Characterization of circadian behavior in the starlet sea anemone, Nematostella vectensis.
Directory of Open Access Journals (Sweden)
William D Hendricks
Full Text Available Although much is known about how circadian systems control daily cycles in the physiology and behavior of Drosophila and several vertebrate models, marine invertebrates have often been overlooked in circadian rhythms research. This study focuses on the starlet sea anemone, Nematostella vectensis, a species that has received increasing attention within the scientific community for its potential as a model research organism. The recently sequenced genome of N. vectensis makes it an especially attractive model for exploring the molecular evolution of circadian behavior. Critical behavioral data needed to correlate gene expression patterns to specific behaviors are currently lacking in N. vectensis.To detect the presence of behavioral oscillations in N. vectensis, locomotor activity was evaluated using an automated system in an environmentally controlled chamber. Animals exposed to a 24 hr photoperiod (12 hr light: 12 hr dark exhibited locomotor behavior that was both rhythmic and predominantly nocturnal. The activity peak occurred in the early half of the night with a 2-fold increase in locomotion. Upon transfer to constant lighting conditions (constant light or constant dark, an approximately 24 hr rhythm persisted in most animals, suggesting that the rhythm is controlled by an endogenous circadian mechanism. Fourier analysis revealed the presence of multiple peaks in some animals suggesting additional rhythmic components could be present. In particular, an approximately 12 hr oscillation was often observed. The nocturnal increase in generalized locomotion corresponded to a 24 hr oscillation in animal elongation.These data confirm the presence of a light-entrainable circadian clock in Nematostella vectensis. Additional components observed in some individuals indicate that an endogenous clock of approximately 12 hr frequency may also be present. By describing rhythmic locomotor behavior in N. vectensis, we have made important progress in developing
Williams, R.B.
2003-01-01
The locomotory behaviour and functional morphology of English populations of a small (<2 cm long), burrowing athenarian sea anemone, Nematostella vectensis Stephenson, 1935 (= N. pellucida Crowell, 1946), which lives in soft mud in salt marshes and creeks, are described. Objectives were to ascertain
Directory of Open Access Journals (Sweden)
Aldine R. Amiel
2015-12-01
Full Text Available Cnidarians, the extant sister group to bilateria, are well known for their impressive regenerative capacity. The sea anemone Nematostella vectensis is a well-established system for the study of development and evolution that is receiving increased attention for its regenerative capacity. Nematostella is able to regrow missing body parts within five to six days after its bisection, yet studies describing the morphological, cellular, and molecular events underlying this process are sparse and very heterogeneous in their experimental approaches. In this study, we lay down the basic framework to study oral regeneration in Nematostella vectensis. Using various imaging and staining techniques we characterize in detail the morphological, cellular, and global molecular events that define specific landmarks of this process. Furthermore, we describe in vivo assays to evaluate wound healing success and the initiation of pharynx reformation. Using our described landmarks for regeneration and in vivo assays, we analyze the effects of perturbing either transcription or cellular proliferation on the regenerative process. Interestingly, neither one of these experimental perturbations has major effects on wound closure, although they slightly delay or partially block it. We further show that while the inhibition of transcription blocks regeneration in a very early step, inhibiting cellular proliferation only affects later events such as pharynx reformation and tentacle elongation.
Directory of Open Access Journals (Sweden)
Botman Daniel
2012-10-01
Full Text Available Abstract Background Spatial gene expression quantification is required for modeling gene regulation in developing organisms. The fruit fly Drosophila melanogaster is the model system most widely applied for spatial gene expression analysis due to its unique embryonic properties: the shape does not change significantly during its early cleavage cycles and most genes are differentially expressed along a straight axis. This system of development is quite exceptional in the animal kingdom. In the sea anemone Nematostella vectensis the embryo changes its shape during early development; there are cell divisions and cell movement, like in most other metazoans. Nematostella is an attractive case study for spatial gene expression since its transparent body wall makes it accessible to various imaging techniques. Findings Our new quantification method produces standardized gene expression profiles from raw or annotated Nematostella in situ hybridizations by measuring the expression intensity along its cell layer. The procedure is based on digital morphologies derived from high-resolution fluorescence pictures. Additionally, complete descriptions of nonsymmetric expression patterns have been constructed by transforming the gene expression images into a three-dimensional representation. Conclusions We created a standard format for gene expression data, which enables quantitative analysis of in situ hybridizations from embryos with various shapes in different developmental stages. The obtained expression profiles are suitable as input for optimization of gene regulatory network models, and for correlation analysis of genes from dissimilar Nematostella morphologies. This approach is potentially applicable to many other metazoan model organisms and may also be suitable for processing data from three-dimensional imaging techniques.
Moran, Yehu; Weinberger, Hagar; Sullivan, James C; Reitzel, Adam M; Finnerty, John R; Gurevitz, Michael
2008-04-01
Gene families, which encode toxins, are found in many poisonous animals, yet there is limited understanding of their evolution at the nucleotide level. The release of the genome draft sequence for the sea anemone Nematostella vectensis enabled a comprehensive study of a gene family whose neurotoxin products affect voltage-gated sodium channels. All gene family members are clustered in a highly repetitive approximately 30-kb genomic region and encode a single toxin, Nv1. These genes exhibit extreme conservation at the nucleotide level which cannot be explained by purifying selection. This conservation greatly differs from the toxin gene families of other animals (e.g., snakes, scorpions, and cone snails), whose evolution was driven by diversifying selection, thereby generating a high degree of genetic diversity. The low nucleotide diversity at the Nv1 genes is reminiscent of that reported for DNA encoding ribosomal RNA (rDNA) and 2 hsp70 genes from Drosophila, which have evolved via concerted evolution. This evolutionary pattern was experimentally demonstrated in yeast rDNA and was shown to involve unequal crossing-over. Through sequence analysis of toxin genes from multiple N. vectensis populations and 2 other anemone species, Anemonia viridis and Actinia equina, we observed that the toxin genes for each sea anemone species are more similar to one another than to those of other species, suggesting they evolved by manner of concerted evolution. Furthermore, in 2 of the species (A. viridis and A. equina) we found genes that evolved under diversifying selection, suggesting that concerted evolution and accelerated evolution may occur simultaneously.
Moran, Yehu; Genikhovich, Grigory; Gordon, Dalia; Wienkoop, Stefanie; Zenkert, Claudia; Özbek, Suat; Technau, Ulrich; Gurevitz, Michael
2011-01-01
Jellyfish, hydras, corals and sea anemones (phylum Cnidaria) are known for their venomous stinging cells, nematocytes, used for prey and defence. Here we show, however, that the potent Type I neurotoxin of the sea anemone Nematostella vectensis, Nv1, is confined to ectodermal gland cells rather than nematocytes. We demonstrate massive Nv1 secretion upon encounter with a crustacean prey. Concomitant discharge of nematocysts probably pierces the prey, expediting toxin penetration. Toxin efficie...
Moran, Yehu; Genikhovich, Grigory; Gordon, Dalia; Wienkoop, Stefanie; Zenkert, Claudia; Ozbek, Suat; Technau, Ulrich; Gurevitz, Michael
2012-04-07
Jellyfish, hydras, corals and sea anemones (phylum Cnidaria) are known for their venomous stinging cells, nematocytes, used for prey and defence. Here we show, however, that the potent Type I neurotoxin of the sea anemone Nematostella vectensis, Nv1, is confined to ectodermal gland cells rather than nematocytes. We demonstrate massive Nv1 secretion upon encounter with a crustacean prey. Concomitant discharge of nematocysts probably pierces the prey, expediting toxin penetration. Toxin efficiency in sea water is further demonstrated by the rapid paralysis of fish or crustacean larvae upon application of recombinant Nv1 into their medium. Analysis of other anemone species reveals that in Anthopleura elegantissima, Type I neurotoxins also appear in gland cells, whereas in the common species Anemonia viridis, Type I toxins are localized to both nematocytes and ectodermal gland cells. The nematocyte-based and gland cell-based envenomation mechanisms may reflect substantial differences in the ecology and feeding habits of sea anemone species. Overall, the immunolocalization of neurotoxins to gland cells changes the common view in the literature that sea anemone neurotoxins are produced and delivered only by stinging nematocytes, and raises the possibility that this toxin-secretion mechanism is an ancestral evolutionary state of the venom delivery machinery in sea anemones.
Cadherin-23 may be dynamic in hair bundles of the model sea anemone Nematostella vectensis.
Directory of Open Access Journals (Sweden)
Pei-Ciao Tang
Full Text Available Cadherin 23 (CDH23, a component of tip links in hair cells of vertebrate animals, is essential to mechanotransduction by hair cells in the inner ear. A homolog of CDH23 occurs in hair bundles of sea anemones. Anemone hair bundles are located on the tentacles where they detect the swimming movements of nearby prey. The anemone CDH23 is predicted to be a large polypeptide featuring a short exoplasmic C-terminal domain that is unique to sea anemones. Experimentally masking this domain with antibodies or mimicking this domain with free peptide rapidly disrupts mechanotransduction and morphology of anemone hair bundles. The loss of normal morphology is accompanied, or followed by a decrease in F-actin in stereocilia of the hair bundles. These effects were observed at very low concentrations of the reagents, 0.1-10 nM, and within minutes of exposure. The results presented herein suggest that: (1 the interaction between CDH23 and molecular partners on stereocilia of hair bundles is dynamic and; (2 the interaction is crucial for normal mechanotransduction and morphology of hair bundles.
Energy Technology Data Exchange (ETDEWEB)
Ebchuqin, Eerdundagula; Yokota, Naoto; Yamada, Lixy [Sugashima Marine Biological Laboratory, Graduate School of Science, Nagoya University, Sugashima, Toba 517-0004 (Japan); Yasuoka, Yuuri [Marine Genomics Unit, Okinawa Institute of Science and Technology, Onna, Okinawa 904-0495 (Japan); Akasaka, Mari [Laboratory of Molecular Genetics, Graduate School of Science, Nagoya University, Chikusa-ku, Furo-cho, Nagoya 464-8602 (Japan); Arakawa, Mio; Deguchi, Ryusaku [Department of Biology, Miyagi University of Education, Sendai, Miyagi 980-0845 (Japan); Mori, Toshiyuki [Waseda Institute for Advanced Study, Waseda University, Shinjuku, Tokyo 169-8050 (Japan); Sawada, Hitoshi, E-mail: hsawada@bio.nagoya-u.ac.jp [Sugashima Marine Biological Laboratory, Graduate School of Science, Nagoya University, Sugashima, Toba 517-0004 (Japan)
2014-09-05
Highlights: • GCS1 is a sperm transmembrane protein that is essential for gamete fusion in flowering plants. • The GCS1 gene is present not only in angiosperms but also in unicellular organisms and animals. • NvGCS1 gene is expressed in the testis and GCS1 protein exists in sperm of a sea anemone. • Anti-GCS1 antibodies inhibited the fertilization, showing the participation in fertilization. - Abstract: It has been reported that GCS1 (Generative Cell Specific 1) is a transmembrane protein that is exclusively expressed in sperm cells and is essential for gamete fusion in flowering plants. The GCS1 gene is present not only in angiosperms but also in unicellular organisms and animals, implying the occurrence of a common or ancestral mechanism of GCS1-mediated gamete fusion. In order to elucidate the common mechanism, we investigated the role of GCS1 in animal fertilization using a sea anemone (Cnidaria), Nematostella vectensis. Although the existence of the GCS1 gene in N. vectensis has been reported, the expression of GCS1 in sperm and the role of GCS1 in fertilization are not known. In this study, we showed that the GCS1 gene is expressed in the testis and that GCS1 protein exists in sperm by in situ hybridization and proteomic analysis, respectively. Then we made four peptide antibodies against the N-terminal extracellular region of NvGCS1. These antibodies specifically reacted to NvGCS1 among sperm proteins on the basis of Western analysis and potently inhibited fertilization in a concentration-dependent manner. These results indicate that sperm GCS1 plays a pivotal role in fertilization, most probably in sperm–egg fusion, in a starlet sea anemone, suggesting a common gamete-fusion mechanism shared by eukaryotic organisms.
Comprehensive EST analysis of the symbiotic sea anemone, Anemonia viridis.
Sabourault, Cécile; Ganot, Philippe; Deleury, Emeline; Allemand, Denis; Furla, Paola
2009-07-23
Coral reef ecosystems are renowned for their diversity and beauty. Their immense ecological success is due to a symbiotic association between cnidarian hosts and unicellular dinoflagellate algae, known as zooxanthellae. These algae are photosynthetic and the cnidarian-zooxanthellae association is based on nutritional exchanges. Maintenance of such an intimate cellular partnership involves many crosstalks between the partners. To better characterize symbiotic relationships between a cnidarian host and its dinoflagellate symbionts, we conducted a large-scale EST study on a symbiotic sea anemone, Anemonia viridis, in which the two tissue layers (epiderm and gastroderm) can be easily separated. A single cDNA library was constructed from symbiotic tissue of sea anemones A. viridis in various environmental conditions (both normal and stressed). We generated 39,939 high quality ESTs, which were assembled into 14,504 unique sequences (UniSeqs). Sequences were analysed and sorted according to their putative origin (animal, algal or bacterial). We identified many new repeated elements in the 3'UTR of most animal genes, suggesting that these elements potentially have a biological role, especially with respect to gene expression regulation. We identified genes of animal origin that have no homolog in the non-symbiotic starlet sea anemone Nematostella vectensis genome, but in other symbiotic cnidarians, and may therefore be involved in the symbiosis relationship in A. viridis. Comparison of protein domain occurrence in A. viridis with that in N. vectensis demonstrated an increase in abundance of some molecular functions, such as protein binding or antioxidant activity, suggesting that these functions are essential for the symbiotic state and may be specific adaptations. This large dataset of sequences provides a valuable resource for future studies on symbiotic interactions in Cnidaria. The comparison with the closest available genome, the sea anemone N. vectensis, as well as
Comprehensive EST analysis of the symbiotic sea anemone, Anemonia viridis
Directory of Open Access Journals (Sweden)
Deleury Emeline
2009-07-01
Full Text Available Abstract Background Coral reef ecosystems are renowned for their diversity and beauty. Their immense ecological success is due to a symbiotic association between cnidarian hosts and unicellular dinoflagellate algae, known as zooxanthellae. These algae are photosynthetic and the cnidarian-zooxanthellae association is based on nutritional exchanges. Maintenance of such an intimate cellular partnership involves many crosstalks between the partners. To better characterize symbiotic relationships between a cnidarian host and its dinoflagellate symbionts, we conducted a large-scale EST study on a symbiotic sea anemone, Anemonia viridis, in which the two tissue layers (epiderm and gastroderm can be easily separated. Results A single cDNA library was constructed from symbiotic tissue of sea anemones A. viridis in various environmental conditions (both normal and stressed. We generated 39,939 high quality ESTs, which were assembled into 14,504 unique sequences (UniSeqs. Sequences were analysed and sorted according to their putative origin (animal, algal or bacterial. We identified many new repeated elements in the 3'UTR of most animal genes, suggesting that these elements potentially have a biological role, especially with respect to gene expression regulation. We identified genes of animal origin that have no homolog in the non-symbiotic starlet sea anemone Nematostella vectensis genome, but in other symbiotic cnidarians, and may therefore be involved in the symbiosis relationship in A. viridis. Comparison of protein domain occurrence in A. viridis with that in N. vectensis demonstrated an increase in abundance of some molecular functions, such as protein binding or antioxidant activity, suggesting that these functions are essential for the symbiotic state and may be specific adaptations. Conclusion This large dataset of sequences provides a valuable resource for future studies on symbiotic interactions in Cnidaria. The comparison with the closest
Nicosia, Aldo; Bennici, Carmelo; Biondo, Girolama; Costa, Salvatore; Di Natale, Marilena; Masullo, Tiziana; Monastero, Calogera; Ragusa, Maria Antonietta; Tagliavia, Marcello; Cuttitta, Angela
2018-01-11
Gene family encoding translationally controlled tumour protein (TCTP) is defined as highly conserved among organisms; however, there is limited knowledge of non-bilateria. In this study, the first TCTP homologue from anthozoan was characterised in the Mediterranean Sea anemone, Anemonia viridis . The release of the genome sequence of Acropora digitifera , Exaiptasia pallida , Nematostella vectensis and Hydra vulgaris enabled a comprehensive study of the molecular evolution of TCTP family among cnidarians. A comparison among TCTP members from Cnidaria and Bilateria showed conserved intron exon organization, evolutionary conserved TCTP signatures and 3D protein structure. The pattern of mRNA expression profile was also defined in A. viridis . These analyses revealed a constitutive mRNA expression especially in tissues with active proliferation. Additionally, the transcriptional profile of A. viridis TCTP ( AvTCTP ) after challenges with different abiotic/biotic stresses showed induction by extreme temperatures, heavy metals exposure and immune stimulation. These results suggest the involvement of AvTCTP in the sea anemone defensome taking part in environmental stress and immune responses.
Directory of Open Access Journals (Sweden)
Aldo Nicosia
2018-01-01
Full Text Available Gene family encoding translationally controlled tumour protein (TCTP is defined as highly conserved among organisms; however, there is limited knowledge of non-bilateria. In this study, the first TCTP homologue from anthozoan was characterised in the Mediterranean Sea anemone, Anemonia viridis. The release of the genome sequence of Acropora digitifera, Exaiptasia pallida, Nematostella vectensis and Hydra vulgaris enabled a comprehensive study of the molecular evolution of TCTP family among cnidarians. A comparison among TCTP members from Cnidaria and Bilateria showed conserved intron exon organization, evolutionary conserved TCTP signatures and 3D protein structure. The pattern of mRNA expression profile was also defined in A. viridis. These analyses revealed a constitutive mRNA expression especially in tissues with active proliferation. Additionally, the transcriptional profile of A. viridis TCTP (AvTCTP after challenges with different abiotic/biotic stresses showed induction by extreme temperatures, heavy metals exposure and immune stimulation. These results suggest the involvement of AvTCTP in the sea anemone defensome taking part in environmental stress and immune responses.
MODIFICATION OF SEA ANEMONE BEHAVIOR BY SYMBIOTIC ZOOXANTHELLAE: PHOTOTAXIS.
Pearse, Vicki Buchsbaum
1974-12-01
The sea anemone Anthopleura elegantissima, with and without endosymbiotic zooxanthellae, was tested for evidence of phototactic behavior. Anemones with zooxanthellae always displayed phototaxis, either positive or negative depending on the experimental light intensity and the light intensity of the habitat from which the animals were taken. Anemones without zooxanthellae-even those that had previously harbored zooxanthellae and that were genetically identical clone-mates of phototactic individuals-never displayed phototaxis, appearing completely indifferent to light and shade. The results indicate that phototaxis in this sea anemone depends directly on the presence of its symbiotic algae. It is suggested that the flexible phototactic behavior of the anemone may play an important role in favorably regulating the amount of light to which the zooxanthellae are exposed.
Har, Jia Y.; Helbig, Tim; Lim, Ju H.; Fernando, Samodha C.; Reitzel, Adam M.; Penn, Kevin; Thompson, Janelle R.
2015-01-01
We have characterized the molecular and genomic diversity of the microbiota of the starlet sea anemone Nematostella vectensis, a cnidarian model for comparative developmental and functional biology and a year-round inhabitant of temperate salt marshes. Molecular phylogenetic analysis of 16S rRNA gene clone libraries revealed four ribotypes associated with N. vectensis at multiple locations and times. These associates include two novel ribotypes within the ε-Proteobacterial order Campylobacter...
Germ-layer commitment and axis formation in sea anemone embryonic cell aggregates.
Kirillova, Anastasia; Genikhovich, Grigory; Pukhlyakova, Ekaterina; Demilly, Adrien; Kraus, Yulia; Technau, Ulrich
2018-02-20
Robust morphogenetic events are pivotal for animal embryogenesis. However, comparison of the modes of development of different members of a phylum suggests that the spectrum of developmental trajectories accessible for a species might be far broader than can be concluded from the observation of normal development. Here, by using a combination of microsurgery and transgenic reporter gene expression, we show that, facing a new developmental context, the aggregates of dissociated embryonic cells of the sea anemone Nematostella vectensis take an alternative developmental trajectory. The self-organizing aggregates rely on Wnt signals produced by the cells of the original blastopore lip organizer to form body axes but employ morphogenetic events typical for normal development of distantly related cnidarians to re-establish the germ layers. The reaggregated cells show enormous plasticity including the capacity of the ectodermal cells to convert into endoderm. Our results suggest that new developmental trajectories may evolve relatively easily when highly plastic embryonic cells face new constraints. Copyright © 2018 the Author(s). Published by PNAS.
Ectosymbionts of the Sea Anemone Stichodactyla gigantea at Kosrae, Micronesia
Directory of Open Access Journals (Sweden)
Hayes, Floyd E.
2016-04-01
Full Text Available We studied the ectosymbionts associating with the sea anemone Stichodactyla gigantea at Kosrae, Micronesia. Ectosymbionts of seven species associated with 60.7% of S. gigantea (n=28, with a mean of 2.4 per anemone and 3.9 per occupied anemone. Anemones hosting one or more ectosymbionts did not differ significantly in size from anemones lacking ectosymbionts and there was no significant correlation between anemone size and the number of ectosymbionts. Of 67 ectosymbionts observed, the sea cucumber Stichopus vastus comprised 23.9%, followed by the shrimp Thor amboinensis (20.9%, unidentified hermit crabs (Paguroidea; 20.9%, the cardinalfish Ostorhinchus novemfasciatus (20.9%, the shrimp Periclimenes brevicarpalis (9.0%, the sea cucumber Holothuria hilla (3.0%, and an unidentified brachyuran crab (1.5%. This study documents the first records of S. vastus, H. hilla, and O. novemfasciatus associating with S. gigantea, and the first locality records of S. gigantea, T. amboinensis, P. brevicarpalis, and S. vastus for Kosrae. Because humans often harvest S. gigantea for food at Kosrae, we recommend protecting the symbiotic assemblage of S. gigantea by establishing a sustainable system of harvesting.
DNA extraction from sea anemone (Cnidaria: Actiniaria tissues for molecular analyses
Directory of Open Access Journals (Sweden)
Pinto S.M.
2000-01-01
Full Text Available A specific DNA extraction method for sea anemones is described in which extraction of total DNA from eight species of sea anemones and one species of corallimorpharian was achieved by changing the standard extraction protocols. DNA extraction from sea anemone tissue is made more difficult both by the tissue consistency and the presence of symbiotic zooxanthellae. The technique described here is an efficient way to avoid problems of DNA contamination and obtain large amounts of purified and integral DNA which can be used in different kinds of molecular analyses.
Reitzel, Adam M; Daly, Marymegan; Sullivan, James C; Finnerty, John R
2009-02-01
The evolution of parasitism is often accompanied by profound changes to the developmental program. However, relatively few studies have directly examined the developmental evolution of parasitic species from free-living ancestors. The lined sea anemone Edwardsiella lineata is a relatively recently evolved parasite for which closely related free-living outgroups are known, including the starlet sea anemone Nematostella vectensis. The larva of E. lineata parasitizes the ctenophore Mnemiopsis leidyi, and, once embedded in its host, the anemone assumes a novel vermiform body plan. That we might begin to understand how the developmental program of this species has been transformed during the evolution of parasitism, we characterized the gross anatomy, histology, and cnidom of the parasitic stage, post-parasitic larval stage, and adult stage of the E. lineata life cycle. The distinct parasitic stage of the life cycle differs from the post-parasitic larva with respect to overall shape, external ciliation, cnida frequency, and tissue architecture. The parasitic stage and planula both contain holotrichs, a type of cnida not previously reported in Edwardsiidae. The internal morphology of the post-parasitic planula is extremely similar to the adult morphology, with a complete set of mesenterial tissue and musculature despite this stage having little external differentiation. Finally, we observed 2 previously undocumented aspects of asexual reproduction in E. lineata: (1) the parasitic stage undergoes transverse fission via physal pinching, the first report of asexual reproduction in a pre-adult stage in the Edwardsiidae; and (2) the juvenile polyp undergoes transverse fission via polarity reversal, the first time this form of fission has been reported in E. lineata.
Molecular cloning of a peptidylglycine alpha-hydroxylating monooxygenase from sea anemones
DEFF Research Database (Denmark)
Hauser, F; Williamson, M; Grimmelikhuijzen, C J
1997-01-01
conserved regions of PHM, we have now cloned a PHM from the sea anemone Calliactis parasitica showing 42% amino acid sequence identity with rat PHM. Among the conserved (identical) amino acid residues are five histidine and one methionine residue, which bind two Cu2+ atoms that are essential for PHM...... activity. No cDNA coding for PAL could be identified, suggesting that sea anemone PAL is coded for by a gene that is different from the sea anemone PHM gene, a situation similar to the one found in insects. This is the first report on the molecular cloning of a cnidarian PHM. Udgivelsesdato: 1997-Dec-18...
RGM regulates BMP-mediated secondary axis formation in the sea anemone Nematostella vectensis.
Leclère, Lucas; Rentzsch, Fabian
2014-12-11
Patterning of the metazoan dorsoventral axis is mediated by a complex interplay of BMP signaling regulators. Repulsive guidance molecule (RGM) is a conserved BMP coreceptor that has not been implicated in axis specification. We show that NvRGM is a key positive regulator of BMP signaling during secondary axis establishment in the cnidarian Nematostella vectensis. NvRGM regulates first the generation and later the shape of a BMP-dependent Smad1/5/8 gradient with peak activity on the side opposite the NvBMP/NvRGM/NvChordin expression domain. Full knockdown of Smad1/5/8 signaling blocks the formation of endodermal structures, the mesenteries, and the establishment of bilateral symmetry, while altering the gradient through partial NvRGM or NvBMP knockdown shifts the boundaries of asymmetric gene expression and the positioning of the mesenteries along the secondary axis. These findings provide insight into the diversification of axis specification mechanisms and identify a previously unrecognized role for RGM in BMP-mediated axial patterning. Copyright © 2014 The Authors. Published by Elsevier Inc. All rights reserved.
MODIFICATION OF SEA ANEMONE BEHAVIOR BY SYMBIOTIC ZOOXANTHELLAE: EXPANSION AND CONTRACTION.
Pearse, Vicki Buchsbaum
1974-12-01
The pattern of expansion and contraction by the sea anemone Anthopleura elegantissima differs in individuals with or without endosymbiotic zooxanthellae. Anemones without zooxanthellae, found in dark habitats, do not regularly expand or contract under changes in light. Anemones with zooxanthellae expand in moderate light and contract in intense light or in darkness, with striking uniformity. However, this behavior does not always depend directly on the presence of zooxanthellae. Anemones that have previously had endosymbiotic zooxanthellae subsequently expand and contract with changes in light in the absence of these algae. Thus, conditioned responses may be involved. It is suggested that expansion and contraction of the anemones may play an important role in favorably regulating the amount of light to which their zooxanthellae are exposed.
Sea anemone Radianthus macrodactylus--a new source of palytoxin.
Mahnir, V M; Kozlovskaya, E P; Kalinovsky, A I
1992-11-01
A very potent non-protein toxin was isolated from the sea anemone Radianthus macrodactylus with the use of chromatography on polytetrafluoroethylene, CM-Sephadex C-25 and by cation and anion exchange HPLC. The toxin was identified as palytoxin by u.v.-, i.r.- and 500 MHz 1H NMR spectroscopy. Its LD50 was 0.74 +/- 0.29 micrograms/kg by i.v. injection into mice. So far, palytoxin has been associated with zoanthids only. The toxin caused the loss of haemoglobin from erythrocytes but only in about 2 hr after the beginning of incubation, which is characteristic for palytoxin from zoanthids. Sea anemone palytoxin was divided into major and minor components by HPLC. The latter proved to be a product of degradation of palytoxin.
Directory of Open Access Journals (Sweden)
Yisrael Schnytzer
2017-01-01
Full Text Available Crabs of the genus Lybia have the remarkable habit of holding a sea anemone in each of their claws. This partnership appears to be obligate, at least on the part of the crab. The present study focuses on Lybia leptochelis from the Red Sea holding anemones of the genus Alicia (family Aliciidae. These anemones have not been found free living, only in association with L. leptochelis. In an attempt to understand how the crabs acquire them, we conducted a series of behavioral experiments and molecular analyses. Laboratory observations showed that the removal of one anemone from a crab induces a “splitting” behavior, whereby the crab tears the remaining anemone into two similar parts, resulting in a complete anemone in each claw after regeneration. Furthermore, when two crabs, one holding anemones and one lacking them, are confronted, the crabs fight, almost always leading to the “theft” of a complete anemone or anemone fragment by the crab without them. Following this, crabs “split” their lone anemone into two. Individuals of Alicia sp. removed from freshly collected L. leptochelis were used for DNA analysis. By employing AFLP (Fluorescence Amplified Fragments Length Polymorphism it was shown that each pair of anemones from a given crab is genetically identical. Furthermore, there is genetic identity between most pairs of anemone held by different crabs, with the others showing slight genetic differences. This is a unique case in which one animal induces asexual reproduction of another, consequently also affecting its genetic diversity.
Hoeksema, B.; Crowther, A.L.
2011-01-01
Phyllodiscus semoni is a morphologically variable sea anemone species from the Indo-Pacific with morphotypes ranging from upright and branched to low-lying and rounded. The apparent camouflage strategies of this sea anemone allow it to resemble other species or objects in its environment, such as
Chi, Sylvia Ighem; Urbarova, Ilona; Johansen, Steinar D
2018-04-30
The mitochondrial genomes of sea anemones are dynamic in structure. Invasion by genetic elements, such as self-catalytic group I introns or insertion-like sequences, contribute to sea anemone mitochondrial genome expansion and complexity. By using next generation sequencing we investigated the complete mtDNAs and corresponding transcriptomes of the temperate sea anemone Anemonia viridis and its closer tropical relative Anemonia majano. Two versions of fused homing endonuclease gene (HEG) organization were observed among the Actiniidae sea anemones; in-frame gene fusion and pseudo-gene fusion. We provided support for the pseudo-gene fusion organization in Anemonia species, resulting in a repressed HEG from the COI-884 group I intron. orfA, a putative protein-coding gene with insertion-like features, was present in both Anemonia species. Interestingly, orfA and COI expression were significantly up-regulated upon long-term environmental stress corresponding to low seawater pH conditions. This study provides new insights to the dynamics of sea anemone mitochondrial genome structure and function. Copyright © 2018 Elsevier B.V. All rights reserved.
Repair of traumatized mammalian hair cells via sea anemone repair proteins.
Tang, Pei-Ciao; Smith, Karen Müller; Watson, Glen M
2016-08-01
Mammalian hair cells possess only a limited ability to repair damage after trauma. In contrast, sea anemones show a marked capability to repair damaged hair bundles by means of secreted repair proteins (RPs). Previously, it was found that recovery of traumatized hair cells in blind cavefish was enhanced by anemone-derived RPs; therefore, the ability of anemone RPs to assist recovery of damaged hair cells in mammals was tested here. After a 1 h incubation in RP-enriched culture media, uptake of FM1-43 by experimentally traumatized murine cochlear hair cells was restored to levels comparable to those exhibited by healthy controls. In addition, RP-treated explants had significantly more normally structured hair bundles than time-matched traumatized control explants. Collectively, these results indicate that anemone-derived RPs assist in restoring normal function and structure of experimentally traumatized hair cells of the mouse cochlea. © 2016. Published by The Company of Biologists Ltd.
Directory of Open Access Journals (Sweden)
Z. DURIS
2013-10-01
Full Text Available Three anemone-associated decapod crustaceans, two shrimp species, Periclimenes amethysteus and P. aegylios (Caridea: Palaemonidae: Pontoniinae, and the crab Inachus phalangium (Brachyura: Inachidae, all collected from the Dardanelles, are reported for the first time from Turkish coasts. Another inachid crab, Macropodia czernjawskii is also reported for the first time to occur in association with the sea anemone, Anemonia viridis. Periclimenes scriptus was the fifth decapod species recorded associated with sea anemones within the present study, and while this species has already been reported from Turkish waters, this is the first time it is recorded from the Dardanelles (the Turkish Straits System.
Chadwick, Nanette E
1987-08-01
Corallimorpharians are sessile cnidarians that are morphologically similar to the actiniarian sea anemones and scleractinian corals. This study describes for the first time the behavioral mechanism and effects of aggression by a corallimorpharian. Polyps of the temperate clonal corallimorpharian Corynactis californica extruded their mesenteries and associated filaments onto members of certain species of sea anemones and corals. They did not exhibit this behavior intraspecifically, and members of different clones of C. californica remained expanded upon contact. In contrast, members of four species of corals and zoanthids responded to contact with C. californica by contracting their tentacles, and members of three sea anemone species bent or moved away, detached from the substrate, or attacked using their aggressive structures. When interspecific contact was prolonged, individuals of C. californica extruded filaments onto, and killed polyps of, the sea anemones Anthopleura elegantissima and Metridium senile within 3 weeks, and the corals Astrangia lajollaensis and Balanophyllia elegans within 4-10 months under laboratory conditions. The use of extruded mesenterial filaments by C. californica to attack members of other anthozoan species is similar to the aggressive behavior exhibited by many scleractinian reef corals. Field observations suggest that C. californica may use this agonistic behavior during interspecific competition for space on hard marine substrate.
DEFF Research Database (Denmark)
Arvedlund, Michael; Iwao, Kenji; Brolund, Thea Marie
2006-01-01
each) of the juvenile wrasse Thalassoma amblycephalum dwelling among the tentacles of the two sea anemones Entacmaea quadricolor (clonal type), and Heteractis magnifica at a coral reef in southern Japan during 16 months in daylight hours. There are only two past records of this facultative association......, one from east Africa and one from Indonesia. The wrasse remained close to and was occasionally in physical contact with the host when foraging amongst the tentacles. When frightened, they took shelter among corals, away from the host anemone. The wrasse co-existed with the anemonefishes Amphiprion...
Gatins, Remy
2016-10-08
Relatively few studies have investigated the genetic population structure of sea anemones. This is particularly true for sea anemones that host some of the most iconic fishes on coral reefs, the anemonefishes. One of the main reasons for this knowledge gap is the lack of appropriate genetic markers. We developed and characterized a total of 47 novel polymorphic microsatellite markers for four host sea anemone species from the Indo-Pacific: Entacmaea quadricolor (n = 16 microsatellite markers), Heteractis magnifica (n = 8), Stichodactyla mertensii (n = 13), and Stichodactyla gigantea (n = 10). Here, we report genetic diversity statistics from two different sampling locations for each anemone species. Overall, we found that most markers were highly polymorphic. On average, we found a mean of seven alleles per locus. Observed and expected heterozygosities displayed high variation among loci, ranging from 0.033 to 0.980 and from 0.038 to 0.927, respectively. Only four loci showed deviations of Hardy–Weinberg equilibrium in both populations and were identified as having null alleles. Additionally, two pairs of loci were identified to be in linkage disequilibrium in only one population. Host anemones are highly sought after in the marine aquarium trade and are susceptible to thermal bleaching. Although most studies focus on their obligate symbionts (the anemonefish), genetic analyses of host sea anemones can expand our understanding of the biology, connectivity, and population structure of these organisms and potentially help develop conservation strategies that will aid both the host and its symbionts.
Gatins, Remy; Saenz-Agudelo, Pablo; Scott, Anna; Berumen, Michael L.
2016-01-01
Relatively few studies have investigated the genetic population structure of sea anemones. This is particularly true for sea anemones that host some of the most iconic fishes on coral reefs, the anemonefishes. One of the main reasons for this knowledge gap is the lack of appropriate genetic markers. We developed and characterized a total of 47 novel polymorphic microsatellite markers for four host sea anemone species from the Indo-Pacific: Entacmaea quadricolor (n = 16 microsatellite markers), Heteractis magnifica (n = 8), Stichodactyla mertensii (n = 13), and Stichodactyla gigantea (n = 10). Here, we report genetic diversity statistics from two different sampling locations for each anemone species. Overall, we found that most markers were highly polymorphic. On average, we found a mean of seven alleles per locus. Observed and expected heterozygosities displayed high variation among loci, ranging from 0.033 to 0.980 and from 0.038 to 0.927, respectively. Only four loci showed deviations of Hardy–Weinberg equilibrium in both populations and were identified as having null alleles. Additionally, two pairs of loci were identified to be in linkage disequilibrium in only one population. Host anemones are highly sought after in the marine aquarium trade and are susceptible to thermal bleaching. Although most studies focus on their obligate symbionts (the anemonefish), genetic analyses of host sea anemones can expand our understanding of the biology, connectivity, and population structure of these organisms and potentially help develop conservation strategies that will aid both the host and its symbionts.
Digestion rates of prey eaten by intertidal sea anemones from the ...
African Journals Online (AJOL)
Digestion rates were determined for natural prey items offered to each of seven species of sea anemones found at Wooley's Pool in False Say and to the single species (Bunodactis reynaudl) recorded at Siouberg on the Atlantic coast of the south-western Cape, South Africa.This was done by examining prey items removed ...
Directory of Open Access Journals (Sweden)
Anna Scott
Full Text Available Anemonefishes and their host sea anemones form an iconic symbiotic association in reef environments, and are highly sought after in the marine aquarium trade. This study examines asexual propagation as a method for culturing a geographically widespread and commonly traded species of host sea anemone, Entacmaea quadricolor. Two experiments were done: the first to establish whether size or colour morph influenced survival after cutting into halves or quarters; and the second to see whether feeding was needed to maximise survival and growth after cutting. Survival rates were high in both experiments, with 89.3 and 93.8% of the anemones cut in half, and 62.5 and 80.4% cut in quarters surviving in experiments 1 and 2, respectively. Anemones that were cut in half were larger in size, and healed and grew quicker than those cut in quarters. However, even though survival was lower when the individuals were cut in quarters, this treatment produced the greatest number of anemones. Feeding increased oral disc diameter growth and reduced wet weight loss, but did not significantly influence pedal disc diameter. Given that the anemones took up to 56 d to form an off-centre mouth, it is highly likely that feeding may have produced greater effect if the experiment was run for longer. This low technology method of propagation could be used to produce individuals throughout the year and the anemones could then be used to supply the aquarium trade or restock depleted habitats, thus supporting biodiversity conservation in coral reef areas.
Scott, Anna; Hardefeldt, Jannah M; Hall, Karina C
2014-01-01
Anemonefishes and their host sea anemones form an iconic symbiotic association in reef environments, and are highly sought after in the marine aquarium trade. This study examines asexual propagation as a method for culturing a geographically widespread and commonly traded species of host sea anemone, Entacmaea quadricolor. Two experiments were done: the first to establish whether size or colour morph influenced survival after cutting into halves or quarters; and the second to see whether feeding was needed to maximise survival and growth after cutting. Survival rates were high in both experiments, with 89.3 and 93.8% of the anemones cut in half, and 62.5 and 80.4% cut in quarters surviving in experiments 1 and 2, respectively. Anemones that were cut in half were larger in size, and healed and grew quicker than those cut in quarters. However, even though survival was lower when the individuals were cut in quarters, this treatment produced the greatest number of anemones. Feeding increased oral disc diameter growth and reduced wet weight loss, but did not significantly influence pedal disc diameter. Given that the anemones took up to 56 d to form an off-centre mouth, it is highly likely that feeding may have produced greater effect if the experiment was run for longer. This low technology method of propagation could be used to produce individuals throughout the year and the anemones could then be used to supply the aquarium trade or restock depleted habitats, thus supporting biodiversity conservation in coral reef areas.
Expanded functional diversity of shaker K(+ channels in cnidarians is driven by gene expansion.
Directory of Open Access Journals (Sweden)
Timothy Jegla
Full Text Available The genome of the cnidarian Nematostella vectensis (starlet sea anemone provides a molecular genetic view into the first nervous systems, which appeared in a late common ancestor of cnidarians and bilaterians. Nematostella has a surprisingly large and diverse set of neuronal signaling genes including paralogs of most neuronal signaling molecules found in higher metazoans. Several ion channel gene families are highly expanded in the sea anemone, including three subfamilies of the Shaker K(+ channel gene family: Shaker (Kv1, Shaw (Kv3 and Shal (Kv4. In order to better understand the physiological significance of these voltage-gated K(+ channel expansions, we analyzed the function of 18 members of the 20 gene Shaker subfamily in Nematostella. Six of the Nematostella Shaker genes express functional homotetrameric K(+ channels in vitro. These include functional orthologs of bilaterian Shakers and channels with an unusually high threshold for voltage activation. We identified 11 Nematostella Shaker genes with a distinct "silent" or "regulatory" phenotype; these encode subunits that function only in heteromeric channels and serve to further diversify Nematostella Shaker channel gating properties. Subunits with the regulatory phenotype have not previously been found in the Shaker subfamily, but have evolved independently in the Shab (Kv2 family in vertebrates and the Shal family in a cnidarian. Phylogenetic analysis indicates that regulatory subunits were present in ancestral cnidarians, but have continued to diversity at a high rate after the split between anthozoans and hydrozoans. Comparison of Shaker family gene complements from diverse metazoan species reveals frequent, large scale duplication has produced highly unique sets of Shaker channels in the major metazoan lineages.
Moran, Yehu; Cohen, Lior; Kahn, Roy; Karbat, Izhar; Gordon, Dalia; Gurevitz, Michael
2006-07-25
Type I sea anemone toxins are highly potent modulators of voltage-gated Na-channels (Na(v)s) and compete with the structurally dissimilar scorpion alpha-toxins on binding to receptor site-3. Although these features provide two structurally different probes for studying receptor site-3 and channel fast inactivation, the bioactive surface of sea anemone toxins has not been fully resolved. We established an efficient expression system for Av2 (known as ATX II), a highly insecticidal sea anemone toxin from Anemonia viridis (previously named A. sulcata), and mutagenized it throughout. Each toxin mutant was analyzed in toxicity and binding assays as well as by circular dichroism spectroscopy to discern the effects derived from structural perturbation from those related to bioactivity. Six residues were found to constitute the anti-insect bioactive surface of Av2 (Val-2, Leu-5, Asn-16, Leu-18, and Ile-41). Further analysis of nine Av2 mutants on the human heart channel Na(v)1.5 expressed in Xenopus oocytes indicated that the bioactive surfaces toward insects and mammals practically coincide but differ from the bioactive surface of a structurally similar sea anemone toxin, Anthopleurin B, from Anthopleura xanthogrammica. Hence, our results not only demonstrate clear differences in the bioactive surfaces of Av2 and scorpion alpha-toxins but also indicate that despite the general conservation in structure and importance of the Arg-14 loop and its flanking residues Gly-10 and Gly-20 for function, the surface of interaction between different sea anemone toxins and Na(v)s varies.
International Nuclear Information System (INIS)
Mitchelmore, Carys L.; Alan Verde, E.; Ringwood, Amy H.; Weis, Virginia M.
2003-01-01
The accumulation of metals by the North American Pacific Coast temperate sea anemone Anthopleura elegantissima, and its dinoflagellate-algal symbiont Symbiodinium muscatinei was examined following laboratory metal exposures. Both, naturally occurring symbiotic and symbiont-free (aposymbiotic) anemones were used in this study to investigate differences in metal uptake due to the symbiotic state of the animal. The effects of metal exposures on the anemone-algal symbiosis were determined using measures of algal cell density and mitotic index (MI). Anemones were exposed to either cadmium, copper, nickel or zinc chloride (0, 10, 100 μg l -1 for Cd, Cu and Ni; 0, 100, 1000 μg l -1 for Zn) for 42 days followed by a 42-day recovery period in ambient seawater. Anemones were analyzed for metal content using inductively coupled plasma mass spectroscopy (ICP-MS) at various time points during the study. Symbiotic anemones accumulated Cd, Ni and Zn to a greater extent than aposymbiotic anemones. A dramatically different pattern of Cu accumulation was observed, with aposymbiotic anemones accumulating higher levels than symbiotic anemones. Following recovery in ambient seawater, all tissue metal levels were reduced to near pre-exposure control levels in most cases. No changes in algal cell density or MI were observed in symbiotic anemone tentacle clips at any dose or time point in the Cd and Cu exposures. However, significant reductions in algal cell densities were observed in the Ni-exposed and some Zn-exposed animals, although levels returned to control values following recovery. There were no changes in mitotic index (MI) following Ni or Zn exposures. These results demonstrate that the extent of heavy metal accumulation depends upon cnidarian symbiotic state and the heavy metal in question
Directory of Open Access Journals (Sweden)
S. LANDMANN
2015-02-01
Full Text Available We studied the adaptation of the spider crab Inachus phalangium (Fabricius, 1755 to one of its sea anemone host species, Anemonia viridis (Forsskål, 1775 in the coastal region of Rovinj, Croatia. Similar to other brachyuran species, Inachus spp. generally lives within the anemone to obtain protection from possible predators. Using removal and reintroduction experiments, this study investigates the protection mechanism and shows a loss of adaptation after a period of 10 days when the crabs are taken out of their host and kept solitary. Thirty-nine anemones from two different trial sites were marked individually and the inhabiting crabs were isolated to be released back into their individual hosts later. The reactions of the anemones were closely observed and characterized to determine the respective state of crab adaptation. As 35 out of 39 individuals provoked a defense /attack reaction of the anemone, it is concluded that the crabs possessed some sort of non-permanent protection mechanism that was lost during the test run (chi-square test, p < 0.00014. All tested crabs re-inhabited their host anemones within a maximum of 20 minutes after they had been reintroduced and stung by the anemones. Therefore, habituation to the host’s defense / attack mechanism is acquired individually and not genetically inherent to the species. The results are compared to adaptation and protection data on other decapod crustaceans and some anemonefishes.
Tan, De-Xin; Wang, Yan-Li
2018-03-01
Sea anemone-like palladium (Pd)/polyaniline (PANI) nanocomposites were synthesized via visible-light-assisted swollen liquid crystals (SLCs) template method. The resulting samples were characterized by transmission electron microscopy (TEM), selected area electron diffraction (SAED), energy dispersive spectrometer (EDS), x-ray diffraction (XRD), field emission scanning electron microscopy (FESEM), ultraviolet-visible (UV–vis) absorption spectroscopy and Fourier transform infrared (FT-IR) spectroscopy, respectively. The electrocatalytic properties of Pd/PANI nanocomposites modified glass carbon electrode (GCE) for methane oxidation were investigated by cycle voltammetry (CV) and chronoamperometry. Those dispersed sea anemone-like Pd/PANI nanocomposites had an average diameter of 320 nm. The obtained Pd nanoparticles with an average diameter of about 45 nm were uniformly distributed in PANI matrix. Sea anemone-like Pd/PANI nanocomposites exhibited excellent electrocatalytic activity and stability for oxidation of methane (CH4).
