed Microreactor during 2-Methylpropene (Isobutene) Hydrogenation

    Czech Academy of Sciences Publication Activity Database

    Stavárek, Petr; Vajglová, Zuzana; Křišťál, Jiří; Jiřičný, Vladimír; Kolena, J.

    2015-01-01

    Roč. 256, NOV 1 (2015), s. 250-260 ISSN 0920-5861. [InternationalCongress of Chemical and Process Engineering CHISA 2014 /21./. Prague, 23.08.2014-27.08.2014] Institutional support: RVO:67985858 Keywords : hydrogenation * microreactor * oscillation Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 4.312, year: 2015

  6. 77 FR 10968 - Fluopyram; Pesticide Tolerances

    Science.gov (United States)

    2012-02-24

    ... at 260 ppm; hop, dried cones at 100 ppm; nut, tree, group (including pistachio) 14 at 0.05 ppm; okra..., sugar, root; cherry (sweet and tart); grape, wine; nut tree crop group 14; peanut; pistachio; potatoes..., group 14 (including pistachio)'' at 0.05 ppm, EPA determined that separate tolerances must be...

  7. Job resources and employee engagement : A cross-national study

    NARCIS (Netherlands)

    Farndale, E.; Murrer, I.N.J.

    2015-01-01

    Purpose In light of increasing globalization of workforces, the purpose of this paper is to explore the moderating effect of country on the relationship between job resources and employee engagement. Design/methodology/approach Questionnaire responses from 19,260 employees of a large multinational

  8. Self-Esteem as Mediator and Moderator of the Relationship between Social Support and Subjective Well-Being among Chinese University Students

    Science.gov (United States)

    Kong, Feng; Zhao, Jingjing; You, Xuqun

    2013-01-01

    This study examined both the mediating and moderating effects of global self-esteem on the relationship between social support and subjective well-being among Chinese university students. Three hundred and ninety-one university students (260 males and 131 females) from two different Chinese universities completed the social support scale, the…

  9. Gestation period and twinning in chimpanzees.

    Science.gov (United States)

    PEACOCK, L J; ROGERS, C M

    1959-04-10

    The length of the gestation period in 118 births in a colony of chimpanzees was found to be 226.8 days, with a standard deviation of 13.3 and a range of 196 to 260 days. Six pairs of twins were born in 120 parturitions; thus the apparent twinning rate is higher than that in man.

  10. African Journal of Psychiatry - Vol 9, No 4 (2006)

    African Journals Online (AJOL)

    The barriers preventing effective treatment of South African patients with mental health problems · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. L Trump, C Hugo, 249-260. http://dx.doi.org/10.4314/ajpsy.v9i4.30224 ...

  11. Experiment list: SRX524977 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available SRX524977 hg19 Histone H3K4me3 Uterus Endometrial stromal cells NA 35805072,98.7,42....0,260 GSM1372871: H3K4me3 case2 control; Homo sapiens; ChIP-Seq source_name=Human endometrial stromal cells || tissue=Endometr

  12. Minimally invasive drug delivery to the cochlea through application of nanoparticles to the round window membrane

    Czech Academy of Sciences Publication Activity Database

    Buckiová, Daniela; Ranjan, S.; Newman, T. A.; Johnston, A. H.; Sood, R.; Kinnunen, P. K. J.; Popelář, Jiří; Chumak, Tetyana; Syka, Josef

    2012-01-01

    Roč. 7, č. 9 (2012), s. 1339-1354 ISSN 1743-5889 R&D Projects: GA ČR GA309/07/1336; GA MŠk(CZ) LC554 Institutional research plan: CEZ:AV0Z50390512 Keywords : nanoparticles * cochlea * drug delivery Subject RIV: FH - Neurology Impact factor: 5.260, year: 2012

  13. Estabilización de suelos contaminados. El caso de Aznalcóllar

    OpenAIRE

    Cabrera, Francisco

    2005-01-01

    21 páginas, 11 figuras, 4 tablas, 48 referencias.-- El volumen citado consta de 260 páginas.-- Forma parte de la Colección Congresos y Cursos de la Universidad de Burgos.-- Curso de verano celebrado del 18-22 de julio 2005, en Burgos, España.

  14. Performance Based Logistics: Examining the Successes and Challenges When Operating in Stressful Environments

    Science.gov (United States)

    2016-04-30

    partnership between the Army and Lockheed Martin, and the cost benefits that derive from economies of scale, the Marines sought to support its launchers...Between System Abort MTBEFF - Mean Time Between Essential Function Failure Overall Operational Time Avg. of 26.0 Hrs/Launcher/Month  Deployed

  15. Total hip replacement with a superolateral bone graft for osteoarthritis secondary to dysplasia: a long-term follow-up

    NARCIS (Netherlands)

    de Jong, P. T.; Haverkamp, D.; van der Vis, H. M.; Marti, R. K.