Energy Technology Data Exchange (ETDEWEB)
Chariton Chintiroglou, C. [Thessaloniki, Aristotle Univ. (Greece). Dept. of Zoology
1996-12-31
The present paper is concerned with the structural aspects of Anemonia viridis populations found in the North Aegean Sea. It was found that mean wet weight and density of anemone populations increases with depth and distance from shore. Differences in the structure of the Anemonia viridis populations were attributed both to the specific hydrodynamic characteristics of the biotopes and to a number biotic interactions. From our results and t previous investigations the adoption of three different lifestyles by the anemones was assumed.: (1) a colonial form, with population densities around 650 individuals per m{sup 2}, found in substrates exposed to increased hydrodynamism; (2) a colonial form, with lower densities (90 indiv. per m{sup 2}), found in less exposed sites; (3) finally, large individuals in deeper waters chose a solitary lifestyle, as mechanical stresses were much lower.
Directory of Open Access Journals (Sweden)
Jia Yi Har
2015-09-01
Full Text Available We have characterized the molecular and genomic diversity of the microbiota of the starlet sea anemone Nematostella vectensis, a cnidarian model for comparative developmental and functional biology and a year-round inhabitant of temperate salt marshes. Molecular phylogenetic analysis of 16S rRNA gene clone libraries revealed four ribotypes associated with N. vectensis at multiple locations and times. These associates include two novel ribotypes within the ε-Proteobacterial order Campylobacterales and the Spirochetes, respectively, each sharing 99% 16S rRNA identity with Endozoicomonas elysicola and Pseudomonas oleovorans, respectively. Species-specific PCR revealed that these populations persisted in N. vectensis asexually propagated under laboratory conditions. cDNA indicated expression of the Campylobacterales and Endozoicomonas 16S rRNA in anemones from Sippewissett Marsh, MA. A collection of bacteria from laboratory raised N. vectensis was dominated by isolates from P. oleovorans and Rhizobium radiobacter. Isolates from field-collected anemones revealed an association with Limnobacter and Stappia isolates. Genomic DNA sequencing was carried out on 10 cultured bacterial isolates representing field- and laboratory-associates, i.e. Limnobacter spp., Stappia spp., P. oleovorans and R. radiobacter. Genomes contained multiple genes identified as virulence (host-association factors while S. stellulata and L. thiooxidans genomes revealed pathways for mixotrophic sulfur oxidation. A pilot metatranscriptome of laboratory-raised N. vectensis was compared to the isolate genomes and indicated expression of ORFs from L. thiooxidans with predicted functions of motility, nutrient scavenging (Fe and P, polyhydroxyalkanoate synthesis for carbon storage, and selective permeability (porins. We hypothesize that such activities may mediate acclimation and persistence of bacteria in N. vectensis.
Davy, Simon K; Turner, John R
2003-08-01
The ova of Anthopleura ballii become infected with zooxanthellae (endosymbiotic dinoflagellates) of maternal origin just prior to spawning. After fertilization, the zygotes undergo radial, holoblastic cleavage, and then gastrulate by invagination to form ciliated planulae. Because the zooxanthellae are localized on one side of the ovum-and later, within the blastomeres at one end of the embryo-invagination leads to the zooxanthellae being restricted to the planular endoderm and hence to the gastrodermal cells of the adult anemone. We propose that maternal inheritance of zooxanthellae plays an important part in the success of these temperate sea anemones, which live in regions where potential sources of zooxanthellae are scarce.
Taxonomic, Spatial and Temporal Patterns of Bleaching in Anemones Inhabited by Anemonefishes
Hobbs, Jean-Paul A.
2013-08-08
Background:Rising sea temperatures are causing significant destruction to coral reef ecosystems due to coral mortality from thermally-induced bleaching (loss of symbiotic algae and/or their photosynthetic pigments). Although bleaching has been intensively studied in corals, little is known about the causes and consequences of bleaching in other tropical symbiotic organisms.Methodology/Principal Findings:This study used underwater visual surveys to investigate bleaching in the 10 species of anemones that host anemonefishes. Bleaching was confirmed in seven anemone species (with anecdotal reports of bleaching in the other three species) at 10 of 19 survey locations spanning the Indo-Pacific and Red Sea, indicating that anemone bleaching is taxonomically and geographically widespread. In total, bleaching was observed in 490 of the 13,896 surveyed anemones (3.5%); however, this percentage was much higher (19-100%) during five major bleaching events that were associated with periods of elevated water temperatures and coral bleaching. There was considerable spatial variation in anemone bleaching during most of these events, suggesting that certain sites and deeper waters might act as refuges. Susceptibility to bleaching varied between species, and in some species, bleaching caused reductions in size and abundance.Conclusions/Significance:Anemones are long-lived with low natural mortality, which makes them particularly vulnerable to predicted increases in severity and frequency of bleaching events. Population viability will be severely compromised if anemones and their symbionts cannot acclimate or adapt to rising sea temperatures. Anemone bleaching also has negative effects to other species, particularly those that have an obligate relationship with anemones. These effects include reductions in abundance and reproductive output of anemonefishes. Therefore, the future of these iconic and commercially valuable coral reef fishes is inextricably linked to the ability of host
Taxonomic, Spatial and Temporal Patterns of Bleaching in Anemones Inhabited by Anemonefishes
Hobbs, Jean-Paul A.; Frisch, Ashley J.; Ford, Benjamin M.; Thums, Michele; Saenz Agudelo, Pablo; Furby, Kathryn A.; Berumen, Michael L.
2013-01-01
Background:Rising sea temperatures are causing significant destruction to coral reef ecosystems due to coral mortality from thermally-induced bleaching (loss of symbiotic algae and/or their photosynthetic pigments). Although bleaching has been intensively studied in corals, little is known about the causes and consequences of bleaching in other tropical symbiotic organisms.Methodology/Principal Findings:This study used underwater visual surveys to investigate bleaching in the 10 species of anemones that host anemonefishes. Bleaching was confirmed in seven anemone species (with anecdotal reports of bleaching in the other three species) at 10 of 19 survey locations spanning the Indo-Pacific and Red Sea, indicating that anemone bleaching is taxonomically and geographically widespread. In total, bleaching was observed in 490 of the 13,896 surveyed anemones (3.5%); however, this percentage was much higher (19-100%) during five major bleaching events that were associated with periods of elevated water temperatures and coral bleaching. There was considerable spatial variation in anemone bleaching during most of these events, suggesting that certain sites and deeper waters might act as refuges. Susceptibility to bleaching varied between species, and in some species, bleaching caused reductions in size and abundance.Conclusions/Significance:Anemones are long-lived with low natural mortality, which makes them particularly vulnerable to predicted increases in severity and frequency of bleaching events. Population viability will be severely compromised if anemones and their symbionts cannot acclimate or adapt to rising sea temperatures. Anemone bleaching also has negative effects to other species, particularly those that have an obligate relationship with anemones. These effects include reductions in abundance and reproductive output of anemonefishes. Therefore, the future of these iconic and commercially valuable coral reef fishes is inextricably linked to the ability of host
Catalase characterization and implication in bleaching of a symbiotic sea anemone.
Merle, Pierre-Laurent; Sabourault, Cécile; Richier, Sophie; Allemand, Denis; Furla, Paola
2007-01-15
Symbiotic cnidarians are marine invertebrates harboring photosynthesizing microalgae (named zooxanthellae), which produce great amounts of oxygen and free radicals upon illumination. Studying antioxidative balance is then crucial to understanding how symbiotic cnidarians cope with ROS production. In particular, it is suspected that oxidative stress triggers cnidarian bleaching, i.e., the expulsion of zooxanthellae from the animal host, responsible for symbiotic cnidarian mass mortality worldwide. This study therefore investigates catalase antioxidant enzymes and their role in bleaching of the temperate symbiotic sea anemone Anemonia viridis. Using specific separation of animal tissues (ectoderm and endoderm) from the symbionts (zooxanthellae), spectrophotometric assays and native PAGE revealed both tissue-specific and activity pattern distribution of two catalase electrophoretypes, E1 and E2. E1, expressed in all three tissues, presents high sensitivity to the catalase inhibitor aminotriazole (ATZ) and elevated temperatures. The ectodermal E1 form is responsible for 67% of total catalase activity. The E2 form, expressed only within zooxanthellae and their host endodermal cells, displays low sensitivity to ATZ and relative thermostability. We further cloned an ectodermal catalase, which shares 68% identity with mammalian monofunctional catalases. Last, 6 days of exposure of whole sea anemones to ATZ (0.5 mM) led to effective catalase inhibition and initiated symbiont expulsion. This demonstrates the crucial role of this enzyme in cnidarian bleaching, a phenomenon responsible for worldwide climate-change-induced mass mortalities, with catastrophic consequences for marine biodiversity.
Directory of Open Access Journals (Sweden)
Erwann P. Loret
2018-04-01
Full Text Available Sea anemones are a remarkable source of active principles due to a decentralized venom system. New blood vessel growth or angiogenesis is a very promising target against cancer, but the few available antiangiogenic compounds have limited efficacy. In this study, a protein fraction, purified from tentacles of Anemonia viridis, was able to limit endothelial cells proliferation and angiogenesis at low concentration (14 nM. Protein sequences were determined with Edman degradation and mass spectrometry in source decay and revealed homologies with Blood Depressing Substance (BDS sea anemones. The presence of a two-turn alpha helix observed with circular dichroism and a trypsin activity inhibition suggested that the active principle could be a Kunitz-type inhibitor, which may interact with an integrin due to an Arginine Glycin Aspartate (RGD motif. Molecular modeling showed that this RGD motif was well exposed to solvent. This active principle could improve antiangiogenic therapy from existing antiangiogenic compounds binding on the Vascular Endothelial Growth Factor (VEGF.
Loret, Erwann P; Luis, José; Nuccio, Christopher; Villard, Claude; Mansuelle, Pascal; Lebrun, Régine; Villard, Pierre Henri
2018-04-19
Sea anemones are a remarkable source of active principles due to a decentralized venom system. New blood vessel growth or angiogenesis is a very promising target against cancer, but the few available antiangiogenic compounds have limited efficacy. In this study, a protein fraction, purified from tentacles of Anemonia viridis , was able to limit endothelial cells proliferation and angiogenesis at low concentration (14 nM). Protein sequences were determined with Edman degradation and mass spectrometry in source decay and revealed homologies with Blood Depressing Substance (BDS) sea anemones. The presence of a two-turn alpha helix observed with circular dichroism and a trypsin activity inhibition suggested that the active principle could be a Kunitz-type inhibitor, which may interact with an integrin due to an Arginine Glycin Aspartate (RGD) motif. Molecular modeling showed that this RGD motif was well exposed to solvent. This active principle could improve antiangiogenic therapy from existing antiangiogenic compounds binding on the Vascular Endothelial Growth Factor (VEGF).
Har, Jia Y; Helbig, Tim; Lim, Ju H; Fernando, Samodha C; Reitzel, Adam M; Penn, Kevin; Thompson, Janelle R
2015-01-01
We have characterized the molecular and genomic diversity of the microbiota of the starlet sea anemone Nematostella vectensis, a cnidarian model for comparative developmental and functional biology and a year-round inhabitant of temperate salt marshes. Molecular phylogenetic analysis of 16S rRNA gene clone libraries revealed four ribotypes associated with N. vectensis at multiple locations and times. These associates include two novel ribotypes within the ε-Proteobacterial order Campylobacterales and the Spirochetes, respectively, each sharing 99% 16S rRNA identity with Endozoicomonas elysicola and Pseudomonas oleovorans, respectively. Species-specific PCR revealed that these populations persisted in N. vectensis asexually propagated under laboratory conditions. cDNA indicated expression of the Campylobacterales and Endozoicomonas 16S rRNA in anemones from Sippewissett Marsh, MA. A collection of bacteria from laboratory raised N. vectensis was dominated by isolates from P. oleovorans and Rhizobium radiobacter. Isolates from field-collected anemones revealed an association with Limnobacter and Stappia isolates. Genomic DNA sequencing was carried out on 10 cultured bacterial isolates representing field- and laboratory-associates, i.e., Limnobacter spp., Stappia spp., P. oleovorans and R. radiobacter. Genomes contained multiple genes identified as virulence (host-association) factors while S. stellulata and L. thiooxidans genomes revealed pathways for mixotrophic sulfur oxidation. A pilot metatranscriptome of laboratory-raised N. vectensis was compared to the isolate genomes and indicated expression of ORFs from L. thiooxidans with predicted functions of motility, nutrient scavenging (Fe and P), polyhydroxyalkanoate synthesis for carbon storage, and selective permeability (porins). We hypothesize that such activities may mediate acclimation and persistence of bacteria in a N. vectensis holobiont defined by both internal and external gradients of chemicals and
Molecular characterization of two CuZn-superoxide dismutases in a sea anemone.
Plantivaux, Amandine; Furla, Paola; Zoccola, Didier; Garello, Ginette; Forcioli, Didier; Richier, Sophie; Merle, Pierre-Laurent; Tambutté, Eric; Tambutté, Sylvie; Allemand, Denis
2004-10-15
Cnidarians living in symbiosis with photosynthetic cells--called zooxanthellae--are submitted to high oxygen levels generated by photosynthesis. To cope with this hyperoxic state, symbiotic cnidarians present a high diversity of superoxide dismutases (SOD) isoforms. To understand better the mechanism of resistance of cnidarian hosts to hyperoxia, we studied copper- and zinc-containing SOD (CuZnSOD) from Anemonia viridis, a temperate symbiotic sea anemone. We cloned two CuZnSOD genes that we call AvCuZnSODa and AvCuZnSODb. Their molecular analysis suggests that the AvCuZnSODa transcript encodes an extracellular form of CuZnSOD, whereas the AvCuZnSODb transcript encodes an intracellular form. Using in situ hybridization, we showed that both AvCuZnSODa and AvCuZnSODb transcripts are expressed in the endodermal and ectodermal cells of the sea anemone, but not in the zooxanthellae. The genomic flanking sequences of AvCuZnSODa and AvCuZnSODb revealed different putative binding sites for transcription factors, suggesting different modes of regulation for the two genes. This study represents a first step in the understanding of the molecular mechanisms of host animal resistance to permanent hyperoxia status resulting from the photosynthetic symbiosis. Moreover, AvCuZnSODa and AvCuZnSODb are the first SODs cloned from a diploblastic animal, contributing to the evolutionary understanding of SODs.
DEFF Research Database (Denmark)
Nothacker, H P; Rinehart, K L; Grimmelikhuijzen, C J
1991-01-01
sea anemones. We propose that the L-3-phenyllactyl residue renders Antho-KAamide resistant to nonspecific aminopeptidases, thereby increasing the stability of the neuropeptide after neuronal release. The existence of the L-3-phenyllactyl residue in 3 neuropeptides isolated so far suggests...
Moran, Yehu; Weinberger, Hagar; Lazarus, Nimrod; Gur, Maya; Kahn, Roy; Gordon, Dalia; Gurevitz, Michael
2009-08-01
Sea anemones are sessile predators that use a variety of toxins to paralyze prey and foe. Among these toxins, Types I, II and III are short peptides that affect voltage-gated sodium channels. Anemonia viridis is the only sea anemone species that produces both Types I and III neurotoxin. Although the two toxin types are unrelated in sequence and three-dimensional structure, cloning and comparative analysis of their loci revealed a highly similar sequence at the 5' region, which encodes a signal peptide. This similarity was likely generated by gene fusion and could be advantageous in transcript stability and intracellular trafficking and secretion. In addition, these analyses identified the processed pseudogenes of the two gene families in the genome of A. viridis, probably resulting from retrotransposition events. As presence of processed pseudogenes in the genome requires transcription in germ-line cells, we analyzed oocyte-rich ovaries and found that indeed they contain Types I and III transcripts. This result raises questions regarding the role of toxin transcripts in these tissues. Overall, the retrotransposition and gene fusion events suggest that the genes of both Types I and III neurotoxins evolved in a similar fashion and share a partial common ancestry.
Directory of Open Access Journals (Sweden)
Estefanía Rodríguez
2008-03-01
Full Text Available A second species of the sea anemone genus Isosicyonis is described and illustrated from 16 specimens collected in the Weddell Sea (Antarctica on the Polarstern cruises ANT XVII/3, ANT XXI/2 and ANT XXIII/8. Isosicyonis striata n. sp. is easily distinguishable externally from the other species of the genus Isosicyonis alba by its pattern: white longitudinal stripes on the column, oral disc, and tentacles. It is also distinguished by internal features including the retractor muscles, parietobasilar muscles, marginal sphincter muscles, number of mesenteries, and cnidae. The genus Isosycionis is currently only known from the Southern Ocean. Both species of Isosicyonis live in association with a gastropod, with a single sea anemone occupying almost the whole shell of its gastropod host. The description of this new species, and our re-examination of Isosicyonis alba, resolves the controversial higher taxonomic position of the genus, confirming its placement within the Endomyaria.
Energy Technology Data Exchange (ETDEWEB)
Siddiqui, Samreen; Goddard, Russell H.; Bielmyer-Fraser, Gretchen K., E-mail: gkbielmyer@valdosta.edu
2015-03-15
Highlights: • Differences between CuO NP and CuCl{sub 2} exposure were characterized. • Copper accumulation in E. pallida was concentration-dependent. • E. pallida exposed to CuCl{sub 2} accumulated higher copper tissue burdens. • The oxidative stress response was greater in E. pallida exposed to CuO NP. • Both forms of copper inhibited CA activity in E. pallida. - Abstract: Increasing use of metal oxide nanoparticles (NP) by various industries has resulted in substantial output of these NP into aquatic systems. At elevated concentrations, NP may interact with and potentially affect aquatic organisms. Environmental implications of increased NP use are largely unknown, particularly in marine systems. This research investigated and compared the effects of copper oxide (CuO) NP and dissolved copper, as copper chloride (CuCl{sub 2}), on the sea anemone, Exaiptasia pallida. Sea anemones were collected over 21 days and tissue copper accumulation and activities of the enzymes: catalase, glutathione peroxidase, glutathione reductase, and carbonic anhydrase were quantified. The size and shape of CuO NP were observed using a ecanning electron microscope (SEM) and the presence of copper was confirmed by using Oxford energy dispersive spectroscopy systems (EDS/EDX). E. pallida accumulated copper in their tissues in a concentration- and time-dependent manner, with the animals exposed to CuCl{sub 2} accumulating higher tissue copper burdens than those exposed to CuO NP. As a consequence of increased copper exposure, as CuO NP or CuCl{sub 2}, anemones increased activities of all of the antioxidant enzymes measured to some degree, and decreased the activity of carbonic anhydrase. Anemones exposed to CuO NP generally had higher anti-oxidant enzyme activities than those exposed to the same concentrations of CuCl{sub 2}. This study is useful in discerning differences between CuO NP and dissolved copper exposure and the findings have implications for exposure of aquatic
DEFF Research Database (Denmark)
Vibede, N; Hauser, Frank; Williamson, M
1998-01-01
organization of this sea anemone receptor. The receptor gene contains eight introns that are all localized within a region coding for the large extracellular N terminus. These introns occur at the same positions and have the same intron phasing as eight introns in the genes coding for the mammalian...
Indole Alkaloids from the Sea Anemone Heteractis aurora and Homarine from Octopus cyanea.
Shaker, Kamel H; Göhl, Matthias; Müller, Tobias; Seifert, Karlheinz
2015-11-01
The two new indole alkaloids 2-amino-1,5-dihydro-5-(1H-indol-3-ylmethyl)-4H-imidazol-4-one (1), 2-amino-5-[(6-bromo-1H-indol-3-yl)methyl]-3,5-dihydro-3-methyl-4H-imidazol-4-one (2), and auramine (3) have been isolated from the sea anemone Heteractis aurora. Both indole alkaloids were synthesized for the confirmation of the structures. Homarine (4), along with uracil (5), hypoxanthine (6), and inosine (7) have been obtained from Octopus cyanea. Copyright © 2015 Verlag Helvetica Chimica Acta AG, Zürich.
DEFF Research Database (Denmark)
Nothacker, H P; Grimmelikhuijzen, C J
1993-01-01
hormone (FSH, TSH, LH/CG) receptor family from mammals, including a very large, extracellular N terminus (18-25% sequence identity) and a 7 transmembrane region (44-48% sequence identity). As with the mammalian glycoprotein hormone receptor genes, the sea anemone receptor gene yields transcripts which can...... be alternatively spliced, thereby yielding a shortened receptor variant only containing the large extracellular (soluble) N terminus. All this is strong evidence that the putative glycoprotein hormone receptor from sea anemones is evolutionarily related to those from mammals. This is the first report showing...
Three New Indole Diterpenoids from the Sea-Anemone-Derived Fungus Penicillium sp. AS-79.
Hu, Xue-Yi; Meng, Ling-Hong; Li, Xin; Yang, Sui-Qun; Li, Xiao-Ming; Wang, Bin-Gui
2017-05-12
Three new indolediterpenoids, namely, 22-hydroxylshearinine F ( 1 ), 6-hydroxylpaspalinine ( 2 ), and 7- O -acetylemindole SB ( 3 ), along with eight related known analogs ( 4 - 11 ), were isolated from the sea-anemone-derived fungus Penicillium sp. AS-79. The structures and relative configurations of these compounds were determined by a detailed interpretation of the spectroscopic data, and their absolute configurations were determined by ECD calculations ( 1 and 2 ) and single-crystal X-ray diffraction ( 3 ). Some of these compounds exhibited prominent activity against aquatic and human pathogenic microbes.
Salceda, Emilio; López, Omar; Zaharenko, André J; Garateix, Anoland; Soto, Enrique
2010-03-01
Sea anemone toxins bind to site 3 of the sodium channels, which is partially formed by the extracellular linker connecting S3 and S4 segments of domain IV, slowing down the inactivation process. In this work we have characterized the actions of BcIII, a sea anemone polypeptide toxin isolated from Bunodosoma caissarum, on neuronal sodium currents using the patch clamp technique. Neurons of the dorsal root ganglia of Wistar rats (P5-9) in primary culture were used for this study (n=65). The main effects of BcIII were a concentration-dependent increase in the sodium current inactivation time course (IC(50)=2.8 microM) as well as an increase in the current peak amplitude. BcIII did not modify the voltage at which 50% of the channels are activated or inactivated, nor the reversal potential of sodium current. BcIII shows a voltage-dependent action. A progressive acceleration of sodium current fast inactivation with longer conditioning pulses was observed, which was steeper as more depolarizing were the prepulses. The same was observed for other two anemone toxins (CgNa, from Condylactis gigantea and ATX-II, from Anemonia viridis). These results suggest that the binding affinity of sea anemone toxins may be reduced in a voltage-dependent manner, as has been described for alpha-scorpion toxins. (c) 2009 Elsevier Inc. All rights reserved.
Pore formation by actinoporins, cytolysins from sea anemones.
Rojko, Nejc; Dalla Serra, Mauro; Maček, Peter; Anderluh, Gregor
2016-03-01
Actinoporins (APs) from sea anemones are ~20 kDa pore forming toxins with a β-sandwich structure flanked by two α-helices. The molecular mechanism of APs pore formation is composed of several well-defined steps. APs bind to membrane by interfacial binding site composed of several aromatic amino acid residues that allow binding to phosphatidylcholine and specific recognition of sphingomyelin. Subsequently, the N-terminal α-helix from the β-sandwich has to be inserted into the lipid/water interphase in order to form a functional pore. Functional studies and single molecule imaging revealed that only several monomers, 3-4, oligomerise to form a functional pore. In this model the α-helices and surrounding lipid molecules build toroidal pore. In agreement, AP pores are transient and electrically heterogeneous. On the contrary, crystallized oligomers of actinoporin fragaceatoxin C were found to be composed of eight monomers with no lipids present between the adjacent α-helices. This article is part of a Special Issue entitled: Pore-Forming Toxins edited by Maur Dalla Serra and Franco Gambale. Copyright © 2015 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Sebastian Fraune
2016-08-01
Full Text Available The phenotype of an animal cannot be explained entirely by its genes. It is now clear that factors other than the genome contribute to the ecology and evolution of animals. Two fundamentally important factors are the associated microbiota and epigenetic regulations. Unlike the genes and regulatory regions of the genome, epigenetics and microbial composition can be rapidly modified, and may thus represent mechanisms for rapid acclimation to a changing environment. At present, the individual functions of epigenetics, microbiomes, and genomic mutations are largely studied in isolation, particularly for species in marine ecosystems. This single variable approach leaves significant questions open for how these mechanisms intersect in the acclimation and adaptation of organisms in different environments. Here, we propose that the starlet sea anemone, Nematostella vectensis, is a model of choice to investigate the complex interplay between adaptation as well as physiological and molecular plasticity in coastal ecosystems. N. vectensis’ geographic range spans four distinct coastlines, including a wide thermocline along the Atlantic coast of North America. N. vectensis is a particularly powerful invertebrate model for studying genome-environment interactions due to (1 the availability of a well-annotated genome, including preexisting data on genome methylation, histone modifications and miRNAs, (2 an extensive molecular toolkit including well-developed protocols for gene suppression and transgenesis, and (3 the simplicity of culture and experimentation in the laboratory. Taken together, N. vectensis has the tractability to connect the functional relationships between a host animal, microbes, and genome modifications to determine mechanisms underlying phenotypic plasticity and local adaptation.
Parasitic anemone infects the invasive ctenophore Mnemiopsis leidyi in the North East Atlantic
DEFF Research Database (Denmark)
Selander, Erik; Møller, Lene Friis; Sundberg, Per
2010-01-01
We report of the first finding of parasitic sea anemone larvae infecting the invasive ctenophore Mnemiopsis leidyi in the North East Atlantic. Parasitic anemone larvae are common in the native habitat of Mnemiopsis, but have not previously been reported from any of the locations where Mnemiopsis ...
Directory of Open Access Journals (Sweden)
F. Franchini
2017-12-01
Full Text Available The production of dimethyl sulfide (DMS is poorly quantified in tropical reef environments but forms an essential process that couples marine and terrestrial sulfur cycles and affects climate. Here we quantified net aqueous DMS production and the concentration of its cellular precursor dimethylsulfoniopropionate (DMSP in the sea anemone Aiptasia sp., a model organism to study coral-related processes. Bleached anemones did not show net DMS production whereas symbiotic anemones produced DMS concentrations (mean ± standard error of 160.7 ± 44.22 nmol g−1 dry weight (DW after 48 h incubation. Symbiotic and bleached individuals showed DMSP concentrations of 32.7 ± 6.00 and 0.6 ± 0.19 µmol g−1 DW, respectively. We applied these findings to a Monte Carlo simulation to demonstrate that net aqueous DMS production accounts for only 20 % of gross aqueous DMS production. Monte Carlo-based estimations of sea-to-air fluxes of gaseous DMS showed that reefs may release 0.1 to 26.3 µmol DMS m−2 coral surface area (CSA d−1 into the atmosphere with 40 % probability for rates between 0.5 and 1.5 µmol m−2 CSA d−1. These predictions were in agreement with directly quantified fluxes in previous studies. Conversion to a flux normalised to sea surface area (SSA (range 0.1 to 17.4, with the highest probability for 0.3 to 1.0 µmol DMS m−2 SSA d−1 suggests that coral reefs emit gaseous DMS at lower rates than the average global oceanic DMS flux of 4.6 µmol m−2 SSA d−1 (19.6 Tg sulfur per year. The large difference between simulated gross and quantified net aqueous DMS production in corals suggests that the current and future potential for its production in tropical reefs is critically governed by DMS consumption processes. Hence, more research is required to assess the sensitivity of DMS-consumption pathways to ongoing environmental change in order to address the impact of predicted
Franchini, Filippo; Steinke, Michael
2017-12-01
The production of dimethyl sulfide (DMS) is poorly quantified in tropical reef environments but forms an essential process that couples marine and terrestrial sulfur cycles and affects climate. Here we quantified net aqueous DMS production and the concentration of its cellular precursor dimethylsulfoniopropionate (DMSP) in the sea anemone Aiptasia sp., a model organism to study coral-related processes. Bleached anemones did not show net DMS production whereas symbiotic anemones produced DMS concentrations (mean ± standard error) of 160.7 ± 44.22 nmol g-1 dry weight (DW) after 48 h incubation. Symbiotic and bleached individuals showed DMSP concentrations of 32.7 ± 6.00 and 0.6 ± 0.19 µmol g-1 DW, respectively. We applied these findings to a Monte Carlo simulation to demonstrate that net aqueous DMS production accounts for only 20 % of gross aqueous DMS production. Monte Carlo-based estimations of sea-to-air fluxes of gaseous DMS showed that reefs may release 0.1 to 26.3 µmol DMS m-2 coral surface area (CSA) d-1 into the atmosphere with 40 % probability for rates between 0.5 and 1.5 µmol m-2 CSA d-1. These predictions were in agreement with directly quantified fluxes in previous studies. Conversion to a flux normalised to sea surface area (SSA) (range 0.1 to 17.4, with the highest probability for 0.3 to 1.0 µmol DMS m-2 SSA d-1) suggests that coral reefs emit gaseous DMS at lower rates than the average global oceanic DMS flux of 4.6 µmol m-2 SSA d-1 (19.6 Tg sulfur per year). The large difference between simulated gross and quantified net aqueous DMS production in corals suggests that the current and future potential for its production in tropical reefs is critically governed by DMS consumption processes. Hence, more research is required to assess the sensitivity of DMS-consumption pathways to ongoing environmental change in order to address the impact of predicted degradation of coral reefs on DMS production in tropical coastal ecosystems and its impact on
Sea anemones may thrive in a high CO2 world.
Suggett, David J; Hall-Spencer, Jason M; Rodolfo-Metalpa, Riccardo; Boatman, Toby G; Payton, Ross; Tye Pettay, D; Johnson, Vivienne R; Warner, Mark E; Lawson, Tracy
2012-10-01
Increased seawater pCO 2 , and in turn 'ocean acidification' (OA), is predicted to profoundly impact marine ecosystem diversity and function this century. Much research has already focussed on calcifying reef-forming corals (Class: Anthozoa) that appear particularly susceptible to OA via reduced net calcification. However, here we show that OA-like conditions can simultaneously enhance the ecological success of non-calcifying anthozoans, which not only play key ecological and biogeochemical roles in present day benthic ecosystems but also represent a model organism should calcifying anthozoans exist as less calcified (soft-bodied) forms in future oceans. Increased growth (abundance and size) of the sea anemone (Anemonia viridis) population was observed along a natural CO 2 gradient at Vulcano, Italy. Both gross photosynthesis (P G ) and respiration (R) increased with pCO 2 indicating that the increased growth was, at least in part, fuelled by bottom up (CO 2 stimulation) of metabolism. The increase of P G outweighed that of R and the genetic identity of the symbiotic microalgae (Symbiodinium spp.) remained unchanged (type A19) suggesting proximity to the vent site relieved CO 2 limitation of the anemones' symbiotic microalgal population. Our observations of enhanced productivity with pCO 2 , which are consistent with previous reports for some calcifying corals, convey an increase in fitness that may enable non-calcifying anthozoans to thrive in future environments, i.e. higher seawater pCO 2 . Understanding how CO 2 -enhanced productivity of non- (and less-) calcifying anthozoans applies more widely to tropical ecosystems is a priority where such organisms can dominate benthic ecosystems, in particular following localized anthropogenic stress. © 2012 Blackwell Publishing Ltd.
Dunn, S R; Thomason, J C; Le Tissier, M D A; Bythell, J C
2004-11-01
Bleaching of reef building corals and other symbiotic cnidarians due to the loss of their dinoflagellate algal symbionts (=zooxanthellae), and/or their photosynthetic pigments, is a common sign of environmental stress. Mass bleaching events are becoming an increasingly important cause of mortality and reef degradation on a global scale, linked by many to global climate change. However, the cellular mechanisms of stress-induced bleaching remain largely unresolved. In this study, the frequency of apoptosis-like and necrosis-like cell death was determined in the symbiotic sea anemone Aiptasia sp. using criteria that had previously been validated for this symbiosis as indicators of programmed cell death (PCD) and necrosis. Results indicate that PCD and necrosis occur simultaneously in both host tissues and zooxanthellae subject to environmentally relevant doses of heat stress. Frequency of PCD in the anemone endoderm increased within minutes of treatment. Peak rates of apoptosis-like cell death in the host were coincident with the timing of loss of zooxanthellae during bleaching. The proportion of apoptosis-like host cells subsequently declined while cell necrosis increased. In the zooxanthellae, both apoptosis-like and necrosis-like activity increased throughout the duration of the experiment (6 days), dependent on temperature dose. A stress-mediated PCD pathway is an important part of the thermal stress response in the sea anemone symbiosis and this study suggests that PCD may play different roles in different components of the symbiosis during bleaching.
Directory of Open Access Journals (Sweden)
David Fransolet
Full Text Available Recovery of coral after bleaching episodes is a critical period for the health of the reef ecosystem. While events such as symbiont (genus Symbiodinium shifting/shuffling or tissue apoptosis have been demonstrated to occur following bleaching, little is known concerning tissue recovery or cell proliferation. Here, we studied the sea anemone Aiptasia pallida exposed to a transient elevation of water temperature combined with high illumination (33°C and 1900 µmol photons x m(-2 x s(-1 for 30 h. Following such treatment bleached anemones showed a significant reduction of their Symbiodinium density. Cell proliferation in the ectodermis and gastrodermis was determined by assessing the densities of cells labeled with a thymidine analogue (EdU. Cell proliferation significantly increased during the first day following stress in both tissue types. This increased cell proliferation returned to pre-stress values after one week. Although cell proliferation was higher in the ectodermis in absence of stress, it was relatively more pronounced in the gastrodermis of stressed anemones. In addition, the ratio of ectodermal mucocytes significantly increased three weeks after induced stress. These results suggest that thermal/photic stress coupled with the loss of the symbionts is able to enhance cell proliferation in both gastrodermis and ectodermis of cnidarians. While new cells formed in the gastrodermis are likely to host new Symbiodinium, the fate of new cells in the ectodermis was only partially revealed. Some new ectodermal cells may, in part, contribute to the increased number of mucocytes which could eventually help strengthen the heterotrophic state until restoration of the symbiosis.
Anemone bleaching increases the metabolic demands of symbiont anemonefish.
Norin, Tommy; Mills, Suzanne C; Crespel, Amélie; Cortese, Daphne; Killen, Shaun S; Beldade, Ricardo
2018-04-11
Increased ocean temperatures are causing mass bleaching of anemones and corals in the tropics worldwide. While such heat-induced loss of algal symbionts (zooxanthellae) directly affects anemones and corals physiologically, this damage may also cascade on to other animal symbionts. Metabolic rate is an integrative physiological trait shown to relate to various aspects of organismal performance, behaviour and locomotor capacity, and also shows plasticity during exposure to acute and chronic stressors. As climate warming is expected to affect the physiology, behaviour and life history of animals, including ectotherms such as fish, we measured if residing in bleached versus unbleached sea anemones ( Heteractis magnifica ) affected the standard (i.e. baseline) metabolic rate and behaviour (activity) of juvenile orange-fin anemonefish ( Amphiprion chrysopterus ) . Metabolic rate was estimated from rates of oxygen uptake [Formula: see text], and the standard metabolic rate [Formula: see text] of anemonefish from bleached anemones was significantly higher by 8.2% compared with that of fish residing in unbleached anemones, possibly due to increased stress levels. Activity levels did not differ between fish from bleached and unbleached anemones. As [Formula: see text] reflects the minimum cost of living, the increased metabolic demands may contribute to the negative impacts of bleaching on important anemonefish life history and fitness traits observed previously (e.g. reduced spawning frequency and lower fecundity). © 2018 The Author(s).
Directory of Open Access Journals (Sweden)
Li-Hsueh Wang
Full Text Available Lipids are a source of metabolic energy, as well as essential components of cellular membranes. Although they have been shown to be key players in the regulation of cell proliferation in various eukaryotes, including microalgae, their role in the cell cycle of cnidarian-dinoflagellate (genus Symbiodinium endosymbioses remains to be elucidated. The present study examined the effects of a lipid synthesis inhibitor, cerulenin, on the cell cycle of both cultured Symbiodinium (clade B and those engaged in an endosymbiotic association with the sea anemone Aiptasia pulchella. In the former, cerulenin exposure was found to inhibit free fatty acid (FFA synthesis, as it does in other organisms. Additionally, while it also significantly inhibited the synthesis of phosphatidylethanolamine (PE, it did not affect the production of sterol ester (SE or phosphatidylcholine (PC. Interestingly, cerulenin also significantly retarded cell division by arresting the cell cycles at the G0/G1 phase. Cerulenin-treated Symbiodinium were found to be taken up by anemone hosts at a significantly depressed quantity in comparison with control Symbiodinium. Furthermore, the uptake of cerulenin-treated Symbiodinium in host tentacles occurred much more slowly than in untreated controls. These results indicate that FFA and PE may play critical roles in the recognition, proliferation, and ultimately the success of endosymbiosis with anemones.
Choresh, O; Ron, E; Loya, Y
2001-09-01
Expression of heat shock proteins (HSPs) is often correlated with adaptation to environmental stress. We examined the role of HSP60 (60 kDa) in acclimatization to thermal stress in the sea anemone Anemonia viridis. Using monoclonal antibodies, we identified HSP60 in sea anemones for the first time, and showed that its expression varied with changes in seawater temperature (SWT). Anemonia viridis displayed high levels of HSP60 when extreme temperatures prevailed in stressful habitats such as tidal pools. Specimens sampled from different temperature layers in the same tidal pool differed in their levels of HSP60. Specimens from subtidal zones exhibited a seasonal pattern of expression of HSP60, according to the seasonal SWT. The level of HSP60 was significantly higher in the summer (SWT, 31 degrees C) than in other seasons throughout the year. This study suggests the use of HSP60 expression as a tool for stress detection in marine invertebrates.
Bulati, Matteo; Longo, Alessandra; Masullo, Tiziana; Vlah, Sara; Bennici, Carmelo; Bonura, Angela; Salamone, Monica; Tagliavia, Marcello; Nicosia, Aldo; Mazzola, Salvatore; Colombo, Paolo; Cuttitta, Angela
2016-01-01
In the last few years, marine species have been investigated for the presence of natural products with anticancer activity. Using reversed phase chromatography, low molecular weight proteins were fractionated from the sea anemone Anemonia viridis. Four different fractions were evaluated for their cytotoxic activity by means of erythrocyte haemolysis test, MTS, and LDH assays. Finally, the antiproliferative activities of three of these fractions were studied on PC3, PLC/PRF/5, and A375 human c...
Cuttitta, Angela; Ragusa, Maria Antonietta; Costa, Salvatore; Bennici, Carmelo; Colombo, Paolo; Mazzola, Salvatore; Gianguzza, Fabrizio; Nicosia, Aldo
2017-08-01
Gene family encoding allograft inflammatory factor-1 (AIF-1) is well conserved among organisms; however, there is limited knowledge in lower organisms. In this study, the first AIF-1 homologue from cnidarians was identified and characterised in the sea anemone Anemonia viridis. The full-length cDNA of AvAIF-1 was of 913 bp with a 5' -untranslated region (UTR) of 148 bp, a 3'-UTR of 315 and an open reading frame (ORF) of 450 bp encoding a polypeptide with149 amino acid residues and predicted molecular weight of about 17 kDa. The predicted protein possesses evolutionary conserved EF hand Ca 2+ binding motifs, post-transcriptional modification sites and a 3D structure which can be superimposed with human members of AIF-1 family. The AvAIF-1 transcript was constitutively expressed in all tested tissues of unchallenged sea anemone, suggesting that AvAIF-1 could serve as a general protective factor under normal physiological conditions. Moreover, we profiled the transcriptional activation of AvAIF-1 after challenges with different abiotic/biotic stresses showing induction by warming conditions, heavy metals exposure and immune stimulation. Thus, mechanisms associated to inflammation and immune challenges up-regulated AvAIF-1 mRNA levels. Our results suggest its involvement in the inflammatory processes and immune response of A. viridis. Copyright © 2017 Elsevier Ltd. All rights reserved.
Bythell, J. C.; Douglas, A. E.; Sharp, V. A.; Searle, J. B.; Brown, B. E.
1997-01-01
As an approach to investigate the impact of solar radiation on an alga–invertebrate symbiosis, the genetic variation and photosynthetic responses of the dinoflagellate algal symbiosis in an intertidal and a subtidal population of the sea anemone Anemonia viridis were explored. Allozyme analysis of the anemones indicated that the two populations were genetically very similar, with a Nei's index value of genetic identity (I) of 0.998. The algae in all animals examined were identified as Symbiodinium of clade a by PCR-RFLP analysis of the small subunit ribosomal RNA gene. The symbiosis in the two populations did not differ significantly in algal population density, chlorophyll a content per algal cell or any photosynthetic parameter obtained from studies of the relationship between photosynthesis and irradiance. We conclude that there is not necessarily genetic variation or photosynthetic plasticity of the symbiotic algae in Anemonia viridis inhabiting environments characterized by the different solar irradiances of the subtidal and intertidal habitats.
Richier, Sophie; Sabourault, Cécile; Courtiade, Juliette; Zucchini, Nathalie; Allemand, Denis; Furla, Paola
2006-09-01
Symbiosis between cnidarian and photosynthetic protists is widely distributed over temperate and tropical seas. These symbioses can periodically breakdown, a phenomenon known as cnidarian bleaching. This event can be irreversible for some associations subjected to acute and/or prolonged environmental disturbances, and leads to the death of the animal host. During bleaching, oxidative stress has been described previously as acting at molecular level and apoptosis is suggested to be one of the mechanisms involved. We focused our study on the role of apoptosis in bleaching via oxidative stress in the association between the sea anemone Anemonia viridis and the dinoflagellates Symbiodinium species. Characterization of caspase-like enzymes were conducted at the biochemical and molecular level to confirm the presence of a caspase-dependent apoptotic phenomenon in the cnidarian host. We provide evidence of oxidative stress followed by induction of caspase-like activity in animal host cells after an elevated temperature stress, suggesting the concomitant action of these components in bleaching.
Laboratory-Cultured Strains of the Sea Anemone Exaiptasia Reveal Distinct Bacterial Communities
Herrera Sarrias, Marcela; Ziegler, Maren; Voolstra, Christian R.; Aranda, Manuel
2017-01-01
Exaiptasia is a laboratory sea anemone model system for stony corals. Two clonal strains are commonly used, referred to as H2 and CC7, that originate from two genetically distinct lineages and that differ in their Symbiodinium specificity. However, little is known about their other microbial associations. Here, we examined and compared the taxonomic composition of the bacterial assemblages of these two symbiotic Exaiptasia strains, both of which have been cultured in the laboratory long-term under identical conditions. We found distinct bacterial microbiota for each strain, indicating the presence of host-specific microbial consortia. Putative differences in the bacterial functional profiles (i.e., enrichment and depletion of various metabolic processes) based on taxonomic inference were also detected, further suggesting functional differences of the microbiomes associated with these lineages. Our study contributes to the current knowledge of the Exaiptasia holobiont by comparing the bacterial diversity of two commonly used strains as models for coral research.
Laboratory-Cultured Strains of the Sea Anemone Exaiptasia Reveal Distinct Bacterial Communities
Herrera Sarrias, Marcela
2017-05-02
Exaiptasia is a laboratory sea anemone model system for stony corals. Two clonal strains are commonly used, referred to as H2 and CC7, that originate from two genetically distinct lineages and that differ in their Symbiodinium specificity. However, little is known about their other microbial associations. Here, we examined and compared the taxonomic composition of the bacterial assemblages of these two symbiotic Exaiptasia strains, both of which have been cultured in the laboratory long-term under identical conditions. We found distinct bacterial microbiota for each strain, indicating the presence of host-specific microbial consortia. Putative differences in the bacterial functional profiles (i.e., enrichment and depletion of various metabolic processes) based on taxonomic inference were also detected, further suggesting functional differences of the microbiomes associated with these lineages. Our study contributes to the current knowledge of the Exaiptasia holobiont by comparing the bacterial diversity of two commonly used strains as models for coral research.
The genome of Aiptasia, a sea anemone model for coral symbiosis
Baumgarten, Sebastian
2015-08-31
The most diverse marine ecosystems, coral reefs, depend upon a functional symbiosis between a cnidarian animal host (the coral) and intracellular photosynthetic dinoflagellate algae. The molecular and cellular mechanisms underlying this endosymbiosis are not well understood, in part because of the difficulties of experimental work with corals. The small sea anemone Aiptasia provides a tractable laboratory model for investigating these mechanisms. Here we report on the assembly and analysis of the Aiptasia genome, which will provide a foundation for future studies and has revealed several features that may be key to understanding the evolution and function of the endosymbiosis. These features include genomic rearrangements and taxonomically restricted genes that may be functionally related to the symbiosis, aspects of host dependence on alga-derived nutrients, a novel and expanded cnidarian-specific family of putative pattern-recognition receptors that might be involved in the animal–algal interactions, and extensive lineage-specific horizontal gene transfer. Extensive integration of genes of prokaryotic origin, including genes for antimicrobial peptides, presumably reflects an intimate association of the animal–algal pair also with its prokaryotic microbiome.