    2006-01-01

    We evaluated the long-term results of 116 total hip replacements with a superolateral shelfplasty in 102 patients with osteoarthritis secondary to developmental dysplasia of the hip. After a mean follow-up of 19.5 years (11.5 to 26.0), 14 acetabular components (12%) had been revised. The cumulative

  16. A novel sheet topology in the structure of kamitugaite, PbAl[(UO.sub.2./sub.).sub.5./sub.(PO.sub.4./sub.).sub.2.38./sub.(AsO.sub.4./sub.).sub.0.62./sub.O.sub.2./sub.(OH).sub.2./sub.](H.sub.2./sub.O).sub.11.5./sub.

    Czech Academy of Sciences Publication Activity Database

    Plášil, Jakub

    2017-01-01

    Roč. 62, č. 4 (2017), s. 253-260 ISSN 1802-6222 R&D Projects: GA ČR GA17-09161S Institutional support: RVO:68378271 Keywords : kamitugaite * uranyl phosphate * crystal structure * topology Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Geology Impact factor: 0.609, year: 2016

  17. South African Medical Journal - Vol 105, No 4 (2015)

    African Journals Online (AJOL)

    Basic and comprehensive emergency obstetric and neonatal care in 12 South African health districts · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. RC Pattinson, JD Makin, Y Pillay, N van den Broek, J Moodley, 256-260 ...

  18. Search Results | Page 26 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 251 - 260 of 1128 ... ... MILLET 28 Apply MILLET filter · WATER MANAGEMENT 28 Apply WATER MANAGEMENT filter ... The quality of diets within Africa food systems appears to be getting worse as ... Traditional grains boost nutrition in rural India ... South Asian Water (SAWA) Leadership Program on Climate Change.

  19. Cloning and characterization of NBS-LRR resistance gene ...

    African Journals Online (AJOL)

    biotech

    2013-07-03

    Jul 3, 2013 ... Rose using degernate primers designed from the conserved motifs of different plant resistance genes. A total of 40 sequences were hit with various R genes, of which 20 .... absorption ratio OD260 nm/OD280 nm between 1.80 and ..... status and outlook for small-holders agriculture in C S Gold and B.

  20. Psychiatric symptoms among an HIV positive Urban Population in ...

    African Journals Online (AJOL)

    RICHY

    frequently psychiatric symptoms in an HIV positive adult ... affect the outcome of HIV disease. Firstly ... ignoring the serious consequences and impact the have on ... separated. 10. 5.4 divorced. 19. 10.3 widowed. 48. 26.0. Educational level.

  1. Symptoms associated in the diagnosis and management of malaria ...

    African Journals Online (AJOL)

    Symptomatic diagnosis of the 352 pregnant women and children, showed that 260 (79%) did not manifest any of the malarial symptoms within the past three months as at the time of the study, 20 (5.7%) patients had fever alone, chill and blisters (0.9%), headache, diarrhoea and joint pain (0.3%), and weakness and anorexia ...

  2. Autopoietic Automata: Complexity Issues in Offspring-Producing Evolving Processes

    Czech Academy of Sciences Publication Activity Database

    Wiedermann, Jiří

    2007-01-01

    Roč. 383, č. 2-3 (2007), s. 260-269 ISSN 0304-3975 R&D Projects: GA AV ČR 1ET100300517 Institutional research plan: CEZ:AV0Z10300504 Keywords : autopoietic automata * self-reproducing automata * interactive Turing machine * simulation * computational complexity Subject RIV: IN - Informatics, Computer Science Impact factor: 0.735, year: 2007

  3. Recent natural hybridization between two allopolyploid wheatgrasses (Elytrigia, Poaceae): Ecological and evolutionary implications

    Czech Academy of Sciences Publication Activity Database

    Mahelka, Václav; Fehrer, Judith; Krahulec, František; Jarolímová, Vlasta

    2007-01-01

    Roč. 100, - (2007), s. 249-260 ISSN 0305-7364 R&D Projects: GA ČR GA206/05/0778; GA ČR(CZ) GD206/03/H137 Institutional research plan: CEZ:AV0Z60050516 Keywords : Triticeae * polyploidy * gene flow Subject RIV: EF - Botanics Impact factor: 2.939, year: 2007

  4. 40 CFR 273.81 - Factors for petitions to include other wastes under 40 CFR part 273.

    Science.gov (United States)

    2010-07-01

    ... AGENCY (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR UNIVERSAL WASTE MANAGEMENT Petitions To Include... generic name to identify the waste category (e.g., batteries), the definition of universal waste in § 260..., and specific management standards proposed or referenced by the petitioner (e.g., waste management...

  5. 40 CFR 270.1 - Purpose and scope of these regulations.

    Science.gov (United States)

    2010-07-01

    ... Overview and definitions 40 CFR part 260 3001 Identification and listing of hazardous waste 40 CFR part 261... hazardous waste management units must have permits during the active life (including the closure period) of... of a permit for the active life of a hazardous waste management facility or unit does not affect the...

  6. WAViS server for handling, visualization and presentation of multiple alignments of nucleotide or aminoacids sequences

    Czech Academy of Sciences Publication Activity Database

    Zíka, Radek; Pačes, Jan; Pavlíček, A.; Pačes, Václav

    2004-01-01

    Roč. 32, suppl 2 (2004), s. 48-49 ISSN 0305-1048 R&D Projects: GA MŠk LN00A079 Institutional research plan: CEZ:AV0Z5052915 Keywords : server * alignment * vizualization Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 7.260, year: 2004

  7. 40 CFR 262.11 - Hazardous waste determination.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Hazardous waste determination. 262.11 Section 262.11 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES... Administrator under 40 CFR 260.21; or (2) Applying knowledge of the hazard characteristic of the waste in light...

  8. Search Results | Page 26 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 251 - 260 of 1804 ... For megacities located in low-lying coastal areas, the threat of climate change is an added stressor to rapid population growth, as well as economic, social, health and cultural challenges. Project. Climate Change and the Health of Indigenous Communities. Indigenous people are among the most ...

  9. Phytochemical constituents and antimicrobial activity of leaf extracts ...

    African Journals Online (AJOL)

    USER

    2010-05-24

    May 24, 2010 ... conventionally used to control microbial growth and survival (Nascimento et al., ... The leaves were air-dried to crispiness in the laboratory at room temperature of 25. - 260C. ... and sequentially extracted in cold with 2 × 1L of distilled hexane, ethyl acetate ..... medicinal plants on smooth muscle. AB Abstract ...

  10. Liquefaction of torrefied wood using microwave irradiation

    Science.gov (United States)

    Mengchao Zhou; Thomas Eberhardt; Pingping Xin; Chung-Yun Hse; Hui Pan

    2016-01-01

    Torrefaction is an effective pretreatment method to improve the uniformity and quality of lignocellulosic biomass before further thermal processing (e.g., gasification, combustion). The objective of this study was to determine the impacts of torrefaction as a pretreatment before liquefaction. Wood chips were torrefied for 2 h at three different temperatures (230, 260,...

  11. Progression of abnormalities in adrenomyeloneuropathy and neurologically asymptomatic X-linked adrenoleukodystrophy despite treatment with "Lorenzo's oil"

    NARCIS (Netherlands)

    van Geel, B. M.; Assies, J.; Haverkort, E. B.; Koelman, J. H.; Verbeeten, B.; Wanders, R. J.; Barth, P. G.

    1999-01-01

    OBJECTIVES: X-linked adrenoleukodystrophy (X-ALD) is an inherited disorder of peroxisomal fatty acid oxidation, biochemically characterised by the accumulation of saturated very long chain fatty acids (VLCFAs), particularly hexacosanoic acid (C26:0). Dietary treatment with a 4:1 mixture of

  12. Search Results | Page 9 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 81 - 90 of 260 ... Towards evidence based ICT policy and regulation : e-skills. Evaluations. -. Because gender matters : strengthening social and gender analysis in ENRM in the Middle East and North Africa; project evaluation ... Gender and work in MENA : research capacity building activities; mid-term evaluation.

  13. Inulin, a flexible oligosaccharide I : Review of its physicochemical characteristics

    NARCIS (Netherlands)

    Mensink, Maarten A.; Frijlink, Henderik W.; Maarschalk, Kees van der Voort; Hinrichs, Wouter L. J.

    2015-01-01

    Inulin, a fructan-type polysaccharide, consists of (2 -> 1) linked beta-D-fructosyl residues (n = 2-60), usually with an (1 2) alpha-D-glucose end group. The applications of inulin and its hydrolyzed florin oligofructose (n = 2-10) are diverse. It is widely used in food industry to modify texture,

  14. ORF Alignment: NC_000117 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000117 gi|15605324 >1jgmA 39 326 7 260 4e-33 ... ref|NP_220110.1| PHP superfamily hydrolase [Chlamydia trachomatis D/UW-3/CX] ... gb|AAC68196.1| PHP... ... trachomatis D/UW-3/CX] pir||G71494 probable php ... hydrolase - Chlamydia trachomatis (sero

  15. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 200 of 260 ... Vol 40 (2000), Plastic mulch and 4-chloro-phenoxyacetic acid (CPA) interaction on growth and yield of eggplant (Solanum aethiopicum L.) Abstract. GO Nkansah ... Vol 30, No 1-2 (1990): Volume 29-30; 1989-1990, Potassiium-Argon radiometric dates of the Mid-Atlantic ocean floor, Abstract. EK Agyei.