Broad-scale Population Genetics of the Host Sea Anemone, Heteractis magnifica
Emms, Madeleine
2015-12-01
Broad-scale population genetics can reveal population structure across an organism’s entire range, which can enable us to determine the most efficient population-wide management strategy depending on levels of connectivity. Genetic variation and differences in genetic diversity on small-scales have been reported in anemones, but nothing is known about their broad-scale population structure, including that of “host” anemone species, which are increasingly being targeted in the aquarium trade. In this study, microsatellite markers were used as a tool to determine the population structure of a sessile, host anemone species, Heteractis magnifica, across the Indo-Pacific region. In addition, two rDNA markers were used to identify Symbiodinium from the samples, and phylogenetic analyses were used to measure diversity and geographic distribution of Symbiodinium across the region. Significant population structure was identified in H. magnifica across the Indo-Pacific, with at least three genetic breaks, possibly the result of factors such as geographic distance, geographic isolation and environmental variation. Symbiodinium associations were also affected by environmental variation and supported the geographic isolation of some regions. These results suggests that management of H. magnifica must be implemented on a local scale, due to the lack of connectivity between clusters. This study also provides further evidence for the combined effects of geographic distance and environmental distance in explaining genetic variance.
Directory of Open Access Journals (Sweden)
Víctor Hugo Molina
2017-01-01
Full Text Available Our current understanding of carbon exchange between partners in the Symbiodinium-cnidarian symbioses is still limited, even though studies employing carbon isotopes have made us aware of the metabolic complexity of this exchange. We examined glycerol and glucose metabolism to better understand how photosynthates are exchanged between host and symbiont. The levels of these metabolites were compared between symbiotic and bleached Exaiptasia pallida anemones, assaying enzymes directly involved in their metabolism. We measured a significant decrease of glucose levels in bleached animals but a significant increase in glycerol and G3P pools, suggesting that bleached animals degrade lipids to compensate for the loss of symbionts and seem to rely on symbiotic glucose. The lower glycerol 3-phosphate dehydrogenase but higher glucose 6-phosphate dehydrogenase specific activities measured in bleached animals agree with a metabolic deficit mainly due to the loss of glucose from the ruptured symbiosis. These results corroborate previous observations on carbon translocation from symbiont to host in the sea anemone Exaiptasia, where glucose was proposed as a main translocated metabolite. To better understand photosynthate translocation and its regulation, additional research with other symbiotic cnidarians is needed, in particular, those with calcium carbonate skeletons.
DEFF Research Database (Denmark)
Darmer, D; Schmutzler, C; Diekhoff, D
1991-01-01
Neuropeptides containing the carboxylterminal sequence Arg-Phe-NH2 are found throughout the animal kingdom and are important substances mediating neuronal communication. Here, we have cloned the cDNA coding for the precursor protein of the sea anemone neuropeptide (Antho-RFamide) less than Glu...... harbors four other putative neuropeptides that are much less related to Antho-RFamide. This report shows that the biosynthetic machinery for neuropeptides in coelenterates, the lowest animal group having a nervous system, is already very efficient and similar to that of higher invertebrates...
Directory of Open Access Journals (Sweden)
Fabián H. Acuña
2012-11-01
Full Text Available The sea anemone fauna of Isla del Coco National Park (also known as Cocos Island Nacional Park, Pacific Costa Rica is poorly known. In the present work we report the first occurrence of the species Telmatactis panamensis. Individuals of this sea anemone (n=24 were collected at Chatham Bay intertidal and at 15m depth in Punta Ulloa, in both cases attached to rocks; during the expedition UCR-UNA-COCO-I in April 2010. We provide photographs of live individuals, external anatomy and an inventory of cnidae of the studied specimens. Possibly this species is extended to greater depth as observed by other authors in the Galápagos Islands.La fauna de anémonas de mar es prácticamente desconocida para el Parque Nacional Isla del Coco (Costa Rica. En el presente trabajo se reporta por primera vez la presencia de la especie Telmatactis panamensis. Individuos de esta anémona de mar fueron colectados en el intermareal de Bahía Chatham y a 15m de profundidad en Punta Ulloa, en ambos casos adheridas a rocas; durante la expedición UCR-UNA-COCO-I en Abril de 2010. Se proveen fotografías de ejemplares vivos, datos de su anatomía externa y un inventario del cnidae de los especímenes estudiados. Posiblemente esta especie se extienda a mayor profundidad, tal como fue observado por otros autores para ejemplares de las Islas Galápagos.
In silico assessment of interaction of sea anemone toxin APETx2 and acid sensing ion channel 3
International Nuclear Information System (INIS)
Rahman, Taufiq; Smith, Ewan St. John
2014-01-01
Highlights: • We have made a reasonable model of rat ASIC3 using published structure of chicken ASIC1. • We have docked sea anemone toxin APETx2 on the model. • We have identified two putative sites for toxin binding. • We have argued for plausibility one site over the other. • We have identified the residues that are likely to be critical for APETx2–ASIC3 interaction. - Abstract: Acid sensing ion channels (ASICs) are proton-gated cation channels that are expressed throughout the nervous system and have been implicated in mediating sensory perception of noxious stimuli. Amongst the six ASIC isoforms, ASIC1a, 1b, 2a and 3 form proton-gated homomers, which differ in their activation and inactivation kinetics, expression profiles and pharmacological modulation; protons do not gate ASIC2b and ASIC4. As with many other ion channels, structure-function studies of ASICs have been greatly aided by the discovery of some toxins that act in isoform-specific ways. ASIC3 is predominantly expressed by sensory neurons of the peripheral nervous system where it acts to detect acid as a noxious stimulus and thus plays an important role in nociception. ASIC3 is the only ASIC subunit that is inhibited by the sea anemone (Anthopleura elegantissima)-derived toxin APETx2. However, the molecular mechanism by which APETx2 interacts with ASIC3 remains largely unknown. In this study, we made a homology model of ASIC3 and used extensive protein–protein docking to predict for the first time, the probable sites of APETx2 interaction on ASIC3. Additionally, using computational alanine scanning, we also suggest the ‘hot-spots’ that are likely to be critical for ASIC3–APETx2 interaction
In silico assessment of interaction of sea anemone toxin APETx2 and acid sensing ion channel 3
Energy Technology Data Exchange (ETDEWEB)
Rahman, Taufiq, E-mail: mtur2@cam.ac.uk; Smith, Ewan St. John
2014-07-18
Highlights: • We have made a reasonable model of rat ASIC3 using published structure of chicken ASIC1. • We have docked sea anemone toxin APETx2 on the model. • We have identified two putative sites for toxin binding. • We have argued for plausibility one site over the other. • We have identified the residues that are likely to be critical for APETx2–ASIC3 interaction. - Abstract: Acid sensing ion channels (ASICs) are proton-gated cation channels that are expressed throughout the nervous system and have been implicated in mediating sensory perception of noxious stimuli. Amongst the six ASIC isoforms, ASIC1a, 1b, 2a and 3 form proton-gated homomers, which differ in their activation and inactivation kinetics, expression profiles and pharmacological modulation; protons do not gate ASIC2b and ASIC4. As with many other ion channels, structure-function studies of ASICs have been greatly aided by the discovery of some toxins that act in isoform-specific ways. ASIC3 is predominantly expressed by sensory neurons of the peripheral nervous system where it acts to detect acid as a noxious stimulus and thus plays an important role in nociception. ASIC3 is the only ASIC subunit that is inhibited by the sea anemone (Anthopleura elegantissima)-derived toxin APETx2. However, the molecular mechanism by which APETx2 interacts with ASIC3 remains largely unknown. In this study, we made a homology model of ASIC3 and used extensive protein–protein docking to predict for the first time, the probable sites of APETx2 interaction on ASIC3. Additionally, using computational alanine scanning, we also suggest the ‘hot-spots’ that are likely to be critical for ASIC3–APETx2 interaction.
Matthews, Jennifer L; Sproles, Ashley E; Oakley, Clinton A; Grossman, Arthur R; Weis, Virginia M; Davy, Simon K
2016-02-01
Experimental manipulation of the symbiosis between cnidarians and photosynthetic dinoflagellates (Symbiodinium spp.) is crucial to advancing the understanding of the cellular mechanisms involved in host-symbiont interactions, and overall coral reef ecology. The anemone Aiptasia sp. is a model for cnidarian-dinoflagellate symbiosis, and notably it can be rendered aposymbiotic (i.e. dinoflagellate-free) and re-infected with a range of Symbiodinium types. Various methods exist for generating aposymbiotic hosts; however, they can be hugely time consuming and not wholly effective. Here, we optimise a method using menthol for production of aposymbiotic Aiptasia. The menthol treatment produced aposymbiotic hosts within just 4 weeks (97-100% symbiont loss), and the condition was maintained long after treatment when anemones were held under a standard light:dark cycle. The ability of Aiptasia to form a stable symbiosis appeared to be unaffected by menthol exposure, as demonstrated by successful re-establishment of the symbiosis when anemones were experimentally re-infected. Furthermore, there was no significant impact on photosynthetic or respiratory performance of re-infected anemones. © 2016. Published by The Company of Biologists Ltd.
Nesher, Nir; Shapira, Eli; Sher, Daniel; Moran, Yehu; Tsveyer, Liora; Turchetti-Maia, Ana Luiza; Horowitz, Michal; Hochner, Binyamin; Zlotkin, Eliahu
2013-04-01
Heart failure is one of the most prevalent causes of death in the western world. Sea anemone contains a myriad of short peptide neurotoxins affecting many pharmacological targets, several of which possess cardiotonic activity. In the present study we describe the isolation and characterization of AdE-1 (ion channel modifier), a novel cardiotonic peptide from the sea anemone Aiptasia diaphana, which differs from other cnidarian toxins. Although AdE-1 has the same cysteine residue arrangement as sea anemone type 1 and 2 Na(+) channel toxins, its sequence contains many substitutions in conserved and essential sites and its overall homology to other toxins identified to date is low (Anemonia viridis toxin II), AdE-1 markedly inhibits Na(+) current inactivation with no significant effect on current activation, suggesting a similar mechanism of action. However, its effects on twitch relaxation velocity, action potential amplitude and on the time to peak suggest that this novel toxin affects cardiomyocyte function via a more complex mechanism. Additionally, Av2's characteristic delayed and early after-depolarizations were not observed. Despite its structural differences, AdE-1 physiologic effectiveness is comparable with Av2 with a similar ED(50) value to blowfly larvae. This finding raises questions regarding the extent of the universality of structure-function in sea anemone Na(+) channel toxins.
Severe Toxic Skin Reaction Caused by a Common Anemone and Identification of the Culprit Organism.
Tezcan, Özgür Deniz; Gözer, Özgür
2015-01-01
In a marine envenomation, identification of the culprit organism can be difficult. In this case report, we present our method to identify snakelocks anemone (Anemonia viridis or formerly Anemonia sulcata) as the culprit of a severe toxic skin reaction. A. viridis is one of the most common anemones of the Mediterranean Sea and the North Atlantic Ocean. It lives at a depth of up to 10 m. It is a member of the phylum Cnidaria, which includes jellyfish, anemones, hydroids, and corals. They have toxic organelles called cnidocysts that have the capacity to inject venom with microscopic harpoon-like structures. The cnidocysts of A. viridis may cause toxic and allergic reactions, and although its venom is one of the most studied cnidarian venoms, detailed case reports are rare. © 2015 International Society of Travel Medicine.
Bamber, Tess Olivia; Jackson, Angus Charles; Mansfield, Robert Philip
2018-05-01
Increasing concentrations of atmospheric carbon dioxide are causing oceanic pH to decline worldwide, a phenomenon termed ocean acidification. Mounting experimental evidence indicates that near-future levels of CO2 will affect calcareous invertebrates such as corals, molluscs and gastropods, by reducing their scope for calcification. Despite extensive research into ocean acidification in recent years, the effects on non-calcifying anthozoans, such as sea anemones, remain little explored. In Western Europe, intertidal anemones such as Actinia equina are abundant, lower trophic-level organisms that function as important ecosystem engineers. Changes to behaviours of these simple predators could have implications for intertidal assemblages. This investigation identified the effects of reduced seawater pH on feeding and contest behaviour by A. equina. Video footage was recorded for A. equina feeding at current-day seawater (pH 8.1), and the least (pH 7.9) and most (pH 7.6) severe end-of-century predictions. Footage was also taken of contests over ownership of space between anemones exposed to reduced pH and those that were not. No statistically significant differences were identified in feeding duration or various aspects of contest behaviour including initiating, winning, inflating acrorhagi, inflicting acrorhagial peels and contest duration. Multivariate analyses showed no effect of pH on a combination of these variables. This provides contrast with other studies where anemones with symbiotic algae thrive in areas of natural increased acidity. Thus, novel experiments using intraspecific contests and resource-holding potential may prove an effective approach to understand sub-lethal consequences of ocean acidification for A. equina, other sea anemones and more broadly for marine ecosystems.
Trace element profiles of the sea anemone Anemonia viridis living nearby a natural CO2 vent.
Horwitz, Rael; Borell, Esther M; Fine, Maoz; Shaked, Yeala
2014-01-01
Ocean acidification (OA) is not an isolated threat, but acts in concert with other impacts on ecosystems and species. Coastal marine invertebrates will have to face the synergistic interactions of OA with other global and local stressors. One local factor, common in coastal environments, is trace element contamination. CO2 vent sites are extensively studied in the context of OA and are often considered analogous to the oceans in the next few decades. The CO2 vent found at Levante Bay (Vulcano, NE Sicily, Italy) also releases high concentrations of trace elements to its surrounding seawater, and is therefore a unique site to examine the effects of long-term exposure of nearby organisms to high pCO2 and trace element enrichment in situ. The sea anemone Anemonia viridis is prevalent next to the Vulcano vent and does not show signs of trace element poisoning/stress. The aim of our study was to compare A. viridis trace element profiles and compartmentalization between high pCO2 and control environments. Rather than examining whole anemone tissue, we analyzed two different body compartments-the pedal disc and the tentacles, and also examined the distribution of trace elements in the tentacles between the animal and the symbiotic algae. We found dramatic changes in trace element tissue concentrations between the high pCO2/high trace element and control sites, with strong accumulation of iron, lead, copper and cobalt, but decreased concentrations of cadmium, zinc and arsenic proximate to the vent. The pedal disc contained substantially more trace elements than the anemone's tentacles, suggesting the pedal disc may serve as a detoxification/storage site for excess trace elements. Within the tentacles, the various trace elements displayed different partitioning patterns between animal tissue and algal symbionts. At both sites iron was found primarily in the algae, whereas cadmium, zinc and arsenic were primarily found in the animal tissue. Our data suggests that A. viridis
Duckworth, Christina G; Picariello, Codie R; Thomason, Rachel K; Patel, Krina S; Bielmyer-Fraser, Gretchen K
2017-01-01
Ocean acidification, caused by increasing atmospheric carbon dioxide (CO 2 ), is a growing concern in marine environments. Land-based sources of pollution, such as metals, have also been a noted problem; however, little research has addressed the combined exposure of both pollutants to coral reef organisms. In this study we examined tissue metal accumulation and physiological effects (activity of anti-oxidant enzymes, catalase and glutathione reductase) in the sea anemone, Exaiptasia pallida after exposure to increased CO 2 , as well as zinc (Zn) or nickel (Ni). After exposure to four concentrations (nominal values=control, 10, 50, 100μg/L) of Zn or Ni over 7days, both metals accumulated in the tissues of E. pallida in a concentration-dependent manner. Anemones exposed to elevated CO 2 (1000ppm) accumulated significant tissue burdens of Zn or Ni faster (by 48h) than those exposed to the same metal concentrations at ambient CO 2 . No differences were observed in catalase activity due to Zn exposure; however, 50μg/L Ni caused a significant increase in catalase activity at ambient CO 2 . No significant effect on catalase activity from CO 2 exposure alone was observed. Glutathione reductase activity was affected by increased Zn or Ni exposure and those effects were influenced by increased CO 2 . Results of this study provide insight into the toxic mechanisms and environmental implications of CO 2 and Zn or Ni exposure to the cnidarian E. pallida. Copyright © 2016 Elsevier B.V. All rights reserved.
Urbarova, Ilona; Patel, Hardip; Forêt, Sylvain; Karlsen, Bård Ove; Jørgensen, Tor Erik; Hall-Spencer, Jason M; Johansen, Steinar D
2018-02-01
Cnidarians harbor a variety of small regulatory RNAs that include microRNAs (miRNAs) and PIWI-interacting RNAs (piRNAs), but detailed information is limited. Here, we report the identification and expression of novel miRNAs and putative piRNAs, as well as their genomic loci, in the symbiotic sea anemone Anemonia viridis. We generated a draft assembly of the A. viridis genome with putative size of 313 Mb that appeared to be composed of about 36% repeats, including known transposable elements. We detected approximately equal fractions of DNA transposons and retrotransposons. Deep sequencing of small RNA libraries constructed from A. viridis adults sampled at a natural CO2 gradient off Vulcano Island, Italy, identified 70 distinct miRNAs. Eight were homologous to previously reported miRNAs in cnidarians, whereas 62 appeared novel. Nine miRNAs were recognized as differentially expressed along the natural seawater pH gradient. We found a highly abundant and diverse population of piRNAs, with a substantial fraction showing ping-pong signatures. We identified nearly 22% putative piRNAs potentially targeting transposable elements within the A. viridis genome. The A. viridis genome appeared similar in size to that of other hexacorals with a very high divergence of transposable elements resembling that of the sea anemone genus Exaiptasia. The genome encodes and expresses a high number of small regulatory RNAs, which include novel miRNAs and piRNAs. Differentially expressed small RNAs along the seawater pH gradient indicated regulatory gene responses to environmental stressors. © The Author(s) 2018. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution.
Towanda, Trisha; Thuesen, Erik V.
2012-01-01
Summary Some photosynthetic organisms benefit from elevated levels of carbon dioxide, but studies on the effects of elevated PCO2 on the algal symbionts of animals are very few. This study investigated the impact of hypercapnia on a photosynthetic symbiosis between the anemone Anthopleura elegantissima and its zooxanthella Symbiodinium muscatinei. Anemones were maintained in the laboratory for 1 week at 37 Pa PCO2 and pH 8.1. Clonal pairs were then divided into two groups and maintained for 6 weeks under conditions naturally experienced in their intertidal environment, 45 Pa PCO2, pH 8.1 and 231 Pa PCO2, pH 7.3. Respiration and photosynthesis were measured after the 1-week acclimation period and after 6 weeks in experimental conditions. Density of zooxanthellal cells, zooxanthellal cell size, mitotic index and chlorophyll content were compared between non-clonemate anemones after the 1-week acclimation period and clonal anemones at the end of the experiment. Anemones thrived in hypercapnia. After 6 weeks, A. elegantissima exhibited higher rates of photosynthesis at 45 Pa (4.2 µmol O2 g−1 h−1) and 231 Pa (3.30 µmol O2 g−1 h−1) than at the initial 37 Pa (1.53 µmol O2 g−1 h−1). Likewise, anemones at 231 Pa received more of their respiratory carbon from zooxanthellae (CZAR = 78.2%) than those at 37 Pa (CZAR = 66.6%) but less than anemones at 45 Pa (CZAR = 137.3%). The mitotic index of zooxanthellae was significantly greater in the hypercapnic anemones than in anemones at lower PCO2. Excess zooxanthellae were expelled by their hosts, and cell densities, cell diameters and chlorophyll contents were not significantly different between the groups. The response of A. elegantissima to hypercapnic acidification reveals the potential adaptation of an intertidal, photosynthetic symbiosis for high PCO2. PMID:23213455
Directory of Open Access Journals (Sweden)
Trisha Towanda
2012-05-01
Some photosynthetic organisms benefit from elevated levels of carbon dioxide, but studies on the effects of elevated PCO2 on the algal symbionts of animals are very few. This study investigated the impact of hypercapnia on a photosynthetic symbiosis between the anemone Anthopleura elegantissima and its zooxanthella Symbiodinium muscatinei. Anemones were maintained in the laboratory for 1 week at 37 Pa PCO2 and pH 8.1. Clonal pairs were then divided into two groups and maintained for 6 weeks under conditions naturally experienced in their intertidal environment, 45 Pa PCO2, pH 8.1 and 231 Pa PCO2, pH 7.3. Respiration and photosynthesis were measured after the 1-week acclimation period and after 6 weeks in experimental conditions. Density of zooxanthellal cells, zooxanthellal cell size, mitotic index and chlorophyll content were compared between non-clonemate anemones after the 1-week acclimation period and clonal anemones at the end of the experiment. Anemones thrived in hypercapnia. After 6 weeks, A. elegantissima exhibited higher rates of photosynthesis at 45 Pa (4.2 µmol O2 g−1 h−1 and 231 Pa (3.30 µmol O2 g−1 h−1 than at the initial 37 Pa (1.53 µmol O2 g−1 h−1. Likewise, anemones at 231 Pa received more of their respiratory carbon from zooxanthellae (CZAR = 78.2% than those at 37 Pa (CZAR = 66.6% but less than anemones at 45 Pa (CZAR = 137.3%. The mitotic index of zooxanthellae was significantly greater in the hypercapnic anemones than in anemones at lower PCO2. Excess zooxanthellae were expelled by their hosts, and cell densities, cell diameters and chlorophyll contents were not significantly different between the groups. The response of A. elegantissima to hypercapnic acidification reveals the potential adaptation of an intertidal, photosynthetic symbiosis for high PCO2.
Towanda, Trisha; Thuesen, Erik V
2012-07-15
Some photosynthetic organisms benefit from elevated levels of carbon dioxide, but studies on the effects of elevated PCO(2) on the algal symbionts of animals are very few. This study investigated the impact of hypercapnia on a photosynthetic symbiosis between the anemone Anthopleura elegantissima and its zooxanthella Symbiodinium muscatinei. Anemones were maintained in the laboratory for 1 week at 37 Pa PCO(2) and pH 8.1. Clonal pairs were then divided into two groups and maintained for 6 weeks under conditions naturally experienced in their intertidal environment, 45 Pa PCO(2), pH 8.1 and 231 Pa PCO(2), pH 7.3. Respiration and photosynthesis were measured after the 1-week acclimation period and after 6 weeks in experimental conditions. Density of zooxanthellal cells, zooxanthellal cell size, mitotic index and chlorophyll content were compared between non-clonemate anemones after the 1-week acclimation period and clonal anemones at the end of the experiment. Anemones thrived in hypercapnia. After 6 weeks, A. elegantissima exhibited higher rates of photosynthesis at 45 Pa (4.2 µmol O(2) g(-1) h(-1)) and 231 Pa (3.30 µmol O(2) g(-1) h(-1)) than at the initial 37 Pa (1.53 µmol O(2) g(-1) h(-1)). Likewise, anemones at 231 Pa received more of their respiratory carbon from zooxanthellae (CZAR = 78.2%) than those at 37 Pa (CZAR = 66.6%) but less than anemones at 45 Pa (CZAR = 137.3%). The mitotic index of zooxanthellae was significantly greater in the hypercapnic anemones than in anemones at lower PCO(2). Excess zooxanthellae were expelled by their hosts, and cell densities, cell diameters and chlorophyll contents were not significantly different between the groups. The response of A. elegantissima to hypercapnic acidification reveals the potential adaptation of an intertidal, photosynthetic symbiosis for high PCO(2).
Directory of Open Access Journals (Sweden)
Agustín Garese
2014-10-01
Full Text Available Bunodactis Verril, 1899 comprises at present 19 nominal species of sea anemones. The validity of the genus is under discussion. The description of the species, Bunodactis octoradiata Carlgren, 1899, is insufficient for reliable identification, and although subsequent works have provided additional information on the species, its description still needs to be complemented. Herein we describe B. octoradiata based on histological sections of the internal anatomy, and give a complete and detailed description of the external anatomy. The cnidom is composed of spirocysts, basitrichs and microbasic p-mastigophores; their distribution in the organism, sizes and relative abundances are provided. The presence of zooxanthellae is reported for the first time. Bunodactis octoradiata is distributed in groups that vary from 5.6 to 45 ind./m² in the field. Additionally, our data extends the distribution of the species along the coast of southern Patagonia (47°44'36"-49°15'13"S and 65°50'26"-67°39'45"W.
Directory of Open Access Journals (Sweden)
Frank Kühn
2017-10-01
Full Text Available A decisive element in the human cation channel TRPM2 is a region in its cytosolic C-terminus named NUDT9H because of its homology to the NUDT9 enzyme, a pyrophosphatase degrading ADP-ribose (ADPR. In hTRPM2, however, the NUDT9H domain has lost its enzymatic activity but serves as a binding domain for ADPR. As consequence of binding, gating of the channel is initiated. Since ADPR is produced after oxidative DNA damage, hTRPM2 mediates Ca2+ influx in response to oxidative stress which may lead to cell death. In the genome of the sea anemone Nematostella vectensis (nv, a preferred model organism for the evolution of key bilaterian features, a TRPM2 ortholog has been identified that contains a NUDT9H domain as well. Heterologous expression of nvTRPM2 in HEK-293 cells reveals a cation channel with many close similarities to the human counterpart. Most notably, nvTRPM2 is activated by ADPR, and Ca2+ is a co-agonist. However, the intramolecular mechanisms of ADPR gating as well as the role of NUDT9H are strikingly different in the two species. Whereas already subtle changes of NUDT9H abolish ADPR gating in hTRPM2, the region can be completely removed from nvTRPM2 without loss of responses to ADPR. An alternative ADPR binding site seems to be present but has not yet been characterized. The ADP-ribose pyrophosphatase (ADPRase function of nvNUDT9H has been preserved but can be abolished by numerous genetic manipulations. All these manipulations create channels that are sensitive to hydrogen peroxide which fails to induce channel activity in wild-type nvTRPM2. Therefore, the function of NUDT9H in nvTRPM2 is the degradation of ADPR, thereby reducing agonist concentration in the presence of oxidative stress. Thus, the two TRPM2 orthologs have evolved divergently but nevertheless gained analogous functional properties, i.e., gating by ADPR with Ca2+ as co-factor. Opposite roles are played by the respective NUDT9H domains, either binding of ADPR and mediating
Marsh, Adam G; Hoadley, Kenneth D; Warner, Mark E
2016-01-01
Coral reefs are under assault from stressors including global warming, ocean acidification, and urbanization. Knowing how these factors impact the future fate of reefs requires delineating stress responses across ecological, organismal and cellular scales. Recent advances in coral reef biology have integrated molecular processes with ecological fitness and have identified putative suites of temperature acclimation genes in a Scleractinian coral Acropora hyacinthus. We wondered what unique characteristics of these genes determined their coordinate expression in response to temperature acclimation, and whether or not other corals and cnidarians would likewise possess these features. Here, we focus on cytosine methylation as an epigenetic DNA modification that is responsive to environmental stressors. We identify common conserved patterns of cytosine-guanosine dinucleotide (CpG) motif frequencies in upstream promoter domains of different functional gene groups in two cnidarian genomes: a coral (Acropora digitifera) and an anemone (Nematostella vectensis). Our analyses show that CpG motif frequencies are prominent in the promoter domains of functional genes associated with environmental adaptation, particularly those identified in A. hyacinthus. Densities of CpG sites in upstream promoter domains near the transcriptional start site (TSS) are 1.38x higher than genomic background levels upstream of -2000 bp from the TSS. The increase in CpG usage suggests selection to allow for DNA methylation events to occur more frequently within 1 kb of the TSS. In addition, observed shifts in CpG densities among functional groups of genes suggests a potential role for epigenetic DNA methylation within promoter domains to impact functional gene expression responses in A. digitifera and N. vectensis. Identifying promoter epigenetic sequence motifs among genes within specific functional groups establishes an approach to describe integrated cellular responses to environmental stress in
Directory of Open Access Journals (Sweden)
Adam G Marsh
Full Text Available Coral reefs are under assault from stressors including global warming, ocean acidification, and urbanization. Knowing how these factors impact the future fate of reefs requires delineating stress responses across ecological, organismal and cellular scales. Recent advances in coral reef biology have integrated molecular processes with ecological fitness and have identified putative suites of temperature acclimation genes in a Scleractinian coral Acropora hyacinthus. We wondered what unique characteristics of these genes determined their coordinate expression in response to temperature acclimation, and whether or not other corals and cnidarians would likewise possess these features. Here, we focus on cytosine methylation as an epigenetic DNA modification that is responsive to environmental stressors. We identify common conserved patterns of cytosine-guanosine dinucleotide (CpG motif frequencies in upstream promoter domains of different functional gene groups in two cnidarian genomes: a coral (Acropora digitifera and an anemone (Nematostella vectensis. Our analyses show that CpG motif frequencies are prominent in the promoter domains of functional genes associated with environmental adaptation, particularly those identified in A. hyacinthus. Densities of CpG sites in upstream promoter domains near the transcriptional start site (TSS are 1.38x higher than genomic background levels upstream of -2000 bp from the TSS. The increase in CpG usage suggests selection to allow for DNA methylation events to occur more frequently within 1 kb of the TSS. In addition, observed shifts in CpG densities among functional groups of genes suggests a potential role for epigenetic DNA methylation within promoter domains to impact functional gene expression responses in A. digitifera and N. vectensis. Identifying promoter epigenetic sequence motifs among genes within specific functional groups establishes an approach to describe integrated cellular responses to
Directory of Open Access Journals (Sweden)
Matteo Bulati
2016-01-01
Full Text Available In the last few years, marine species have been investigated for the presence of natural products with anticancer activity. Using reversed phase chromatography, low molecular weight proteins were fractionated from the sea anemone Anemonia viridis. Four different fractions were evaluated for their cytotoxic activity by means of erythrocyte haemolysis test, MTS, and LDH assays. Finally, the antiproliferative activities of three of these fractions were studied on PC3, PLC/PRF/5, and A375 human cancer cell lines. Our analysis revealed that the four fractions showed different protein contents and diverse patterns of activity towards human PBMC and cancer cell lines. Interestingly, fractions III and IV exerted cytotoxic effects on human cells. Conversely, fractions I and II displayed very low toxic effects associated with antiproliferative activities on cancer cell lines.
Bulati, Matteo; Longo, Alessandra; Masullo, Tiziana; Vlah, Sara; Bennici, Carmelo; Bonura, Angela; Salamone, Monica; Tagliavia, Marcello; Nicosia, Aldo; Mazzola, Salvatore; Colombo, Paolo; Cuttitta, Angela
2016-01-01
In the last few years, marine species have been investigated for the presence of natural products with anticancer activity. Using reversed phase chromatography, low molecular weight proteins were fractionated from the sea anemone Anemonia viridis . Four different fractions were evaluated for their cytotoxic activity by means of erythrocyte haemolysis test, MTS, and LDH assays. Finally, the antiproliferative activities of three of these fractions were studied on PC3, PLC/PRF/5, and A375 human cancer cell lines. Our analysis revealed that the four fractions showed different protein contents and diverse patterns of activity towards human PBMC and cancer cell lines. Interestingly, fractions III and IV exerted cytotoxic effects on human cells. Conversely, fractions I and II displayed very low toxic effects associated with antiproliferative activities on cancer cell lines.
PhcrTx2, a New Crab-Paralyzing Peptide Toxin from the Sea Anemone Phymanthus crucifer
Garateix, Anoland; Salceda, Emilio; Zaharenko, André Junqueira; Pons, Tirso; Santos, Yúlica; Arreguín, Roberto; Ständker, Ludger; Forssmann, Wolf-Georg; Tytgat, Jan; Vega, Rosario
2018-01-01
Sea anemones produce proteinaceous toxins for predation and defense, including peptide toxins that act on a large variety of ion channels of pharmacological and biomedical interest. Phymanthus crucifer is commonly found in the Caribbean Sea; however, the chemical structure and biological activity of its toxins remain unknown, with the exception of PhcrTx1, an acid-sensing ion channel (ASIC) inhibitor. Therefore, in the present work, we focused on the isolation and characterization of new P. crucifer toxins by chromatographic fractionation, followed by a toxicity screening on crabs, an evaluation of ion channels, and sequence analysis. Five groups of toxic chromatographic fractions were found, and a new paralyzing toxin was purified and named PhcrTx2. The toxin inhibited glutamate-gated currents in snail neurons (maximum inhibition of 35%, IC50 4.7 µM), and displayed little or no influence on voltage-sensitive sodium/potassium channels in snail and rat dorsal root ganglion (DRG) neurons, nor on a variety of cloned voltage-gated ion channels. The toxin sequence was fully elucidated by Edman degradation. PhcrTx2 is a new β-defensin-fold peptide that shares a sequence similarity to type 3 potassium channels toxins. However, its low activity on the evaluated ion channels suggests that its molecular target remains unknown. PhcrTx2 is the first known paralyzing toxin in the family Phymanthidae. PMID:29414882
PhcrTx2, a New Crab-Paralyzing Peptide Toxin from the Sea Anemone Phymanthus crucifer
Directory of Open Access Journals (Sweden)
Armando Alexei Rodríguez
2018-02-01
Full Text Available Sea anemones produce proteinaceous toxins for predation and defense, including peptide toxins that act on a large variety of ion channels of pharmacological and biomedical interest. Phymanthus crucifer is commonly found in the Caribbean Sea; however, the chemical structure and biological activity of its toxins remain unknown, with the exception of PhcrTx1, an acid-sensing ion channel (ASIC inhibitor. Therefore, in the present work, we focused on the isolation and characterization of new P. crucifer toxins by chromatographic fractionation, followed by a toxicity screening on crabs, an evaluation of ion channels, and sequence analysis. Five groups of toxic chromatographic fractions were found, and a new paralyzing toxin was purified and named PhcrTx2. The toxin inhibited glutamate-gated currents in snail neurons (maximum inhibition of 35%, IC50 4.7 µM, and displayed little or no influence on voltage-sensitive sodium/potassium channels in snail and rat dorsal root ganglion (DRG neurons, nor on a variety of cloned voltage-gated ion channels. The toxin sequence was fully elucidated by Edman degradation. PhcrTx2 is a new β-defensin-fold peptide that shares a sequence similarity to type 3 potassium channels toxins. However, its low activity on the evaluated ion channels suggests that its molecular target remains unknown. PhcrTx2 is the first known paralyzing toxin in the family Phymanthidae.
Häussermann, V.
2003-01-01
Two species of sea anemones with a conspicuous marginal ruff of frond-like structures encompassing the tentacular crown occur on the Chilean coast. Oulactis concinnata (= Isoulactis chilensis) (Drayton in Dana, 1846) is re-described in detail and further information is provided for Oulactis
DEFF Research Database (Denmark)
Leviev, I; Grimmelikhuijzen, C J
1995-01-01
a polyp, a medusa, and a planula larva stage. Recently, a neuropeptide, metamorphosis in a hydroid planula larva to become a hydropolyp [Leitz, T., Morand, K. & Mann, M. (1994) Dev. Biol. 163, 440-446]. Here, we have cloned...... the precursor protein for this metamorphosis-inducing neuropeptide from sea anemones. The precursor protein is 514-amino acid residues long and contains 10 copies of the immature, authentic neuropeptide (Gln-Gln-Pro-Gly-Leu-Trp-Gly). All neuropeptide copies are preceded by Xaa-Pro or Xaa-Ala sequences...
Alvarez, Carlos; Ros, Uris; Valle, Aisel; Pedrera, Lohans; Soto, Carmen; Hervis, Yadira P; Cabezas, Sheila; Valiente, Pedro A; Pazos, Fabiola; Lanio, Maria E
2017-10-01
Actinoporins constitute a unique class of pore-forming toxins found in sea anemones that are able to bind and oligomerize in membranes, leading to cell swelling, impairment of ionic gradients and, eventually, to cell death. In this review we summarize the knowledge generated from the combination of biochemical and biophysical approaches to the study of sticholysins I and II (Sts, StI/II), two actinoporins largely characterized by the Center of Protein Studies at the University of Havana during the last 20 years. These approaches include strategies for understanding the toxin structure-function relationship, the protein-membrane association process leading to pore formation and the interaction of toxin with cells. The rational combination of experimental and theoretical tools have allowed unraveling, at least partially, of the complex mechanisms involved in toxin-membrane interaction and of the molecular pathways triggered upon this interaction. The study of actinoporins is important not only to gain an understanding of their biological roles in anemone venom but also to investigate basic molecular mechanisms of protein insertion into membranes, protein-lipid interactions and the modulation of protein conformation by lipid binding. A deeper knowledge of the basic molecular mechanisms involved in Sts-cell interaction, as described in this review, will support the current investigations conducted by our group which focus on the design of immunotoxins against tumor cells and antigen-releasing systems to cell cytosol as Sts-based vaccine platforms.
Body size and symbiotic status influence gonad development in Aiptasia pallida anemones.
Carlisle, Judith F; Murphy, Grant K; Roark, Alison M
2017-01-01
Pale anemones ( Aiptasia pallida ) coexist with dinoflagellates (primarily Symbiodinium minutum ) in a mutualistic relationship. The purpose of this study was to investigate the role of these symbionts in gonad development of anemone hosts. Symbiotic and aposymbiotic anemones were subjected to light cycles that induced gametogenesis. These anemones were then sampled weekly for nine weeks, and gonad development was analyzed histologically. Anemone size was measured as mean body column diameter, and oocytes or sperm follicles were counted for each anemone. Generalized linear models were used to evaluate the influence of body size and symbiotic status on whether gonads were present and on the number of oocytes or sperm follicles produced. Body size predicted whether gonads were present, with larger anemones being more likely than smaller anemones to develop gonads. Both body size and symbiotic status predicted gonad size, such that larger and symbiotic anemones produced more oocytes and sperm follicles than smaller and aposymbiotic anemones. Overall, only 22 % of aposymbiotic females produced oocytes, whereas 63 % of symbiotic females produced oocytes. Similarly, 6 % of aposymbiotic males produced sperm follicles, whereas 60 % of symbiotic males produced sperm follicles. Thus, while gonads were present in 62 % of symbiotic anemones, they were present in only 11 % of aposymbiotic anemones. These results indicate that dinoflagellate symbionts influence gonad development and thus sexual maturation in both female and male Aiptasia pallida anemones. This finding substantiates and expands our current understanding of the importance of symbionts in the development and physiology of cnidarian hosts.
Krediet, Cory J; Meyer, Julie L; Gimbrone, Nicholas; Yanong, Roy; Berzins, Ilze; Alagely, Ali; Castro, Herman; Ritchie, Kim B; Paul, Valerie J; Teplitski, Max
2014-06-01
Coral reefs are under increasing stress caused by global and local environmental changes, which are thought to increase the susceptibility of corals to opportunistic pathogens. In the absence of an easily culturable model animal, the understanding of the mechanisms of disease progression in corals remains fairly limited. In the present study, we tested the susceptibility of the tropical sea anemone Aiptasia pallida to an opportunistic coral pathogen (Serratia marcescens). A. pallida was susceptible to S. marcescens PDL100 and responded to this opportunistic coral pathogen with darkening of the tissues and retraction of tentacles, followed by complete disintegration of polyp tissues. Histological observations revealed loss of zooxanthellae and structural changes in eosinophilic granular cells in response to pathogen infection. A screen of S. marcescens mutants identified a motility and tetrathionate reductase mutants as defective in virulence in the A. pallida infection model. In co-infections with the wild-type strain, the tetrathionate reductase mutant was less fit within the surface mucopolysaccharide layer of the host coral Acropora palmata. © 2014 Society for Applied Microbiology and John Wiley & Sons Ltd.
Directory of Open Access Journals (Sweden)
Subramanian Bragadeeswaran
2011-07-01
Full Text Available Sea anemones (Actiniaria are solitary, ocean-dwelling members of the phylum Cnidaria and the class Anthozoa. In this study, we screened antibacterial activity of two benthic sea anemones (Heteractis magnifica and H. aurora collected from the Mandapam coast of southeast India. Crude extracts of the sea anemone were assayed against seven bacterial biofilms isolated from three different test panels. The crude extract of H. magnifica showed a maximum inhibition zone of 18 mm against Pseudomonas sp. and Escherichia coli and a minimum inhibition zone of 3 mm against Pseudomonas aeruginosa, Micrococcus sp., and Bacillus cerens for methanol, acetone, and DCM extracts, respectively. The butanol extract of H. aurora showed a maximum inhibition zone of 23 mm against Vibrio parahaemolyticus, whereas the methanol extract revealed a minimum inhibition zone of 1 mm against V. parahaemolyticus. The present study revealed that the H. aurora extracts were more effective than those of H. magnifica and that the active compounds from the sea anemone can be used as antifouling compounds.Las anémonas de mar (Actiniaria son solitarias, habitantes oceánicos del phylum Cnidaria y de la clase Anthozoa. En este estudio se determina la actividad antibacteriana de dos anémonas bentónicas Heteractis magnifica y H. aurora recolectadas en la costa de Mandapam, sudeste de India. Los extractos crudos de estas anémonas fueron ensayados frente a siete biofilms bacterianos aislados de tres paneles de control distintos. El extracto crudo de la anémona H. magnifica mostró una zona inhibición máxima de 18 mm contra Psudomonas sp. y Escherichia coli y la zona de inhibición mínima de 3 mm fue encontrada frente a Pseudomonas aeruginosa, Micrococus sp. y Bacillus cerens de extractos de metanol, acetona y DCM respectivamente. El extracto de butanol de la anémona H. magnifica mostró una zona de inhibición máxima de 23 mm frente a Vibrio parahemolyticus, mientras que con el
Shick, J M
1990-08-01
Depending on their size and morphology, anthozoan polyps and colonies may be diffusion-limited in their oxygen consumption, even under well-stirred, air-saturated conditions. This is indicated by an enhancement of oxygen consumption under steady-state hyperoxic conditions that simulate the levels of O2 produced photosynthetically by zooxanthellae in the hosts' tissues. Such hyperoxia in the tissues of zooxanthellate species negates the effect of the diffusive boundary layer, and increases the rate of oxygen consumption; thus, in many cases, the rate of respiration measured under normoxia in the dark may not be representative of the rate during the day when the zooxanthellae are photosynthesizing and when the supply of oxygen for respiration is in the tissues themselves, not from the environment. These results have implications in respirometric methodology and in calculating the rate of gross photosynthesis in energetic studies. The activity of cytochrome c oxidase is higher in aposymbiotic than in zooxanthellate specimens of the sea anemone Aiptasia pulchella, and this may indicate a compensation for the relative hypoxia in the tissues of the former, enhancing the delivery of oxygen to the mitochondria from the environment.
APETx4, a Novel Sea Anemone Toxin and a Modulator of the Cancer-Relevant Potassium Channel KV10.1
Directory of Open Access Journals (Sweden)
Lien Moreels
2017-09-01
Full Text Available The human ether-à-go-go channel (hEag1 or KV10.1 is a cancer-relevant voltage-gated potassium channel that is overexpressed in a majority of human tumors. Peptides that are able to selectively inhibit this channel can be lead compounds in the search for new anticancer drugs. Here, we report the activity-guided purification and electrophysiological characterization of a novel KV10.1 inhibitor from the sea anemone Anthopleura elegantissima. Purified sea anemone fractions were screened for inhibitory activity on KV10.1 by measuring whole-cell currents as expressed in Xenopus laevis oocytes using the two-microelectrode voltage clamp technique. Fractions that showed activity on Kv10.1 were further purified by RP-HPLC. The amino acid sequence of the peptide was determined by a combination of MALDI- LIFT-TOF/TOF MS/MS and CID-ESI-FT-ICR MS/MS and showed a high similarity with APETx1 and APETx3 and was therefore named APETx4. Subsequently, the peptide was electrophysiologically characterized on KV10.1. The selectivity of the toxin was investigated on an array of voltage-gated ion channels, including the cardiac human ether-à-go-go-related gene potassium channel (hERG or Kv11.1. The toxin inhibits KV10.1 with an IC50 value of 1.1 μM. In the presence of a similar toxin concentration, a shift of the activation curve towards more positive potentials was observed. Similar to the effect of the gating modifier toxin APETx1 on hERG, the inhibition of Kv10.1 by the isolated toxin is reduced at more positive voltages and the peptide seems to keep the channel in a closed state. Although the peptide also induces inhibitory effects on other KV and NaV channels, it exhibits no significant effect on hERG. Moreover, APETx4 induces a concentration-dependent cytotoxic and proapoptotic effect in various cancerous and noncancerous cell lines. This newly identified KV10.1 inhibitor can be used as a tool to further characterize the oncogenic channel KV10.1 or as a
Cristofori-Armstrong, Ben; Rash, Lachlan D
2017-12-01
Acid-sensing ion channels (ASICs) are proton-activated cation channels that are expressed in a variety of neuronal and non-neuronal tissues. As proton-gated channels, they have been implicated in many pathophysiological conditions where pH is perturbed. Venom derived compounds represent the most potent and selective modulators of ASICs described to date, and thus have been invaluable as pharmacological tools to study ASIC structure, function, and biological roles. There are now ten ASIC modulators described from animal venoms, with those from snakes and spiders favouring ASIC1, while the sea anemones preferentially target ASIC3. Some modulators, such as the prototypical ASIC1 modulator PcTx1 have been studied in great detail, while some of the newer members of the club remain largely unstudied. Here we review the current state of knowledge on venom derived ASIC modulators, with a particular focus on their molecular interaction with ASICs, what they have taught us about channel structure, and what they might still reveal about ASIC function and pathophysiological roles. This article is part of the Special Issue entitled 'Venom-derived Peptides as Pharmacological Tools.' Copyright © 2017 Elsevier Ltd. All rights reserved.