  16. Interteaching within a Human Physiology Course: A Comparison of First- and Second-Year Students' Learning Skills and Perceptions

    Science.gov (United States)

    Byrne, Bruce; Guy, Richard

    2016-01-01

    This article describes student perceptions and outcomes in relation to the use of a novel interteaching approach. The study sample (n = 260) was taken from a large human physiology class, which included both first- and second-year students. However, unlike the first-year students, the second-year students had significant prior knowledge, having…

  17. Rigidity theorem for Willmore surfaces in a sphere

    Indian Academy of Sciences (India)

    (Math. Sci.) Vol. 126, No. 2, May 2016, pp. 253–260. c Indian Academy of Sciences. Rigidity theorem for Willmore surfaces in a sphere. HONGWEI XU1 and DENGYUN YANG2,∗. 1Center of Mathematical Sciences, Zhejiang University, Hangzhou 310027,. People's Republic of China. 2College of Mathematics and ...

  18. Proceedings – Mathematical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Proceedings – Mathematical Sciences; Volume 126; Issue 2. Volume 126, Issue 2. May 2016, pages 143-287. pp 143-151 Research Article. Existence of ..... pp 253-260 Research Article. Rigidity theorem forWillmore surfaces in a sphere · Hongwei Xu Dengyun Yang · More Details Abstract Fulltext PDF.

  19. Sero-prevalence of immunodeficiency virus, hepatitis B and C and ...

    African Journals Online (AJOL)

    Objectives: This study aimed to determine the sero-prevalence of transfusion transmitted infections (TTIs), namely immunodeficiency virus, hepatitis B and C and syphilis among blood donors. Setting: The study was carried in the blood bank at ElObeid Teaching Hospital. Material and methods: The study included 260 blood ...

  20. Fiction and Conviction | Blackburn | Philosophical Papers

    African Journals Online (AJOL)

    I claim that there is nothing so unusual in the interleaving of myth or fiction and history that Williams finds in Herodotus. I also reflect on the difficulty of separating acceptance of truth from acceptance of myth, metaphor, and model, not only in history but also in science. Philosophical Papers Vol.32(3) 2003: 243-260 ...

  1. Semisynthetic flavonoid 7-O-galloylquercetin activates Nrf2 and induces Nrf2-dependent gene expression in RAW264.7 and Hepa1c1c7 cells

    Czech Academy of Sciences Publication Activity Database

    Roubalová, L.; Biedermann, David; Papoušková, B.; Vacek, J.; Kuzma, Marek; Křen, Vladimír; Ulrichová, J.; Dinkova-Kostova, A.T.; Vrba, J.

    2016-01-01

    Roč. 260, 25 December (2016), s. 58-66 ISSN 0009-2797 R&D Projects: GA MZd(CZ) NV16-27317A Institutional support: RVO:61388971 Keywords : Heme oxygenase-1 * Metabolism * Methyl gallate Subject RIV: CE - Biochemistry Impact factor: 3.143, year: 2016

  2. Problems associated with scintillation counting of NaH14CO3 and gel suspension counting of Ba14CO3

    International Nuclear Information System (INIS)

    MacRae, J.C.; Wilson, S.

    1978-01-01

    Liquid NaH 14 CO 3 was assayed in emulsion-type (NE260 and Unisolve) and dioxan-based (NE250) scintillation cocktails contained in glass or polyethylene vials kept at 2 0 or 24-30 0 C. Different particle size ranges of standard Ba 14 CO 3 were assayed by gel suspension counting in Cabosil scintillation cocktail and in NE260 following solubilisation in EDTA-tetrasodium salt. Initial detectable activities of NaH 14 CO 3 in glass and polyethylene vials in NE250, NE260 and Unisolve were 97 and 96, 68 and 83, 71 and 89% of the true value respectively. Subsequent losses of activity over 7 days with the emulsion-type scintillators was greater from the polyethylene vials. Addition of phenylethylamine to the NE260 and Unisolve cocktails gave the true activity levels for all vials with no loss of activity over 6 days. When different particle size ranges of Standard Ba 14 CO 3 were suspended in Cabosil scintillation cocktail there was considerable variation in counting efficiency (77-88%) with little relationship between particle size and counting efficiency. The relationship between counting efficiency and channels ratio was not sufficiently precise for predictive purposes. Solubilisation of Ba 14 CO 3 in EDTA-tetrasodium salt gave similar counting efficiency and channels ratio values for all samples. (U.K.)

  3. Fatty Acid Composition of the Aerial Parts of Some Centaurea ...

    African Journals Online (AJOL)

    The fatty acid methyl esters (FAMEs) were analyzed on a Hewlett Packard Agilent 6890 N gas chromatograph (GC), equipped with a flame ionization detector (FID) and fitted to a Supelco. SP-2380 fused silica capillary column (60 m,. 0.25 mm i.d. and 0.2 µm). Injector and detector temperatures were set at 250 and 260ºC,.

  4. Iodometric determination of ampicillin in proprietary capsules | Ejele ...

    African Journals Online (AJOL)

    The concentration of ampicillin in ampicillin capsule preparations purchased in Owerri main market, Imo State of Nigeria, was determined using the iodometric titration method. The results showed that the ampicillin concentrations in the capsules contained between 250 and 260 mg/cap of ampicillin trihydrate. Statistical ...

  5. European Birth Cohorts for Environmental Health Research

    Czech Academy of Sciences Publication Activity Database

    Vrijheid, M.; Casas, M.; Bergström, A.; Carmichael, A.; Cordier, S.; Eggesbø, M.; Eller, E.; Fantini, M. P.; Fernández, M. F.; Fernández-Somoano, A.; Gehring, U.; Grazuleviciene, R.; Hohmann, C.; Karvonen, A. M.; Keil, T.; Kogevinas, M.; Koppen, G.; Krämer, U.; Kuehni, C. E.; Magnus, P.; Majewska, R.; Andersen, A. M. N.; Patelarou, E.; Petersen, M. S.; Pierik, F. H.; Polanska, K.; Porta, D.; Richiardi, L.; Santos, A. C.; Slama, R.; Šrám, Radim; Thijs, C.; Tischer, C.; Toft, G.; Trnovec, T.; Vandentorren, S.; Vrijkotte, T. G. M.; Wilhelm, M.; Wright, J.; Nieuwenhuijsen, M.

    2012-01-01

    Roč. 120, č. 1 (2012), s. 29-37 ISSN 0091-6765 Institutional research plan: CEZ:AV0Z50390703 Keywords : environment pollution * child health * European birth cohorts Subject RIV: DN - Health Impact of the Environment Quality Impact factor: 7.260, year: 2012

  6. Search Results | Page 26 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 251 - 260 of 374 ... Environmental and Health Impacts of Small-scale Gold Mining in Ecuador - Phase III ... based on the Ethnobotanical Garden and Traditional Medicine Concept ... where there is wide disparity in health services access and delivery. ... Corporate Social Responsibility in the Latin American Extractive ...

  7. Book Review :The Essential Guide to Rocky Mountain Mushrooms by Habitat

    Science.gov (United States)

    A mushroom guide book, 'The Essential Guide to Rocky Mountain Mushrooms by Habitat' by Cathy L. Cripps, Vera S. Evenson, and Michael Kou (University of Illinois Press, 260 pages), is reviewed in non-technical fashion from the standpoints of format, comprehensiveness, and clarity. Postive features (...

  8. Fort Hood Building and Landscape Inventory with WWII and Cold War Context

    Science.gov (United States)

    2007-03-01

    barracks, 1970s (NARA)........................................................... 112 Figure 37. Palmer Movie Theater (NARA...revised 1953) showing layout of Hood Village and trailer park (Fort Hood...arms ammunition storage building #92012 (ERDC-CERL, 2004). ......... 260 Figure 163: Radio reception building #92063 (ERDC-CERL, 2004

  9. Nikkaji Dictionary: メタンイミン [MeCab user dictionary for science technology term[Archive

    Lifescience Database Archive (English)

    Full Text Available MeCab user dictionary for science technology term メタンイミン 名詞 一般 * * * * メタンイミン ... Nikkaji J260.357H 200906004407959940 C CA06 UNKNOWN_1 メタンイミン

  10. Neonatal Predictors of Cognitive Ability in Adults Born Very Preterm : A Prospective Cohort Study

    NARCIS (Netherlands)

    Breeman, L.D.; Jaekel, Julia; Baumann, Nicole; Bartmann, Peter; Wolke, Dieter

    Aim To identify neonatal predictors to allow a developmental prognosis of very preterm / very-low birthweight (VP/VLBW) survivors' cognitive abilities into adult life. Method The Bavarian Longitudinal Study is a prospective whole population study that followed 260 VP/VLBW infants from birth to

  11. High temperature microcalorimetry. Study of metal-oxygen systems

    International Nuclear Information System (INIS)

    Tetot, R.; Picard, C.; Boureau, G.; Gerdanian, P.

    1981-01-01

    Determination of partial molar enthalpy in metal-oxygen systems at 1050 0 C. Three representative systems are studied: the solution of oxygen in titanium, the titanium-oxygen system and the uranium-oxygen system from UOsub(2.00) to UOsub(2.60) [fr

  12. Laser microirradiation of cells

    International Nuclear Information System (INIS)

    Berns, M.W.; Kitzes, M.; Rattner, J.B.; Burt, J.; Meredith, S.

    1979-01-01

    The brief review outlines the technique of laser microbeam irradiation (260 - 700 nm) of cells to study ultrastructural changes. In combination with other techniques such as optical microscopy, electron microscopy and autoradiography structure and organization of chromosomes and nucleoli, chromosome stability, mechanisms of mitosis, gene mapping, cytoplasmic functions, and structure of nucleic acids are investigated

  13. Female morphology of Philometra hyderabadensis Rasheed, 1963 (Nematoda: Philometridae), a little-known parasite of the catfish Wallago attu Bloch & Schneider in India, as revealed by SEM observations

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Chavan, S. P.