Rodríguez, Estefanía; Barbeitos, Marcos S.; Brugler, Mercer R.; Crowley, Louise M.; Grajales, Alejandro; Gusmão, Luciana; Häussermann, Verena; Reft, Abigail; Daly, Marymegan
2014-01-01
Sea anemones (order Actiniaria) are among the most diverse and successful members of the anthozoan subclass Hexacorallia, occupying benthic marine habitats across all depths and latitudes. Actiniaria comprises approximately 1,200 species of solitary and skeleton-less polyps and lacks any anatomical synapomorphy. Although monophyly is anticipated based on higher-level molecular phylogenies of Cnidaria, to date, monophyly has not been explicitly tested and at least some hypotheses on the diversification of Hexacorallia have suggested that actiniarians are para- or poly-phyletic. Published phylogenies have demonstrated the inadequacy of existing morphological-based classifications within Actiniaria. Superfamilial groups and most families and genera that have been rigorously studied are not monophyletic, indicating conflict with the current hierarchical classification. We test the monophyly of Actiniaria using two nuclear and three mitochondrial genes with multiple analytical methods. These analyses are the first to include representatives of all three currently-recognized suborders within Actiniaria. We do not recover Actiniaria as a monophyletic clade: the deep-sea anemone Boloceroides daphneae, previously included within the infraorder Boloceroidaria, is resolved outside of Actiniaria in several of the analyses. We erect a new genus and family for B. daphneae, and rank this taxon incerti ordinis. Based on our comprehensive phylogeny, we propose a new formal higher-level classification for Actiniaria composed of only two suborders, Anenthemonae and Enthemonae. Suborder Anenthemonae includes actiniarians with a unique arrangement of mesenteries (members of Edwardsiidae and former suborder Endocoelantheae). Suborder Enthemonae includes actiniarians with the typical arrangement of mesenteries for actiniarians (members of former suborders Protantheae, Ptychodacteae, and Nynantheae and subgroups therein). We also erect subgroups within these two newly-erected suborders
Directory of Open Access Journals (Sweden)
Estefanía Rodríguez
Full Text Available Sea anemones (order Actiniaria are among the most diverse and successful members of the anthozoan subclass Hexacorallia, occupying benthic marine habitats across all depths and latitudes. Actiniaria comprises approximately 1,200 species of solitary and skeleton-less polyps and lacks any anatomical synapomorphy. Although monophyly is anticipated based on higher-level molecular phylogenies of Cnidaria, to date, monophyly has not been explicitly tested and at least some hypotheses on the diversification of Hexacorallia have suggested that actiniarians are para- or poly-phyletic. Published phylogenies have demonstrated the inadequacy of existing morphological-based classifications within Actiniaria. Superfamilial groups and most families and genera that have been rigorously studied are not monophyletic, indicating conflict with the current hierarchical classification. We test the monophyly of Actiniaria using two nuclear and three mitochondrial genes with multiple analytical methods. These analyses are the first to include representatives of all three currently-recognized suborders within Actiniaria. We do not recover Actiniaria as a monophyletic clade: the deep-sea anemone Boloceroides daphneae, previously included within the infraorder Boloceroidaria, is resolved outside of Actiniaria in several of the analyses. We erect a new genus and family for B. daphneae, and rank this taxon incerti ordinis. Based on our comprehensive phylogeny, we propose a new formal higher-level classification for Actiniaria composed of only two suborders, Anenthemonae and Enthemonae. Suborder Anenthemonae includes actiniarians with a unique arrangement of mesenteries (members of Edwardsiidae and former suborder Endocoelantheae. Suborder Enthemonae includes actiniarians with the typical arrangement of mesenteries for actiniarians (members of former suborders Protantheae, Ptychodacteae, and Nynantheae and subgroups therein. We also erect subgroups within these two newly
Directory of Open Access Journals (Sweden)
Passamaneck Yale J
2012-12-01
Full Text Available Abstract Background The contribution of cell proliferation to regeneration varies greatly between different metazoan models. Planarians rely on pluripotent neoblasts and amphibian limb regeneration depends upon formation of a proliferative blastema, while regeneration in Hydra can occur in the absence of cell proliferation. Recently, the cnidarian Nematostella vectensis has shown potential as a model for studies of regeneration because of the ability to conduct comparative studies of patterning during embryonic development, asexual reproduction, and regeneration. The present study investigates the pattern of cell proliferation during the regeneration of oral structures and the role of cell proliferation in this process. Results In intact polyps, cell proliferation is observed in both ectodermal and endodermal tissues throughout the entire oral-aboral axis, including in the tentacles and physa. Following bisection, there is initially little change in proliferation at the wound site of the aboral fragment, however, beginning 18 to 24 hours after amputation there is a dramatic increase in cell proliferation at the wound site in the aboral fragment. This elevated level of proliferation is maintained throughout the course or regeneration of oral structures, including the tentacles, the mouth, and the pharynx. Treatments with the cell proliferation inhibitors hydroxyurea and nocodazole demonstrate that cell proliferation is indispensable for the regeneration of oral structures. Although inhibition of regeneration by nocodazole was generally irreversible, secondary amputation reinitiates cell proliferation and regeneration. Conclusions The study has found that high levels of cell proliferation characterize the regeneration of oral structures in Nematostella, and that this cell proliferation is necessary for the proper progression of regeneration. Thus, while cell proliferation contributes to regeneration of oral structures in both Nematostella and
Early evolution of the LIM homeobox gene family
Energy Technology Data Exchange (ETDEWEB)
Srivastava, Mansi; Larroux, Claire; Lu, Daniel R; Mohanty, Kareshma; Chapman, Jarrod; Degnan, Bernard M; Rokhsar, Daniel S
2010-01-01
LIM homeobox (Lhx) transcription factors are unique to the animal lineage and have patterning roles during embryonic development in flies, nematodes and vertebrates, with a conserved role in specifying neuronal identity. Though genes of this family have been reported in a sponge and a cnidarian, the expression patterns and functions of the Lhx family during development in non-bilaterian phyla are not known. We identified Lhx genes in two cnidarians and a placozoan and report the expression of Lhx genes during embryonic development in Nematostella and the demosponge Amphimedon. Members of the six major LIM homeobox subfamilies are represented in the genomes of the starlet sea anemone, Nematostella vectensis, and the placozoan Trichoplax adhaerens. The hydrozoan cnidarian, Hydra magnipapillata, has retained four of the six Lhx subfamilies, but apparently lost two others. Only three subfamilies are represented in the haplosclerid demosponge Amphimedon queenslandica. A tandem cluster of three Lhx genes of different subfamilies and a gene containing two LIM domains in the genome of T. adhaerens (an animal without any neurons) indicates that Lhx subfamilies were generated by tandem duplication. This tandem cluster in Trichoplax is likely a remnant of the original chromosomal context in which Lhx subfamilies first appeared. Three of the six Trichoplax Lhx genes are expressed in animals in laboratory culture, as are all Lhx genes in Hydra. Expression patterns of Nematostella Lhx genes correlate with neural territories in larval and juvenile polyp stages. In the aneural demosponge, A. queenslandica, the three Lhx genes are expressed widely during development, including in cells that are associated with the larval photosensory ring. The Lhx family expanded and diversified early in animal evolution, with all six subfamilies already diverged prior to the cnidarian-placozoan-bilaterian last common ancestor. In Nematostella, Lhx gene expression is correlated with neural
Early evolution of the LIM homeobox gene family
Directory of Open Access Journals (Sweden)
Degnan Bernard M
2010-01-01
Full Text Available Abstract Background LIM homeobox (Lhx transcription factors are unique to the animal lineage and have patterning roles during embryonic development in flies, nematodes and vertebrates, with a conserved role in specifying neuronal identity. Though genes of this family have been reported in a sponge and a cnidarian, the expression patterns and functions of the Lhx family during development in non-bilaterian phyla are not known. Results We identified Lhx genes in two cnidarians and a placozoan and report the expression of Lhx genes during embryonic development in Nematostella and the demosponge Amphimedon. Members of the six major LIM homeobox subfamilies are represented in the genomes of the starlet sea anemone, Nematostella vectensis, and the placozoan Trichoplax adhaerens. The hydrozoan cnidarian, Hydra magnipapillata, has retained four of the six Lhx subfamilies, but apparently lost two others. Only three subfamilies are represented in the haplosclerid demosponge Amphimedon queenslandica. A tandem cluster of three Lhx genes of different subfamilies and a gene containing two LIM domains in the genome of T. adhaerens (an animal without any neurons indicates that Lhx subfamilies were generated by tandem duplication. This tandem cluster in Trichoplax is likely a remnant of the original chromosomal context in which Lhx subfamilies first appeared. Three of the six Trichoplax Lhx genes are expressed in animals in laboratory culture, as are all Lhx genes in Hydra. Expression patterns of Nematostella Lhx genes correlate with neural territories in larval and juvenile polyp stages. In the aneural demosponge, A. queenslandica, the three Lhx genes are expressed widely during development, including in cells that are associated with the larval photosensory ring. Conclusions The Lhx family expanded and diversified early in animal evolution, with all six subfamilies already diverged prior to the cnidarian-placozoan-bilaterian last common ancestor. In
Trace element profiles of the sea anemone Anemonia viridis living nearby a natural CO2 vent
Directory of Open Access Journals (Sweden)
Rael Horwitz
2014-09-01
Full Text Available Ocean acidification (OA is not an isolated threat, but acts in concert with other impacts on ecosystems and species. Coastal marine invertebrates will have to face the synergistic interactions of OA with other global and local stressors. One local factor, common in coastal environments, is trace element contamination. CO2 vent sites are extensively studied in the context of OA and are often considered analogous to the oceans in the next few decades. The CO2 vent found at Levante Bay (Vulcano, NE Sicily, Italy also releases high concentrations of trace elements to its surrounding seawater, and is therefore a unique site to examine the effects of long-term exposure of nearby organisms to high pCO2 and trace element enrichment in situ. The sea anemone Anemonia viridis is prevalent next to the Vulcano vent and does not show signs of trace element poisoning/stress. The aim of our study was to compare A. viridis trace element profiles and compartmentalization between high pCO2 and control environments. Rather than examining whole anemone tissue, we analyzed two different body compartments—the pedal disc and the tentacles, and also examined the distribution of trace elements in the tentacles between the animal and the symbiotic algae. We found dramatic changes in trace element tissue concentrations between the high pCO2/high trace element and control sites, with strong accumulation of iron, lead, copper and cobalt, but decreased concentrations of cadmium, zinc and arsenic proximate to the vent. The pedal disc contained substantially more trace elements than the anemone’s tentacles, suggesting the pedal disc may serve as a detoxification/storage site for excess trace elements. Within the tentacles, the various trace elements displayed different partitioning patterns between animal tissue and algal symbionts. At both sites iron was found primarily in the algae, whereas cadmium, zinc and arsenic were primarily found in the animal tissue. Our data
Binsarhan, Mohammad
2016-01-01
Recent works has highlighted the contribution of microbes to animal function. In this regard, the microbial community associated with corals has become a growing field of research in order to understand how microbes contribute to the host organisms’ response to environmental changes. It has been shown that microbes associated with corals have important functions in the coral holobiont such as immunity and nutrient assimilation. However, corals are notoriously difficult to work with. To this end, the sea anemone Aiptasia is becoming a model organism for coral symbiosis. Given the importance of host-microbiome interactions, the topic of this thesis is to assess microbial structure of Aiptasia, culture prominent bacterial members, and compare bacterial community structure to corals. Different molecular methods have been applied using 16S rRNA bacterial gene fragments to characterize the microbial composition of Aiptasia. 16S rRNA gene sequence derived from cultured bacteria was compared to 16S rRNA gene sequences retrieved from native Red Sea Aiptasia. Inter-individual as well as methodological differences were found to account for variance in microbiome composition. However, all approaches showed a highly abundant microbial taxon belonging to the genus Alteromonas in all samples. The Alteromonas species was successfully isolated for further research targeting microbiome selection mechanisms in Aiptasia. Future investigations by using different molecular tools will help to define the functions and relationship between the Aiptasia and its complex microbiome.
Moran, Yehu; Kahn, Roy; Cohen, Lior; Gur, Maya; Karbat, Izhar; Gordon, Dalia; Gurevitz, Michael
2007-08-15
Av3 is a short peptide toxin from the sea anemone Anemonia viridis shown to be active on crustaceans and inactive on mammals. It inhibits inactivation of Na(v)s (voltage-gated Na+ channels) like the structurally dissimilar scorpion alpha-toxins and type I sea anemone toxins that bind to receptor site-3. To examine the potency and mode of interaction of Av3 with insect Na(v)s, we established a system for its expression, mutagenized it throughout, and analysed it in toxicity, binding and electrophysiological assays. The recombinant Av3 was found to be highly toxic to blowfly larvae (ED50=2.65+/-0.46 pmol/100 mg), to compete well with the site-3 toxin LqhalphaIT (from the scorpion Leiurus quinquestriatus) on binding to cockroach neuronal membranes (K(i)=21.4+/-7.1 nM), and to inhibit the inactivation of Drosophila melanogaster channel, DmNa(v)1, but not that of mammalian Na(v)s expressed in Xenopus oocytes. Moreover, like other site-3 toxins, the activity of Av3 was synergically enhanced by ligands of receptor site-4 (e.g. scorpion beta-toxins). The bioactive surface of Av3 was found to consist mainly of aromatic residues and did not resemble any of the bioactive surfaces of other site-3 toxins. These analyses have portrayed a toxin that might interact with receptor site-3 in a different fashion compared with other ligands of this site. This assumption was corroborated by a D1701R mutation in DmNa(v)1, which has been shown to abolish the activity of all other site-3 ligands, except Av3. All in all, the present study provides further evidence for the heterogeneity of receptor site-3, and raises Av3 as a unique model for design of selective anti-insect compounds.
Directory of Open Access Journals (Sweden)
M. AHSIN RIFA’I
2012-11-01
Full Text Available Rifa’i MA. 2012. Keragaman genetik simbion alga Zooxanthellae pada anemone laut Stichodactyla gigantea (Forsskal 1775 hasil reproduksi aseksual. Bioteknologi 9: 49-56. Penelitian ini bertujuan untuk mengetahui keragaman genetik simbion alga zooxanthellae yang bersimbiosis dengan anemon laut Stichodactyla gigantea hasil reproduksi aseksual dengan teknik fragmentasi. Penelitian dilaksanakan selama 10 bulan, mulai Oktober 2011 – Juli 2012, bertempat di kolam pembibitan Universitas Hasanuddin di Pulau Barrang Lompo dan kawasan terumbu karang Pulau Barrang Lompo. Rangkaian penelitian meliputi koleksi induk anemon laut, aklimatisasi, fragmentasi tubuh, dan kultur anemon di kawasan terumbu karang, serta koleksi alga zooxanthellae untuk analisis PCR-ISSR. Keragaman genetik dianalisis menggunakan analisis pengelompokan data matriks (cluster analysis dan pembuatan dendrogram pohon kekerabatan menggunakan metode UPGMA melalui program NTSYS. Hasilnya menunjukkan bahwa seluruh primer menghasilkan pita polimorfis antara 16,67%-66,67%. Hasil analisis variasi genetik terhadap zooxanthellae yang ditemukan pada anemon uji menunjukkan polimorfisme sebesar 37,93%. Sedangkan berdasarkan analisis jarak genetik ditemukan tingkat ketidakmiripan sebesar 19% yang bersumber dari 2 kelompok anemon utama yaitu kelompok anemon hasil fragmentasi 4 bagian (AF4 yang terpisah dengan kelompok anemon alami (AA dan anemon hasil fragmentasi 2 bagian (AF2.
Cervino, J M; Hayes, R L; Honovich, M; Goreau, T J; Jones, S; Rubec, P J
2003-05-01
Sodium cyanide (NaCN) is widely used for the capture of reef fish throughout Southeast Asia and causes extensive fish mortality, but the effect of NaCN on reef corals remains debated. To document the impact of cyanide exposure on corals, the species Acropora millepora, Goniopora sp., Favites abdita, Trachyphyllia geoffrio, Plerogyra sp., Heliofungia actinformis, Euphyllia divisa, and Scarophyton sp., and the sea anemone Aiptasia pallida were exposed to varying concentrations of cyanide for varying time periods. Corals were exposed to 50, 100, 300, and 600 mg/l of cyanide ion (CN(-)) for 1-2 min (in seawater, the CN(-) forms hydrocyanic acid). These concentrations are much lower than those reportedly used by fish collectors. Exposed corals and anemones immediately retracted their tentacles and mesenterial filaments, and discharged copious amounts of mucus containing zooxanthellae. Gel electrophoreses techniques found changes in protein expression in both zooxanthellae and host tissue. Corals and anemones exposed to cyanide showed an immediate increase in mitotic cell division of their zooxenthellae, and a decrease in zooxanthellae density. In contrast, zooxanthellae cell division and density remained constant in controls. Histopathological changes included gastrodermal disruption, mesogleal degradation, and increased mucus in coral tissues. Zooxanthellae showed pigment loss, swelling, and deformation. Mortality occurred at all exposure levels. Exposed specimens experienced an increase in the ratio of gram-negative to gram-positive bacteria on the coral surface. The results demonstrate that exposure cyanide causes mortality to corals and anemones, even when applied at lower levels than that used by fish collectors. Even brief exposure to cyanide caused slow-acting and long-term damage to corals and their zooxanthellae.
Hartog, den J.C.
1997-01-01
The genus Amphiprion Bloch & Schneider, 1801, is represented in the Seychelles by two species, A. akallopisos Bleeker, 1853, and the endemic A. fuscocaudatus Allen, 1972. Throughout its distributional range Amphiprion akallopisos has exclusively been recorded to associate with the clownfish anemones
Meinhardt, Hans
2015-09-01
Conserved from Cnidarians to vertebrates, the dorsoventral (DV) axis is patterned by the Chordin-BMP pathway. However, the functions of the pathway's components are very different in different phyla. By modeling it is shown that many observations can be integrated by the assumption that BMP, acting as an inhibitory component in more ancestral systems, became a necessary and activating component for the generation of a secondary and antipodal-located signaling center. The different realizations seen in vertebrates, Drosophila, sea urchins and Nematostella allow reconstruction of a chain of modifications during evolution. BMP-signaling is proposed to be based on a pattern-forming reaction of the activator-depleted substrate type in which BMP-signaling acts via pSmad as the local self-enhancing component and the depletion of the highly mobile BMP-Chordin complex as the long-ranging antagonistic component. Due to the rapid removal of the BMP/Chordin complex during BMP-signaling, an oriented transport and "shuttling" results, although only ordinary diffusion is involved. The system can be self-organizing, allowing organizer formation even from near homogeneous initial situations. Organizers may regenerate after removal. Although connected with some losses of self-regulation, for large embryos as in amphibians, the employment of maternal determinants is an efficient strategy to make sure that only a single organizer of each type is generated. The generation of dorsoventral positional information along a long-extended anteroposterior (AP) axis cannot be achieved directly by a single patch-like organizer. Nature found different solutions for this task. Corresponding models provide a rationale for the well-known reversal in the dorsoventral patterning between vertebrates and insects. Copyright © 2015 Elsevier Inc. All rights reserved.
Geller, J B; Walton, E D
2001-09-01
Clonal growth and symbiosis with photosynthetic zooxanthellae typify many genera of marine organisms, suggesting that these traits are usually conserved. However, some, such as Anthopleura, a genus of sea anemones, contain members lacking one or both of these traits. The evolutionary origins of these traits in 13 species of Anthopleura were inferred from a molecular phylogeny derived from 395 bp of the mitochondrial 16S rRNA gene and 410 bp of the mitochondrial cytochrome oxidase subunit III gene. Sequences from these genes were combined and analyzed by maximum-parsimony, maximum-likelihood, and neighbor-joining methods. Best trees from each method indicated a minimum of four changes in growth mode and that symbiosis with zooxanthellae has arisen independently in eastern and western Pacific species. Alternative trees in which species sharing growth modes or the symbiotic condition were constrained to be monophyletic were significantly worse than best trees. Although clade composition was mostly consistent with geographic sympatry, A. artemisia from California was included in the western Pacific clade. Likewise, A. midori from Japan was not placed in a clade containing only other Asian congeners. The history of Anthopleura includes repeated shifts between clonality and solitariness, repeated attainment of symbiosis with zooxanthellae, and intercontinental dispersal.
Horst, R.
1903-01-01
Among an interesting collection of Invertebrate animals from Sabang-bay (Poeloe Weh) brought together by Mr. G. A. J. van der Sande, Surgeon in the Dutch naval service, and presented by him to the Leyden Museum, there is a large Anemone, belonging to the genus Discosoma. About this specimen Mr. van
van Alstyne, K. L.; Dominique, V. J.; Muller-Parker, G.
2009-03-01
Many groups of tropical cnidarians including scleractinian corals, octocorals, corallimorphs, and anemones contain the tertiary sulfonium compound dimethylsulfoniopropionate (DMSP). It is not known if the compound is synthesized by the animals, their microalgal symbionts, or derived through their diet. We determined the source of the DMSP in several species of tropical and temperate anemones using three approaches: (1) conducting comparative measurements of DMSP in aposymbiotic and zooxanthellate anemones of three species that harbor zooxanthellae, and similar measurements in one species that can harbor both zooxanthellae and zoochlorellae, (2) manipulating the presence or absence of zooxanthellae by inoculating juvenile aposymbiotic anemones ( Aiptasia pallida) with their symbiont, Symbiodinium bermudense, and (3) manipulating the numbers of S. bermudense by growing aposymbiotic and zooxanthellate A. pallida in the light and the dark. DMSP was present in zooxanthellate anemones in concentrations of 3.4-15 μmol g-1 fresh mass (FM). In aposymbiotic Aiptasia spp. and Anthopleura elegantissima that lacked large numbers of zooxanthellae, concentrations ranged from being undetectable to 0.43 μmol g-1 FM. When aposymbiotic A. pallida were inoculated with zooxanthellae, concentrations of DMSP were an average of 4.24 μmol g-1 FM after 5 weeks; DMSP was undetectable in uninoculated control animals. Aposymbiotic anemones maintained in the light or the dark for 6 weeks contained no DMSP or zooxanthellae. Zooxanthellate anemones in the light contained five times as many zooxanthellae and approximately 7.5 times as much DMSP as zooxanthellate anemones maintained in the dark. Taken together, these data show that the zooxanthellae are the sole source of DMSP in A. pallida. The trends in DMSP concentrations in other species of zooxanthellate anemones suggest that this phenomenon is not limited to A. pallida but may be more generally true for other anemones or even other
Directory of Open Access Journals (Sweden)
Aldo Nicosia
Full Text Available Gene family encoding small Heat-Shock Proteins (sHSPs containing α-crystallin domain are found both in prokaryotic and eukaryotic organisms; however, there is limited knowledge of their evolution. In this study, two small HSP genes termed AvHSP28.6 and AvHSP27, both organized in one intron and two exons, were characterised in the Mediterranean snakelocks anemone Anemonia viridis. The release of the genome sequence of Hydra magnipapillata and Nematostella vectensis enabled a comprehensive study of the molecular evolution of α-crystallin gene family among cnidarians. Most of the H. magnipapillata sHSP genes share the same gene organization described for AvHSP28.6 and AvHSP27, differing from the sHSP genes of N. vectensis which mainly show an intronless architecture. The different genomic organization of sHSPs, the phylogenetic analyses based on protein sequences, and the relationships among Cnidarians, suggest that the A.viridis sHSPs represent the common ancestor from which H. magnipapillata genes directly evolved through segmental genome duplication. Additionally retroposition events may be considered responsible for the divergence of sHSP genes of N. vectensis from A. viridis. Analyses of transcriptional expression profile showed that AvHSP28.6 was constitutively expressed among different tissues from both ectodermal and endodermal layers of the adult sea anemones, under normal physiological conditions and also under different stress condition. Specifically, we profiled the transcriptional activation of AvHSP28.6 after challenges with different abiotic/biotic stresses showing induction by extreme temperatures, heavy metals exposure and immune stimulation. Conversely, no AvHSP27 transcript was detected in such dissected tissues, in adult whole body cDNA library or under stress conditions. Hence, the involvement of AvHSP28.6 gene in the sea anemone defensome is strongly suggested.
Nicosia, Aldo; Maggio, Teresa; Mazzola, Salvatore; Gianguzza, Fabrizio; Cuttitta, Angela; Costa, Salvatore
2014-01-01
Gene family encoding small Heat-Shock Proteins (sHSPs containing α-crystallin domain) are found both in prokaryotic and eukaryotic organisms; however, there is limited knowledge of their evolution. In this study, two small HSP genes termed AvHSP28.6 and AvHSP27, both organized in one intron and two exons, were characterised in the Mediterranean snakelocks anemone Anemonia viridis. The release of the genome sequence of Hydra magnipapillata and Nematostella vectensis enabled a comprehensive study of the molecular evolution of α-crystallin gene family among cnidarians. Most of the H. magnipapillata sHSP genes share the same gene organization described for AvHSP28.6 and AvHSP27, differing from the sHSP genes of N. vectensis which mainly show an intronless architecture. The different genomic organization of sHSPs, the phylogenetic analyses based on protein sequences, and the relationships among Cnidarians, suggest that the A.viridis sHSPs represent the common ancestor from which H. magnipapillata genes directly evolved through segmental genome duplication. Additionally retroposition events may be considered responsible for the divergence of sHSP genes of N. vectensis from A. viridis. Analyses of transcriptional expression profile showed that AvHSP28.6 was constitutively expressed among different tissues from both ectodermal and endodermal layers of the adult sea anemones, under normal physiological conditions and also under different stress condition. Specifically, we profiled the transcriptional activation of AvHSP28.6 after challenges with different abiotic/biotic stresses showing induction by extreme temperatures, heavy metals exposure and immune stimulation. Conversely, no AvHSP27 transcript was detected in such dissected tissues, in adult whole body cDNA library or under stress conditions. Hence, the involvement of AvHSP28.6 gene in the sea anemone defensome is strongly suggested.
Meron, Dalit; Buia, Maria-Cristina; Fine, Maoz; Banin, Ehud
2013-02-01
Ocean acidification, resulting from rising atmospheric carbon dioxide concentrations, is a pervasive stressor that can affect many marine organisms and their symbionts. Studies which examine the host physiology and microbial communities have shown a variety of responses to the ocean acidification process. Recently, several studies were conducted based on field experiments, which take place in natural CO(2) vents, exposing the host to natural environmental conditions of varying pH. This study examines the sea anemone Anemonia viridis which is found naturally along the pH gradient in Ischia, Italy, with an aim to characterize whether exposure to pH impacts the holobiont. The physiological parameters of A. viridis (Symbiodinium density, protein, and chlorophyll a+c concentration) and its microbial community were monitored. Although reduction in pH was seen to have had an impact on composition and diversity of associated microbial communities, no significant changes were observed in A. viridis physiology, and no microbial stress indicators (i.e., pathogens, antibacterial activity, etc.) were detected. In light of these results, it appears that elevated CO(2) does not have a negative influence on A. viridis that live naturally in the site. This suggests that natural long-term exposure and dynamic diverse microbial communities may contribute to the acclimation process of the host in a changing pH environment.
DEFF Research Database (Denmark)
Tychsen, Anders; Brolund, T. M.; Nielsen, L. E.
2004-01-01
The Heteractis magnifica assemblage at the tip of the Sinai Peninsula was examined. The actinian size, location, and number of resident anemonefishes were recorded. The anemones were found at depths down to approximately 40 m and the sizes of clustering H. magnifica and clusters were positively c...
Borell, Esther M; Steinke, Michael; Horwitz, Rael; Fine, Maoz
2014-02-01
Marine anthozoans maintain a mutualistic symbiosis with dinoflagellates that are prolific producers of the algal secondary metabolite dimethylsulfoniopropionate (DMSP), the precursor of the climate-cooling trace gas dimethyl sulfide (DMS). Surprisingly, little is known about the physiological role of DMSP in anthozoans and the environmental factors that regulate its production. Here, we assessed the potential functional role of DMSP as an antioxidant and determined how future increases in seawater pCO2 may affect DMSP concentrations in the anemone Anemonia viridis along a natural pCO2 gradient at the island of Vulcano, Italy. There was no significant difference in zooxanthellae genotype and characteristics (density of zooxanthellae, and chlorophyll a) as well as protein concentrations between anemones from three stations along the gradient, V1 (3232 μatm CO2), V2 (682 μatm) and control (463 μatm), which indicated that A. viridis can acclimate to various seawater pCO2. In contrast, DMSP concentrations in anemones from stations V1 (33.23 ± 8.30 fmol cell(-1)) and V2 (34.78 ± 8.69 fmol cell(-1)) were about 35% lower than concentrations in tentacles from the control station (51.85 ± 12.96 fmol cell(-1)). Furthermore, low tissue concentrations of DMSP coincided with low activities of the antioxidant enzyme superoxide dismutase (SOD). Superoxide dismutase activity for both host (7.84 ± 1.37 U·mg(-1) protein) and zooxanthellae (2.84 ± 0.41 U·mg(-1) protein) at V1 was 40% lower than at the control station (host: 13.19 ± 1.42; zooxanthellae: 4.72 ± 0.57 U·mg(-1) protein). Our results provide insight into coastal DMSP production under predicted environmental change and support the function of DMSP as an antioxidant in symbiotic anthozoans.
Dattoli, A.A.; Hink, M.A.; DuBuc, T.Q.; Teunisse, B.J.; Goedhart, J.; Röttinger, E.; Postma, M.
2015-01-01
SNAIL transcriptional factors are key regulators during development and disease. They arose early during evolution, and in cnidarians such as Nematostella vectensis, NvSNAILA/B are detected in invaginating tissues during gastrulation. The function of SNAIL proteins is well established in bilaterians
Directory of Open Access Journals (Sweden)
Wan-Nan U. Chen
2016-08-01
Full Text Available Anemones of genus Exaiptasia are used as model organisms for the study of cnidarian-dinoflagellate (genus Symbiodinium endosymbiosis. However, while most reef-building corals harbor Symbiodinium of clade C, Exaiptasia spp. anemones mainly harbor clade B Symbiodinium (ITS2 type B1 populations. In this study, we reveal for the first time that bleached Exaiptasia pallida anemones can establish a symbiotic relationship with a clade C Symbiodinium (ITS2 type C1. We further found that anemones can transmit the exogenously supplied clade C Symbiodinium cells to their offspring by asexual reproduction (pedal laceration. In order to corroborate the establishment of stable symbiosis, we used microscopic techniques and genetic analyses to examine several generations of anemones, and the results of these endeavors confirmed the sustainability of the system. These findings provide a framework for understanding the differences in infection dynamics between homologous and heterologous dinoflagellate types using a model anemone infection system.
Beldade, Ricardo; Blandin, Agathe; O'Donnell, Rory; Mills, Suzanne C
2017-10-10
Organisms can behaviorally, physiologically, and morphologically adjust to environmental variation via integrative hormonal mechanisms, ultimately allowing animals to cope with environmental change. The stress response to environmental and social changes commonly promotes survival at the expense of reproduction. However, despite climate change impacts on population declines and diversity loss, few studies have attributed hormonal stress responses, or their regulatory effects, to climate change in the wild. Here, we report hormonal and fitness responses of individual wild fish to a recent large-scale sea warming event that caused widespread bleaching on coral reefs. This 14-month monitoring study shows a strong correlation between anemone bleaching (zooxanthellae loss), anemonefish stress response, and reproductive hormones that decreased fecundity by 73%. These findings suggest that hormone stress responses play a crucial role in changes to population demography following climate change and plasticity in hormonal responsiveness may be a key mechanism enabling individual acclimation to climate change.Elevated temperatures can cause anemones to bleach, with unknown effects on their associated symbiotic fish. Here, Beldade and colleagues show that climate-induced bleaching alters anemonefish hormonal stress response, resulting in decreased reproductive hormones and severely impacted reproduction.
Furla, P; Bénazet-Tambutté, S; Jaubert, J; Allemand, D
1998-02-01
The oral epithelial layers of anthozoans have a polarized morphology: photosynthetic endosymbionts live within endodermal cells facing the coelenteric cavity and are separated from the external seawater by the ectodermal layer and the mesoglea. To study if this morphology plays a role in the supply of inorganic carbon for symbiont photosynthesis, we measured the change in pH and the rate of OH- (H+) fluxes induced by each cell layer on a tentacle of the sea anemone Anemonia viridis. Light-induced pH increase of the medium bathing the endodermal layers led to the generation of a transepithelial pH gradient of approximately 0.8 pH units across the tentacle, whereas darkness induced acidification of this medium. The light-induced pH change was associated with an increase of total alkalinity. Only the endodermal layer was able to induce a net OH- secretion (H+ absorption). The light-induced OH- secretion by the endodermal cell layer was dependent on the presence of HCO3- in the compartment facing the ectoderm and was sensitive to several inhibitors of ion transport. [14C] HCO3- incorporation into photosynthates confirmed the ectodermal supply, the extent of which varied from 25 to > 90%, according to HCO3- availability. Our results suggest that the light-induced OH- secretion by the endodermal cell layer followed the polarized transport of HCO3- and its subsequent decarboxylation within the endodermal cell layer. This polarity may play a significant role both in inorganic carbon absorption and in the control of light-enhanced calcification in scleractinian corals.
Nicosia, Aldo; Maggio, Teresa; Mazzola, Salvatore; Gianguzza, Fabrizio; Cuttitta, Angela; Costa, Salvatore
2014-01-01
Gene family encoding small Heat-Shock Proteins (sHSPs containing α-crystallin domain) are found both in prokaryotic and eukaryotic organisms; however, there is limited knowledge of their evolution. In this study, two small HSP genes termed AvHSP28.6 and AvHSP27, both organized in one intron and two exons, were characterised in the Mediterranean snakelocks anemone Anemonia viridis. The release of the genome sequence of Hydra magnipapillata and Nematostella vectensis enabled a comprehensive stu...
Phytochemicals and bioactivities of Anemone raddeana Regel: a review.
Sun, Yong-Xu; Liu, Ji-Cheng; Liu, Da-You
2011-11-01
Anemone raddeana, usually called as'"Toujian Liang" in China, is an Anemone herb belonging to the Ranunculaceae family. Until now there are in total 67 of chemical components identified including triterpenoids, steroids, lactones, fats and oils, saccharide and alkaloids. A broad spectrum of pharmacological activity of A. raddeana compounds have been reported, such as antitumor, antimicrobial, anti-inflammatory, sedative and analgesic activites, as well as anti-convulsant and anti-histamine effects. In view of this, we initiated this short review to present the phytochemical and pharmacological profile of A. raddeana to support future studies in this discipline.
A deep sea community at the Kebrit brine pool in the Red Sea
Vestheim, Hege
2015-02-26
Approximately 25 deep sea brine pools occur along the mid axis of the Red Sea. These hypersaline, anoxic, and acidic environments have previously been reported to host diverse microbial communities. We visited the Kebrit brine pool in April 2013 and found macrofauna present just above the brine–seawater interface (~1465 m). In particular, inactive sulfur chimneys had associated epifauna of sea anemones, sabellid type polychaetes, and hydroids, and infauna consisting of capitellid polychaetes, gastropods of the genus Laeviphitus (fam. Elachisinidae), and top snails of the family Cocculinidae. The deep Red Sea generally is regarded as extremely poor in benthos. We hypothesize that the periphery along the Kebrit holds increased biomass and biodiversity that are sustained by prokaryotes associated with the brine pool or co-occurring seeps.
Revel, Johana; Massi, Lionel; Mehiri, Mohamed; Boutoute, Marc; Mayzaud, Patrick; Capron, Laure; Sabourault, Cécile
2016-01-01
Cnidarian-dinoflagellate symbiosis mainly relies on nutrient recycling, thus providing both partners with a competitive advantage in nutrient-poor waters. Essential processes related to lipid metabolism can be influenced by various factors, including hyperthermal stress. This can affect the lipid content and distribution in both partners, while contributing to symbiosis disruption and bleaching. In order to gain further insight into the role and distribution of lipids in the cnidarian metabolism, we investigated the lipid composition of the sea anemone Anemonia viridis and its photosynthetic dinoflagellate endosymbionts (Symbiodinium). We compared the lipid content and fatty acid profiles of the host cellular layers, non-symbiotic epidermal and symbiont-containing gastrodermal cells, and those of Symbiodinium, in a mass spectrometry-based assessment. Lipids were more concentrated in Symbiodinium cells, and the lipid class distribution was dominated by polar lipids in all tissues. The fatty acid distribution between host cell layers and Symbiodinium cells suggested potential lipid transfers between the partners. The lipid composition and distribution was modified during short-term hyperthermal stress, mainly in Symbiodinium cells and gastrodermis. Exposure to elevated temperature rapidly caused a decrease in polar lipid C18 unsaturated fatty acids and a strong and rapid decrease in the abundance of polar lipid fatty acids relative to sterols. These lipid indicators could therefore be used as sensitive biomarkers to assess the physiology of symbiotic cnidarians, especially the effect of thermal stress at the onset of cnidarian bleaching. Overall, the findings of this study provide some insight on key lipids that may regulate maintenance of the symbiotic interaction. Copyright © 2015 Elsevier Inc. All rights reserved.
Davy, S K; Lucas, I A N; Turner, J R
1997-04-01
The uptake and persistence of symbiotic dinoflagellates (zooxanthellae) were measured in the temperate sea anemone Cereus pedunculatus (Pennant). Aposymbiotic specimens of C. pedunculatus were inoculated with zooxanthellae freshly isolated from a range of temperate and subtropical Anthozoa. Each inoculate consisted of zooxanthellae from a single host species and was either homologous (zooxanthellae from a host of the same species as the one being inoculated) or heterologous (from a host of a different species than the one being inoculated). The densities of zooxanthellae in host tissues were determined at regular intervals. C. pedunculatus took up homologous and heterologous zooxanthellae to similar degrees, except for zooxanthellae from the temperate Anthopleura ballii, which were taken up to a lesser extent. The densities of all zooxanthellae declined between 4 hours and 4 days after uptake, indicating that zooxanthellae were expelled, digested, or both during this period. The densities of all zooxanthellae increased between 2 and 8 weeks after inoculation, indicating zooxanthella growth. Over the entire 8-week period after uptake, densities of homologous zooxanthellae were always greater than those of heterologous zooxanthellae. Between 8 and 36 weeks after infection, densities of homologous zooxanthellae declined markedly and densities of some heterologous zooxanthellae increased further, resulting in homologous and heterologous zooxanthella densities being the same at 36 weeks. These densities were the same as those in naturally infected C. pedunculatus of similar size. The results suggest that zooxanthellae from a range of host species and environments can establish symbioses with C. pedunculatus and that, over long periods under laboratory conditions, heterologous zooxanthellae may populate C. pedunculatus to the same extent as homologous zooxanthellae.
Dicty_cDB: Contig-U04457-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available tochiensis_EST Glob... 42 8.4 1 ( FK759483 ) av02078b12r1.1 Symbiotic sea anemone... (Anemonia vi... 42 8.4 1 ( FK758489 ) av01028a18r1.1 Symbiotic sea anemone (Anemonia vi... 42 8.4 1 ( FK751904 ) av02108b22r1.1 Symb...iotic sea anemone (Anemonia vi... 42 8.4 1 ( FK750287 ) av02092i15r1.1 Symbiotic se...a anemone (Anemonia vi... 42 8.4 1 ( FK745283 ) av02120i24r1.1 Symbiotic sea anemone (Anemonia vi... 42 8.4 ...1 ( FK742118 ) av01024i20r1.1 Symbiotic sea anemone (Anemonia vi... 42 8.4 1 ( FK
Dicty_cDB: Contig-U03566-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available norvegicus EST, 5'-end sequence, clone etn... 44 10.0 1 ( FK755862 ) av02117h21r1.1 Symbiotic sea anemone (A...nemonia vi... 44 10.0 1 ( FK744247 ) av02071a20r1.1 Symbiotic sea anemone (Anemonia vi... 44 10.0 1 ( FK743844 ) av02079l20r1.1 Symbi...otic sea anemone (Anemonia vi... 44 10.0 1 ( FK739201 ) av02095d13r1.1 Symbiotic se...a anemone (Anemonia vi... 44 10.0 1 ( FK738983 ) av02074d14r1.1 Symbiotic sea ane...mone (Anemonia vi... 44 10.0 1 ( FK732177 ) av02130j21r1.1 Symbiotic sea anemone (Anemonia vi... 44 10.0 1 (
Dicty_cDB: Contig-U02225-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ... 46 1.6 1 ( FK758941 ) av02067l14r1.1 Symbiotic sea anemone (Anemonia vi... 46 1.6 1 ( FK749130 ) av01004a16r1.1 Symbiotic... sea anemone (Anemonia vi... 46 1.6 1 ( FK748859 ) av01043j05r1.1 Symbiotic sea anemone (A...nemonia vi... 46 1.6 1 ( FK729302 ) av02077a20r1.1 Symbiotic sea anemone (Anemoni...a vi... 46 1.6 1 ( FK722182 ) av01028l19r1.1 Symbiotic sea anemone (Anemonia vi... 46 1.6 1 ( AC068995 ) Hom
Pharmacological effects of two cytolysins isolated from the sea ...
Indian Academy of Sciences (India)
Sticholysins I and II (St I/II) are cytolysins purified from the sea anemone Stichodactyla helianthus. In this study, we show their pharmacological action on guinea-pig and snail models in native and pH-denatured conditions in order to correlate the pharmacological findings with the pore-forming activity of both isoforms.
Correlation of Coral Bleaching Events and Remotely-Sensed Sea Surface Temperatures
1994-05-19
water column. Diving on the reefs, they found significant tracts of bleached corals, zoanthids , gorgonians, and sea anemones (Bunckley-Williams and... zoanthids between May and July 1988 on shallow lagoonal reefs and rim margin reefs was the first indication of any sort of bleaching event at Bermuda
Moya, A; Ganot, P; Furla, P; Sabourault, C
2012-03-01
Among the environmental threats to coral reef health, temperature and ultraviolet increases have been proposed as major agents, although the relative contribution of each in the cnidarian/zooxanthellae symbiosis breakdown has been poorly addressed. We have investigated the transcriptomic response to thermal stress, with and without ultraviolet radiation (UVR), in the symbiotic sea anemone Anemonia viridis. Using the Oligo2K A. viridis microarray, dedicated to genes potentially involved in the symbiosis interaction, we monitored the gene expression profiles after 1, 2 and 5 days of stresses that further lead to massive losses of zooxanthellae. Each stress showed a specific gene expression profile with very little overlap. We showed that the major response to thermal stress is immediate (24 h) but returns to the baseline gene expression profile after 2 days. UVR alone has little effect but potentiates thermal stress, as a second response at 5 days was observed when the two stresses were coupled. Several pathways were highlighted, such as mesoglea loosening, cell death and calcium homeostasis and described in more details. Finally, we showed that the dermatopontin gene family, potentially involved in collagen fibrillogenesis, issued from actinarian-specific duplication events, with one member preferentially expressed in the gastroderm and specifically responding to stress. Anemonia viridis EST sequences have been deposited into GenBank dbEST ([GenBank:FK719875–FK759813]. © 2012 Blackwell Publishing Ltd.
Development of Highly Selective Kv1.3-Blocking Peptides Based on the Sea Anemone Peptide ShK
Directory of Open Access Journals (Sweden)
Michael W. Pennington
2015-01-01
Full Text Available ShK, from the sea anemone Stichodactyla helianthus, is a 35-residue disulfide-rich peptide that blocks the voltage-gated potassium channel Kv1.3 at ca. 10 pM and the related channel Kv1.1 at ca. 16 pM. We developed an analog of this peptide, ShK-186, which is currently in Phase 1b-2a clinical trials for the treatment of autoimmune diseases such as multiple sclerosis and rheumatoid arthritis. While ShK-186 displays a >100-fold improvement in selectivity for Kv1.3 over Kv1.1 compared with ShK, there is considerable interest in developing peptides with an even greater selectivity ratio. In this report, we describe several variants of ShK that incorporate p-phophono-phenylalanine at the N-terminus coupled with internal substitutions at Gln16 and Met21. In addition, we also explored the combinatorial effects of these internal substitutions with an alanine extension at the C-terminus. Their selectivity was determined by patch-clamp electrophysiology on Kv1.3 and Kv1.1 channels stably expressed in mouse fibroblasts. The peptides with an alanine extension blocked Kv1.3 at low pM concentrations and exhibited up to 2250-fold selectivity for Kv1.3 over Kv1.1. Analogs that incorporates p-phosphono-phenylalanine at the N-terminus blocked Kv1.3 with IC50s in the low pM range and did not affect Kv1.1 at concentrations up to 100 nM, displaying a selectivity enhancement of >10,000-fold for Kv1.3 over Kv1.1. Other potentially important Kv channels such as Kv1.4 and Kv1.6 were only partially blocked at 100 nM concentrations of each of the ShK analogs.
International Nuclear Information System (INIS)
Wang, J.T.; Douglas, A.E.
1997-01-01
Exogenous concentrations of 10 micromolar to 1 mM of the nonprotein amino acid taurine stimulated photosynthate release from the dinoflagellate alga Symbiodinium, which had been freshly isolated from the sea anemone Aiptasia pulchella. Photosynthate release, as induced by taurine and animal extract, was metabolically equivalent at both concentrations in that they (a) stimulated photosynthate release to the same extent and (b) induced the selective release of photosynthetically derived organic acids. A complex mixture of amino acids at 75 mM also promoted photosynthate release, but the release rate was reduced by 34% after the omission of taurine (3 mM) from the mixture, suggesting that much of the effect of amino acids was largely attributable to taurine. Exogenous 14C-labeled taurine was taken up by the cells, and more than 95% of the internalized 14C was recovered as taurine, indicating that taurine-induced photosynthate release was not dependent on taurine metabolism. Both taurine uptake and taurine-induced photosynthate release by Symbiodinium exhibited saturation kinetics, but with significantly different Km values of 68 and 21 micromolar, respectively. The difference in Km values is compatible with the hypothesis that Symbiodinium has a taurine signal transducer that is responsible for photosynthate release and is distinct from the taurine transporter
Wang, Xiang; Huang, Yanqiu; Sheng, Yanqing; Su, Pei; Qiu, Yan; Ke, Caihuan; Feng, Danqing
2017-03-28
Mussels are major fouling organisms causing serious technical and economic problems. In this study, antifouling activity towards mussel was found in three compounds isolated from a marine bacterium associated with the sea anemone Haliplanella sp. This bacterial strain, called PE2, was identified as Vibrio alginolyticus using morphology, biochemical tests, and phylogenetic analysis based on sequences of 16S rRNA and four housekeeping genes ( rpoD, gyrB, rctB, and toxR ). Three small-molecule compounds (indole, 3-formylindole, and cyclo (Pro-Leu)) were purified from the ethyl acetate extract of V. alginolyticus PE2 using column chromatography techniques. They all significantly inhibited byssal thread production of the green mussel Perna viridis , with EC 50 values of 24.45 μg/ml for indole, 50.07 μg/ml for 3-formylindole, and 49.24 μg/ml for cyclo (Pro-Leu). Previous research on the antifouling activity of metabolites from marine bacteria towards mussels is scarce. Indole, 3-formylindole and cyclo (Pro-Leu) also exhibited antifouling activity against settlement of the barnacle Balanus albicostatus (EC 50 values of 8.84, 0.43, and 11.35 μg/ml, respectively) and the marine bacterium Pseudomonas sp. (EC 50 values of 42.68, 69.68, and 39.05 μg/ml, respectively). These results suggested that the three compounds are potentially useful for environmentally friendly mussel control and/or the development of new antifouling additives that are effective against several biofoulers.