    2012-01-01

    Roč. 83, č. 2 (2012), s. 117-122 ISSN 0165-5752 R&D Projects: GA ČR GBP505/12/G112 Institutional research plan: CEZ:AV0Z60220518 Keywords : Philometra * Wallago * India Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.260, year: 2012

  14. Search Results | Page 18 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 171 - 180 of 260 ... ... West Indies filter · United Kingdom 108 Apply United Kingdom filter ... It promotes economic research on inclusive sustainable ... The past century has witnessed disruptions in Middle Eastern politics, economics, ... This project will explore the experiences of emerging and developing countries in ...

  15. Geochemical characterization of the Krishna–Godavari and Mahanadi offshore basin (Bay of Bengal) sediments: A comparative study of provenance

    Digital Repository Service at National Institute of Oceanography (India)

    Mazumdar, A.; Kocherla, M.; Carvalho, M.A.; Peketi, A.; Joshi, R.K.; Mahalaxmi, P.; Joao, H.M.; Jisha, R.

    and further extends offshore into the Bay of Bengal (Fig. 1).  It is a passive pericratonic basin covering an area of 260,000 km2 with water depth exceeding 3000 m (including deep offshore) (Singh, 2008). The Mahanadi offshore area represents a pull...

  16. ACRO - a computer program for calculating organ doses from acute or chronic inhalation and ingestion of radionuclides

    International Nuclear Information System (INIS)

    Hirayama, Akio; Kishimoto, Yoichiro; Shinohara, Kunihiko.

    1978-01-01

    The computer program ACRO has been developed to calculate organ doses from acute or chronic inhalation and ingestion of radionuclides. The ICRP Task Group Lung Model (TGLM) was used for inhalation model, and a simple one-compartment model for ingestion. This program is written in FORTRAN IV, and can be executed with storage requirements of about 260 K bytes. (auth.)

  17. A dilatometer to measure the influence of cooling rate and melt shearing on specific volume

    NARCIS (Netherlands)

    van der Beek, M.H.E.; Peters, G.W.M.; Meijer, H.E.H.

    2005-01-01

    We developed a dilatometer to investigate the specific volume of polymers as a function of pressure (to 100 MPa), temperature (to 260 oC), cooling rate (to 80 C/s), and shear rate (to 77 1/s). The dilatometeris based on the principle of con¯ned compression and comprises of a pressure cell used in

  18. Impact on Adults of Dramatized Television Programs.

    Science.gov (United States)

    Gorney, Roderic; And Others

    Psychosocial adaptations are sometimes affected by experiences that are ordinarily considered to be amusements. In 1974, a field study was undertaken by the Program on Psychosocial Adaptation and the Future to determine if it is possible to measure the effect of television on adult viewers. A sample of 260 couples, controlled for demographic…

  19. Mass Entertainment and Human Survival: Television's Potential for Prosocial Effects on Adults.

    Science.gov (United States)

    Loye, David

    Psychosocial adaptations are sometimes affected by experiences that are ordinarily considered to be amusements. In 1974, a field study was undertaken by the Program on Psychosocial Adaptation and the Future to determine if it is possible to measure the effect of television on adult viewers. A sample of 260 couples, controlled for demographic…

  20. 76 FR 79258 - Self-Regulatory Organizations; Chicago Mercantile Exchange, Inc.; Notice of Filing and Order...

    Science.gov (United States)

    2011-12-21

    ..., Forwards and Swaps); CME Chapter 260H (Cleared OTC U.S. Dollar/Russian Ruble (USD/RUB) Spot, Forwards and... positive or negative. This language had been adopted previously by CME for many of the cleared OTC FX NDF... 271H. These changes would add language to the cash settlement provisions in the rules governing four...

  1. 76 FR 50436 - Kentucky Regulatory Program

    Science.gov (United States)

    2011-08-15

    ... instructions; or Mail/Hand Delivery/Courier: Joseph L. Blackburn, Field Office Director, Lexington Field Office... Office. Joseph L. Blackburn, Field Office Director, Lexington Field Office, Office of Surface Mining Reclamation and Enforcement, 2675 Regency Road, Lexington, Kentucky 40503, (859) 260-3900. Carl E. Campbell...

  2. Simulation of preindustrial atmospheric methane to constrain the global source strength of natural wetlands

    NARCIS (Netherlands)

    Houweling, S; Dentener, F; Lelieveld, J

    2000-01-01

    Previous attempts to quantify the global source strength of CH4 from natural wetlands have resulted in a range of 90-260 TE(CH4) yr(-1). This relatively uncertain estimate significantly limits our understanding of atmospheric methane. In this study we reduce this uncertainty by simulating

  3. Causes for variation in pork quality

    NARCIS (Netherlands)

    Wal, van der P.; Engel, B.; Hulsegge, B.

    1997-01-01

    Research was carried out on 260 pigs that were slaughtered in 12 batches in the slaughter facilities of ID-DLO at Zeist. The practical circumstances were highly standardized. The 'animals' meat quality was good with only little variation; 46 animals showed a 'slightly' aberrant quality and 6

  4. Bayou Vista: A Market-Driven Development

    Science.gov (United States)

    Izzo, G. Martin; Teal, Elisabeth J.

    2012-01-01

    The case touches on several areas of marketing: ethics, sales issues, conflicts of interest, marketing forecasts, and issues of pricing. Joe Brice, the visionary and real estate broker for a 36-lot subdivision of moderately priced single-family homes targeting the $190,000 to $260,000 range, seems to have identified an unmet housing market,…

  5. Application of functional derivatives to analysis of complex systems

    Czech Academy of Sciences Publication Activity Database

    Beran, Zdeněk; Čelikovský, Sergej

    2013-01-01

    Roč. 350, č. 10 (2013), s. 2982-2993 ISSN 0016-0032 R&D Projects: GA ČR GA13-20433S Institutional support: RVO:67985556 Keywords : complex systems * linear equation * modeling Subject RIV: BC - Control Systems Theory Impact factor: 2.260, year: 2013 http://library.utia.cas.cz/separaty/2013/TR/beran-0398123.pdf

  6. 76 FR 62760 - Foreign-Trade Zone 277-Western Maricopa County, AZ; Application for Temporary/Interim...

    Science.gov (United States)

    2011-10-11

    ... exempt Sub-Zero from customs duty payments on the foreign components used in export production. The company anticipates that some 10 percent of the plant's shipments will be exported. On its domestic sales... (260 employees, 10 acres, 150,000 units/year) is located at 4295 N. Cotton Lane within the Palm Valley...

  7. Selective biotransformation of substituted alicyclic nitriles by Rhodococcus equi A4

    Czech Academy of Sciences Publication Activity Database

    Martínková, Ludmila; Klempier, N.; Preiml, M.; Ovesná, Mária; Kuzma, Marek; Mylerová, Veronika; Křen, Vladimír

    2002-01-01

    Roč. 80, - (2002), s. 724-727 ISSN 0008-4042 R&D Projects: GA ČR GA524/00/1275; GA AV ČR IAA4020802 Keywords : nitrile hydratase * substituted cyclohexanecarbonitriles * cyclopentanecarbonitriles Subject RIV: EE - Microbiology, Virology Impact factor: 1.260, year: 2002

  8. Stressful Events and Depressive Symptoms among Old Women and Men: A Longitudinal Study.

    Science.gov (United States)

    Chou, Kee-Lee; Chi, Iris

    2000-01-01

    Examines the impact of a series of common stressful life events (SLEs) on changes in depressive symptoms among older adults (N=260) aged 70 or older. Results show that of eight SLEs only widowhood was associated with depression symptoms three years later. SLEs influenced the depression of men and women differently. (Author/MKA)

  9. Grinding induced martensite on the surface of rails

    DEFF Research Database (Denmark)

    Rasmussen, C.J.; Zhang, Xiaodan; Danielsen, Hilmar Kjartansson

    2014-01-01

    determined. Two different rail types R260 and R350HT that both had been ground by a grinding train were investigated. The rail sections, studied using optical and scanning electron microscopy, showed that the surface of both types of rails is covered with WELs. The hardness of the WEL is increased compared...

  10. Disgust domains in the prediction of contamination fear : A comparison of Dutch and US samples

    NARCIS (Netherlands)

    Sawchuk, Craig N.; Olatunji, Bunmi O.; De Jong, Peter J.

    2006-01-01

    The present study examines the disgust-contamination fear relationship among Dutch (N =260) and US (N =292) participants. US participants reported higher levels of disgust sensitivity across the majority of disgust domains and also endorsed stronger contamination fear than their Dutch counterparts.

  11. Checklist of the birds of Aruba, Curaçao and Bonaire, South Caribbean

    NARCIS (Netherlands)

    Prins, T.G.; Reuter, J.H.; Debrot, A.O.; Wattel, J.; Nijman, V.

    2009-01-01

    We present an updated checklist of the birds of the islands of Aruba, Curaçao and Bonaire, and the islets of Klein Curaçao and Klein Bonaire, southern Caribbean, and compare this with earlier checklists (K.H. Voous, Stud. Fauna Curaçao Carib. Isl. 7: 1-260, 1957; Ardea 53: 205-234, 1965; Birds of

  12. Functional screening of abundant bacteria from acidic forest soil indicates the metabolic potential of Acidobacteria subdivision 1 for polysaccharide decomposition

    Czech Academy of Sciences Publication Activity Database

    Lladó, Salvador; Žifčáková, Lucia; Větrovský, Tomáš; Eichlerová, Ivana; Baldrian, Petr

    2016-01-01

    Roč. 52, č. 2 (2016), s. 251-260 ISSN 0178-2762 R&D Projects: GA ČR(CZ) GP14-09040P EU Projects: European Commission(CZ) FP7ITN no.289949 Institutional support: RVO:61388971 Keywords : Coniferous forest * Bacterial ecology * Acidobacteria Subject RIV: EE - Microbiology, Virology Impact factor: 3.683, year: 2016

  13. 76 FR 14663 - Notice of Public Information Collection(s) Being Reviewed by the Federal Communications...