Directory of Open Access Journals (Sweden)
Lin-Tao Han
2013-01-01
Full Text Available Anemone flaccida Fr. Schmidt, a family of ancient hopanoids, have been used as traditional Asian herbs for the treatments of inflammation and convulsant diseases. Previous study on HeLa cells suggested that triterpenoid saponins from Anemone flaccida Fr. Schmidt may have potential antitumor effect due to their apoptotic activities. Here, we confirmed the apoptotic activities of the following five triterpenoid saponins: glycoside St-I4a (1, glycoside St-J (2, anhuienoside E (3, hedera saponin B (4, and flaccidoside II (5 on human BEL-7402 and HepG2 hepatoma cell lines, as well as the model of HeLa cells treated with lipopolysaccharide (LPS. We found that COX-2/PGE2 signaling pathway, which plays key roles in the development of cancer, is involved in the antitumor activities of these saponins. These data provide the evidence that triterpenoid saponins can induce apoptosis via COX-2/PGE2 pathway, implying a preventive role of saponins from Anemone flaccida in tumor.
The stable microbiome of inter and sub-tidal anemone species under increasing pCO2.
Muller, Erinn M; Fine, Maoz; Ritchie, Kim B
2016-11-23
Increasing levels of pCO 2 within the oceans will select for resistant organisms such as anemones, which may thrive under ocean acidification conditions. However, increasing pCO 2 may alter the bacterial community of marine organisms, significantly affecting the health status of the host. A pH gradient associated with a natural volcanic vent system within Levante Bay, Vulcano Island, Italy, was used to test the effects of ocean acidification on the bacterial community of two anemone species in situ, Anemonia viridis and Actinia equina using 16 S rDNA pyrosequencing. Results showed the bacterial community of the two anemone species differed significantly from each other primarily because of differences in the Gammaproteobacteria and Epsilonproteobacteria abundances. The bacterial communities did not differ within species among sites with decreasing pH except for A. viridis at the vent site (pH = 6.05). In addition to low pH, the vent site contains trace metals and sulfide that may have influenced the bacteria community of A. viridis. The stability of the bacterial community from pH 8.1 to pH 7.4, coupled with previous experiments showing the lack of, or beneficial changes within anemones living under low pH conditions indicates that A. viridis and A. equina will be winners under future ocean acidification scenarios.
Bouwmeester, Jessica; Gatins, Remy; Giles, Emily; Sinclair-Taylor, Tane; Berumen, Michael L.
2016-01-01
species, as well as a general lack of data for other invertebrates. Here, we document the detailed timing of spawning for 13 scleractinian coral species, one sea anemone, and six echinoderms from an inshore reef off the coast of Thuwal, Saudi Arabia
Tada, Hiroshi; Suzuki, Tomohiko
2010-08-01
The arginine kinase (AK) from the sea anemone Anthopleura japonicus has an unusual two-domain structure (contiguous dimer; denoted by D1-D2). In a previous report, we suggested cooperativity in the contiguous dimer, which may be a result of domain-domain interactions, using MBP-fused enzymes. To further understand this observation, we inserted six-Lys residues into the linker region of the two-domain AK (D1-K6-D2 mutant) using His-tagged enzyme. The dissociation constants, K(a) and K(ia), of the mutant were similar to those of the wild-type enzyme but the catalytic constant, k(cat), was decreased to 28% that of the wild-type, indicating that some of the domain-domain interactions are lost due to the six-Lys insertion. Y68 plays a major role in arginine binding in the catalytic pocket in Limulus AK, and introduction of mutation at the Y68 position virtually abolishes catalytic activity. Thus, the constructed D1(Y68G)-D2 and D1-D2(Y68G) mutants mimic the D1(inactive)-D2(active) and D1(active)-D2(inactive) enzymes, respectively. The k(cat) values of both Y68 mutants were decreased to 13-18% that of the wild-type enzyme, which is much less than the 50% level of the two-domain enzyme. Thus, it is clear that substrate-binding to both domains is necessary for full expression of activity. In other words, substrate-binding appears to act as the trigger of the functional cooperativity in two-domain AK. Copyright 2010 Elsevier B.V. All rights reserved.
Dicty_cDB: Contig-U02747-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 3d05.g1 Oxytricha_pSMART_OXBB Sterkiella... 50 0.098 1 ( FK749731 ) av02085g19r1.1 Symbiotic... sea anemone (Anemonia vi... 50 0.098 1 ( FK731884 ) av02115l17r1.1 Symbiotic sea anemone (Anemon
Two new triterpenoid saponins from rhizome of Anemone raddeana Regel
DEFF Research Database (Denmark)
Fan, Li; Lu, Jincai; Wang, Jing
2009-01-01
Two new 27-hydroxyoleanolic acid-type triterpenoid saponins, raddeanoside Ra (1) and raddeanoside Rb (2), were isolated from the rhizome of Anemone raddeana Regel. The structures of the two compounds were elucidated to be 27-hydroxyoleanolic acid 3-O-beta-D: -glucopyranosyl-(1 --> 4)-alpha...
Dicty_cDB: Contig-U16416-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available eg... 32 0.83 3 ( FK743489 ) av02083p10r1.1 Symbiotic sea anemone (Anemonia vi... 32 0.84 3 ( GO096539 ) CAF... regu... 32 1.1 3 ( FK745351 ) av02070p02r1.1 Symbiotic sea anemone (Anemonia vi... 32 1.2 3 ( AZ547466 ) EN....6 2 ( FK720330 ) av02061h11r1.1 Symbiotic sea anemone (Anemonia vi... 32 9.8 3 (
Dicty_cDB: Contig-U05205-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ormalization and subtr... 64 4e-09 2 ( FK758356 ) av02131e10r1.1 Symbiotic sea anemone (Anemonia vi... 38 7e...-09 4 ( EE000082 ) ROE00011310 Rhizopus oryzae Company Rhizopus oryz... 54 8e-09 2 ( FK729955 ) av01023i17r1.1 Symbiotic...ncorhynchus mykiss clone omyk-evo-505-080 Charge... 56 1e-08 3 ( FK744942 ) av02063f01r1.1 Symbiotic sea ane...mone (Anemonia vi... 38 1e-08 4 ( FK726627 ) av01045a04r1.1 Symbiotic sea anemone...rus cDNA clone IM... 40 2e-05 3 ( FK744316 ) av01008j21r1.1 Symbiotic sea anemone
Directory of Open Access Journals (Sweden)
Carlos Spano
2017-05-01
Full Text Available A new species of sea anemone, Anthopleura radians n. sp., is described from the intertidal zone of northern Chile and the taxonomic status of the other Anthopleura species from the South Pacific are discussed. A. radians n. sp. is characterized by a yellow-whitish and brown checkerboard-like pattern on the oral disc, adhesive verrucae along the entire column and a series of marginal projections, each bearing a brightly-colored acrorhagus on the oral surface. This is the seventh species of Anthopleura described from the South Pacific Ocean; each one distinguished by a particular combination of differences related to their coloration pattern, presence of zooxanthellae, cnidae, and mode of reproduction. Some of these species have not been reported since their original description and thus require to be taxonomically validated. A. hermaphroditica and A. aureoradiata are synonyms considering the lack of differences seen between live specimens, museum collections and published records. A. radians could also be a junior synonym of A. minima, however, no type material was found for testing this hypothesis. Furthermore, it is crucial to designate neotypes for A. inconspicua, A. rosea and A. minima since there are no name-bearing types reported for these species.
Dicty_cDB: Contig-U01136-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 48 0.12 1 ( FK745334 ) av02089f15r1.1 Symbiotic sea anemone (Anemonia vi... 48 0....12 1 ( FK739054 ) av02117m13r1.1 Symbiotic sea anemone (Anemonia vi... 48 0.12 1 ( AW483267 ) 52212 MARC 2P...02F010925 AZO3 Triticum aestivum cDNA cl... 44 1.8 1 ( FK759151 ) av01045m14r1.1 Symbiotic sea anemone (Anem
Dicty_cDB: Contig-U16413-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available .23 12 ( FK748792 ) av02120l18r1.1 Symbiotic sea anemone (Anemonia vi... 36 0.24 4 ( AZ957723 ) 2M0224M10R M...clone:ddc49i08, 3' ... 36 0.74 3 ( FK742700 ) av02131k10r1.1 Symbiotic sea anemon...AP_M_S4 Mus muscu... 42 5.7 2 ( FK733345 ) av01016a23r1.1 Symbiotic sea anemone (
Dicty_cDB: Contig-U04009-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 7 ) Le_emtis_210C02_M13R29 Little skate (Leucoraja er... 46 1.5 1 ( FK750322 ) av02087c17r1.1 Symbiotic sea ...anemone (Anemonia vi... 46 1.5 1 ( FK745011 ) av01018o18r1.1 Symbiotic sea anemone (Anemonia vi... 46 1.5 1 ...( FK732517 ) av01041d03r1.1 Symbiotic sea anemone (Anemonia vi... 46 1.5 1 ( EY42
Directory of Open Access Journals (Sweden)
Angela ePoole
2016-04-01
Full Text Available The complement system is an innate immune pathway that in vertebrates, is responsible for initial recognition and ultimately phagocytosis and destruction of microbes. Several complement molecules including C3, Factor B, and mannose binding lectin associated serine proteases (MASP have been characterized in invertebrates and while most studies have focused on their conserved role in defense against pathogens, little is known about their role in managing beneficial microbes. The purpose of this study was to (1 characterize complement pathway genes in the symbiotic sea anemone A. pallida, (2 investigate the evolution of complement genes in invertebrates, and (3 examine the potential dual role of complement genes Factor B and MASP in the onset and maintenance of cnidarian-dinoflagellate symbiosis and immune challenge using qPCR based studies. The results demonstrate that A. pallida has multiple Factor B genes (Ap_Bf-1, Ap_Bf-2a, and Ap_Bf-2b and one MASP gene (Ap_MASP. Phylogenetic analysis indicates that the evolutionary history of complement genes is complex, and there have been many gene duplications or gene loss events, even within members of the same phylum. Gene expression analyses revealed a potential role for complement in both onset and maintenance of cnidarian-dinoflagellate symbiosis and immune challenge. Specifically, Ap_Bf-1 and Ap_MASP are significantly upregulated in the light at the onset of symbiosis and in response to challenge with the pathogen Serratia marcescens suggesting that they play a role in the initial recognition of both beneficial and harmful microbes. Ap_Bf-2b in contrast was generally downregulated during the onset and maintenance of symbiosis and in response to challenge with S. marcescens. Therefore the exact role of Ap_Bf-2b in response to microbes remains unclear, but the results suggests that the presence of microbes leads to repressed expression. Together these results indicate functional divergence between Ap
Lifescience Database Archive (English)
Full Text Available Dugesia ryukyuensis mRNA, clone: Dr_sW_010_D02, 5... 58 4e-08 2 ( FK755475 ) av02113g24r1.1 Symbiotic sea a...nemone (Anemonia vi... 54 5e-08 3 ( FK726793 ) av01007b10r1.1 Symbiotic sea anemo...ne (Anemonia vi... 54 5e-08 3 ( FK756891 ) av02081m01r1.1 Symbiotic sea anemone (Anemonia vi... 54 5e-08 3 d
Rocha, Joana; Coelho, Francisco J R C; Peixe, Luísa; Gomes, Newton C M; Calado, Ricardo
2014-11-11
For several years, knowledge on the microbiome associated with marine invertebrates was impaired by the challenges associated with the characterization of bacterial communities. With the advent of culture independent molecular tools it is possible to gain new insights on the diversity and richness of microorganisms associated with marine invertebrates. In the present study, we evaluated if different preservation and processing methodologies (prior to DNA extraction) can affect the bacterial diversity retrieved from snakelocks anemone Anemonia viridis. Denaturing gradient gel electrophoresis (DGGE) community fingerprints were used as proxy to determine the bacterial diversity retrieved (H'). Statistical analyses indicated that preservation significantly affects H'. The best approach to preserve and process A. viridis biomass for bacterial community fingerprint analysis was flash freezing in liquid nitrogen (preservation) followed by the use of a mechanical homogenizer (process), as it consistently yielded higher H'. Alternatively, biomass samples can be processed fresh followed by cell lyses using a mechanical homogenizer or mortar &pestle. The suitability of employing these two alternative procedures was further reinforced by the quantification of the 16S rRNA gene; no significant differences were recorded when comparing these two approaches and the use of liquid nitrogen followed by processing with a mechanical homogenizer.
Predicted Bacterial Interactions Affect in Vivo Microbial Colonization Dynamics in Nematostella
Domin, Hanna; Zurita-Gutiérrez, Yazmín H.; Scotti, Marco; Buttlar, Jann; Hentschel Humeida, Ute; Fraune, Sebastian
2018-01-01
The maintenance and resilience of host-associated microbiota during development is a fundamental process influencing the fitness of many organisms. Several host properties were identified as influencing factors on bacterial colonization, including the innate immune system, mucus composition, and diet. In contrast, the importance of bacteria–bacteria interactions on host colonization is less understood. Here, we use bacterial abundance data of the marine model organism Nematostella vectensis to reconstruct potential bacteria–bacteria interactions through co-occurrence networks. The analysis indicates that bacteria–bacteria interactions are dynamic during host colonization and change according to the host’s developmental stage. To assess the predictive power of inferred interactions, we tested bacterial isolates with predicted cooperative or competitive behavior for their ability to influence bacterial recolonization dynamics. Within 3 days of recolonization, all tested bacterial isolates affected bacterial community structure, while only competitive bacteria increased bacterial diversity. Only 1 week after recolonization, almost no differences in bacterial community structure could be observed between control and treatments. These results show that predicted competitive bacteria can influence community structure for a short period of time, verifying the in silico predictions. However, within 1 week, the effects of the bacterial isolates are neutralized, indicating a high degree of resilience of the bacterial community. PMID:29740401
Predicted Bacterial Interactions Affect in Vivo Microbial Colonization Dynamics in Nematostella
Directory of Open Access Journals (Sweden)
Hanna Domin
2018-04-01
Full Text Available The maintenance and resilience of host-associated microbiota during development is a fundamental process influencing the fitness of many organisms. Several host properties were identified as influencing factors on bacterial colonization, including the innate immune system, mucus composition, and diet. In contrast, the importance of bacteria–bacteria interactions on host colonization is less understood. Here, we use bacterial abundance data of the marine model organism Nematostella vectensis to reconstruct potential bacteria–bacteria interactions through co-occurrence networks. The analysis indicates that bacteria–bacteria interactions are dynamic during host colonization and change according to the host’s developmental stage. To assess the predictive power of inferred interactions, we tested bacterial isolates with predicted cooperative or competitive behavior for their ability to influence bacterial recolonization dynamics. Within 3 days of recolonization, all tested bacterial isolates affected bacterial community structure, while only competitive bacteria increased bacterial diversity. Only 1 week after recolonization, almost no differences in bacterial community structure could be observed between control and treatments. These results show that predicted competitive bacteria can influence community structure for a short period of time, verifying the in silico predictions. However, within 1 week, the effects of the bacterial isolates are neutralized, indicating a high degree of resilience of the bacterial community.
Chemical and biological characterization of a crude venom extract ...
African Journals Online (AJOL)
Background: Sea-anemones, in common with other members of the phylum cnidaria (coelenterate) possess numerous tentacles containing specialized stinging cells of cnidocysts. Our main objective is to elucidate the chemical character and biological properties of this Nigerian species of sea anemone Bunodosoma ...
Dicty_cDB: Contig-U04535-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available .8 2 ( FK720958 ) av01047a19r1.1 Symbiotic sea anemone (Anemonia vi... 32 8.0 2 (... FK734048 ) av02126b02r1.1 Symbiotic sea anemone (Anemonia vi... 32 8.4 2 ( AP003563 ) Oryza sativa Japonica
Wang, Xiao-Yang; Gao, Hui; Xie, Xiao-Jie; Jurhiin, Jirimubatu; Zhang, Mu-Zi-He; Zhou, Yan-Ping; Liu, Rui; Ning, Meng; Han, Jin; Tang, Hai-Feng
2018-02-23
Five previously undescribed triterpenoid saponins ( 1 - 5 ), along with eight known ones ( 6 - 13 ), were isolated from the whole plants of Anemone rivularis var. flore-minore . Their structures were clarified by extensive spectroscopic data and chemical evidence. For the first time, the lupane-type saponins ( 3 and 12 ) were reported from the Anemone genus. The anti-proliferative activity of all isolated saponins was evaluated on hepatic stellate cells (HSC-T6). Saponins 12 and 13 , which possess more monosaccharides than the others, displayed potent anti-proliferative activity, with IC 50 values of 18.21 and 15.56 μM, respectively.
Dicty_cDB: Contig-U03742-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available H240-264L12, WORKING DRAFT SEQU... 48 0.55 1 ( FK748225 ) av01025l02r1.1 Symbiotic sea anemone (Anemonia vi...... 48 0.55 1 ( FK733073 ) av01027g09r1.1 Symbiotic sea anemone (Anemonia vi... 48
Dicty_cDB: Contig-U02685-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available cDNA, clone SSM636. 44 2e-08 3 ( FK735507 ) av02073b04r1.1 Symbiotic sea anemone (Anemonia vi... 60 2e-08 3...yte cDNA Library Porphyra ha... 50 2e-08 3 ( FK721873 ) av02130a08r1.1 Symbiotic sea anemone (Anemonia vi...... 60 2e-08 3 ( FK754800 ) av02104k17r1.1 Symbiotic sea anemone (Anemonia vi... 60 ...3e-08 3 ( BG227669 ) kq13h06.y1 TBN95TM-SSR Strongyloides stercoralis ... 38 3e-08 4 ( FK730953 ) av01010m13r1.1 Symbiotic
Directory of Open Access Journals (Sweden)
Rajaram Rajendran
2014-12-01
Full Text Available Understanding the transect survey for abundance of anemone fishes and other living organisms is important to asses reef associated fish diversity in North Bay island. The percentage distribution of 10 different substratum from the disturbed, semi-disturbed and undisturbed areas was recorded during the survey in North Bay islands during November 2009 to April 2010. The survey observations reveal that the fishes were the dominant groups followed by mollusks, lobsters and octopus. There are 5 different anemone fishes were collected during the transect survey and their distribution is more in undisturbed area. We are standardizing the different mass culture techniques for production of phytoplankton and zooplankton for the nutritional source for the anemone fish larvae. Monitoring the water quality parameters and culture the phytoplankton and zooplankton used in different culture media with 2 adjustment studies like with and without salinity adjustment. The results of this experiment indicate that zooplankton was rich in protein and fat content and it will be used as high nutritional source for feeding fish larvae.
Dicty_cDB: Contig-U01941-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ( FK735597 ) av02126o07r1.1 Symbiotic sea anemone (Anemonia vi... 34 5.9 2 ( FK724972 ) av02089m01r1.1 Symbiotic... sea anemone (Anemonia vi... 34 5.9 2 ( FK733349 ) av02079i15r1.1 Symbiotic s
Dicty_cDB: Contig-U05251-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available mantle Lot... 52 4e-09 4 ( FK724738 ) av02079k03r1.1 Symbiotic sea anemone (Anemo...nia vi... 40 5e-08 3 ( FK753021 ) av02111m08r1.1 Symbiotic sea anemone (Anemonia vi... 40 5e-08 3 ( FF613254
Gatins, Remy
2014-12-01
Anemonefish are one of the main groups that have been used over the last decade to empirically measure larval dispersal and connectivity in coral reef populations. A few species of anemones are integral to the life history of these fish, as well as other obligate symbionts, yet the biology and population structure of these anemones remains poorly understood. The aim of this study was to measure the genetic structure of these anemones within and between two reefs in order to assess their reproductive mode and dispersal potential. To do this, we sampled almost exhaustively two anemones species (Stichodactyla gigantea and Heteractis magnifica) at two small islands in Kimbe Bay (Papua New Guinea) separated by approximately 25 km. Both the host anemones and the anemonefish are heavily targeted for the aquarium trade, in addition to the populations being affected by bleaching pressures (Hill and Scott 2012; Hobbs et al. 2013; Saenz- Agudelo et al. 2011; Thomas et al. 2014), therefore understanding their biology is crucial for better management strategies. Panels of microsatellite markers were developed for each species using next generation sequencing tools. Clonality analyses confirm six pairs of identical genotypes for S. gigantea (n=350) and zero for H. magnifica (n=128), indicating presence/absence of asexual reproduction in this region. S. gigantea showed low structure between islands (FST= 0.003, p-value= 0.000), however, even if the majority of the individuals were unrelated (r~0), 81 families that shared 50% of their genetic material formed from two to four members were found. Out of these families, 45% were found with individuals only within Tuare Island, 11% only in Kimbe Island, and 44% were sharing individuals among islands. In comparison, H. magnifica showed no structure (FST= 0.002, p-value= 0.278), mean relatedness indicated the majority of individuals were unrelated, and 31 families were identified. Families again consisted from two to four members and
Dicty_cDB: Contig-U16424-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available -05 8 ( FK751038 ) av02129i18r1.1 Symbiotic sea anemone (Anemonia vi... 60 9e-05 3 ( FE230988 ) CAPG10114.fw... primary mesenchyme cell cDNA ... 60 0.001 1 ( FK740079 ) av02058c02r1.1 Symbiotic sea anemone (Anemonia vi.
A Taxonomic Note on the Misidentification of Anemone tschernjaewii Regel. in Kashmir Himalaya
Directory of Open Access Journals (Sweden)
Aijaz Hassan Ganie
2015-03-01
Full Text Available The correct identification of Anemone tschernjaewii Regel. previously misidentified as A. biflora DC. in the Kashmir Himalaya, India is reported. In this brief report, a detailed taxonomic description and photo-plates of its diagnostic morphological and anatomical characters are provided to validate this plant record for the region and to facilitate its easier field identification.
Spiral phyllotaxis underlies constrained variation in Anemone (Ranunculaceae) tepal arrangement.
Kitazawa, Miho S; Fujimoto, Koichi
2018-05-01
Stabilization and variation of floral structures are indispensable for plant reproduction and evolution; however, the developmental mechanism regulating their structural robustness is largely unknown. To investigate this mechanism, we examined positional arrangement (aestivation) of excessively produced perianth organs (tepals) of six- and seven-tepaled (lobed) flowers in six Anemone species (Ranunculaceae). We found that the tepal arrangement that occurred in nature varied intraspecifically between spiral and whorled arrangements. Moreover, among the studied species, variation was commonly limited to three types, including whorls, despite five geometrically possible arrangements in six-tepaled flowers and two types among six possibilities in seven-tepaled flowers. A spiral arrangement, on the other hand, was unique to five-tepaled flowers. A spiral phyllotaxis model with stochasticity on initiating excessive primordia accounted for these limited variations in arrangement in cases when the divergence angle between preexisting primordia was less than 144°. Moreover, interspecific differences in the frequency of the observed arrangements were explained by the change of model parameters that represent meristematic growth and differential organ growth. These findings suggest that the phyllotaxis parameters are responsible for not only intraspecific stability but interspecific difference of floral structure. Decreasing arrangements from six-tepaled to seven-tepaled Anemone flowers demonstrate that the stabilization occurs as development proceeds to increase the component (organ) number, in contrast from the intuition that the variation will be larger due to increasing number of possible states (arrangements).
Directory of Open Access Journals (Sweden)
Kumburegama Shalika
2011-01-01
Full Text Available Abstract Background Gastrulation is a uniquely metazoan character, and its genesis was arguably the key step that enabled the remarkable diversification within this clade. The process of gastrulation involves two tightly coupled events during embryogenesis of most metazoans. Morphogenesis produces a distinct internal epithelial layer in the embryo, and this epithelium becomes segregated as an endoderm/endomesodermal germ layer through the activation of a specific gene regulatory program. The developmental mechanisms that induced archenteron formation and led to the segregation of germ layers during metazoan evolution are unknown. But an increased understanding of development in early diverging taxa at the base of the metazoan tree may provide insights into the origins of these developmental mechanisms. Results In the anthozoan cnidarian Nematostella vectensis, initial archenteron formation begins with bottle cell-induced buckling of the blastula epithelium at the animal pole. Here, we show that bottle cell formation and initial gut invagination in Nematostella requires NvStrabismus (NvStbm, a maternally-expressed core component of the Wnt/Planar Cell Polarity (PCP pathway. The NvStbm protein is localized to the animal pole of the zygote, remains asymmetrically expressed through the cleavage stages, and becomes restricted to the apical side of invaginating bottle cells at the blastopore. Antisense morpholino-mediated NvStbm-knockdown blocks bottle cell formation and initial archenteron invagination, but it has no effect on Wnt/ß-catenin signaling-mediated endoderm cell fate specification. Conversely, selectively blocking Wnt/ß-catenin signaling inhibits endoderm cell fate specification but does not affect bottle cell formation and initial archenteron invagination. Conclusions Our results demonstrate that Wnt/PCP-mediated initial archenteron invagination can be uncoupled from Wnt/ß-catenin-mediated endoderm cell fate specification in
Carballeira, N M; Reyes, M
1995-11-01
A new brominated fatty acid, 6-bromo-5,9-eicosadienoic acid [1] was identified in the phospholipids (mainly phosphatidylethanolamine) of the anemone Condylactis gigantea and the zoanthid Palythoa caribaeorum. The delta 5,9 fatty acids, 5,9-octadecadienoic acid, 5,9-eicosadienoic acid, 5,9-docosadienoic acid, and 5,9-tetracosadienoic acid, were also identified in both organisms. Structural elucidation was accomplished by spectroscopic and chemical means. Our results further corroborate that delta 5,9 phospholipid fatty acids are not unique to sponges, as recognized previously, but can be found in other marine invertebrates such as anemones and zoanthids. An improved procedure for the synthesis of picolinyl esters is also described.
Baker, Bradley J; Jin, Lei; Han, Zhou; Cohen, Lawrence B; Popovic, Marko; Platisa, Jelena; Pieribone, Vincent
2012-07-15
A substantial increase in the speed of the optical response of genetically encoded fluorescent protein voltage sensors (FP voltage sensors) was achieved by using the voltage-sensing phosphatase genes of Nematostella vectensis and Danio rerio. A potential N. vectensis voltage-sensing phosphatase was identified in silico. The voltage-sensing domain (S1-S4) of the N. vectensis homolog was used to create an FP voltage sensor called Nema. By replacing the phosphatase with a cerulean/citrine FRET pair, a new FP voltage sensor was synthesized with fast off kinetics (Tau(off)voltage-sensing phosphatase homolog, designated Zahra and Zahra 2, exhibited fast on and off kinetics within 2ms of the time constants observed with the organic voltage-sensitive dye, di4-ANEPPS. Mutagenesis of the S4 region of the Danio FP voltage sensor shifted the voltage dependence to more negative potentials but did not noticeably affect the kinetics of the optical signal. Copyright © 2012 Elsevier B.V. All rights reserved.
Baker, Bradley J.; Jin, Lei; Han, Zhou; Cohen, Lawrence B.; Popovic, Marko; Platisa, Jelena; Pieribone, Vincent
2012-01-01
A substantial increase in the speed of the optical response of genetically-encoded Fluorescent Protein voltage sensors (FP voltage sensors) was achieved by using the voltage-sensing phosphatase genes of Nematostella vectensis and Danio rerio. A potential N. vectensis voltage-sensing phosphatase was identified in silico. The voltage-sensing domain (S1–S4) of the N. vectensis homolog was used to create an FP voltage sensor called Nema. By replacing the phosphatase with a cerulean/citrine FRET pair, a new FP voltage sensor was synthesized with fast off kinetics (Tauoff voltage-sensing phosphatase homolog, designated Zahra and Zahra 2, exhibited fast on and off kinetics within 2 msec of the time constants observed with the organic voltage-sensitive dye, di4-ANEPPS. Mutagenesis of the S4 region of the Danio FP voltage sensor shifted the voltage dependence to more negative potentials but did not noticeably affect the kinetics of the optical signal. PMID:22634212
Short Toxin-like Proteins Abound in Cnidaria Genomes
Directory of Open Access Journals (Sweden)
Michal Linial
2012-11-01
Full Text Available Cnidaria is a rich phylum that includes thousands of marine species. In this study, we focused on Anthozoa and Hydrozoa that are represented by the Nematostella vectensis (Sea anemone and Hydra magnipapillata genomes. We present a method for ranking the toxin-like candidates from complete proteomes of Cnidaria. Toxin-like functions were revealed using ClanTox, a statistical machine-learning predictor trained on ion channel inhibitors from venomous animals. Fundamental features that were emphasized in training ClanTox include cysteines and their spacing along the sequences. Among the 83,000 proteins derived from Cnidaria representatives, we found 170 candidates that fulfill the properties of toxin-like-proteins, the vast majority of which were previously unrecognized as toxins. An additional 394 short proteins exhibit characteristics of toxin-like proteins at a moderate degree of confidence. Remarkably, only 11% of the predicted toxin-like proteins were previously classified as toxins. Based on our prediction methodology and manual annotation, we inferred functions for over 400 of these proteins. Such functions include protease inhibitors, membrane pore formation, ion channel blockers and metal binding proteins. Many of the proteins belong to small families of paralogs. We conclude that the evolutionary expansion of toxin-like proteins in Cnidaria contributes to their fitness in the complex environment of the aquatic ecosystem.
Reproduction of Persian Gulf anemone fish (Amphiprion clarkii) in captive system
Javad Sahandi
2011-01-01
The present study was carried out to assess the reproduction of Persian Gulf anemone fish,Amphiprion clarkii (Bennett, 1830), in captive conditions with artificial features. Persian Gulf, havinggood relation with Indian Ocean, is one of the important niches of fishes and the specific position ofthis Gulf makes its fishes popular. The yellow tail clown fish which originates to this gulf has the bestsurvival rate and health than the other areas. Live food is the most important factor in product...
サンゴイソギンチャクにおけるZooxanthellaeについて
佐倉, 緑; 鈴木, 博
1997-01-01
In this short report, the population and localization of the zooxanthellae, the endosymbiotic algae in sea anemone (Entacmea actinostoloides), are dealt with. The population of zooxanthellae is concentrated in the tentacles and oral disc of the sea anemone, while it is not so dense near its basal disc. Algae are concentrated in a location that provides the most direct exposure to sunlight. In the tissues which include little number of nematocysts, enzyme cells and mucous cells, zooxanthellae ...
Gur Barzilai, Maya; Kahn, Roy; Regev, Noa; Gordon, Dalia; Moran, Yehu; Gurevitz, Michael
2014-10-15
Av3 is a peptide neurotoxin from the sea anemone Anemonia viridis that shows specificity for arthropod voltage-gated sodium channels (Navs). Interestingly, Av3 competes with a scorpion α-toxin on binding to insect Navs and similarly inhibits the inactivation process, and thus has been classified as 'receptor site-3 toxin', although the two peptides are structurally unrelated. This raises questions as to commonalities and differences in the way both toxins interact with Navs. Recently, site-3 was partly resolved for scorpion α-toxins highlighting S1-S2 and S3-S4 external linkers at the DIV voltage-sensor module and the juxtaposed external linkers at the DI pore module. To uncover channel determinants involved in Av3 specificity for arthropods, the toxin was examined on channel chimaeras constructed with the external linkers of the mammalian brain Nav1.2a, which is insensitive to Av3, in the background of the Drosophila DmNav1. This approach highlighted the role of linker DI/SS2-S6, adjacent to the channel pore, in determining Av3 specificity. Point mutagenesis at DI/SS2-S6 accompanied by functional assays highlighted Trp404 and His405 as a putative point of Av3 interaction with DmNav1. His405 conservation in arthropod Navs compared with tyrosine in vertebrate Navs may represent an ancient substitution that explains the contemporary selectivity of Av3. Trp404 and His405 localization near the membrane surface and the hydrophobic bioactive surface of Av3 suggest that the toxin possibly binds at a cleft by DI/S6. A partial overlap in receptor site-3 of both toxins nearby DI/S6 may explain their binding competition capabilities.
Lehnert, Erik M; Burriesci, Matthew S; Pringle, John R
2012-06-22
Coral reefs are hotspots of oceanic biodiversity, forming the foundation of ecosystems that are important both ecologically and for their direct practical impacts on humans. Corals are declining globally due to a number of stressors, including rising sea-surface temperatures and pollution; such stresses can lead to a breakdown of the essential symbiotic relationship between the coral host and its endosymbiotic dinoflagellates, a process known as coral bleaching. Although the environmental stresses causing this breakdown are largely known, the cellular mechanisms of symbiosis establishment, maintenance, and breakdown are still largely obscure. Investigating the symbiosis using an experimentally tractable model organism, such as the small sea anemone Aiptasia, should improve our understanding of exactly how the environmental stressors affect coral survival and growth. We assembled the transcriptome of a clonal population of adult, aposymbiotic (dinoflagellate-free) Aiptasia pallida from ~208 million reads, yielding 58,018 contigs. We demonstrated that many of these contigs represent full-length or near-full-length transcripts that encode proteins similar to those from a diverse array of pathways in other organisms, including various metabolic enzymes, cytoskeletal proteins, and neuropeptide precursors. The contigs were annotated by sequence similarity, assigned GO terms, and scanned for conserved protein domains. We analyzed the frequency and types of single-nucleotide variants and estimated the size of the Aiptasia genome to be ~421 Mb. The contigs and annotations are available through NCBI (Transcription Shotgun Assembly database, accession numbers JV077153-JV134524) and at http://pringlelab.stanford.edu/projects.html. The availability of an extensive transcriptome assembly for A. pallida will facilitate analyses of gene-expression changes, identification of proteins of interest, and other studies in this important emerging model system.
Directory of Open Access Journals (Sweden)
Mark Briffa
Full Text Available 'Animal personality' means that individuals differ from one another in either single behaviours or suites of related behaviours in a way that is consistent over time. It is usually assumed that such consistent individual differences in behaviour are driven by variation in how individuals respond to information about their environment, rather than by differences in external factors such as variation in microhabitat. Since behavioural variation is ubiquitous in nature we might expect 'animal personality' to be present in diverse taxa, including animals with relatively simple nervous systems. We investigated in situ startle responses in a sea anemone, Actinia equina, to determine whether personalities might be present in this example of an animal with a simple nervous system. We found very high levels of repeatability among individuals that were re-identified in the same locations over a three week sampling period. In a subset of the data, where we used tide-pool temperature measurements to control for a key element of variation in microhabitat, these high levels of repeatability remained. Although a range of other consistent differences in micro-habitat features could have contributed to consistent differences between the behaviour of individuals, these data suggest the presence of animal personality in A. equina. Rather than being restricted to certain groups, personality may be a general feature of animals and may be particularly pronounced in species with simple nervous systems.
Directory of Open Access Journals (Sweden)
Ricardo Calado
2007-06-01
Full Text Available The present work identifies the decapod crustaceans that associate with Anemonia sulcata on the southwestern Atlantic coast of Portugal and characterises their host use pattern. It determines whether the anemone is monopolised by any species, resulting in the exclusion of conspecifics or other decapods and, under laboratory conditions, it evaluates the degree of association between each species and A. sulcata. From all sampled anemones, 79% harboured at least 1 decapod crustacean, with the majority displaying either one or two specimens (32 and 24%, respectively. The most abundant species were the shrimp Periclimenes sagittifer and the crab Inachus phalangium (representing 36 and 31% of collected specimens, respectively, which displayed lasting associations and were commonly recorded among the tentacles of the host. The species Eualus occultus, E. complex cranchii, Clibanarius erythropus, Maja brachydactyla, Pilumnus hirtellus and Polybius (Necora puber displayed short-term associations, were mainly present on the substratum near the base, and avoided the tentacles of A. sulcata. Periclimenes sagittifer and I. phalangium were only recorded alone or in heterosexual pairs, appearing to efficiently defend their host against conspecifics. The majority of recorded species only seem to temporarily associate with A. sulcata, in order to seek protection from predators when other shelters are unavailable.
A taxonomic review of the dry-fruited species of Anemone (Ranunculaceae in southern Africa
Directory of Open Access Journals (Sweden)
J. C. Manning
2013-01-01
Full Text Available The three dry-fruited species of Anemone sect. Pulsatilloides subsect. Alchemillifoliae (Ranunculaceae from southern Africa are reviewed, with full descriptions and nomenclature, including complete synonomy, taxonomic history with nomenclatural corrections, ecological notes, and distribution. A. tenuifolia (L.f. DC. from the Cape Floristic Region is segregated as ser. Pinnatifoliae from the two summer rainfall species, A. caffra (Eckl. & Zeyh. Harv. and A. fanninnii Harv. ex Masters, which remain in ser. Alchemillifoliae, emphasising the strong vegetative differences between the two series.
Directory of Open Access Journals (Sweden)
Lehnert Erik M
2012-06-01
Full Text Available Abstract Background Coral reefs are hotspots of oceanic biodiversity, forming the foundation of ecosystems that are important both ecologically and for their direct practical impacts on humans. Corals are declining globally due to a number of stressors, including rising sea-surface temperatures and pollution; such stresses can lead to a breakdown of the essential symbiotic relationship between the coral host and its endosymbiotic dinoflagellates, a process known as coral bleaching. Although the environmental stresses causing this breakdown are largely known, the cellular mechanisms of symbiosis establishment, maintenance, and breakdown are still largely obscure. Investigating the symbiosis using an experimentally tractable model organism, such as the small sea anemone Aiptasia, should improve our understanding of exactly how the environmental stressors affect coral survival and growth. Results We assembled the transcriptome of a clonal population of adult, aposymbiotic (dinoflagellate-free Aiptasia pallida from ~208 million reads, yielding 58,018 contigs. We demonstrated that many of these contigs represent full-length or near-full-length transcripts that encode proteins similar to those from a diverse array of pathways in other organisms, including various metabolic enzymes, cytoskeletal proteins, and neuropeptide precursors. The contigs were annotated by sequence similarity, assigned GO terms, and scanned for conserved protein domains. We analyzed the frequency and types of single-nucleotide variants and estimated the size of the Aiptasia genome to be ~421 Mb. The contigs and annotations are available through NCBI (Transcription Shotgun Assembly database, accession numbers JV077153-JV134524 and at http://pringlelab.stanford.edu/projects.html. Conclusions The availability of an extensive transcriptome assembly for A. pallida will facilitate analyses of gene-expression changes, identification of proteins of interest, and other studies in this
Pappas, Melissa
2017-05-19
The biodiversity of the Red Sea remains relatively understudied, particularly for invertebrate taxa. Documenting present patterns of biodiversity is essential for better understanding Red Sea reef ecosystems and how these ecosystems may be impacted by stressors (such as fishing and climate change). Several species of giant clams (genus Tridacna) are reported from the Red Sea, although the majority of research effort has occurred in the Gulf of Aqaba. We investigated the genetic diversity (16S rDNA) of the Tridacna species found in the central Saudi Arabian Red Sea. We also investigated the genetic diversity (ITS rDNA) of symbiotic dinoflagellates Symbiodinium associated with these clams. Samples were collected from nine reefs on a cross-shelf gradient near Thuwal, Saudi Arabia. Two species, T. squamosa and T. maxima, were recorded, with the latter being the most abundant. Tridacna squamosina, a species recently reported in the northern Red Sea, was not found, suggesting that this species is not present or is very rare in our study region. All tridacnids sampled were found to harbor Symbiodinium grouped in Clade A, considered an opportunistic, heat-tolerant symbiont group in anemones and corals. The consistent association with Clade A Symbiodinium in central Red Sea tridacnids may reflect the consequence of adaptation to the relatively extreme conditions of the Red Sea. This study contributes to an ever-growing catalog of Red Sea biodiversity and serves as important baseline information for a region experiencing dynamic pressures.
Pappas, Melissa; He, Song; Hardenstine, Royale; Kanee, Hana; Berumen, Michael L.
2017-01-01
The biodiversity of the Red Sea remains relatively understudied, particularly for invertebrate taxa. Documenting present patterns of biodiversity is essential for better understanding Red Sea reef ecosystems and how these ecosystems may be impacted by stressors (such as fishing and climate change). Several species of giant clams (genus Tridacna) are reported from the Red Sea, although the majority of research effort has occurred in the Gulf of Aqaba. We investigated the genetic diversity (16S rDNA) of the Tridacna species found in the central Saudi Arabian Red Sea. We also investigated the genetic diversity (ITS rDNA) of symbiotic dinoflagellates Symbiodinium associated with these clams. Samples were collected from nine reefs on a cross-shelf gradient near Thuwal, Saudi Arabia. Two species, T. squamosa and T. maxima, were recorded, with the latter being the most abundant. Tridacna squamosina, a species recently reported in the northern Red Sea, was not found, suggesting that this species is not present or is very rare in our study region. All tridacnids sampled were found to harbor Symbiodinium grouped in Clade A, considered an opportunistic, heat-tolerant symbiont group in anemones and corals. The consistent association with Clade A Symbiodinium in central Red Sea tridacnids may reflect the consequence of adaptation to the relatively extreme conditions of the Red Sea. This study contributes to an ever-growing catalog of Red Sea biodiversity and serves as important baseline information for a region experiencing dynamic pressures.
Chiang, Cheng-Yi; Chen, Yi-Lin; Tsai, Huai-Jen
2014-08-01
Green fluorescent protein (GFP)-like proteins have been studied with the aim of developing fluorescent proteins. Since the property of color variation is understudied, we isolated a novel GFP-like chromoprotein from the carpet anemone Stichodactyla haddoni, termed shCP. Its maximum absorption wavelength peak (λ(max)) is located at 574 nm, resulting in a purple color. The shCP protein consists of 227 amino acids (aa), sharing 96 % identity with the GFP-like chromoprotein of Heteractis crispa. We mutated aa residues to examine any alteration in color. When E63, the first aa of the chromophore, was replaced by serine (E63S), the λ(max) of the mutated protein shCP-E63S was shifted to 560 nm and exhibited a pink color. When Q39, T194, and I196, which reside in the surrounding 5 Å of the chromophore's microenvironment, were mutated, we found that (1) the λ(max) of the mutated protein shCP-Q39S was shifted to 518 nm and exhibited a red color, (2) shCP-T194I exhibited a purple-blue color, and (3) an additional mutation at I196H of the mutated protein shCP-E63L exhibited green fluorescence. In contrast, when the aa located neither at the chromophore nor within its microenvironment were mutated, the resultant proteins shCP-L122H, -E138G, -S137D, -T95I, -D129N, -T194V, -E138Q, -G75E, -I183V, and -I70V never altered their purple color, suggesting that mutations at the shCP chromophore and the surrounding 5 Å microenvironment mostly control changes in color expression or cause fluorescence to develop. Additionally, we found that the cDNAs of shCP and its mutated varieties are faithfully and stably expressed both in Escherichia coli and zebrafish embryos.
Changes in Alaskan soft-bottom prey communities along a gradient in sea otter predation
Kvitek, R.G.; Oliver, J.S.; DeGange, A.R.; Anderson, B.S.
1992-01-01
Sea Otter (Enhydra lutris), well documented as "keystone" predators in rocky marine communities, were found to exert a strong influence on infaunal prey communities in soft-sediment habitats. Direct and indirect effects of sea otter predation on subtidal soft-bottom prey communities were evaluated along a temporal gradient of sea otter occupancy around the Kodiak Archipelago. The results indicate that Kodiak otters forage primarily on bivalve prey and dramatically reduce infaunal bivalve and green sea urchin (Strongylocentrotus droebachiensis) prey populations. Bivalve prey abundance, biomass, and size were inversely related to duration of sea otter occupancy. The relative conditions of shells discarded by otters in shallow ( 20 m) water at the same sites indicate that otters first exploited Saxidomus in shallow-water feeding areas, and later switched to Macoma spp. in deeper water. Otter-cracked shells of the deep-burrowing clam Tresus capax were rarely found, even at otter foraging sites where the clam accounted for the majority of available prey biomass, suggesting that it has a partial depth refuge from otter predation. The indirect effects of otter predation included substratum disturbance and the facilitation of sea star predation on infaunal prey. Sea stars, Pycnopodia helianthoides, were attracted to experimentally dug excavations as well as natural sea otter foraging pits, where the sea stars foraged on smaller size classes of infaunal bivalves than those eaten by otters. Otters also discard clam shells on the sediment surface and expose old, buried shells during excavation. Surface shells were found to provide attachment sites for large anemones and kelp. Our study shows that sea otters can affect soft-sediment communities, not only through predation, as in rocky habitats, but also through disturbance, and thus retain a high degree of influence in two very different habitat types.
Directory of Open Access Journals (Sweden)
Mark P Johnson
Full Text Available We describe a novel biotope at 633 to 762 m depth on a vertical wall in the Whittard Canyon, an extensive canyon system reaching from the shelf to the deep sea on Ireland's continental margin. We explored this wall with an ROV and compiled a photomosaic of the habitat. The assemblage contributing to the biotope was dominated by large limid bivalves, Acesta excavata (mean shell height 10.4 cm, and deep-sea oysters, Neopycnodonte zibrowii, at high densities, particularly at overhangs. Mean density of N. zibrowii increased with depth, with densities of the most closely packed areas of A. excavata also increasing with depth. Other taxa associated with the assemblage included the solitary coral Desmophyllum dianthus, cerianthid anemones, comatulid crinoids, the trochid gastropod Margarites sp., the portunid crab Bathynectes longispina and small fish of the family Bythitidae. The scleractinian coral Madrepora oculata, the pencil urchin Cidaris cidaris and a species of Epizoanthus were also common. Prominent but less abundant species included the flytrap anemone Actinoscyphia saginata, the carrier crab Paramola cuvieri, and the fishes Lepidion eques and Conger conger. Observations of the hydrography of the canyon system identified that the upper 500 m was dominated by Eastern North Atlantic Water, with Mediterranean Outflow Water beneath it. The permanent thermocline is found between 600 and 1000 m depth, i.e., in the depth range of the vertical wall and the dense assemblage of filter feeders. Beam attenuation indicated nepheloid layers present in the canyon system with the greatest amounts of suspended material at the ROV dive site between 500 and 750 m. A cross-canyon CTD transect indicated the presence of internal waves between these depths. We hypothesise that internal waves concentrate suspended sediment at high concentrations at the foot of the vertical wall, possibly explaining the large size and high density of filter-feeding molluscs.