    Science.gov (United States)

    2011-03-17

    ....209, 53.211, and 53.213, Accounting Safeguards and Sections 260 and 271-276 of the Communications Act... reporting requirements, third party disclosure requirement, and recordkeeping requirement. Obligation to... party disclosure requirements). There is no change in the Commission's burden estimates. A Bell...

  14. STUDY OF USING CANON 1000D DIGITAL CAMERA FOR MULTIZONE PHOTOGRAPHY WITH SPATIALLY-RESOLVED SPECTRAL DEVICES

    Directory of Open Access Journals (Sweden)

    K. N. Kaplevskiy

    2013-01-01

    Full Text Available The possibility of use a CANON 1000D digital camera for multizone photography is demonstrated. It is found that a dynamic range of the recorded light intensities is varied from 260 to 3650 quantization levels of the ADC. Linearity of the light-sensitive element of the camera has been studied in dependence on its illumination and exposure time.

  15. Wet effluent diffusion denuder: The tool for determination of monoterpenes in forest

    Czech Academy of Sciences Publication Activity Database

    Křůmal, Kamil; Mikuška, Pavel; Večeřová, Kristýna; Urban, Otmar; Pallozzi, E.; Večeřa, Zbyněk

    2016-01-01

    Roč. 153, JUN (2016), s. 260-267 ISSN 0039-9140 R&D Projects: GA MŠk(CZ) LO1415 Institutional support: RVO:68081715 ; RVO:67179843 Keywords : diffusion denuder * monoterpene * biogenic volatile organic compounds * tenax tubes Subject RIV: CB - Analytical Chemistry , Separation; EH - Ecology, Behaviour (UEK-B) Impact factor: 4.162, year: 2016

  16. Roman impact on the landscape near castellum Fectio, The Netherlands

    NARCIS (Netherlands)

    van den Bos, Valerie; Brinkkemper, Otto; Bull, Ian; Engels, Stefan; Hakbijl, Tom; Schepers, Mans; van Dinter, Marieke; van Reenen, Guido; van Geel, Bas

    2014-01-01

    Castellum Fectio was one of the largest fortifications along the Limes, the northern border of the Roman Empire. The castellum, situated 5 km southeast of Utrecht, the Netherlands, was occupied from around the start of our Era to ca. A.D. 260. It was situated along a river bend of the Rhine that was

  17. 78 FR 76629 - The National Children's Study, Vanguard (Pilot) Study; Submission for OMB Review; 30-Day Comment...

    Science.gov (United States)

    2013-12-18

    ... understand what activities are feasible in specific settings, participants' willingness to complete requested..., Primary Caregiver, Secondary Residence Caregiver. Validation Interview (Pre- Pregnant Woman, 850 1 2/60 28 Pregnancy to 60M). Father/Father Figure, Biological Mother, Primary Caregiver, Secondary Residence Caregiver...

  18. Linked data-as-a-service: The semantic web redeployed

    NARCIS (Netherlands)

    Rietveld, Laurens; Verborgh, Ruben; Beek, Wouter; Vander Sande, Miel; Schlobach, Stefan

    2015-01-01

    Ad-hoc querying is crucial to access information from Linked Data, yet publishing queryable RDF datasets on the Web is not a trivial exercise. The most compelling argument to support this claim is that the Web contains hundreds of thousands of data documents, while only 260 queryable SPARQL

  19. Search Results | Page 26 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 251 - 260 of 420 ... ... 38 Apply Cambodia filter · Thailand 35 Apply Thailand filter ... Gender and Citizenship in the Information Society in Asia ... This project builds on an earlier phase, Poverty and Inequality ... As the country emerges from this situation, it is overwhelmed by a long list of priorities in almost every sector.

  20. A search for high-mass resonances decaying to τ.sup.+./sup.τ.sup.-./sup. in pp collisions at √s = 7 TeV with the ATLAS detector

    Czech Academy of Sciences Publication Activity Database

    Aad, G.; Abajyan, T.; Abbott, B.; Böhm, Jan; Chudoba, Jiří; Gallus, Petr; Gunther, Jaroslav; Jakoubek, Tomáš; Juránek, Vojtěch; Kepka, Oldřich; Kupčo, Alexander; Kůs, Vlastimil; Lokajíček, Miloš; Marčišovský, Michal; Mikeštíková, Marcela; Myška, Miroslav; Němeček, Stanislav; Růžička, Pavel; Schovancová, Jaroslava; Šícho, Petr; Staroba, Pavel; Svatoš, Michal; Taševský, Marek; Tic, Tomáš; Valenta, J.; Vrba, Václav; Zeman, Martin

    2013-01-01

    Roč. 719, 4-5 (2013), 242-260 ISSN 0370-2693 R&D Projects: GA MŠk LA08032 Institutional support: RVO:68378271 Keywords : pair production * mass spectrum * (tau + tau - ) * scattering * Z' * leptonic decay * ATLAS * CERN LHC Coll * tau * decay modes Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 6.019, year: 2013