Mlinarec, Jelena; Chester, Mike; Siljak-Yakovlev, Sonja; Papes, Drazena; Leitch, Andrew R; Besendorfer, Visnja
2009-01-01
The structure, abundance and location of repetitive DNA sequences on chromosomes can characterize the nature of higher plant genomes. Here we report on three new repeat DNA families isolated from Anemone hortensis L.; (i) AhTR1, a family of satellite DNA (stDNA) composed of a 554-561 bp long EcoRV monomer; (ii) AhTR2, a stDNA family composed of a 743 bp long HindIII monomer and; (iii) AhDR, a repeat family composed of a 945 bp long HindIII fragment that exhibits some sequence similarity to Ty3/gypsy-like retroelements. Fluorescence in-situ hybridization (FISH) to metaphase chromosomes of A. hortensis (2n = 16) revealed that both AhTR1 and AhTR2 sequences co-localized with DAPI-positive AT-rich heterochromatic regions. AhTR1 sequences occur at intercalary DAPI bands while AhTR2 sequences occur at 8-10 terminally located heterochromatic blocks. In contrast AhDR sequences are dispersed over all chromosomes as expected of a Ty3/gypsy-like element. AhTR2 and AhTR1 repeat families include polyA- and polyT-tracks, AT/TA-motifs and a pentanucleotide sequence (CAAAA) that may have consequences for chromatin packing and sequence homogeneity. AhTR2 repeats also contain TTTAGGG motifs and degenerate variants. We suggest that they arose by interspersion of telomeric repeats with subtelomeric repeats, before hybrid unit(s) amplified through the heterochromatic domain. The three repetitive DNA families together occupy approximately 10% of the A. hortensis genome. Comparative analyses of eight Anemone species revealed that the divergence of the A. hortensis genome was accompanied by considerable modification and/or amplification of repeats.
Directory of Open Access Journals (Sweden)
Kaufman Les
2010-04-01
Full Text Available Abstract Background The transcription factors of the LSF/Grainyhead (GRH family are characterized by the possession of a distinctive DNA-binding domain that bears no clear relationship to other known DNA-binding domains, with the possible exception of the p53 core domain. In triploblastic animals, the LSF and GRH subfamilies have diverged extensively with respect to their biological roles, general expression patterns, and mechanism of DNA binding. For example, Grainyhead (GRH homologs are expressed primarily in the epidermis, and they appear to play an ancient role in maintaining the epidermal barrier. By contrast, LSF homologs are more widely expressed, and they regulate general cellular functions such as cell cycle progression and survival in addition to cell-lineage specific gene expression. Results To illuminate the early evolution of this family and reconstruct the functional divergence of LSF and GRH, we compared homologs from 18 phylogenetically diverse taxa, including four basal animals (Nematostella vectensis, Vallicula multiformis, Trichoplax adhaerens, and Amphimedon queenslandica, a choanoflagellate (Monosiga brevicollis and several fungi. Phylogenetic and bioinformatic analyses of these sequences indicate that (1 the LSF/GRH gene family originated prior to the animal-fungal divergence, and (2 the functional diversification of the LSF and GRH subfamilies occurred prior to the divergence between sponges and eumetazoans. Aspects of the domain architecture of LSF/GRH proteins are well conserved between fungi, choanoflagellates, and metazoans, though within the Metazoa, the LSF and GRH families are clearly distinct. We failed to identify a convincing LSF/GRH homolog in the sequenced genomes of the algae Volvox carteri and Chlamydomonas reinhardtii or the amoebozoan Dictyostelium purpureum. Interestingly, the ancestral GRH locus has become split into two separate loci in the sea anemone Nematostella, with one locus encoding a DNA binding
National Research Council Canada - National Science Library
Lewbart, G.A
2012-01-01
.... Coverage includes sponges, jellyfish, anemones, corals, mollusks, starfish, sea urchins, crabs, crayfish, lobsters, shrimp, hermit crabs, spiders, scorpions, and many more, with chapters organized by taxonomy...
Borell, Esther M.; Steinke, Michael; Horwitz, Rael; Fine, Maoz
2014-01-01
Marine anthozoans maintain a mutualistic symbiosis with dinoflagellates that are prolific producers of the algal secondary metabolite dimethylsulfoniopropionate (DMSP), the precursor of the climate-cooling trace gas dimethyl sulfide (DMS). Surprisingly, little is known about the physiological role of DMSP in anthozoans and the environmental factors that regulate its production. Here, we assessed the potential functional role of DMSP as an antioxidant and determined how future increases in sea...
Bates, Amanda E; McLean, Lily; Laing, Patrick; Raeburn, Lisa A; Hare, Crystal
2010-06-01
This study investigated patterns in the relative abundance of two photosynthetic algal symbionts, zoochlorellae (ZC) and zooxanthellae (ZX), hosted by two temperate anemones, Anthopleura elegantissima and A. xanthogrammica. Previous studies have documented varying proportions of each symbiont along environmental gradients, presumably determined by their respective physiological capabilities. To test for differences in the algal type between the two host species, we sampled anemone tissues (tentacle or tentacle and body column) of similarly sized polyps that were located close together in multiple habitats: tidepools, crevices, underneath rock ledges, and along natural light gradients in caves. The ZC-A. elegantissima symbiosis was rare on the west coast of Vancouver Island, British Columbia, Canada. Even in low-irradiance habitats, ZC were the dominant algae hosted by A. xanthogrammica, while nearby A. elegantissima hosted ZX or was algae-free. As a first step in determining whether symbiont growth rates differed between the two host species, we quantified mitotic index (MI), the percentage of cells with division furrows, under artificial light and in the field by simultaneously sampling tentacles from both species. MI was more stable in A. elegantissima: the MI of ZX isolated from the tentacles of A. xanthogrammica was slightly higher at a light level of 80 micromol quanta m(-2) s(-1) than it was for ZX from A. elegantissima (respectively, 7.3 vs. 6.2) and relatively lower at 40 micromol quanta m(-2) s(-1) (3.9 vs. 5.6). Our data indicate host-specific differences in symbiont distributions and MI when extrinsic physical parameters were similar.
Huang, Chen; Morlighem, Jean-Étienne Rl; Zhou, Hefeng; Lima, Érica P; Gomes, Paula B; Cai, Jing; Lou, Inchio; Pérez, Carlos D; Lee, Simon Ming; Rádis-Baptista, Gandhi
2016-10-05
Protopalythoa is a zoanthid that, together with thousands of predominantly marine species, such as hydra, jellyfish, and sea anemones, composes the oldest eumetazoan phylum, i.e., the Cnidaria. Some of these species, such as sea wasps and sea anemones, are highly venomous organisms that can produce deadly toxins for preying, for defense or for territorial disputes. Despite the fact that hundreds of organic and polypeptide toxins have been characterized from sea anemones and jellyfish, practically nothing is known about the toxin repertoire in zoanthids. Here, based on a transcriptome analysis of the zoanthid Protopalythoa variabilis, numerous predicted polypeptides with canonical venom protein features are identified. These polypeptides comprise putative proteins from different toxin families: neurotoxic peptides, hemostatic and hemorrhagic toxins, membrane-active (pore-forming) proteins, protease inhibitors, mixed-function venom enzymes, and venom auxiliary proteins. The synthesis and functional analysis of two of these predicted toxin products, one related to the ShK/Aurelin family and the other to a recently discovered anthozoan toxin, displayed potent in vivo neurotoxicity that impaired swimming in larval zebrafish. Altogether, the complex array of venom-related transcripts that are identified in P. variabilis, some of which are first reported in Cnidaria, provides novel insight into the toxin distribution among species and might contribute to the understanding of composition and evolution of venom polypeptides in toxiferous animals. © The Author 2016. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution.
Sato, Masaaki; Honda, Kentaro; Uy, Wilfredo H; Baslot, Darwin I; Genovia, Tom G; Nakamura, Yohei; Bernardo, Lawrence Patrick C; Kurokochi, Hiroyuki; Pantallano, Allyn Duvin S; Lian, Chunlan; Nadaoka, Kazuo; Nakaoka, Masahiro
2017-10-01
The establishment of marine protected areas (MPAs) can often lead to environmental differences between MPAs and fishing zones. To determine the effects on marine dispersal of environmental dissimilarity between an MPA and fishing zone, we examined the abundance and recruitment patterns of two anemonefishes ( Amphiprion frenatus and A. perideraion ) that inhabit sea anemones in different management zones (i.e., an MPA and two fishing zones) by performing a field survey and a genetic parentage analysis. We found lower levels of abundance per anemone in the MPA compared to the fishing zones for both species ( n = 1,525 anemones, p = .032). The parentage analysis also showed that lower numbers of fishes were recruited from the fishing zones and outside of the study area into each anemone in the MPA than into each anemone in the fishing zones ( n = 1,525 anemones, p fishing zones ( n = 384 females, p = .516). Because the ocean currents around the study site were unlikely to cause a lower settlement intensity of larvae in the MPA, the ocean circulation was not considered crucial to the observed abundance and recruitment patterns. Instead, stronger top-down control and/or a lower density of host anemones in the MPA were potential factors for such patterns. Our results highlight the importance of dissimilarity in a marine environment as a factor that affects connectivity.
Dangerous reef aquaristics: Palytoxin of a brown encrusting anemone causes toxic corneal reactions.
Ruiz, Yasmin; Fuchs, Joan; Beuschel, Ralf; Tschopp, Markus; Goldblum, David
2015-11-01
Although frequently observed in domestic saltwater aquariums, literature on exposure to palytoxin (PTX) of encrusting anemones (Zoanthidea) kept in aquariums is rare. Handling these animals for propagation purposes or during cleaning work can lead to dermal, ocular or respiratory contact with the PTX generated by some Zoanthids. The present study describes a case of ocular exposure to liquid from a Zoanthid, which led to corneal ulcers. The patient also suffered from systemic symptoms of dyspnea and shivering and a suspected rhabdomyolysis, which required monitoring in the Intensive Care Unit. After symptomatic treatment provided insufficient results, the corneal ulcers improved with an amniotic membrane transplantation. A review of the literature regarding ocular exposures to this diverse order of Hexacorallia reveals that severe and systemic symptoms can develop with minimal contact. Copyright © 2015 Elsevier Ltd. All rights reserved.
Dicty_cDB: Contig-U01461-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 38 0.002 2 ( FK759294 ) av02122h06r1.1 Symbiotic sea anemone (Anemonia vi... 40 0.002 3 ( AC178264 ) Strongy... ) Strongylocentrotus purpuratus clone R3-14I24, WOR... 44 0.014 6 ( FK730160 ) av02050j21r1.1 Symbiotic sea
Field and laboratory investigations of budding in the tetillid sponge Cinachyrella cavernosa
Digital Repository Service at National Institute of Oceanography (India)
Singh, A.; Thakur, N.L.
Author for correspondence. Email address: thakurn@nio.org 2 Marine invertebrates such as corals, sponges, sea urchins, sea cucumbers, sea anemones and barnacles can adopt different reproductive strategies (e.g., asexual and /or sexual... factors. Among various marine invertebrates, sponges are noteworthy because they have evolved different modes of propagation (both sexual and asexual) even though they lack specialized reproductive organs. Moreover, asexual reproduction can...
Actiniarian Sea anemone fauna of India
Digital Repository Service at National Institute of Oceanography (India)
Parulekar, A.H.
stream_size 11 stream_content_type text/plain stream_name Mar_Biofouling_Power_Plants_1990_218.pdf.txt stream_source_info Mar_Biofouling_Power_Plants_1990_218.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset...
Salles, Océane C.
2016-07-26
The life-history traits and population dynamics of species are increasingly being attributed to the characteristics of their preferred habitats. While coral reef fish are often strongly associated with particular habitats, long-term studies establishing the demographic and life-history consequences of occupying different reef substrata are rare and no studies have monitored individuals in situ over their lifetime and determined the fate of their offspring. Here, we documented a quasi-turnover and local reproductive success for an entire population of orange clownfish (Amphiprion percula) from Kimbe Island, Papua New Guinea, by taking bi-annual samples of DNA over a 10-yr period (2003–2013). We compared demographic and life-history traits of individuals living on two host anemone species, Heteractis magnifica and Stichodactyla gigantea, including female size, adult continued presence (a proxy for relative longevity range), early post-settlement growth, the number of eggs per clutch and ‘local’ reproductive success (defined for each adult as the number of offspring returning to the natal population). Our results indicate that while the relative longevity of adults was similar on both host anemone species, females living in H. magnifica were larger than females in S. gigantea. However, despite females growing larger and producing more eggs on H. magnifica, we found that local reproductive success was significantly higher for clownfish living in S. gigantea. Life-history traits also exhibited local spatial variation, with higher local reproductive success recorded for adults living on S. gigantea on the eastern side of the island. Our findings support a ‘silver-spoon’ hypothesis that predicts individuals that are fortunate enough to recruit into good habitat and location will be rewarded with higher long-term reproductive success and will make a disproportionate contribution to population renewal. © 2016 Springer-Verlag Berlin Heidelberg
Are Niemann-Pick type C proteins key players in cnidarian-dinoflagellate endosymbioses?
Dani, Vincent; Ganot, Philippe; Priouzeau, Fabrice; Furla, Paola; Sabourault, Cecile
2014-09-01
The symbiotic interaction between cnidarians, such as corals and sea anemones, and the unicellular algae Symbiodinium is regulated by yet poorly understood cellular mechanisms, despite the ecological importance of coral reefs. These mechanisms, including host-symbiont recognition and metabolic exchange, control symbiosis stability under normal conditions, but also lead to symbiosis breakdown (bleaching) during stress. This study describes the repertoire of the sterol-trafficking proteins Niemann-Pick type C (NPC1 and NPC2) in the symbiotic sea anemone Anemonia viridis. We found one NPC1 gene in contrast to the two genes (NPC1 and NPC1L1) present in vertebrate genomes. While only one NPC2 gene is present in many metazoans, this gene has been duplicated in cnidarians, and we detected four NPC2 genes in A. viridis. However, only one gene (AvNPC2-d) was upregulated in symbiotic relative to aposymbiotic sea anemones and displayed higher expression in the gastrodermis (symbiont-containing tissue) than in the epidermis. We performed immunolabelling experiments on tentacle cross sections and demonstrated that the AvNPC2-d protein was closely associated with symbiosomes. In addition, AvNPC1 and AvNPC2-d gene expression was strongly downregulated during stress. These data suggest that AvNPC2-d is involved in both the stability and dysfunction of cnidarian-dinoflagellate symbioses. © 2014 John Wiley & Sons Ltd.
Lesions of Copper Toxicosis in Captive Marine Invertebrates With Comparisons to Normal Histology.
LaDouceur, E E B; Wynne, J; Garner, M M; Nyaoke, A; Keel, M K
2016-05-01
Despite increasing concern for coral reef ecosystem health within the last decade, there is scant literature concerning the histopathology of diseases affecting the major constituents of coral reef ecosystems, particularly marine invertebrates. This study describes histologic findings in 6 species of marine invertebrates (California sea hare [Aplysia californica], purple sea urchin [Strongylocentrotus purpuratus], sunburst anemone [Anthopleura sola], knobby star [Pisaster giganteus], bat star [Asterina miniata], and brittle star [Ophiopteris papillosa]) with spontaneous copper toxicosis, 4 purple sea urchins with experimentally induced copper toxicosis, and 1 unexposed control of each species listed. The primary lesions in the California sea hare with copper toxicosis were branchial and nephridial necrosis. Affected echinoderms shared several histologic lesions, including epidermal necrosis and ulceration and increased numbers of coelomocytes within the water-vascular system. The sunburst anemone with copper toxicosis had necrosis of both epidermis and gastrodermis, as well as expulsion of zooxanthellae from the gastrodermis. In addition to the lesions attributed to copper toxicosis, our results describe normal microscopic features of these animals that may be useful for histopathologic assessment of marine invertebrates. © The Author(s) 2015.
Wang, Xiaoyang; Wang, Minchang; Xu, Min; Wang, Yi; Tang, Haifeng; Sun, Xiaoli
2014-02-18
Phytochemical investigation of the n-BuOH extract of the rhizomes of Anemone rivularis var. flore-minore led to the isolation of five new oleanane-type triterpenoid saponins 1-5, together with five known saponins 6-10. Their structures were determined by the extensive use of 1D and 2D NMR experiments, along with ESIMS analyses and acid hydrolysis. The aglycone of 4 and 5 was determined as 21α-hydroxyoleanolic acid, which was reported in this genus for the first time. The cytotoxicity of these compounds was evaluated against four human cancer cell line, including HL-60 (promyelocytic leukemia), HepG2 (hepatocellular carcinoma), A549 (lung carcinoma) and HeLa (cervical carcinoma). The monodesmosidic saponins 6-8 exhibited cytotoxic activity toward all tested cancer cell lines, with IC50 values in the 7.25-22.38 μM range.
Directory of Open Access Journals (Sweden)
Sandrine Baillon
Full Text Available Anthoptilum grandiflorum and Halipteris finmarchica are two deep-sea corals (Octocorallia: Pennatulacea common on soft bottoms in the North Atlantic where they are believed to act as biogenic habitat. The former also has a worldwide distribution. To assist conservation efforts, this study examines spatial and temporal patterns in the abundance, diversity, and nature of their faunal associates. A total of 14 species were found on A. grandiflorum and 6 species on H. finmarchica during a multi-year and multi-site sampling campaign in eastern Canada. Among those, 7 and 5 species, respectively, were attached to the sea pens and categorized as close associates or symbionts. Rarefaction analyses suggest that the most common associates of both sea pens have been sampled. Biodiversity associated with each sea pen is analyzed according to season, depth and region using either close associates or the broader collection of species. Associated biodiversity generally increases from northern to southern locations and does not vary with depth (∼ 100-1400 m. Seasonal patterns in A. grandiflorum show higher biodiversity during spring/summer due to the transient presence of early life stages of fishes and shrimps whereas it peaks in fall for H. finmarchica. Two distinct endoparasitic species of highly modified copepods (families Lamippidae and Corallovexiidae commonly occur in the polyps of A. grandiflorum and H. finmarchica, and a commensal sea anemone frequently associates with H. finmarchica. Stable isotope analyses (δ(13C and δ(15N reveal potential trophic interactions between the parasites and their hosts. Overall, the diversity of obligate/permanent associates of sea pens is moderate; however the presence of mobile/transient associates highlights an ecological role that has yet to be fully elucidated and supports their key contribution to the enhancement of biodiversity in the Northwest Atlantic.
Gene : CBRC-PTRO-14-0016 [SEVENS
Lifescience Database Archive (English)
Full Text Available icted protein [Nematostella vectensis] gb|EDO44122.1| predicted protein [Nematostella vectensis] 5e-22 27% MHIPYTYIPYICISH...IYVYPYTYIPHICIYRPYTYIPYICIAHIHISHIHISHIYMFIPYTYIPYPYIPCTCISHIRISHVHVYPISVYPMYMYIPYPYIPCTCISHIR...ISHVHVYPVSVYPMYMYIPYPYIPCTCISHIRISHVHVYPVSVYPMYMYILYPYIPCTCISRIRISHVYVYPIYVYPMYMYNPYTYIPYISCVCIYKYPVCIYIYPVCIYIYISCVCVCVYIYIHTHTYSSVFLFLFYFIF ...
Bouwmeester, Jessica
2016-06-22
Recent coral spawning observations in the central Red Sea show that most scleractinian species release their gametes in the spring, with a majority of species spawning in April. There is, however, a lack of reproductive data for several other coral species, as well as a general lack of data for other invertebrates. Here, we document the detailed timing of spawning for 13 scleractinian coral species, one sea anemone, and six echinoderms from an inshore reef off the coast of Thuwal, Saudi Arabia, in the spring between April and June 2014. Furthermore, inferred from the presence of mature gametes, we report the month of spawning for three additional coral species in the spring. Seven scleractinian coral species were inferred to release their gametes in a second reproductive season, in the autumn, between September and November. This is the first report of a second spawning season in the Arabian region. Biannual spawning has so far been reported on the Great Barrier Reef, in Western Australia, in Indonesia, in Malaysia, in Palau, in Thailand, in Taiwan, and in Western Samoa. © 2016, The American Microscopical Society, Inc.
Gates, R. D.; Muscatine, L.
1992-09-01
Three maceration methods are described for the isolation of single endoderm cells from marine cnidarians. Two are enzymatic treatments suitable for fleshy anthozoans such as sea anemones and zoanthids. The third employs calcium free sea water and is suitable for stony corals. The viability and morphology of the endoderm cells is described using fluorogenic dyes and scanning and transmission electron microscopy.
African Zoology - Vol 34, No 4 (1999)
African Journals Online (AJOL)
Korsaranthus natalensis (Carlgren, 1938) nov. comb. (Cnidaria: Actiniaria) a mobile sea anemone attacking octocorals · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Karin Riemann-Zürneck, Charles L. Griffiths, 190-196 ...
Sun, Wei; Zhang, Fengli; He, Liming; Li, Zhiyong
2014-05-01
Diverse sessile organisms inhabit the coral reef ecosystems, including corals, sponges, and sea anemones. In the past decades, scleractinian corals (Cnidaria, Anthozoa, Scleractinia) and their associated microorganisms have attracted much attention. Zoanthids (Cnidaria, Anthozoa, Zoanthidea) are commonly found in coral reefs. However, little is known about the community structure of zoanthid-associated microbiota. In this study, the microbial community associated with the zoanthid Palythoa australiae in the South China Sea was investigated by 454 pyrosequencing. As a result, 2,353 bacterial, 583 archaeal, and 36 eukaryotic microbial ribotypes were detected, respectively. A total of 22 bacterial phyla (16 formally described phyla and six candidate phyla) were recovered. Proteobacteria was the most abundant group, followed by Chloroflexi and Actinobacteria. High-abundance Rhizobiales and diverse Chloroflexi were observed in the bacterial community. The archaeal population was composed of Crenarchaeota and Euryarchaeota, with Marine Group I as the dominant lineage. In particular, Candidatus Nitrosopumilus dominated the archaeal community. Besides bacteria and archaea, the zoanthid harbored eukaryotic microorganisms including fungi and algae though their diversity was very low. This study provided the first insights into the microbial community associated with P. australiae by 454 pyrosequencing, consequently laid a basis for the understanding of the association of P. australiae-microbes symbioses.
Dispersal and speciation: The cross Atlantic relationship of two parasitic cnidarians
DEFF Research Database (Denmark)
Dnyansagar, Rohit; Zimmermann, Bob; Moran, Yehu
2018-01-01
How dispersal strategies impact the distribution of species and subsequent speciation events is a fundamental question in evolutionary biology. Sedentary benthic marine organisms, such as corals or sea anemones usually rely on motile larval stages for dispersal and therefore have a relatively res...
Directory of Open Access Journals (Sweden)
О.М. Tsarenko
2016-06-01
Full Text Available Based on SEM and LM some morphological and anatomical features of achenes of Anemone L. of Ukrainian flora (A. narcissiflora, A. sylvestris, A. nemorosa, A. narcissiflora have been investigated. Сarpological features after which it is possible to diagnose species are detected: the dimensions and shape of the achenes and beaks, the peculiarities of pubescence (length and character of localization of the hairs, a presence of different appendages of pericarp (as ribs or wings which surround body of fruit, thickness of pericarp and peculiarities of the thickness of the cell walls of endocarp. Detailed descriptions of fruitlets have been represented. The key for determination of species not in a flourishing condition on the revealed signs have been composed. Data obtained are important for systematics and phylogeny of the genus and the family as a whole.
Directory of Open Access Journals (Sweden)
Alex D Rogers
2012-01-01
Full Text Available Since the first discovery of deep-sea hydrothermal vents along the Galápagos Rift in 1977, numerous vent sites and endemic faunal assemblages have been found along mid-ocean ridges and back-arc basins at low to mid latitudes. These discoveries have suggested the existence of separate biogeographic provinces in the Atlantic and the North West Pacific, the existence of a province including the South West Pacific and Indian Ocean, and a separation of the North East Pacific, North East Pacific Rise, and South East Pacific Rise. The Southern Ocean is known to be a region of high deep-sea species diversity and centre of origin for the global deep-sea fauna. It has also been proposed as a gateway connecting hydrothermal vents in different oceans but is little explored because of extreme conditions. Since 2009 we have explored two segments of the East Scotia Ridge (ESR in the Southern Ocean using a remotely operated vehicle. In each segment we located deep-sea hydrothermal vents hosting high-temperature black smokers up to 382.8°C and diffuse venting. The chemosynthetic ecosystems hosted by these vents are dominated by a new yeti crab (Kiwa n. sp., stalked barnacles, limpets, peltospiroid gastropods, anemones, and a predatory sea star. Taxa abundant in vent ecosystems in other oceans, including polychaete worms (Siboglinidae, bathymodiolid mussels, and alvinocaridid shrimps, are absent from the ESR vents. These groups, except the Siboglinidae, possess planktotrophic larvae, rare in Antarctic marine invertebrates, suggesting that the environmental conditions of the Southern Ocean may act as a dispersal filter for vent taxa. Evidence from the distinctive fauna, the unique community structure, and multivariate analyses suggest that the Antarctic vent ecosystems represent a new vent biogeographic province. However, multivariate analyses of species present at the ESR and at other deep-sea hydrothermal vents globally indicate that vent biogeography is more
Cnidarian Neurotoxic Peptides Affecting Central Nervous System Targets.
Lazcano-Pérez, Fernando; Hernández-Guzmán, Ulises; Sánchez-Rodríguez, Judith; Arreguín-Espinosa, Roberto
2016-01-01
Natural products from animal venoms have been used widely in the discovery of novel molecules with particular biological activities that enable their use as potential drug candidates. The phylum Cnidaria (jellyfish, sea anemones, corals zoanthids, hydrozoans, etc.) is the most ancient venomous phylum on earth. Its venoms are composed of a complex mixture of peptidic compounds with neurotoxic and cytolitic properties that have shown activity on mammalian systems despite the fact that they are naturally targeted against fish and invertebrate preys, mainly crustaceans. For this reason, cnidarian venoms are an interesting and vast source of molecules with a remarkable activity on central nervous system, targeting mainly voltage-gated ion channels, ASIC channels, and TRPV1 receptors. In this brief review, we list the amino acid sequences of most cnidarian neurotoxic peptides reported to date. Additionally, we propose the inclusion of a new type of voltage-gated sea anemone sodium channel toxins based on the most recent reports.
Analysis of an Anemone-Type Eruption in an On-Disk Coronal Hole
Adams, Mitzi; Tennant, Allyn; Alexander, Caroline; Sterling, Alphonse; Moore, Ronald; Woolley, Robert
2016-01-01
We report on an eruption seen in a very small coronal hole (about 120 arcseconds across), beginning at approximately 19:00 Universal Time on March 3, 2016. The event was initially observed by an amateur astronomer (RW) in an H-alpha movie from the Global Oscillation Network Group (GONG); the eruption attracted the attention of the observer because there was no nearby active region. To examine the region in detail, we use data from the Solar Dynamics Observatory (SDO), provided by the Atmospheric Imaging Assembly (AIA) in wavelengths 193 angstroms, 304 angstroms, and 94 angstroms, and the Helioseismic and Magnetic Imager (HMI). Data analysis and calibration activities such as scaling, rotation so that north is up, and removal of solar rotation are accomplished with SunPy. The eruption in low-cadence HMI data begins with the appearance of a bipole in the location of the coronal hole, followed by (apparent) expansion outwards when the intensity of the AIA wavelengths brighten; as the event proceeds, the coronal hole disappears. From high-cadence data, we will present results on the magnetic evolution of this structure, how it is related to intensity brightenings seen in the various SDO/AIA wavelengths, and how this event compares with the standard-anemone picture.
African Journals Online (AJOL)
Items 1 - 25 of 1853 ... (Cnidaria: Actiniaria) a mobile sea anemone attacking octocorals, Abstract PDF. Karin Riemann-Zürneck, Charles L. Griffiths. Vol 35, No 2 (2000), Kroyeria deetsi n.sp. (Kroyeriidae: Siphonostomatoida), a parasitic copepod infecting gills of spinner sharks, Carcharhinus brevipinna (Müller & Henle, 1839), ...
Gastrin/CCK-like immunoreactivity in the nervous system of coelenterates
DEFF Research Database (Denmark)
Grimmelikhuijzen, C J; Sundler, F; Rehfeld, J F
1980-01-01
Using immunocytochemistry, gastrin/CCK-like immunoreactivity is found in sensory nerve cells in the ectoderm of the mouth region of hydra and in nerve cells in the endoderm of all body regions of the sea anemone tealia. These results are corroborated by radioimmunoassay: One hydra contains at lea...
Magie, Craig; Bossert, Patricia; Aramli, Lili; Thomsen, Gerald
2016-01-01
Animal biology is fascinating for its incredible diversity in life strategies. These strategies amaze scientists and can also fire the enthusiasm of science students. One group of animals impressive in this way is the phylum "Cnidaria," containing some 10,000 invertebrate species that include jellyfish, corals, sea anemones, hydroids,…
To Build an Ecosystem: An Introductory Lab for Environmental Science & Biology Students
Hudon, Daniel; Finnerty, John R.
2013-01-01
A hypothesis-driven laboratory is described that introduces students to the complexities of ecosystem function. Students work with live algae, brine shrimp, and sea anemones to test hypotheses regarding the trophic interactions among species, the exchange of nutrients and gases, and the optimal ratio of producers to consumers and predators in…
Dicty_cDB: Contig-U16417-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available CAFZ10096.rev CAFZ Alvinella pompejana Incyte reg... 32 1.1 3 ( FK743489 ) av02083p10r1.1 Symbiotic...cl... 26 1.4 6 ( FK745351 ) av02070p02r1.1 Symbiotic sea anemone (Anemonia vi... 32 1.5 3 ( EJ367168 ) 10929
Variations in the Life Cycle of Anemone patens L. (Ranunculaceae in Wild Populations of Canada
Directory of Open Access Journals (Sweden)
Vladimir Kricsfalusy
2016-06-01
Full Text Available Based on a study of a perennial herb Anemone patens L. (Ranunculaceae in a variety of natural habitats in Saskatchewan, Canada, eight life stages (seed, seedling, juvenile, immature, vegetative, generative, subsenile, and senile are distinguished and characterized in detail. The species ontogenetic growth patterns are investigated. A. patens has a long life cycle that may last for several decades which leads to the formation of compact clumps. The distribution and age of clumps vary substantially in different environments with different levels of disturbance. The plant ontogeny includes the regular cycle with reproduction occurring through seeds. There is an optional subsenile vegetative disintegration at the end of the life span. The following variations in the life cycle of A. patens are identified: with slower development in young age, with an accelerated development, with omission of the generative stage, with retrogression to previous life stages in mature age, and with vegetative dormancy. The range of variations in the life cycle of A. patens may play an important role in maintaining population stability in different environmental conditions and management regimes.
Dicty_cDB: Contig-U04071-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 6 ) CAPF4788.fwd CAPF Capitella sp. I ECS-2004 whole ... 72 4e-22 4 ( FK751871 ) av01047m03r1.1 Symbiotic... sea anemone (Anemonia vi... 78 7e-22 3 ( FK753948 ) av01037l24r1.1 Symbiotic sea an...M3650.b1_C02.ab1 CCI(LMS) chicory Cichorium in... 92 1e-16 2 ( FK756589 ) av02103n03r1.1 Symbiotic
Blocking actions of the sea anemone, Bunodosoma cavernata ...
African Journals Online (AJOL)
It was also found to block acetylcholine (ACh) – induced contractions of the ileum of grass cutter (90 + 6.2% inhibition + SEM) and the contractile action induced by ACh (0.2mg and 0.4mg) (89 + 5.8% inhibition + SEM) and histamine (0.075mg and 0.15mg) on the rabbit ileum (80 + 4.6% inhibition + SEM) . The antagonism ...
Dicty_cDB: Contig-U03464-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available alar cDNA c... 46 2.8 1 ( GE530226 ) CCHS17029.b1_J09.ab1 CCHS Espina Barnadesia spino... 46 2.8 1 ( FK723110 ) av02122j19r1.1 Symbio...tic sea anemone (Anemonia vi... 46 2.8 1 ( FG396350 ) 000320KSFA001919HT (KSFA) A.
Avsar, D.
2001-02-01
Life-history parameters and diet of spurdog ( Squalus acanthias) sampled from the SE Black Sea were studied. Spurdog from age classes I to XIV were identified, with a dominance of age class VIII for both sexes. The length-weight relationship was W=0·0040*L 2·95and the mean annual growth rates in length and weight were 7·2 cm and 540·1 g, respectively. The estimated von Bertalanffy growth parameters were: W ∞=12021 (g), L ∞=157 (cm), K=0·12 (year -1) and t 0=-1·30 (year). The size at first maturity was 82 cm for males and 88 cm for females. Mean biennial fecundity was also found to be 8 pups/female. The relationships between fecundity-length, fecundity-weight and fecundity-age were found to be: F=-17·0842+0·2369*L (R=0·93), F=0·3780+0·0018*W (R=0·89) and F =-0·7859+1·1609*A (R=0·94) respectively. The spurdog can be considered an opportunistic feeder. Their natural diet was composed mainly of teleost fishes, followed by Crustaceans, Nematodes and Actinarians (=sea anemones). Whiting ( Merlangius merlangus euxinus) was the predominant prey item among their fish prey. Demersal teleosts formed the majority of the diet, and there was no difference ( P>0·05) among the food items of immature, maturing and mature individuals of both sexes.
Imaging intracellular pH in a reef coral and symbiotic anemone.
Venn, A A; Tambutté, E; Lotto, S; Zoccola, D; Allemand, D; Tambutté, S
2009-09-29
The challenges corals and symbiotic cnidarians face from global environmental change brings new urgency to understanding fundamental elements of their physiology. Intracellular pH (pHi) influences almost all aspects of cellular physiology but has never been described in anthozoans or symbiotic cnidarians, despite its pivotal role in carbon concentration for photosynthesis and calcification. Using confocal microscopy and the pH sensitive probe carboxy SNARF-1, we mapped pHi in short-term light and dark-incubated cells of the reef coral Stylophora pistillata and the symbiotic anemone Anemonia viridis. In all cells isolated from both species, pHi was markedly lower than the surrounding seawater pH of 8.1. In cells that contained symbiotic algae, mean values of pHi were significantly higher in light treated cells than dark treated cells (7.41 +/- 0.22 versus 7.13 +/- 0.24 for S. pistillata; and 7.29 +/- 0.15 versus 7.01 +/- 0.27 for A. viridis). In contrast, there was no significant difference in pHi in light and dark treated cells without algal symbionts. Close inspection of the interface between host cytoplasm and algal symbionts revealed a distinct area of lower pH adjacent to the symbionts in both light and dark treated cells, possibly associated with the symbiosome membrane complex. These findings are significant developments for the elucidation of models of inorganic carbon transport for photosynthesis and calcification and also provide a cell imaging procedure for future investigations into how pHi and other fundamental intracellular parameters in corals respond to changes in the external environment such as reductions in seawater pH.
Stochastic occurrence of trimery from pentamery in floral phyllotaxis of Anemone (Ranunculaceae
Directory of Open Access Journals (Sweden)
Miho S. Kitazawa
2016-12-01
Full Text Available Merosity, indicating the basic number of floral organs such as sepals and petals, has been constrained to specific and stable numbers during the evolution of angiosperms. The ancestral flower is considered to have a spiral arrangement of perianth organs, as in phyllotaxis, the arrangement of leaves. How has the ancestral spiral evolved into flowers with specific merosities? To address this question, we studied perianth organ arrangement in the Anemone genus of the basal eudicot family Ranunculaceae, because various merosities are found in this genus. In three species, A. flaccida, A. scabiosa, and A. nikoensis that are normally pentamerous, we found positional arrangement of the excessive sixth perianth organ indicating the possibility of a transition from pentamerous to trimerous arrangement. Arrangement was intraspecifically stochastic, but constrained to three of five types, where trimerous arrangement was the most frequent in all species except for a form of A. scabiosa. The rank of frequency of the other two types was species-dependent. We connect these observations with classical theories of spiral phyllotaxis. The phyllotaxis model for initiation of the sixth organ showed that the three arrangements occur at a divergence angle <144°, indicating the spiral nature of floral phyllotaxis rather than a perfect penta-radial symmetry of 144°. The model further showed that selective occurrence of trimerous arrangement is mainly regulated by the organ growth rate. Differential organ growth as well as divergence angle may regulate transitions between pentamerous and trimerous flowers in intraspecific variation as well as in species evolution.
Sea level trends in South East Asian Seas (SEAS)
Strassburg, M. W.; Hamlington, B. D.; Leben, R. R.; Manurung, P.; Lumban Gaol, J.; Nababan, B.; Vignudelli, S.; Kim, K.-Y.
2014-10-01
Southeast Asian Seas (SEAS) span the largest archipelago in the global ocean and provide a complex oceanic pathway connecting the Pacific and Indian Oceans. The SEAS regional sea level trends are some of the highest observed in the modern satellite altimeter record that now spans almost two decades. Initial comparisons of global sea level reconstructions find that 17 year sea level trends over the past 60 years exhibit good agreement in areas and at times of strong signal to noise associated decadal variability forced by low frequency variations in Pacific trade winds. The SEAS region exhibits sea level trends that vary dramatically over the studied time period. This historical variation suggests that the strong regional sea level trends observed during the modern satellite altimeter record will abate as trade winds fluctuate on decadal and longer time scales. Furthermore, after removing the contribution of the Pacific Decadal Oscillation (PDO) to sea level trends in the past twenty years, the rate of sea level rise is greatly reduced in the SEAS region. As a result of the influence of the PDO, the SEAS regional sea level trends during 2010s and 2020s are likely to be less than the global mean sea level (GMSL) trend if the observed oscillations in wind forcing and sea level persist. Nevertheless, long-term sea level trends in the SEAS will continue to be affected by GMSL rise occurring now and in the future.
Dicty_cDB: Contig-U16439-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available cDNA clon... 50 6e-16 3 ( FK739797 ) av01001d15r1.1 Symbiotic sea anemone (Anemonia vi... 84 4e-15 2 ( D872... ( CB933531 ) ri31b11.y1 Meloidogyne chitwoodi egg pAMP1 v1 Mel... 64 4e-11 2 ( FK729638 ) av02130e15r1.1 Symbiotic
The mining of toxin-like polypeptides from EST database by single residue distribution analysis.
Kozlov, Sergey; Grishin, Eugene
2011-01-31
Novel high throughput sequencing technologies require permanent development of bioinformatics data processing methods. Among them, rapid and reliable identification of encoded proteins plays a pivotal role. To search for particular protein families, the amino acid sequence motifs suitable for selective screening of nucleotide sequence databases may be used. In this work, we suggest a novel method for simplified representation of protein amino acid sequences named Single Residue Distribution Analysis, which is applicable both for homology search and database screening. Using the procedure developed, a search for amino acid sequence motifs in sea anemone polypeptides was performed, and 14 different motifs with broad and low specificity were discriminated. The adequacy of motifs for mining toxin-like sequences was confirmed by their ability to identify 100% toxin-like anemone polypeptides in the reference polypeptide database. The employment of novel motifs for the search of polypeptide toxins in Anemonia viridis EST dataset allowed us to identify 89 putative toxin precursors. The translated and modified ESTs were scanned using a special algorithm. In addition to direct comparison with the motifs developed, the putative signal peptides were predicted and homology with known structures was examined. The suggested method may be used to retrieve structures of interest from the EST databases using simple amino acid sequence motifs as templates. The efficiency of the procedure for directed search of polypeptides is higher than that of most currently used methods. Analysis of 39939 ESTs of sea anemone Anemonia viridis resulted in identification of five protein precursors of earlier described toxins, discovery of 43 novel polypeptide toxins, and prediction of 39 putative polypeptide toxin sequences. In addition, two precursors of novel peptides presumably displaying neuronal function were disclosed.
Horwitz, Rael; Borell, Esther M.; Yam, Ruth; Shemesh, Aldo; Fine, Maoz
2015-01-01
Contemporary cnidarian-algae symbioses are challenged by increasing CO2 concentrations (ocean warming and acidification) affecting organisms' biological performance. We examined the natural variability of carbon and nitrogen isotopes in the symbiotic sea anemone Anemonia viridis to investigate dietary shifts (autotrophy/heterotrophy) along a natural pCO2 gradient at the island of Vulcano, Italy. ?13C values for both algal symbionts (Symbiodinium) and host tissue of A. viridis became significa...
Regulation of intracellular pH in cnidarians: response to acidosis in Anemonia viridis.
Laurent, Julien; Venn, Alexander; Tambutté, Éric; Ganot, Philippe; Allemand, Denis; Tambutté, Sylvie
2014-02-01
The regulation of intracellular pH (pHi) is a fundamental aspect of cell physiology that has received little attention in studies of the phylum Cnidaria, which includes ecologically important sea anemones and reef-building corals. Like all organisms, cnidarians must maintain pH homeostasis to counterbalance reductions in pHi, which can arise because of changes in either intrinsic or extrinsic parameters. Corals and sea anemones face natural daily changes in internal fluids, where the extracellular pH can range from 8.9 during the day to 7.4 at night. Furthermore, cnidarians are likely to experience future CO₂-driven declines in seawater pH, a process known as ocean acidification. Here, we carried out the first mechanistic investigation to determine how cnidarian pHi regulation responds to decreases in extracellular and intracellular pH. Using the anemone Anemonia viridis, we employed confocal live cell imaging and a pH-sensitive dye to track the dynamics of pHi after intracellular acidosis induced by acute exposure to decreases in seawater pH and NH₄Cl prepulses. The investigation was conducted on cells that contained intracellular symbiotic algae (Symbiodinium sp.) and on symbiont-free endoderm cells. Experiments using inhibitors and Na⁺-free seawater indicate a potential role of Na⁺/H⁺ plasma membrane exchangers (NHEs) in mediating pHi recovery following intracellular acidosis in both cell types. We also measured the buffering capacity of cells, and obtained values between 20.8 and 43.8 mM per pH unit, which are comparable to those in other invertebrates. Our findings provide the first steps towards a better understanding of acid-base regulation in these basal metazoans, for which information on cell physiology is extremely limited. © 2013 FEBS.
The mining of toxin-like polypeptides from EST database by single residue distribution analysis
Directory of Open Access Journals (Sweden)
Grishin Eugene
2011-01-01
Full Text Available Abstract Background Novel high throughput sequencing technologies require permanent development of bioinformatics data processing methods. Among them, rapid and reliable identification of encoded proteins plays a pivotal role. To search for particular protein families, the amino acid sequence motifs suitable for selective screening of nucleotide sequence databases may be used. In this work, we suggest a novel method for simplified representation of protein amino acid sequences named Single Residue Distribution Analysis, which is applicable both for homology search and database screening. Results Using the procedure developed, a search for amino acid sequence motifs in sea anemone polypeptides was performed, and 14 different motifs with broad and low specificity were discriminated. The adequacy of motifs for mining toxin-like sequences was confirmed by their ability to identify 100% toxin-like anemone polypeptides in the reference polypeptide database. The employment of novel motifs for the search of polypeptide toxins in Anemonia viridis EST dataset allowed us to identify 89 putative toxin precursors. The translated and modified ESTs were scanned using a special algorithm. In addition to direct comparison with the motifs developed, the putative signal peptides were predicted and homology with known structures was examined. Conclusions The suggested method may be used to retrieve structures of interest from the EST databases using simple amino acid sequence motifs as templates. The efficiency of the procedure for directed search of polypeptides is higher than that of most currently used methods. Analysis of 39939 ESTs of sea anemone Anemonia viridis resulted in identification of five protein precursors of earlier described toxins, discovery of 43 novel polypeptide toxins, and prediction of 39 putative polypeptide toxin sequences. In addition, two precursors of novel peptides presumably displaying neuronal function were disclosed.
Life-History Traits and Population Structure of Pederson Cleaner Shrimps Ancylomenes pedersoni.
Gilpin, Jessica A; Chadwick, Nanette E
2017-12-01
Cleaner organisms perform key functional roles in reducing rates of parasitism in marine communities. Pederson cleaner shrimps Ancylomenes pedersoni are major cleaners of reef fishes in the tropical western Atlantic and form obligate symbioses with host sea anemones. Information about their life-history traits would contribute to understanding how symbiosis impacts life-history evolution in crustaceans, but little is known about patterns of growth and reproduction in this anemone shrimp. We quantified growth, sexual reproduction, senescence, and mortality in individuals of A. pedersoni under laboratory conditions and their abundance and population size structure on coral reefs in St. Thomas, U.S. Virgin Islands. Von Bertalanffy growth curves were fitted to the data to determine age-size relationships, and the Beverton-Holt model was used to estimate mortality rates and size at maximum yield. Individuals grew rapidly when young, then slowed their growth after reaching sexual maturity at ~6 months. Individuals were gonochoric, with males attaining significantly smaller body sizes and shorter life spans than did females. Prior to death at <2 years, members of both genders exhibited senescence during which they ceased reproducing, shrank (females only), and decreased their activity levels over ~1-4 weeks. Field populations were abundant and composed mostly of juveniles during both years examined. Populations appeared to be stable but highly dynamic in terms of individuals, reaching maximum yield at 4 months of age. We conclude that obligate symbiosis with large sea anemones and cleaner mutualism with reef fishes both contribute to explaining aspects of the life history of Pederson shrimps, especially their apparent mating system of pure-search polygynandry. This life-history information also provides a scientific basis for sustainable fishery management and aquaculture of this key coral reef organism.
Characterization of superoxide dismutases in anoxia- and hyperoxia-tolerant symbiotic cnidarians.
Richier, Sophie; Merle, Pierre-Laurent; Furla, Paola; Pigozzi, Delphine; Sola, François; Allemand, Denis
2003-04-07
Many cnidarians, such as sea anemones, contain photosynthetic symbiotic dinoflagellates called zooxanthellae. During a light/dark cycle, the intratentacular O(2) state changes in minutes from hypoxia to hyperoxia (3-fold normoxia). To understand the origin of the high tolerance to these unusual oxic conditions, we have characterized superoxide dismutases (SODs) from the three cellular compartments (ectoderm, endoderm and zooxanthellae) of the Mediterranean sea anemone Anemonia viridis. The lowest SOD activity was found in ectodermal cells while endodermal cells and zooxanthellae showed a higher SOD activity. Two, seven and six SOD activity bands were identified on native PAGE in ectoderm, endoderm and zooxanthellae, respectively. A CuZnSOD was identified in both ectodermal and endodermal tissues. MnSODs were detected in all compartments with two different subcellular localizations. One band displays a classical mitochondrial localization, the three others being extramitochondrial. FeSODs present in zooxanthellae also appeared in endodermal host tissue. The isoelectric points of all SODs were distributed between 4 and 5. For comparative study, a similar analysis was performed on the whole homogenate of a scleractinian coral Stylophora pistillata. These results are discussed in the context of tolerance to hyperoxia and to the transition from anoxia to hyperoxia.
The Role of Symbiotic Zooxanthellae on Giant Clam Nutrition
Ambariyanto
1997-01-01
Zooxanthellae, Symbiodinium sp, are single cell dinoflagellate algae known to live in association with many marine invertebrates such as hermatypic corals, sea anemones, jellyfish and giant clams (family Tridacnidae). In giant clams, these photosynthetic algae are located in a tubular system (known as Z tube system) which occurs within the clams. Apart from filter feeding, the nutrition of the clams is provided by zooxanthellae. These algae are capable of translocating part of their photosynt...
Ten new records of marine invertebrates from the Azores
Directory of Open Access Journals (Sweden)
WIRTZ, P.
2009-01-01
Full Text Available The sea anemones Telmatactis cricoides (Duchassaign, 1850 and Actinia n. sp., themolluscs Tonna galea Linnaeus, 1758, Vitreolina philippi (de Rayneval & Ponzi, 1854,Melanella n. sp., Phidiana lynceus (de Rayneval & Ponzi, 1854 and Anomia patelliformis(Linnaeus, 1761, the nemertine Baseodiscus delineatus (DelleChiaje, 1825 and the echinoderms Leptosynapta inhaerens (O. F. Müller, 1776 and Stichopus regalis (Cuvier, 1817, are here recorded from the Azores for the first time. The presence of the two starfishspecies Chaetaster longipes (Retzius, 1805 and Luidia ciliaris (Philippi, 1837 in the Azores is confirmed and the spawning behaviour of the sea urchin Echinocyamus pusillus (O. F. Müller, 1776 is described.
Johnsen, Sönke; Frank, Tamara M; Haddock, Steven H D; Widder, Edith A; Messing, Charles G
2012-10-01
Bioluminescence is common and well studied in mesopelagic species. However, the extent of bioluminescence in benthic sites of similar depths is far less studied, although the relatively large eyes of benthic fish, crustaceans and cephalopods at bathyal depths suggest the presence of significant biogenic light. Using the Johnson-Sea-Link submersible, we collected numerous species of cnidarians, echinoderms, crustaceans, cephalopods and sponges, as well as one annelid from three sites in the northern Bahamas (500-1000 m depth). Using mechanical and chemical stimulation, we tested the collected species for light emission, and photographed and measured the spectra of the emitted light. In addition, in situ intensified video and still photos were taken of different benthic habitats. Surprisingly, bioluminescence in benthic animals at these sites was far less common than in mesopelagic animals from similar depths, with less than 20% of the collected species emitting light. Bioluminescent taxa comprised two species of anemone (Actinaria), a new genus and species of flabellate Parazoanthidae (formerly Gerardia sp.) (Zoanthidea), three sea pens (Pennatulacea), three bamboo corals (Alcyonacea), the chrysogorgiid coral Chrysogorgia desbonni (Alcyonacea), the caridean shrimp Parapandalus sp. and Heterocarpus ensifer (Decapoda), two holothuroids (Elasipodida and Aspidochirota) and the ophiuroid Ophiochiton ternispinus (Ophiurida). Except for the ophiuroid and the two shrimp, which emitted blue light (peak wavelengths 470 and 455 nm), all the species produced greener light than that measured in most mesopelagic taxa, with the emissions of the pennatulaceans being strongly shifted towards longer wavelengths. In situ observations suggested that bioluminescence associated with these sites was due primarily to light emitted by bioluminescent planktonic species as they struck filter feeders that extended into the water column.
Sea level trends in Southeast Asian seas
Strassburg, M. W.; Hamlington, B. D.; Leben, R. R.; Manurung, P.; Lumban Gaol, J.; Nababan, B.; Vignudelli, S.; Kim, K.-Y.
2015-05-01
Southeast Asian seas span the largest archipelago in the global ocean and provide a complex oceanic pathway connecting the Pacific and Indian oceans. The Southeast Asian sea regional sea level trends are some of the highest observed in the modern satellite altimeter record that now spans almost 2 decades. Initial comparisons of global sea level reconstructions find that 17-year sea level trends over the past 60 years exhibit good agreement with decadal variability associated with the Pacific Decadal Oscillation and related fluctuations of trade winds in the region. The Southeast Asian sea region exhibits sea level trends that vary dramatically over the studied time period. This historical variation suggests that the strong regional sea level trends observed during the modern satellite altimeter record will abate as trade winds fluctuate on decadal and longer timescales. Furthermore, after removing the contribution of the Pacific Decadal Oscillation (PDO) to sea level trends in the past 20 years, the rate of sea level rise is greatly reduced in the Southeast Asian sea region. As a result of the influence of the PDO, the Southeast Asian sea regional sea level trends during the 2010s and 2020s are likely to be less than the global mean sea level (GMSL) trend if the observed oscillations in wind forcing and sea level persist. Nevertheless, long-term sea level trends in the Southeast Asian seas will continue to be affected by GMSL rise occurring now and in the future.
Horwitz, Rael; Borell, Esther M; Yam, Ruth; Shemesh, Aldo; Fine, Maoz
2015-03-05
Contemporary cnidarian-algae symbioses are challenged by increasing CO2 concentrations (ocean warming and acidification) affecting organisms' biological performance. We examined the natural variability of carbon and nitrogen isotopes in the symbiotic sea anemone Anemonia viridis to investigate dietary shifts (autotrophy/heterotrophy) along a natural pCO2 gradient at the island of Vulcano, Italy. δ(13)C values for both algal symbionts (Symbiodinium) and host tissue of A. viridis became significantly lighter with increasing seawater pCO2. Together with a decrease in the difference between δ(13)C values of both fractions at the higher pCO2 sites, these results indicate there is a greater net autotrophic input to the A. viridis carbon budget under high pCO2 conditions. δ(15)N values and C/N ratios did not change in Symbiodinium and host tissue along the pCO2 gradient. Additional physiological parameters revealed anemone protein and Symbiodinium chlorophyll a remained unaltered among sites. Symbiodinium density was similar among sites yet their mitotic index increased in anemones under elevated pCO2. Overall, our findings show that A. viridis is characterized by a higher autotrophic/heterotrophic ratio as pCO2 increases. The unique trophic flexibility of this species may give it a competitive advantage and enable its potential acclimation and ecological success in the future under increased ocean acidification.
Host specialist clownfishes are environmental niche generalists
Litsios, Glenn; Kostikova, Anna; Salamin, Nicolas
2014-01-01
Why generalist and specialist species coexist in nature is a question that has interested evolutionary biologists for a long time. While the coexistence of specialists and generalists exploiting resources on a single ecological dimension has been theoretically and empirically explored, biological systems with multiple resource dimensions (e.g. trophic, ecological) are less well understood. Yet, such systems may provide an alternative to the classical theory of stable evolutionary coexistence of generalist and specialist species on a single resource dimension. We explore such systems and the potential trade-offs between different resource dimensions in clownfishes. All species of this iconic clade are obligate mutualists with sea anemones yet show interspecific variation in anemone host specificity. Moreover, clownfishes developed variable environmental specialization across their distribution. In this study, we test for the existence of a relationship between host-specificity (number of anemones associated with a clownfish species) and environmental-specificity (expressed as the size of the ecological niche breadth across climatic gradients). We find a negative correlation between host range and environmental specificities in temperature, salinity and pH, probably indicating a trade-off between both types of specialization forcing species to specialize only in a single direction. Trade-offs in a multi-dimensional resource space could be a novel way of explaining the coexistence of generalist and specialists. PMID:25274370
DEFF Research Database (Denmark)
Leviev, I; Williamson, M; Grimmelikhuijzen, C J
1997-01-01
The simple, freshwater polyp Hydra is often used as a model to study development in cnidarians. Recently, a neuropeptide, metamorphosis in a hydroid planula larva to become a polyp. Here, we have cloned a preprohormone...... from Hydra magnipapillata containing 11 (eight different) immature neuropeptide sequences that are structurally related to the metamorphosis-inducing neuropeptide from sea anermones. During the final phase of our cloning experiments, another research team independently isolated and sequenced five...... most frequent one being Gly-Pro-Pro-Pro-Gly-Leu-Trp-NH2; Hydra-LWamide l; three copies). Based on their structural similarities with the metamorphosis-inducing neuropeptide from sea anemones, the mature peptides derived from the Hydra-LWamide preprohormone are potential candidates for being...
National Oceanic and Atmospheric Administration, Department of Commerce — Surface temperatures and salinities were collected in the Barents Sea, Sea of Japan, North Atlantic Ocean, Philippine Sea, Red Sea, and South China Sea (Nan Hai)...
Observational analysis of air-sea fluxes and sea water temperature offshore South China Sea
Bi, X.; Huang, J.; Gao, Z.; Liu, Y.
2017-12-01
This paper investigates the air-sea fluxes (momentum flux, sensible heat flux and latent heat flux) from eddy covariance method based on data collected at an offshore observation tower in the South China Sea from January 2009 to December 2016 and sea water temperature (SWT) on six different levels based on data collected from November 2011 to June 2013. The depth of water at the tower over the sea averages about 15 m. This study presents the in-situ measurements of continuous air-sea fluxes and SWT at different depths. Seasonal and diurnal variations in air-sea fluxes and SWT on different depths are examined. Results show that air-sea fluxes and all SWT changed seasonally; sea-land breeze circulation appears all the year round. Unlike winters where SWT on different depths are fairly consistent, the difference between sea surface temperature (SST) and sea temperature at 10 m water depth fluctuates dramatically and the maximum value reaches 7 °C during summer.
Woo, Sau Pinn; Yasin, Zulfigar; Ismail, Siti Hasmah; Tan, Shau Hwai
2013-11-01
A study on the distribution and diversity of sea cucumbers in the coral reefs of the South China Sea, Sulu Sea and Sulawesi Sea was carried out in July 2009. The survey was done using wandering transect underwater with SCUBA. Twelve species of sea cucumber were found from four different families and nine genera. The most dominant family was Holothuriidae (five species), followed by Stichopodidae (three species), Synaptidae (three species) and Cucumariidae with only one species. The most dominant species found around the island was Pearsonothuria graffei, which can be found abundantly on substrate of dead corals in a wide range of depth (6-15 m). The Sulawesi Sea showed a higher diversity of sea cucumber with seven different species compared to the South China Sea with only six different species and Sulu Sea with only two species. Ordination by multidimensional scaling of Bray-Curtis similarities clustered the sampling locations to three main clusters with two outgroups. Previous studies done indicated a higher diversity of sea cucumber as compared to this study. This can be indication that the population and diversity of sea cucumbers in the reef is under threat.
International Nuclear Information System (INIS)
Candan, F.
2015-01-01
The present study presents a comparison of the pollen morphology and viability of naturally distributed four varieties of Anemone coronaria L. These are A. coronaria var. coccinea (Jord.) Burn, A. coronaria var. rosea (Hanry) Batt, A. coronaria var. cyanea, A. coronaria var. alba Goaty and Pens) and its commercial cultivars. The four varieties were collected from areas near the road side along the Kirkagac-Soma highway in the State of Manisa. The commercial cultivars were obtained from the commercial flower growers in the Urla region of zmir. Pollen viability levels decreased in all commercial cultivars of A. coronaria. The highest reduction in pollen viability was recorded in A. coronaria pink cultivars of de Caen group. The general pollen type is prolate spheroidal in all pure forms, but there are some pollen morphological features which were not observed in the natural ones, although encountered in all commercial cultivars. On the other hand, various non-viable pollen types like wrinkled pollens, with abnormally shaped pollens or pollinia were found in the commercial cultivars. It was concluded that pesticides used to produce more flowers with rapid growth are the major cause for his reduction. Another reason could be the use of tetraploid F1 hybrids of A. coronaria cultivars of de Caen group as commercial samples. (author)
Zhang, Dandan; Lei, Tianli; Lv, Chongning; Zhao, Huimin; Xu, Haiyan; Lu, Jincai
2017-02-15
The rhizome of Anemone raddeana Regel, a Traditional Chinese Medicine (TCM) which has a robust history treating rheumatism and neuralgia. The total secondary saponin (TSS) from it has demonstrated antitumor activity. In this study, a rapid and validated LC-MS/MS method was developed to simultaneously determine the active compounds (Hederacolchiside A1 and Eleutheroside K). Analytes were separated on a reverse-phase C18 column with acetonitrile-water (5mmol/L ammonium acetate) as the mobile phase. This assay showed acceptable linearity (r>0.99) over the concentration range 5-1000 nmol/L for two analytes. The intra- and inter-day precision was within 8.06% and accuracy was ranged from -3.16% to 3.34% for two analytes. The mean extraction recoveries of analytes and IS from rat plasma were all more than 76.0%. Under the developed analytical conditions, the obtained values of main pharmacokinetic parameters (C max and AUC 0-t ) indicated that the pure compounds were more efficient than the TSS extract in Hederacolchiside A1 and Eleutheroside K absorption. In addition, pharmacokinetic studies of two individual compounds demonstrated their poor oral absorption in rat ( a F%, 0.019-1.521). In the study of absorption and transportation of Hederacolchiside A1 and Eleutheroside K in Caco-2 cell monolayer model, the uptake permeability was in 10 -6 cm/sec range suggesting poor absorption, which confirmed the previous pharmacokinetic profiles in vivo. Interestingly, the uptake ratio of them declined significantly when treated with phloridzin (SGLT1 inhibitor). It indicated that the absorption of Hederacolchiside A1 in intestine was mainly through positive transport and SGLT1 might participate in its active absorption. Copyright © 2017 Elsevier B.V. All rights reserved.
Wind-sea surface temperature-sea ice relationship in the Chukchi-Beaufort Seas during autumn
Zhang, Jing; Stegall, Steve T.; Zhang, Xiangdong
2018-03-01
Dramatic climate changes, especially the largest sea ice retreat during September and October, in the Chukchi-Beaufort Seas could be a consequence of, and further enhance, complex air-ice-sea interactions. To detect these interaction signals, statistical relationships between surface wind speed, sea surface temperature (SST), and sea ice concentration (SIC) were analyzed. The results show a negative correlation between wind speed and SIC. The relationships between wind speed and SST are complicated by the presence of sea ice, with a negative correlation over open water but a positive correlation in sea ice dominated areas. The examination of spatial structures indicates that wind speed tends to increase when approaching the ice edge from open water and the area fully covered by sea ice. The anomalous downward radiation and thermal advection, as well as their regional distribution, play important roles in shaping these relationships, though wind-driven sub-grid scale boundary layer processes may also have contributions. Considering the feedback loop involved in the wind-SST-SIC relationships, climate model experiments would be required to further untangle the underlying complex physical processes.
Functional studies on the role of Notch signaling in Hydractinia development.
Gahan, James M; Schnitzler, Christine E; DuBuc, Timothy Q; Doonan, Liam B; Kanska, Justyna; Gornik, Sebastian G; Barreira, Sofia; Thompson, Kerry; Schiffer, Philipp; Baxevanis, Andreas D; Frank, Uri
2017-08-01
The function of Notch signaling was previously studied in two cnidarians, Hydra and Nematostella, representing the lineages Hydrozoa and Anthozoa, respectively. Using pharmacological inhibition in Hydra and a combination of pharmacological and genetic approaches in Nematostella, it was shown in both animals that Notch is required for tentacle morphogenesis and for late stages of stinging cell maturation. Surprisingly, a role for Notch in neural development, which is well documented in bilaterians, was evident in embryonic Nematostella but not in adult Hydra. Adult neurogenesis in the latter seemed to be unaffected by DAPT, a drug that inhibits Notch signaling. To address this apparent discrepancy, we studied the role of Notch in Hydractinia echinata, an additional hydrozoan, in all life stages. Using CRISPR-Cas9 mediated mutagenesis, transgenesis, and pharmacological interference we show that Notch is dispensable for Hydractinia normal neurogenesis in all life stages but is required for the maturation of stinging cells and for tentacle morphogenesis. Our results are consistent with a conserved role for Notch in morphogenesis and nematogenesis across Cnidaria, and a lineage-specific loss of Notch dependence in neurogenesis in hydrozoans. Copyright © 2017 Elsevier Inc. All rights reserved.
The genome of Aiptasia, a sea anemone model for coral symbiosis
Baumgarten, Sebastian; Simakov, Oleg; Esherick, Lisl Y.; Liew, Yi Jin; Lehnert, Erik M.; Michell, Craig; Li, Yong; Hambleton, Elizabeth A.; Guse, Annika; Oates, Matt E.; Gough, Julian; Weis, Virginia M.; Aranda, Manuel; Pringle, John R.; Voolstra, Christian R.
2015-01-01
The most diverse marine ecosystems, coral reefs, depend upon a functional symbiosis between a cnidarian animal host (the coral) and intracellular photosynthetic dinoflagellate algae. The molecular and cellular mechanisms underlying
Loram, J E; Trapido-Rosenthal, H G; Douglas, A E
2007-11-01
The giant sea anemone Condylactis gigantea associates with members of two clades of the dinoflagellate alga Symbiodinium, either singly or in mixed infection, as revealed by clade-specific quantitative polymerase chain reaction of large subunit ribosomal DNA. To explore the functional significance of this molecular variation, the fate of photosynthetically fixed carbon was investigated by (14)C radiotracer experiments. Symbioses with algae of clades A and B released ca. 30-40% of fixed carbon to the animal tissues. Incorporation into the lipid fraction and the low molecular weight fraction dominated by amino acids was significantly higher in symbioses with algae of clade A than of clade B, suggesting that the genetically different algae in C. gigantea are not functionally equivalent. Symbioses with mixed infections yielded intermediate values, such that this functional trait of the symbiosis can be predicted from the traits of the contributing algae. Coral and sea anemone symbioses with Symbiodinium break down at elevated temperature, a process known as 'coral bleaching'. The functional response of the C. gigantea symbiosis to heat stress varied between the algae of clades A and B, with particularly depressed incorporation of photosynthetic carbon into lipid of the clade B algae, which are more susceptible to high temperature than the algae of clade A. This study provides a first exploration of how the core symbiotic function of photosynthate transfer to the host varies with the genotype of Symbiodinium, an algal symbiont which underpins corals and, hence, coral reef ecosystems.
Liao, Qiwen; Li, Shengnan; Siu, Shirley Weng In; Yang, Binrui; Huang, Chen; Chan, Judy Yuet-Wa; Morlighem, Jean-Étienne R L; Wong, Clarence Tsun Ting; Rádis-Baptista, Gandhi; Lee, Simon Ming-Yuen
2018-02-02
Palythoa caribaeorum (class Anthozoa) is a zoanthid that together jellyfishes, hydra, and sea anemones, which are venomous and predatory, belongs to the Phyllum Cnidaria. The distinguished feature in these marine animals is the cnidocytes in the body tissues, responsible for toxin production and injection that are used majorly for prey capture and defense. With exception for other anthozoans, the toxin cocktails of zoanthids have been scarcely studied and are poorly known. Here, on the basis of the analysis of P. caribaeorum transcriptome, numerous predicted venom-featured polypeptides were identified including allergens, neurotoxins, membrane-active, and Kunitz-like peptides (PcKuz). The three predicted PcKuz isotoxins (1-3) were selected for functional studies. Through computational processing comprising structural phylogenetic analysis, molecular docking, and dynamics simulation, PcKuz3 was shown to be a potential voltage gated potassium-channel inhibitor. PcKuz3 fitted well as new functional Kunitz-type toxins with strong antilocomotor activity as in vivo assessed in zebrafish larvae, with weak inhibitory effect toward proteases, as evaluated in vitro. Notably, PcKuz3 can suppress, at low concentration, the 6-OHDA-induced neurotoxicity on the locomotive behavior of zebrafish, which indicated PcKuz3 may have a neuroprotective effect. Taken together, PcKuz3 figures as a novel neurotoxin structure, which differs from known homologous peptides expressed in sea anemone. Moreover, the novel PcKuz3 provides an insightful hint for biodrug development for prospective neurodegenerative disease treatment.
DEFF Research Database (Denmark)
Cassoli, Juliana Silva; Verano-Braga, Thiago; Oliveira, Joacir Stolarz
2013-01-01
duerdeni from Brazilian coast. We used a combination of offline RPC-MALDI-TOF and online nano-RPC-ESI-LTQ-Orbitrap proteomic techniques as well as functional bioassays. The mucus was milked by electric stimulation and fractionated by gel filtration on Sephadex G-50 yielding 5 main fractions. The low...... present in sea anemone secretions, the number of reported primary sequences is still low. Thus, to access the scenery of protein components from S. duerdeni mucus, including their biological functions, a robust proteomic approach was used together with bioinformatic tools. The demonstrated strategy...
Michaelis, Rune; Mielck, Finn; Papenmeier, Svenja; Sander, Lasse; Hass, H. Christian
2017-04-01
predominantly covered by sessile invertebrate organisms (e.g. the soft coral Alcyonium digitatum and the sea-anemone Metridium senile), while cobbles are largely uncovered. In muddy areas, however, even cobbles show a higher amount of sessile coverage though at an earlier or reduced state of development. The proposed method allows to obtain detailed data on the distribution, kind and composition of marine sessile organisms populating hard-substrate habitats in the North Sea. Already at this stage, the practical assumption of many investigations that stones are all and always inhabited by the typical organisms, which is utilized in many investigations can hardly be supported. Our research further shows the need to develop methodologies to upscale these observations to be able to assess spatial patterns between and within larger reef complexes. The video analysis presents a valuable first step towards a full-scale characterization of hard-substrate habitats under difficult survey conditions.
Climatology of sea breezes along the Red Sea coast of Saudi Arabia
Khan, Basit
2018-04-25
Long-term near-surface observations from five coastal stations, high-resolution model data from Modern Era Retrospective-Analysis for Research and Applications (MERRA) and high-resolution daily sea surface temperature (SST) from National Ocean and Atmospheric Administration (NOAA) are used to investigate the climatology of sea breezes over the eastern side of the Red Sea region. Results show existence of separate sea breeze systems along different segments of the Red Sea coastline. Based on the physical character and synoptic influences, sea breezes in the Red Sea are broadly divided into three regions: the north and the middle Red Sea (NMRS), the Red Sea convergence zone (RSCZ) and the southern Red Sea (SRS) regions. On average, sea breezes developed on 67% of days of the 10-year study period. Although sea breezes occur almost all year, this mesoscale phenomenon is most frequent from May to October (78% of the total sea breeze days). The sea breeze frequency increases from north to south (equatorwards), and sea breeze characteristics appear to vary both temporally and spatially. In addition to land-sea thermal differential, coastline shape, latitude and topography, the prevailing northwesterly at NMRS region, the convergence of northwesterly and southeasterly wind system at RSCZ region and the northeast and southwest monsoon at SRS region play an important role in defining the sea breeze characteristics over the Red Sea.
Intraseasonal sea surface temperature variability in Indonesian seas
Napitu, A. M.; Gordon, A. L.; Yuan, X.
2012-12-01
The satellite-derived sea surface temperature (SST) data, 1998-mid 2012, are used to examine intraseasonal variability (ISV; 20-90 days) across the Indonesian seas. The most energetic ISV is observed in the Banda Sea and across the Indo-Australia basin with an The satellite-derived sea surface temperature (SST) data, 1998-mid 2012, are used to examine intraseasonal variability (ISV; 20-90 days) across the Indonesian seas. The most energetic ISV is observed in the Banda Sea and across the Indo-Australia basin with an average SST standard deviation (STD) between 0.4-0.5°C, with strongest signature during boreal winter. What physical processes force the SST ISV variability within the Indonesian seas? Ocean process, sea-air interaction, or both? To help identify the main forcing, the satellite derived outgoing longwave radiation (OLR) and wind stress data in the region are examined. The OLR shows robust intraseasonal variations and is significantly correlated with the SST, particularly for variability with periods of 30-60 days, with OLR accounting for ~60-70% of the SST variance. The OLR is also maximum during boreal winter. Conversely, the surface wind may play insignificant role in perturbing the SST at intraseasonal timescales as shown by weak correlation between wind stress and SST. We thus suspect that the surface solar flux (suggested by the OLR) is likely more dominant than the surface turbulent heat flux (indicated by the surface wind) as the main source for the ISV in the SST in Indonesian seas. Furthermore the maximum OLR phase, coupled with a period of minimum mixed layer depth, may explain the strong SST variation during boreal winter in Indonesian seas. The influence of the Madden-Julian Oscillation (MJO) on the OLR and SST variability is currently being evaluated.
Wang, Yuangang; Tang, Haifeng; Zhang, Yun; Li, Juan; Li, Bo; Gao, Zhenhui; Wang, Xiaoyang; Cheng, Guang; Fei, Zhou
2013-11-01
Glioblastoma multiforme (GBM) is one of the most common malignant brain tumors. Saponin B, a novel compound isolated from the medicinal plant, Anemone taipaiensis, has been found to have a strong time- and dose-dependent cytostatic effect on human glioma cells and to suppress the growth of U87MG GBM cells. In this study, we investigated whether saponin B induces the apoptosis of glioblastoma cells and examined the underlying mechanism(s) of action of saponin B. Saponin B significantly suppressed U87MG cell proliferation. Flow cytometric analysis of DNA in the U87MG cells confirmed that saponin B blocked the cell cycle at the S phase. Furthermore, treatment of the U87MG cells with saponin B induced chromatin condensation and led to the formation of apoptotic bodies, as observed under a fluorescence microscope, and Annexin V/PI assay further suggested that phosphatidylserine (PS) externalization was apparent at higher drug concentrations. Treatment with saponin B activated the receptor-mediated pathway of apoptosis, as western blot analysis revealed the activation of Fas-l. Saponin B increased the Bax and caspase-3 ratio and decreased the protein expression of Bcl-2. The results from the present study demonstrate that the novel compound, saponin B, effectively induces the apoptosis of GBM cells and inhibits glioma cell growth and survival. Therefore, saponin B may be a potential candidate for the development of novel cancer therapeutics with antitumor activity against gliomas.
Pemberton, Per; Löptien, Ulrike; Hordoir, Robinson; Höglund, Anders; Schimanke, Semjon; Axell, Lars; Haapala, Jari
2017-08-01
The Baltic Sea is a seasonally ice-covered marginal sea in northern Europe with intense wintertime ship traffic and a sensitive ecosystem. Understanding and modeling the evolution of the sea-ice pack is important for climate effect studies and forecasting purposes. Here we present and evaluate the sea-ice component of a new NEMO-LIM3.6-based ocean-sea-ice setup for the North Sea and Baltic Sea region (NEMO-Nordic). The setup includes a new depth-based fast-ice parametrization for the Baltic Sea. The evaluation focuses on long-term statistics, from a 45-year long hindcast, although short-term daily performance is also briefly evaluated. We show that NEMO-Nordic is well suited for simulating the mean sea-ice extent, concentration, and thickness as compared to the best available observational data set. The variability of the annual maximum Baltic Sea ice extent is well in line with the observations, but the 1961-2006 trend is underestimated. Capturing the correct ice thickness distribution is more challenging. Based on the simulated ice thickness distribution we estimate the undeformed and deformed ice thickness and concentration in the Baltic Sea, which compares reasonably well with observations.
International Nuclear Information System (INIS)
Schwartz, M.L.
1979-01-01
Study of Cenozoic Era sea levels shows a continual lowering of sea level through the Tertiary Period. This overall drop in sea level accompanied the Pleistocene Epoch glacio-eustatic fluctuations. The considerable change of Pleistocene Epoch sea level is most directly attributable to the glacio-eustatic factor, with a time span of 10 5 years and an amplitude or range of approximately 200 m. The lowering of sea level since the end of the Cretaceous Period is attributed to subsidence and mid-ocean ridges. The maximum rate for sea level change is 4 cm/y. At present, mean sea level is rising at about 3 to 4 mm/y. Glacio-eustacy and tectono-eustacy are the parameters for predicting sea level changes in the next 1 my. Glacio-eustatic sea level changes may be projected on the basis of the Milankovitch Theory. Predictions about tectono-eustatic sea level changes, however, involve predictions about future tectonic activity and are therefore somewhat difficult to make. Coastal erosion and sedimentation are affected by changes in sea level. Erosion rates for soft sediments may be as much as 50 m/y. The maximum sedimentation accumulation rate is 20 m/100 y
The wind sea and swell waves climate in the Nordic seas
Semedo, Alvaro; Vettor, Roberto; Breivik, Øyvind; Sterl, Andreas; Reistad, Magnar; Soares, Carlos Guedes; Lima, Daniela
2015-02-01
A detailed climatology of wind sea and swell waves in the Nordic Seas (North Sea, Norwegian Sea, and Barents Sea), based on the high-resolution reanalysis NORA10, developed by the Norwegian Meteorological Institute, is presented. The higher resolution of the wind forcing fields, and the wave model (10 km in both cases), along with the inclusion of the bottom effect, allowed a better description of the wind sea and swell features, compared to previous global studies. The spatial patterns of the swell-dominated regional wave fields are shown to be different from the open ocean, due to coastal geometry, fetch dimensions, and island sheltering. Nevertheless, swell waves are still more prevalent and carry more energy in the Nordic Seas, with the exception of the North Sea. The influence of the North Atlantic Oscillation on the winter regional wind sea and swell patterns is also presented. The analysis of the decadal trends of wind sea and swell heights during the NORA10 period (1958-2001) shows that the long-term trends of the total significant wave height (SWH) in the Nordic Seas are mostly due to swell and to the wave propagation effect.
Li, Fu; Liu, Xin; Tang, Minghai; Chen, Bin; Ding, Lisheng; Chen, Lijuan; Wang, Mingkui
2012-05-15
Electrospray ionization ion-trap tandem mass spectrometry (ESI-MS(n)) was first employed for reinvestigating the structures of hupehensis saponin F and G previously isolated from Anemone hupehensis in our lab. Hupehensis saponin G was determined to contain one more trisaccharide unit (Rha-(1→4)-Glc-(1→6)-Glc-), not a glucose residue, than saponin F based on their molecular weights deduced from their [M+Na](+) ions in ESI-MS spectra. The (2,4)A(4α)-ion at m/z 551.3 formed by retro-Diels-Alder (RDA) rearrangement in positive mode illustrated that the C-28 sugar chains of the two saponins were composed of trisaccharide repeating moieties with (1→4) linkages rather than (1→3) linkages. The interpretation of 2D-NMR spectra of the two compounds also confirmed the results obtained by ESI-MS(n). Moreover, from the water soluble part of A. hupehensis, two novel triterpene saponins were tentatively characterized to contain 4 and 5 (1→4)-linked above trisaccharide repeating moieties at C-28 position according to their ESI-MS(n) behaviors, respectively. Copyright © 2012 Elsevier Ltd. All rights reserved.
Investigating Arctic Sea Ice Survivability in the Beaufort Sea
Directory of Open Access Journals (Sweden)
Matthew Tooth
2018-02-01
Full Text Available Arctic sea ice extent has continued to decline in recent years, and the fractional coverage of multi-year sea ice has decreased significantly during this period. The Beaufort Sea region has been the site of much of the loss of multi-year sea ice, and it continues to play a large role in the extinction of ice during the melt season. We present an analysis of the influence of satellite-derived ice surface temperature, ice thickness, albedo, and downwelling longwave/shortwave radiation as well as latitude and airborne snow depth estimates on the change in sea ice concentration in the Beaufort Sea from 2009 to 2016 using a Lagrangian tracking database. Results from this analysis indicate that parcels that melt during summer in the Beaufort Sea reside at lower latitudes and have lower ice thickness at the beginning of the melt season in most cases. The influence of sea ice thickness and snow depth observed by IceBridge offers less conclusive results, with some years exhibiting higher thicknesses/depths for melted parcels. Parcels that melted along IceBridge tracks do exhibit lower latitudes and ice thicknesses, however, which indicates that earlier melt and breakup of ice may contribute to a greater likelihood of extinction of parcels in the summer.
Digital Repository Service at National Institute of Oceanography (India)
Church, J.A.; Clark, P.U.; Cazenave, A.; Gregory, J.M.; Jevrejeva, S.; Levermann, A.; Merrifield, M.A.; Milne, G.A.; Nerem, R.S.; Nunn, P.D.; Payne, A.J.; Pfeffer, W.T.; Stammer, D.; Unnikrishnan, A.S.
This chapter considers changes in global mean sea level, regional sea level, sea level extremes, and waves. Confidence in projections of global mean sea level rise has increased since the Fourth Assessment Report (AR4) because of the improved...
Air-sea exchange studies at the North Sea
Leeuw, G. de; Eijk, A.M.J. van; Kunz, G.J.; Veefkind, P.J.
1996-01-01
The North Sea can be considered as a local 'inner' sea in which many processes are quite different from these over the open ocean. The surrounding land has a major influence, being the source for man-made aerosols and gases, whereas the North Sea acts as a sink for these. At the same time the North
Sea ice dynamics across the Mid-Pleistocene transition in the Bering Sea.
Detlef, H; Belt, S T; Sosdian, S M; Smik, L; Lear, C H; Hall, I R; Cabedo-Sanz, P; Husum, K; Kender, S
2018-03-05
Sea ice and associated feedback mechanisms play an important role for both long- and short-term climate change. Our ability to predict future sea ice extent, however, hinges on a greater understanding of past sea ice dynamics. Here we investigate sea ice changes in the eastern Bering Sea prior to, across, and after the Mid-Pleistocene transition (MPT). The sea ice record, based on the Arctic sea ice biomarker IP 25 and related open water proxies from the International Ocean Discovery Program Site U1343, shows a substantial increase in sea ice extent across the MPT. The occurrence of late-glacial/deglacial sea ice maxima are consistent with sea ice/land ice hysteresis and land-glacier retreat via the temperature-precipitation feedback. We also identify interactions of sea ice with phytoplankton growth and ocean circulation patterns, which have important implications for glacial North Pacific Intermediate Water formation and potentially North Pacific abyssal carbon storage.
Symbiosis-induced adaptation to oxidative stress.
Richier, Sophie; Furla, Paola; Plantivaux, Amandine; Merle, Pierre-Laurent; Allemand, Denis
2005-01-01
Cnidarians in symbiosis with photosynthetic protists must withstand daily hyperoxic/anoxic transitions within their host cells. Comparative studies between symbiotic (Anemonia viridis) and non-symbiotic (Actinia schmidti) sea anemones show striking differences in their response to oxidative stress. First, the basal expression of SOD is very different. Symbiotic animal cells have a higher isoform diversity (number and classes) and a higher activity than the non-symbiotic cells. Second, the symbiotic animal cells of A. viridis also maintain unaltered basal values for cellular damage when exposed to experimental hyperoxia (100% O(2)) or to experimental thermal stress (elevated temperature +7 degrees C above ambient). Under such conditions, A. schmidti modifies its SOD activity significantly. Electrophoretic patterns diversify, global activities diminish and cell damage biomarkers increase. These data suggest symbiotic cells adapt to stress while non-symbiotic cells remain acutely sensitive. In addition to being toxic, high O(2) partial pressure (P(O(2))) may also constitute a preconditioning step for symbiotic animal cells, leading to an adaptation to the hyperoxic condition and, thus, to oxidative stress. Furthermore, in aposymbiotic animal cells of A. viridis, repression of some animal SOD isoforms is observed. Meanwhile, in cultured symbionts, new activity bands are induced, suggesting that the host might protect its zooxanthellae in hospite. Similar results have been observed in other symbiotic organisms, such as the sea anemone Aiptasia pulchella and the scleractinian coral Stylophora pistillata. Molecular or physical interactions between the two symbiotic partners may explain such variations in SOD activity and might confer oxidative stress tolerance to the animal host.
Castañeda, Olga; Harvey, Alan L
2009-12-15
Peptides have been isolated from several species of sea anemones and shown to block currents through various potassium ion channels, particularly in excitable cells. The toxins can be grouped into four structural classes: type 1 with 35-37 amino acid residues and three disulphide bridges; type 2 with 58-59 residues and three disulphide bridges; type 3 with 41-42 residues and three disulphide bridges; and type 4 with 28 residues and two disulphide bridges. Examples from the first class are BgK from Bunodosoma granulifera, ShK from Stichodactyla helianthus and AsKS (or kaliseptine) from Anemonia sulcata (now A. viridis). These interfere with binding of radiolabelled dendrotoxin to synaptosomal membranes and block currents through channels with various Kv1 subunits and also intermediate conductance K(Ca) channels. Toxins in the second class are homologous to Kunitz-type inhibitors of serine proteases; these toxins include kalicludines (AsKC 1-3) from A. sulcata and SHTXIII from S. haddoni; they block Kv1.2 channels. The third structural group includes BDS-I, BDS-II (from A. sulcata) and APETx 1 (from Anthropleura elegantissima). Their pharmacological specificity differs: BDS-I and -II block currents involving Kv3 subunits, while APETx1 blocks ERG channels. The fourth group comprises the more recently discovered SHTX I and II from S. haddoni. Their channel blocking specificity is not yet known but they displace dendrotoxin binding from synaptosomal membranes. Sea anemones can be predicted to be a continued source of new toxins that will serve as molecular probes of various K(+) channels.
Expression patterns of sterol transporters NPC1 and NPC2 in the cnidarian-dinoflagellate symbiosis.
Dani, Vincent; Priouzeau, Fabrice; Mertz, Marjolijn; Mondin, Magali; Pagnotta, Sophie; Lacas-Gervais, Sandra; Davy, Simon K; Sabourault, Cécile
2017-10-01
The symbiotic interaction between cnidarians (e.g., corals and sea anemones) and photosynthetic dinoflagellates of the genus Symbiodinium is triggered by both host-symbiont recognition processes and metabolic exchange between the 2 partners. The molecular communication is crucial for homeostatic regulation of the symbiosis, both under normal conditions and during stresses that further lead to symbiosis collapse. It is therefore important to identify and fully characterise the key players of this intimate interaction at the symbiotic interface. In this study, we determined the cellular and subcellular localization and expression of the sterol-trafficking Niemann-Pick type C proteins (NPC1 and NPC2) in the symbiotic sea anemones Anemonia viridis and Aiptasia sp. We first established that NPC1 is localised within vesicles in host tissues and to the symbiosome membranes in several anthozoan species. We demonstrated that the canonical NPC2-a protein is mainly expressed in the epidermis, whereas the NPC2-d protein is closely associated with symbiosome membranes. Furthermore, we showed that the expression of the NPC2-d protein is correlated with symbiont presence in healthy symbiotic specimens. As npc2-d is a cnidarian-specific duplicated gene, we hypothesised that it probably arose from a subfunctionalisation process that might result in a gain of function and symbiosis adaptation in anthozoans. Niemann-Pick type C proteins may be key players in a functional symbiosis and be useful tools to study host-symbiont interactions in the anthozoan-dinoflagellate association. © 2017 John Wiley & Sons Ltd.
ACCELERATION OF SEA LEVEL RISE OVER MALAYSIAN SEAS FROM SATELLITE ALTIMETER
Directory of Open Access Journals (Sweden)
A. I. A. Hamid
2016-09-01
Full Text Available Sea level rise becomes our concern nowadays as a result of variously contribution of climate change that cause by the anthropogenic effects. Global sea levels have been rising through the past century and are projected to rise at an accelerated rate throughout the 21st century. Due to this change, sea level is now constantly rising and eventually will threaten many low-lying and unprotected coastal areas in many ways. This paper is proposing a significant effort to quantify the sea level trend over Malaysian seas based on the combination of multi-mission satellite altimeters over a period of 23 years. Eight altimeter missions are used to derive the absolute sea level from Radar Altimeter Database System (RADS. Data verification is then carried out to verify the satellite derived sea level rise data with tidal data. Eight selected tide gauge stations from Peninsular Malaysia, Sabah and Sarawak are chosen for this data verification. The pattern and correlation of both measurements of sea level anomalies (SLA are evaluated over the same period in each area in order to produce comparable results. Afterwards, the time series of the sea level trend is quantified using robust fit regression analysis. The findings clearly show that the absolute sea level trend is rising and varying over the Malaysian seas with the rate of sea level varies and gradually increase from east to west of Malaysia. Highly confident and correlation level of the 23 years measurement data with an astonishing root mean square difference permits the absolute sea level trend of the Malaysian seas has raised at the rate 3.14 ± 0.12 mm yr-1 to 4.81 ± 0.15 mm yr-1 for the chosen sub-areas, with an overall mean of 4.09 ± 0.12 mm yr-1. This study hopefully offers a beneficial sea level information to be applied in a wide range of related environmental and climatology issue such as flood and global warming.
Acceleration of Sea Level Rise Over Malaysian Seas from Satellite Altimeter
Hamid, A. I. A.; Din, A. H. M.; Khalid, N. F.; Omar, K. M.
2016-09-01
Sea level rise becomes our concern nowadays as a result of variously contribution of climate change that cause by the anthropogenic effects. Global sea levels have been rising through the past century and are projected to rise at an accelerated rate throughout the 21st century. Due to this change, sea level is now constantly rising and eventually will threaten many low-lying and unprotected coastal areas in many ways. This paper is proposing a significant effort to quantify the sea level trend over Malaysian seas based on the combination of multi-mission satellite altimeters over a period of 23 years. Eight altimeter missions are used to derive the absolute sea level from Radar Altimeter Database System (RADS). Data verification is then carried out to verify the satellite derived sea level rise data with tidal data. Eight selected tide gauge stations from Peninsular Malaysia, Sabah and Sarawak are chosen for this data verification. The pattern and correlation of both measurements of sea level anomalies (SLA) are evaluated over the same period in each area in order to produce comparable results. Afterwards, the time series of the sea level trend is quantified using robust fit regression analysis. The findings clearly show that the absolute sea level trend is rising and varying over the Malaysian seas with the rate of sea level varies and gradually increase from east to west of Malaysia. Highly confident and correlation level of the 23 years measurement data with an astonishing root mean square difference permits the absolute sea level trend of the Malaysian seas has raised at the rate 3.14 ± 0.12 mm yr-1 to 4.81 ± 0.15 mm yr-1 for the chosen sub-areas, with an overall mean of 4.09 ± 0.12 mm yr-1. This study hopefully offers a beneficial sea level information to be applied in a wide range of related environmental and climatology issue such as flood and global warming.
National Oceanic and Atmospheric Administration, Department of Commerce — Temperature, Salinity, Oxygen, Phosphate, pH and Alkalinity data collected in the North Atlantic Ocean, Baltic Sea, Barents Sea, Greenland Sea, North Sea, Norwegian...
Directory of Open Access Journals (Sweden)
Juan Pablo Martin
2015-06-01
Full Text Available The objective of this study is to provide information about a harbour-fouling community dominated by Metridium senile in southern Patagonia. Several steel tubes from the wharf of Puerto San Julián were extracted to perform repair tasks, allowing the attached benthic community to be studied. Sampling was conducted at three levels: lower intertidal, 3-4 m depth and 6-7 m depth. In the lower intertidal, M. senile had a relative abundance of 43%, the most abundant accompanying species being Perumytilus purpuratus, Mytilus edulis platensis and Aulacomya atra atra. At subtidal level, the anemone showed relative abundances of 64% and 65%, and was accompanied by Monocorophium insidiosum at 3-4 m depth and by polychaetes of families Sabellidae and Syllidae at 6-7 m at depth. In the lower intertidal, epibiosis was more frequent on P. purpuratus, A. atra atra and M. edulis platensis, while in the subtidal, the richness of substrate-organisms increased significantly and the anemone was fixed to A. atra atra, M. edulis platensis, Paramolgula gregaria, Crepipatella dilatata, Austromegabalanus psittacus, Hiatella arctica, Polyzoa opuntia, Pyura sp. and Sabellidae tubes. The ability of M. senile to settle on many different organisms, along with other strategies, makes it a colonizer able to displace other species that could compete with it for substratum. Given the cosmopolitan nature of M. senile, the fact that this species has not been previously reported in the coastal zone of the region, and the results of our study, we discuss the possibility that this sea anemone is an invasive alien species in southern Patagonia, or at least a cryptogenic species.
Dicty_cDB: Contig-U16556-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 379 ) Dictyostelium discoideum cDNA clone:dda53n08, 3' ... 42 0.041 2 ( FK757919 ) av01018a06r1.1 Symbioti... DW145191 ) CLVX10263.b1_M22.ab1 CLV(XYZ) lettuce virosa Lact... 48 0.050 2 ( FK759690 ) av02060a20r1.1 Symbiotic...1597 ) CAXA9355.rev CAXA Helobdella robusta Subtracted L... 44 0.053 3 ( FK724153 ) av02100l05r1.1 Symbiot...ic sea anemone (Anemonia vi... 48 0.054 3 ( CL080652 ) CH216-159D22_RM4.1 CH216 Xen
First biological measurements of deep-sea corals from the Red Sea.
Roder, C; Berumen, M L; Bouwmeester, J; Papathanassiou, E; Al-Suwailem, A; Voolstra, C R
2013-10-03
It is usually assumed that metabolic constraints restrict deep-sea corals to cold-water habitats, with 'deep-sea' and 'cold-water' corals often used as synonymous. Here we report on the first measurements of biological characters of deep-sea corals from the central Red Sea, where they occur at temperatures exceeding 20°C in highly oligotrophic and oxygen-limited waters. Low respiration rates, low calcification rates, and minimized tissue cover indicate that a reduced metabolism is one of the key adaptations to prevailing environmental conditions. We investigated four sites and encountered six species of which at least two appear to be undescribed. One species is previously reported from the Red Sea but occurs in deep cold waters outside the Red Sea raising interesting questions about presumed environmental constraints for other deep-sea corals. Our findings suggest that the present understanding of deep-sea coral persistence and resilience needs to be revisited.
First biological measurements of deep-sea corals from the Red Sea.
Roder, Cornelia
2013-10-03
It is usually assumed that metabolic constraints restrict deep-sea corals to cold-water habitats, with \\'deep-sea\\' and \\'cold-water\\' corals often used as synonymous. Here we report on the first measurements of biological characters of deep-sea corals from the central Red Sea, where they occur at temperatures exceeding 20°C in highly oligotrophic and oxygen-limited waters. Low respiration rates, low calcification rates, and minimized tissue cover indicate that a reduced metabolism is one of the key adaptations to prevailing environmental conditions. We investigated four sites and encountered six species of which at least two appear to be undescribed. One species is previously reported from the Red Sea but occurs in deep cold waters outside the Red Sea raising interesting questions about presumed environmental constraints for other deep-sea corals. Our findings suggest that the present understanding of deep-sea coral persistence and resilience needs to be revisited.
Benthic assemblages of mega epifauna on the Oregon continental margin
Hemery, Lenaïg G.; Henkel, Sarah K.; Cochrane, Guy R.
2018-01-01
Environmental assessment studies are usually required by a country's administration before issuing permits for any industrial activities. One of the goals of such environmental assessment studies is to highlight species assemblages and habitat composition that could make the targeted area unique. A section of the Oregon continental slope that had not been previously explored was targeted for the deployment of floating wind turbines. We carried out an underwater video survey, using a towed camera sled, to describe its benthic assemblages. Organisms were identified to the lowest taxonomic level possible and assemblages described related to the nature of the seafloor and the depth. We highlighted six invertebrate assemblages and three fish assemblages. For the invertebrates within flat soft sediments areas we defined three different assemblages based on primarily depth: a broad mid-depth (98–315 m) assemblage dominated by red octopus, sea pens and pink shrimps; a narrower mid-depth (250–270 m) assemblage dominated by box crabs and various other invertebrates; and a deeper (310–600 m) assemblage dominated by sea urchins, sea anemones, various snails and zoroasterid sea stars. The invertebrates on mixed sediments also were divided into three different assemblages: a shallow (~100 m deep) assemblage dominated by plumose sea anemones, broad mid-depth (170–370 m) assemblage dominated by sea cucumbers and various other invertebrates; and, again, a narrower mid-depth (230–270 m) assemblage, dominated by crinoids and encrusting invertebrates. For the fish, we identified a rockfish assemblage on coarse mixed sediments at 170–370 m and another fish assemblage on smaller mixed sediments within that depth range (250–370 m) dominated by thornyheads, poachers and flatfishes; and we identified a wide depth-range (98–600 m) fish assemblage on flat soft sediments dominated by flatfishes, eelpouts and thornyheads. Three of these assemblages (the two
Benthic assemblages of mega epifauna on the Oregon continental margin
Hemery, Lenaïg G.; Henkel, Sarah K.; Cochrane, Guy R.
2018-05-01
Environmental assessment studies are usually required by a country's administration before issuing permits for any industrial activities. One of the goals of such environmental assessment studies is to highlight species assemblages and habitat composition that could make the targeted area unique. A section of the Oregon continental slope that had not been previously explored was targeted for the deployment of floating wind turbines. We carried out an underwater video survey, using a towed camera sled, to describe its benthic assemblages. Organisms were identified to the lowest taxonomic level possible and assemblages described related to the nature of the seafloor and the depth. We highlighted six invertebrate assemblages and three fish assemblages. For the invertebrates within flat soft sediments areas we defined three different assemblages based on primarily depth: a broad mid-depth (98-315 m) assemblage dominated by red octopus, sea pens and pink shrimps; a narrower mid-depth (250-270 m) assemblage dominated by box crabs and various other invertebrates; and a deeper (310-600 m) assemblage dominated by sea urchins, sea anemones, various snails and zoroasterid sea stars. The invertebrates on mixed sediments also were divided into three different assemblages: a shallow ( 100 m deep) assemblage dominated by plumose sea anemones, broad mid-depth (170-370 m) assemblage dominated by sea cucumbers and various other invertebrates; and, again, a narrower mid-depth (230-270 m) assemblage, dominated by crinoids and encrusting invertebrates. For the fish, we identified a rockfish assemblage on coarse mixed sediments at 170-370 m and another fish assemblage on smaller mixed sediments within that depth range (250-370 m) dominated by thornyheads, poachers and flatfishes; and we identified a wide depth-range (98-600 m) fish assemblage on flat soft sediments dominated by flatfishes, eelpouts and thornyheads. Three of these assemblages (the two broad fish assemblages and the deep
Phosphorus dynamics in the Black Sea and Baltic Sea
Dijkstra, N.|info:eu-repo/dai/nl/372617034
2017-01-01
The dynamics of the key nutrient phosphorus (P) in hypoxic and anoxic marine basins are still incompletely understood. This thesis focuses on the cycling of P in two of such basins: the Baltic Sea and the Black Sea. Water column particulates and sediments from the deep basin of the Black Sea were
Characterization of glutathione peroxidase diversity in the symbiotic sea anemone Anemonia viridis
Pey , Alexis; Zamoum , Thamilla; Christen , Richard; Merle , Pierre-Laurent; Furla , Paola
2016-01-01
International audience; Cnidarians living in symbiosis with photosynthetic dinoflagellates (commonly named zooxanthellae) are exposed to high concentrations of reactive oxygen species (ROS) upon illumination. To quench ROS production, both the cnidarian host and zooxanthellae express a full suite of antioxidant enzymes. Studying antioxidative balance is therefore crucial to understanding how symbiotic cnidarians cope with ROS production. We characterized glutathione peroxidases (GPx) in the s...
Characterization of glutathione peroxidase diversity in the symbiotic sea anemone Anemonia viridis.
Pey, Alexis; Zamoum, Thamilla; Christen, Richard; Merle, Pierre-Laurent; Furla, Paola
2017-01-01
Cnidarians living in symbiosis with photosynthetic dinoflagellates (commonly named zooxanthellae) are exposed to high concentrations of reactive oxygen species (ROS) upon illumination. To quench ROS production, both the cnidarian host and zooxanthellae express a full suite of antioxidant enzymes. Studying antioxidative balance is therefore crucial to understanding how symbiotic cnidarians cope with ROS production. We characterized glutathione peroxidases (GPx) in the symbiotic cnidarian Anemonia viridis by analysis of their isoform diversity, their activity distribution in the three cellular compartments (ectoderm, endoderm and zooxanthellae) and their involvement in the response to thermal stress. We identified a GPx repertoire through a phylogenetic analysis showing 7 GPx transcripts belonging to the A. viridis host and 4 GPx transcripts strongly related to Symbiodinium sp. The biochemical approach, used for the first time with a cnidarian species, allowed the identification of GPx activity in the three cellular compartments and in the animal mitochondrial fraction, and revealed a high GPx electrophoretic diversity. The symbiotic lifestyle of zooxanthellae requires more GPx activity and diversity than that of free-living species. Heat stress induced no modification of GPx activities. We highlight a high GPx diversity in A. viridis tissues by genomic and biochemical approaches. GPx activities represent an overall constitutive enzymatic pattern inherent to symbiotic lifestyle adaptation. This work allows the characterization of the GPx family in a symbiotic cnidarian and establishes a foundation for future studies of GPx in symbiotic cnidarians. Copyright © 2016 Elsevier B.V. and Société Française de Biochimie et Biologie Moléculaire (SFBBM). All rights reserved.
Monitoring sea level and sea surface temperature trends from ERS satellites
DEFF Research Database (Denmark)
Andersen, Ole Baltazar; Knudsen, Per; Beckley, B.
2002-01-01
Data from the two ESA satellites ERS-1 and ERS-2 are used in global and regional analysis of sea level and sea surface temperature trends over the last, 7.8 years. T he ERS satellites and in the future the ENVISAT satellite provide unique opportunity for monitoring both changes in sea level and sea...
Directory of Open Access Journals (Sweden)
P. Itkin
2017-10-01
Full Text Available Ice retreat in the eastern Eurasian Arctic is a consequence of atmospheric and oceanic processes and regional feedback mechanisms acting on the ice cover, both in winter and summer. A correct representation of these processes in numerical models is important, since it will improve predictions of sea ice anomalies along the Northeast Passage and beyond. In this study, we highlight the importance of winter ice dynamics for local summer sea ice anomalies in thickness, volume and extent. By means of airborne sea ice thickness surveys made over pack ice areas in the south-eastern Laptev Sea, we show that years of offshore-directed sea ice transport have a thinning effect on the late-winter sea ice cover. To confirm the preconditioning effect of enhanced offshore advection in late winter on the summer sea ice cover, we perform a sensitivity study using a numerical model. Results verify that the preconditioning effect plays a bigger role for the regional ice extent. Furthermore, they indicate an increase in volume export from the Laptev Sea as a consequence of enhanced offshore advection, which has far-reaching consequences for the entire Arctic sea ice mass balance. Moreover we show that ice dynamics in winter not only preconditions local summer ice extent, but also accelerate fast-ice decay.
Li, Linghan; McClean, Julie L.; Miller, Arthur J.; Eisenman, Ian; Hendershott, Myrl C.; Papadopoulos, Caroline A.
2014-12-01
The seasonal cycle of sea ice variability in the Bering Sea, together with the thermodynamic and dynamic processes that control it, are examined in a fine resolution (1/10°) global coupled ocean/sea-ice model configured in the Community Earth System Model (CESM) framework. The ocean/sea-ice model consists of the Los Alamos National Laboratory Parallel Ocean Program (POP) and the Los Alamos Sea Ice Model (CICE). The model was forced with time-varying reanalysis atmospheric forcing for the time period 1970-1989. This study focuses on the time period 1980-1989. The simulated seasonal-mean fields of sea ice concentration strongly resemble satellite-derived observations, as quantified by root-mean-square errors and pattern correlation coefficients. The sea ice energy budget reveals that the seasonal thermodynamic ice volume changes are dominated by the surface energy flux between the atmosphere and the ice in the northern region and by heat flux from the ocean to the ice along the southern ice edge, especially on the western side. The sea ice force balance analysis shows that sea ice motion is largely associated with wind stress. The force due to divergence of the internal ice stress tensor is large near the land boundaries in the north, and it is small in the central and southern ice-covered region. During winter, which dominates the annual mean, it is found that the simulated sea ice was mainly formed in the northern Bering Sea, with the maximum ice growth rate occurring along the coast due to cold air from northerly winds and ice motion away from the coast. South of St Lawrence Island, winds drive the model sea ice southwestward from the north to the southwestern part of the ice-covered region. Along the ice edge in the western Bering Sea, model sea ice is melted by warm ocean water, which is carried by the simulated Bering Slope Current flowing to the northwest, resulting in the S-shaped asymmetric ice edge. In spring and fall, similar thermodynamic and dynamic
Sea Surface Height Variability and Eddy Statistical Properties in the Red Sea
Zhan, Peng
2013-01-01
Satellite sea surface height (SSH) data over 1992-2012 are analyzed to study the spatial and temporal variability of sea level in the Red Sea. Empirical orthogonal functions (EOF) analysis suggests the remarkable seasonality of SSH in the Red Sea
Highly variable Pliocene sea surface conditions in the Norwegian Sea
Directory of Open Access Journals (Sweden)
P. E. Bachem
2017-09-01
Full Text Available The Pliocene was a time of global warmth with small sporadic glaciations, which transitioned towards the larger-scale Pleistocene glacial–interglacial variability. Here, we present high-resolution records of sea surface temperature (SST and ice-rafted debris (IRD in the Norwegian Sea from 5.32 to 3.14 Ma, providing evidence that the Pliocene surface conditions of the Norwegian Sea underwent a series of transitions in response to orbital forcing and gateway changes. Average SSTs are 2 °C above the regional Holocene mean, with notable variability on millennial to orbital timescales. Both gradual changes and threshold effects are proposed for the progression of regional climate towards the Late Pliocene intensification of Northern Hemisphere glaciation. Cooling from 4.5 to 4.3 Ma may be linked to the onset of poleward flow through the Bering Strait. This cooling was further intensified by a period of cool summers due to weak obliquity forcing. A 7 °C warming of the Norwegian Sea at 4.0 Ma suggests a major increase in northward heat transport from the North Atlantic, leading to an enhanced zonal SST gradient in the Nordic Seas, which may be linked to the expansion of sea ice in the Arctic and Nordic Seas. A warm Norwegian Sea and enhanced zonal temperature gradient between 4.0 and 3.6 Ma may have been a priming factor for increased glaciation around the Nordic Seas due to enhanced evaporation and precipitation at high northern latitudes.
Cazenave, A. A.
2017-12-01
During recent decades, the Arctic region has warmed at a rate about twice the rest of the globe. Sea ice melting is increasing and the Greenland ice sheet is losing mass at an accelerated rate. Arctic warming, decrease in the sea ice cover and fresh water input to the Arctic ocean may eventually impact the Arctic sea level. In this presentation, we review our current knowledge of contemporary Arctic sea level changes. Until the beginning of the 1990s, Arctic sea level variations were essentially deduced from tide gauges located along the Russian and Norwegian coastlines. Since then, high inclination satellite altimetry missions have allowed measuring sea level over a large portion of the Arctic Ocean (up to 80 degree north). Measuring sea level in the Arctic by satellite altimetry is challenging because the presence of sea ice cover limits the full capacity of this technique. However adapted processing of raw altimetric measurements significantly increases the number of valid data, hence the data coverage, from which regional sea level variations can be extracted. Over the altimetry era, positive trend patterns are observed over the Beaufort Gyre and along the east coast of Greenland, while negative trends are reported along the Siberian shelf. On average over the Arctic region covered by satellite altimetry, the rate of sea level rise since 1992 is slightly less than the global mea sea level rate (of about 3 mm per year). On the other hand, the interannual variability is quite significant. Space gravimetry data from the GRACE mission and ocean reanalyses provide information on the mass and steric contributions to sea level, hence on the sea level budget. Budget studies show that regional sea level trends over the Beaufort Gyre and along the eastern coast of Greenland, are essentially due to salinity changes. However, in terms of regional average, the net steric component contributes little to the observed sea level trend. The sea level budget in the Arctic
Sea Surface Temperature and Ocean Color Variability in the South China Sea
Conaty, A. P.
2001-12-01
The South China Sea is a marginal sea in the Southeast Asian region whose surface circulation is driven by monsoons and whose surface currents have complex seasonal patterns. Its rich natural resources and strategic location have made its small islands areas of political dispute among the neighboring nations. This study aims to show the seasonal and interannual variability of sea surface temperature and ocean color in South China Sea. It makes use of NOAA's Advanced Very High Resolution Radiometer (AVHRR) satellite data sets on sea surface temperature for the period 1981-2000 and NASA's Nimbus-7 Coastal Zone Color Scanner (CZCS) and Sea-viewing Wide Field-of-view Sensor (SeaWiFS) satellite data sets on pigment concentration (ocean color) for the period 1981-1996 and 1997-2000, respectively. Transect lines were drawn along several potential hotspot areas to show the variability in sea surface temperature and pigment concentration through time. In-situ data on sea surface temperature along South China Sea were likewise plotted to see the variability with time. Higher seasonal variability in sea surface temperature was seen at higher latitudes. Interannual variability was within 1-3 Kelvin. In most areas, pigment concentration was higher during northern hemisphere winter and autumn, after the monsoon rains, with a maximum of 30 milligrams per cubic meter.
Vulnerability of marginal seas to sea level rise
Gomis, Damia; Jordà, Gabriel
2017-04-01
Sea level rise (SLR) is a serious thread for coastal areas and has a potential negative impact on society and economy. SLR can lead for instance to land loss, beach reduction, increase of the damage of marine storms on coastal infrastructures and to the salinization of underground water streams. It is well acknowledged that future SLR will be inhomogeneous across the globe, with regional differences of up to 100% with respect to global mean sea level (GMSL). Several studies have addressed the projections of SLR at regional scale, but most of them are based on global climate models (GCMs) that have a relatively coarse spatial resolution (>1°). In marginal seas this has proven to be a strong limitation, as their particular configurations require spatial resolutions that are not reachable by present GCMs. A paradigmatic case is the Mediterranean Sea, connected to the global ocean through the Strait of Gibraltar, a narrow passage of 14 km width. The functioning of the Mediterranean Sea involves a variety of processes including an overturning circulation, small-scale convection and a rich mesoscale field. Moreover, the long-term evolution of Mediterranean sea level has been significantly different from the global mean during the last decades. The observations of present climate and the projections for the next decades have lead some authors to hypothesize that the particular characteristics of the basin could allow Mediterranean mean sea level to evolve differently from the global mean. Assessing this point is essential to undertake proper adaptation strategies for the largely populated Mediterranean coastal areas. In this work we apply a new approach that combines regional and global projections to analyse future SLR. In a first step we focus on the quantification of the expected departures of future Mediterranean sea level from GMSL evolution and on the contribution of different processes to these departures. As a result we find that, in spite of its particularities
Deep-sea Hexactinellida (Porifera) of the Weddell Sea
Janussen, Dorte; Tabachnick, Konstantin R.; Tendal, Ole S.
2004-07-01
New Hexactinellida from the deep Weddel Sea are described. This moderately diverse hexactinellid fauna includes 14 species belonging to 12 genera, of which five species and one subgenus are new to science: Periphragella antarctica n. sp., Holascus pseudostellatus n. sp., Caulophacus (Caulophacus) discohexactinus n. sp., C. ( Caulodiscus) brandti n. sp., C. ( Oxydiscus) weddelli n. sp., and C. ( Oxydiscus) n. subgen. So far, 20 hexactinellid species have been reported from the deep Weddell Sea, 15 are known from the northern part and 10 only from here, while 10 came from the southern area, and five of these only from there. However, this apparent high "endemism" of Antarctic hexactinellid sponges is most likely the result of severe undersampling of the deep-sea fauna. We find no reason to believe that a division between an oceanic and a more continental group of species exists. The current poor database indicates that a substantial part of the deep hexactinellid fauna of the Weddell Sea is shared with other deep-sea regions, but it does not indicate a special biogeographic relationship with any other ocean.
Sea Ice Drift Monitoring in the Bohai Sea Based on GF4 Satellite
Zhao, Y.; Wei, P.; Zhu, H.; Xing, B.
2018-04-01
The Bohai Sea is the inland sea with the highest latitude in China. In winter, the phenomenon of freezing occurs in the Bohai Sea due to frequent cold wave influx. According to historical records, there have been three serious ice packs in the Bohai Sea in the past 50 years which caused heavy losses to our economy. Therefore, it is of great significance to monitor the drift of sea ice and sea ice in the Bohai Sea. The GF4 image has the advantages of short imaging time and high spatial resolution. Based on the GF4 satellite images, the three methods of SIFT (Scale invariant feature - the transform and Scale invariant feature transform), MCC (maximum cross-correlation method) and sift combined with MCC are used to monitor sea ice drift and calculate the speed and direction of sea ice drift, the three calculation results are compared and analyzed by using expert interpretation and historical statistical data to carry out remote sensing monitoring of sea ice drift results. The experimental results show that the experimental results of the three methods are in accordance with expert interpretation and historical statistics. Therefore, the GF4 remote sensing satellite images have the ability to monitor sea ice drift and can be used for drift monitoring of sea ice in the Bohai Sea.
Climatology of sea breezes along the Red Sea coast of Saudi Arabia
Khan, Basit; Abualnaja, Yasser; Al-Subhi, Abdullah M.; Nellayaputhenpeedika, Mohammedali; Nellikkattu Thody, Manoj; Sturman, Andrew P.
2018-01-01
and Atmospheric Administration (NOAA) are used to investigate the climatology of sea breezes over the eastern side of the Red Sea region. Results show existence of separate sea breeze systems along different segments of the Red Sea coastline. Based on the physical
Seasonal variation of deep-sea bioluminescence in the Ionian Sea
International Nuclear Information System (INIS)
Craig, Jessica; Jamieson, Alan J.; Bagley, Philip M.; Priede, Imants G.
2011-01-01
The ICDeep (Image Intensified Charge Coupled Device for Deep sea research) profiler was used to measure the density of deep bioluminescent animals (BL) through the water column in the east, west and mid-Ionian Sea and in the Algerian Basin. A west to east decrease in BL density was found. Generalized additive modelling was used to investigate seasonal variation in the east and west Ionian Sea (NESTOR and NEMO neutrino telescope sites, respectively) from BL measurements in autumn 2008 and spring 2009. A significant seasonal effect was found in the west Ionian Sea (p<0.001), where a deep autumnal peak in BL density occurred between 500 and 2400 m. No significant seasonal variation in BL density was found in the east Ionian Sea (p=0.07). In both spring and autumn, significant differences in BL density were found through the water column between the east and west Ionian Sea (p<0.001).
Seasonal variation of deep-sea bioluminescence in the Ionian Sea
Energy Technology Data Exchange (ETDEWEB)
Craig, Jessica, E-mail: j.craig@abdn.ac.u [University of Aberdeen, Oceanlab, Main Street, Newburgh, Aberdeenshire, AB41 6AA (United Kingdom); Jamieson, Alan J.; Bagley, Philip M.; Priede, Imants G. [University of Aberdeen, Oceanlab, Main Street, Newburgh, Aberdeenshire, AB41 6AA (United Kingdom)
2011-01-21
The ICDeep (Image Intensified Charge Coupled Device for Deep sea research) profiler was used to measure the density of deep bioluminescent animals (BL) through the water column in the east, west and mid-Ionian Sea and in the Algerian Basin. A west to east decrease in BL density was found. Generalized additive modelling was used to investigate seasonal variation in the east and west Ionian Sea (NESTOR and NEMO neutrino telescope sites, respectively) from BL measurements in autumn 2008 and spring 2009. A significant seasonal effect was found in the west Ionian Sea (p<0.001), where a deep autumnal peak in BL density occurred between 500 and 2400 m. No significant seasonal variation in BL density was found in the east Ionian Sea (p=0.07). In both spring and autumn, significant differences in BL density were found through the water column between the east and west Ionian Sea (p<0.001).
Deep-sea geohazards in the South China Sea
Wu, Shiguo; Wang, Dawei; Völker, David
2018-02-01
Various geological processes and features that might inflict hazards identified in the South China Sea by using new technologies and methods. These features include submarine landslides, pockmark fields, shallow free gas, gas hydrates, mud diapirs and earthquake tsunami, which are widely distributed in the continental slope and reefal islands of the South China Sea. Although the study and assessment of geohazards in the South China Sea came into operation only recently, advances in various aspects are evolving at full speed to comply with National Marine Strategy and `the Belt and Road' Policy. The characteristics of geohazards in deep-water seafloor of the South China Sea are summarized based on new scientific advances. This progress is aimed to aid ongoing deep-water drilling activities and decrease geological risks in ocean development.
50 CFR 697.12 - At-sea sea sampler/observer coverage.
2010-10-01
... sampler/observer access to and use of the vessel's communications equipment and personnel upon request for...) Allow the sea sampler/observer to inspect and copy the vessel's log, communications log, and records... must: (1) Notify the sea sampler/observer of any sea turtles, marine mammals, or other specimens taken...
Deglacial sea level history of the East Siberian Sea and Chukchi Sea margins
Cronin, Thomas M.; O'Regan, Matt; Pearce, Christof; Gemery, Laura; Toomey, Michael; Semiletov, Igor; Jakobsson, Martin
2017-09-01
Deglacial (12.8-10.7 ka) sea level history on the East Siberian continental shelf and upper continental slope was reconstructed using new geophysical records and sediment cores taken during Leg 2 of the 2014 SWERUS-C3 expedition. The focus of this study is two cores from Herald Canyon, piston core SWERUS-L2-4-PC1 (4-PC1) and multicore SWERUS-L2-4-MC1 (4-MC1), and a gravity core from an East Siberian Sea transect, SWERUS-L2-20-GC1 (20-GC1). Cores 4-PC1 and 20-GC were taken at 120 and 115 m of modern water depth, respectively, only a few meters above the global last glacial maximum (LGM; ˜ 24 kiloannum or ka) minimum sea level of ˜ 125-130 meters below sea level (m b.s.l.). Using calibrated radiocarbon ages mainly on molluscs for chronology and the ecology of benthic foraminifera and ostracode species to estimate paleodepths, the data reveal a dominance of river-proximal species during the early part of the Younger Dryas event (YD, Greenland Stadial GS-1) followed by a rise in river-intermediate species in the late Younger Dryas or the early Holocene (Preboreal) period. A rapid relative sea level rise beginning at roughly 11.4 to 10.8 ka ( ˜ 400 cm of core depth) is indicated by a sharp faunal change and unconformity or condensed zone of sedimentation. Regional sea level at this time was about 108 m b.s.l. at the 4-PC1 site and 102 m b.s.l. at 20-GC1. Regional sea level near the end of the YD was up to 42-47 m lower than predicted by geophysical models corrected for glacio-isostatic adjustment. This discrepancy could be explained by delayed isostatic adjustment caused by a greater volume and/or geographical extent of glacial-age land ice and/or ice shelves in the western Arctic Ocean and adjacent Siberian land areas.
Energy Technology Data Exchange (ETDEWEB)
Dybern, B.I.; Soederstroem, J.; Thorell, L.
1984-01-01
Due to the special topographical and hydrological features the seas surrounding Sweden are very sensitive to both natural changes and changes caused by man. The sea area between the North Sea and the Baltic Sea has come into focus during the last few decades due to problems with pollution and its impact on the ecosystems and to overfishing of some commer- cially important species. In order to elucidate the present situation from the Swedish viewpoint, the National Board of Fisheries, the National Environment Protection Board and the County Council of the County Goeteborg and Bohyslaen arranged a Symposium on the Situation in the Sea Area between the North Sea and the Baltic Sea in Goeteborg, 14-16 March, 1983. This volume contains lectures given at that Symposium. In most cases there are English summaries and English translations of texts to figures and tables.
Sea-ice cover in the Nordic Seas and the sensitivity to Atlantic water temperatures
Jensen, Mari F.; Nisancioglu, Kerim H.; Spall, Michael A.
2017-04-01
Changes in the sea-ice cover of the Nordic Seas have been proposed to play a key role for the dramatic temperature excursions associated with the Dansgaard-Oeschger events during the last glacial. However, with its proximity to the warm Atlantic water, how a sea-ice cover can persist in the Nordic Seas is not well understood. In this study, we apply an eddy-resolving configuration of the Massachusetts Institute of Technology general circulation model with an idealized topography to study the presence of sea ice in a Nordic Seas-like domain. We assume an infinite amount of warm Atlantic water present in the south by restoring the southern area to constant temperatures. The sea-surface temperatures are restored toward cold, atmospheric temperatures, and as a result, sea ice is present in the interior of the domain. However, the sea-ice cover in the margins of the Nordic Seas, an area with a warm, cyclonic boundary current, is sensitive to the amount of heat entering the domain, i.e., the restoring temperature in the south. When the temperature of the warm, cyclonic boundary current is high, the margins are free of sea ice and heat is released to the atmosphere. We show that with a small reduction in the temperature of the incoming Atlantic water, the Nordic Seas-like domain is fully covered in sea ice. Warm water is still entering the Nordic Seas, however, this happens at depths below a cold, fresh surface layer produced by melted sea ice. Consequently, the heat release to the atmosphere is reduced along with the eddy heat fluxes. Results suggest a threshold value in the amount of heat entering the Nordic Seas before the sea-ice cover disappears in the margins. We study the sensitivity of this threshold to changes in atmospheric temperatures and vertical diffusivity.
Variability and Trends in Sea Ice Extent and Ice Production in the Ross Sea
Comiso, Josefino; Kwok, Ronald; Martin, Seelye; Gordon, Arnold L.
2011-01-01
Salt release during sea ice formation in the Ross Sea coastal regions is regarded as a primary forcing for the regional generation of Antarctic Bottom Water. Passive microwave data from November 1978 through 2008 are used to examine the detailed seasonal and interannual characteristics of the sea ice cover of the Ross Sea and the adjacent Bellingshausen and Amundsen seas. For this period the sea ice extent in the Ross Sea shows the greatest increase of all the Antarctic seas. Variability in the ice cover in these regions is linked to changes in the Southern Annular Mode and secondarily to the Antarctic Circumpolar Wave. Over the Ross Sea shelf, analysis of sea ice drift data from 1992 to 2008 yields a positive rate of increase in the net ice export of about 30,000 sq km/yr. For a characteristic ice thickness of 0.6 m, this yields a volume transport of about 20 cu km/yr, which is almost identical, within error bars, to our estimate of the trend in ice production. The increase in brine rejection in the Ross Shelf Polynya associated with the estimated increase with the ice production, however, is not consistent with the reported Ross Sea salinity decrease. The locally generated sea ice enhancement of Ross Sea salinity may be offset by an increase of relatively low salinity of the water advected into the region from the Amundsen Sea, a consequence of increased precipitation and regional glacial ice melt.
International Nuclear Information System (INIS)
Nakaoka, Shin-Ichiro; Aoki, Shuji; Nakazawa, Takakiyo; Yoshikawa-Inoue, Hisayuki
2006-01-01
In order to elucidate the seasonal and inter annual variations of oceanic CO 2 uptake in the Greenland Sea and the Barents Sea, the partial pressure of CO 2 in the surface ocean (pCO 2 sea ) was measured in all seasons between 1992 and 2001. We derived monthly varying relationships between pCO 2 sea and sea surface temperature (SST) and combined them with the SST data from the NCEP/NCAR reanalysis to determine pCO 2 sea and air-sea CO 2 flux in these seas. The pCO 2 sea values were normalized to the year 1995 by assuming that pCO 2 sea increased at the same growth rate (1.5 μatm/yr) of the pCO 2 in the air (pCO 2 air ) between 1992 and 2001. In 1995, the annual net air-sea CO 2 fluxes were evaluated to be 52 ± 20 gC/m 2 /yr in the Greenland Sea and 46 ± 18 gC/m 2 /yr in the Barents Sea. The CO 2 flux into the ocean reached its maximum in winter and minimum in summer. The wind speed and (delta)pCO 2 (=pCO 2 air -pCO 2 sea ) exerted a greater influence on the seasonal variation than the sea ice coverage. The annual CO 2 uptake examined in this study (70-80 deg N, 20 deg W-40 deg E) was estimated to be 0.050 ± 0.020 GtC/yr in 1995. The inter annual variation in the annual CO 2 uptake was found to be positively correlated with the North Atlantic Oscillation Index (NAOI) via wind strength but negatively correlated with (delta)pCO 2 and the sea ice coverage. The present results indicate that the variability in wind speed and sea ice coverage play a major role, while that in (delta)pCO 2 plays a minor role, in determining the interannual variation of CO 2 uptake in this area
First biological measurements of deep-sea corals from the Red Sea
C. Roder; M. L. Berumen; J. Bouwmeester; E. Papathanassiou; A. Al-Suwailem; C. R. Voolstra
2013-01-01
It is usually assumed that metabolic constraints restrict deep-sea corals to cold-water habitats, with ?deep-sea? and ?cold-water? corals often used as synonymous. Here we report on the first measurements of biological characters of deep-sea corals from the central Red Sea, where they occur at temperatures exceeding 20?C in highly oligotrophic and oxygen-limited waters. Low respiration rates, low calcification rates, and minimized tissue cover indicate that a reduced metabolism is one of the ...
Lukyanova, Olga N; Zhuravel, Elena V; Chulchekov, Denis N; Mazur, Andrey A
2017-08-01
The embryogenesis of the sea urchin sand dollar Scaphechinus mirabilis was used as bioindicators of seawater quality from the impact areas of the Sea of Japan/East Sea (Peter the Great Bay) and the Sea of Okhotsk (northwestern shelf of Sakhalin Island and western shelf of Kamchatka Peninsula). Fertilization membrane formation, first cleavage, blastula formation, gastrulation, and 2-armed and 4-armed pluteus formation have been analyzed and a number of abnormalities were calculated. Number of embryogenesis anomalies in sand dollar larvae exposed to sea water from different stations in Peter the Great Bay corresponds to pollution level at each area. The Sea of Okhotsk is the main fishing area for Russia. Anthropogenic impact on the marine ecosystem is caused by fishing and transport vessels mainly. But two shelf areas are considered as "hot spots" due to oil and gas drilling. Offshore oil exploitation on the northeastern Sakhalin Island has been started and at present time oil is being drill on oil-extracting platforms continuously. Significant reserves of hydrocarbons are prospected on western Kamchatka shelf, and exploitation drilling in this area was intensified in 2014. A higher number of abnormalities at gastrula and pluteus stages (19-36%) were detected for the stations around oil platforms near Sakhalin Island. On the western Kamchatka shelf number of abnormalities was 7-21%. Such anomalies as exogastrula, incomplete development of pairs of arms were not observed at all; only the delay of development was registered. Eggs, embryos, and larvae of sea urchins are the suitable bioindicators of early disturbances caused by marine pollution in impact ecosystems.
Sea ice algal biomass and physiology in the Amundsen Sea, Antarctica
Directory of Open Access Journals (Sweden)
Kevin R. Arrigo
2014-07-01
Full Text Available Abstract Sea ice covers approximately 5% of the ocean surface and is one of the most extensive ecosystems on the planet. The microbial communities that live in sea ice represent an important food source for numerous organisms at a time of year when phytoplankton in the water column are scarce. Here we describe the distributions and physiology of sea ice microalgae in the poorly studied Amundsen Sea sector of the Southern Ocean. Microalgal biomass was relatively high in sea ice in the Amundsen Sea, due primarily to well developed surface communities that would have been replenished with nutrients during seawater flooding of the surface as a result of heavy snow accumulation. Elevated biomass was also occasionally observed in slush, interior, and bottom ice microhabitats throughout the region. Sea ice microalgal photophysiology appeared to be controlled by the availability of both light and nutrients. Surface communities used an active xanthophyll cycle and effective pigment sunscreens to protect themselves from harmful ultraviolet and visible radiation. Acclimation to low light microhabitats in sea ice was facilitated by enhanced pigment content per cell, greater photosynthetic accessory pigments, and increased photosynthetic efficiency. Photoacclimation was especially effective in the bottom ice community, where ready access to nutrients would have allowed ice microalgae to synthesize a more efficient photosynthetic apparatus. Surprisingly, the pigment-detected prymnesiophyte Phaeocystis antarctica was an important component of surface communities (slush and surface ponds where its acclimation to high light may precondition it to seed phytoplankton blooms after the sea ice melts in spring.
Transdermal delivery of scopolamine by natural submicron injectors: in-vivo study in pig.
Directory of Open Access Journals (Sweden)
Esther Shaoul
Full Text Available Transdermal drug delivery has made a notable contribution to medical practice, but has yet to fully achieve its potential as an alternative to oral delivery and hypodermic injections. While transdermal delivery systems would appear to provide an attractive solution for local and systemic drug delivery, only a limited number of drugs can be delivered through the outer layer of the skin. The most difficult to deliver in this way are hydrophilic drugs. The aquatic phylum Cnidaria, which includes sea anemones, corals, jellyfish and hydra, is one of the most ancient multicellular phyla that possess stinging cells containing organelles (cnidocysts, comprising a sophisticated injection system. The apparatus is folded within collagenous microcapsules and upon activation injects a thin tubule that immediately penetrates the prey and delivers its contents. Here we show that this natural microscopic injection system can be adapted for systemic transdermal drug delivery once it is isolated from the cells and uploaded with the drug. Using a topically applied gel containing isolated natural sea anemone injectors and the muscarinic receptor antagonist scopolamine, we found that the formulated injectors could penetrate porcine skin and immediately deliver this hydrophilic drug. An in-vivo study in pigs demonstrated, for the first time, rapid systemic delivery of scopolamine, with T(max of 30 minutes and C(max 5 times higher than in controls treated topically with a scopolamine-containing gel without cnidocysts. The ability of the formulated natural injection system to penetrate a barrier as thick as the skin and systemically deliver an exogenous compound presents an intriguing and attractive alternative for hydrophilic transdermal drug delivery.
Walrus areas of use in the Chukchi Sea during sparse sea ice cover
Jay, Chadwick V.; Fischbach, Anthony S.; Kochnev, Anatoly A.
2012-01-01
The Pacific walrus Odobenus rosmarus divergens feeds on benthic invertebrates on the continental shelf of the Chukchi and Bering Seas and rests on sea ice between foraging trips. With climate warming, ice-free periods in the Chukchi Sea have increased and are projected to increase further in frequency and duration. We radio-tracked walruses to estimate areas of walrus foraging and occupancy in the Chukchi Sea from June to November of 2008 to 2011, years when sea ice was sparse over the continental shelf in comparison to historical records. The earlier and more extensive sea ice retreat in June to September, and delayed freeze-up of sea ice in October to November, created conditions for walruses to arrive earlier and stay later in the Chukchi Sea than in the past. The lack of sea ice over the continental shelf from September to October caused walruses to forage in nearshore areas instead of offshore areas as in the past. Walruses did not frequent the deep waters of the Arctic Basin when sea ice retreated off the shelf. Walruses foraged in most areas they occupied, and areas of concentrated foraging generally corresponded to regions of high benthic biomass, such as in the northeastern (Hanna Shoal) and southwestern Chukchi Sea. A notable exception was the occurrence of concentrated foraging in a nearshore area of northwestern Alaska that is apparently depauperate in walrus prey. With increasing sea ice loss, it is likely that walruses will increase their use of coastal haul-outs and nearshore foraging areas, with consequences to the population that are yet to be understood.
DEFF Research Database (Denmark)
Stoeglehner, G.; Brown, A.L.; Kørnøv, Lone
2009-01-01
, and the relationship of the SEA to the planning activity itself. This paper focuses on the influence that planners have in these implementation processes, postulating the hypothesis that these are key players in achieving effectiveness in SEA. Based upon implementation theory and empirical experience, the paper......As the field of strategic environmental assessment (SEA) has matured, the focus has moved from the development of legislation, guidelines and methodologies towards improving the effectiveness of SEA. Measuring and of course achieving effectiveness is both complex and challenging. This paper...
Deglacial sea level history of the East Siberian Sea and Chukchi Sea margins
Cronin, Thomas M.; O'Regan, Matt; Pearce, Christof; Gemery, Laura; Toomey, Michael; Semiletov, Igor
2017-01-01
Deglacial (12.8–10.7 ka) sea level history on the East Siberian continental shelf and upper continental slope was reconstructed using new geophysical records and sediment cores taken during Leg 2 of the 2014 SWERUS-C3 expedition. The focus of this study is two cores from Herald Canyon, piston core SWERUS-L2-4-PC1 (4-PC1) and multicore SWERUS-L2-4-MC1 (4-MC1), and a gravity core from an East Siberian Sea transect, SWERUS-L2-20-GC1 (20-GC1). Cores 4-PC1 and 20-GC were taken at 120 and 115 m of modern water depth, respectively, only a few meters above the global last glacial maximum (LGM; ∼ 24 kiloannum or ka) minimum sea level of ∼ 125–130 meters below sea level (m b.s.l.). Using calibrated radiocarbon ages mainly on molluscs for chronology and the ecology of benthic foraminifera and ostracode species to estimate paleodepths, the data reveal a dominance of river-proximal species during the early part of the Younger Dryas event (YD, Greenland Stadial GS-1) followed by a rise in river-intermediate species in the late Younger Dryas or the early Holocene (Preboreal) period. A rapid relative sea level rise beginning at roughly 11.4 to 10.8 ka ( ∼ 400 cm of core depth) is indicated by a sharp faunal change and unconformity or condensed zone of sedimentation. Regional sea level at this time was about 108 m b.s.l. at the 4-PC1 site and 102 m b.s.l. at 20-GC1. Regional sea level near the end of the YD was up to 42–47 m lower than predicted by geophysical models corrected for glacio-isostatic adjustment. This discrepancy could be explained by delayed isostatic adjustment caused by a greater volume and/or geographical extent of glacial-age land ice and/or ice shelves in the western Arctic Ocean and adjacent Siberian land areas.
Deglacial sea level history of the East Siberian Sea and Chukchi Sea margins
Directory of Open Access Journals (Sweden)
T. M. Cronin
2017-09-01
Full Text Available Deglacial (12.8–10.7 ka sea level history on the East Siberian continental shelf and upper continental slope was reconstructed using new geophysical records and sediment cores taken during Leg 2 of the 2014 SWERUS-C3 expedition. The focus of this study is two cores from Herald Canyon, piston core SWERUS-L2-4-PC1 (4-PC1 and multicore SWERUS-L2-4-MC1 (4-MC1, and a gravity core from an East Siberian Sea transect, SWERUS-L2-20-GC1 (20-GC1. Cores 4-PC1 and 20-GC were taken at 120 and 115 m of modern water depth, respectively, only a few meters above the global last glacial maximum (LGM; ∼ 24 kiloannum or ka minimum sea level of ∼ 125–130 meters below sea level (m b.s.l.. Using calibrated radiocarbon ages mainly on molluscs for chronology and the ecology of benthic foraminifera and ostracode species to estimate paleodepths, the data reveal a dominance of river-proximal species during the early part of the Younger Dryas event (YD, Greenland Stadial GS-1 followed by a rise in river-intermediate species in the late Younger Dryas or the early Holocene (Preboreal period. A rapid relative sea level rise beginning at roughly 11.4 to 10.8 ka ( ∼ 400 cm of core depth is indicated by a sharp faunal change and unconformity or condensed zone of sedimentation. Regional sea level at this time was about 108 m b.s.l. at the 4-PC1 site and 102 m b.s.l. at 20-GC1. Regional sea level near the end of the YD was up to 42–47 m lower than predicted by geophysical models corrected for glacio-isostatic adjustment. This discrepancy could be explained by delayed isostatic adjustment caused by a greater volume and/or geographical extent of glacial-age land ice and/or ice shelves in the western Arctic Ocean and adjacent Siberian land areas.
Directory of Open Access Journals (Sweden)
D. Neumann
2016-03-01
Full Text Available Coarse sea salt particles are emitted ubiquitously from the ocean surface by wave-breaking and bubble-bursting processes. These particles impact the atmospheric chemistry by affecting the condensation of gas-phase species and, thus, indirectly the nucleation of new fine particles, particularly in regions with significant air pollution. In this study, atmospheric particle concentrations are modeled for the North Sea and Baltic Sea regions in northwestern Europe using the Community Multiscale Air Quality (CMAQ modeling system and are compared to European Monitoring and Evaluation Programme (EMEP measurement data. The sea salt emission module is extended by a salinity-dependent scaling of the sea salt emissions because the salinity in large parts of the Baltic Sea is very low, which leads to considerably lower sea salt mass emissions compared to other oceanic regions. The resulting improvement in predicted sea salt concentrations is assessed. The contribution of surf zone emissions is considered separately. Additionally, the impacts of sea salt particles on atmospheric nitrate and ammonium concentrations and on nitrogen deposition are evaluated. The comparisons with observational data show that sea salt concentrations are commonly overestimated at coastal stations and partly underestimated farther inland. The introduced salinity scaling improves the predicted Baltic Sea sea salt concentrations considerably. The dates of measured peak concentrations are appropriately reproduced by the model. The impact of surf zone emissions is negligible in both seas. Nevertheless, they might be relevant because surf zone emissions were cut at an upper threshold in this study. Deactivating sea salt leads to minor increases in NH3 + NH4+ and HNO3 + NO3− and a decrease in NO3− concentrations. However, the overall effect on NH3 + NH4+ and HNO3 + NO3− concentrations is smaller than the deviation from the measurements. Nitrogen wet deposition is
Bertler, Nancy A. N.; Conway, Howard; Dahl-Jensen, Dorthe; Emanuelsson, Daniel B.; Winstrup, Mai; Vallelonga, Paul T.; Lee, James E.; Brook, Ed J.; Severinghaus, Jeffrey P.; Fudge, Taylor J.; Keller, Elizabeth D.; Baisden, W. Troy; Hindmarsh, Richard C. A.; Neff, Peter D.; Blunier, Thomas; Edwards, Ross; Mayewski, Paul A.; Kipfstuhl, Sepp; Buizert, Christo; Canessa, Silvia; Dadic, Ruzica; Kjær, Helle A.; Kurbatov, Andrei; Zhang, Dongqi; Waddington, Edwin D.; Baccolo, Giovanni; Beers, Thomas; Brightley, Hannah J.; Carter, Lionel; Clemens-Sewall, David; Ciobanu, Viorela G.; Delmonte, Barbara; Eling, Lukas; Ellis, Aja; Ganesh, Shruthi; Golledge, Nicholas R.; Haines, Skylar; Handley, Michael; Hawley, Robert L.; Hogan, Chad M.; Johnson, Katelyn M.; Korotkikh, Elena; Lowry, Daniel P.; Mandeno, Darcy; McKay, Robert M.; Menking, James A.; Naish, Timothy R.; Noerling, Caroline; Ollive, Agathe; Orsi, Anaïs; Proemse, Bernadette C.; Pyne, Alexander R.; Pyne, Rebecca L.; Renwick, James; Scherer, Reed P.; Semper, Stefanie; Simonsen, Marius; Sneed, Sharon B.; Steig, Eric J.; Tuohy, Andrea; Ulayottil Venugopal, Abhijith; Valero-Delgado, Fernando; Venkatesh, Janani; Wang, Feitang; Wang, Shimeng; Winski, Dominic A.; Winton, V. Holly L.; Whiteford, Arran; Xiao, Cunde; Yang, Jiao; Zhang, Xin
2018-02-01
High-resolution, well-dated climate archives provide an opportunity to investigate the dynamic interactions of climate patterns relevant for future projections. Here, we present data from a new, annually dated ice core record from the eastern Ross Sea, named the Roosevelt Island Climate Evolution (RICE) ice core. Comparison of this record with climate reanalysis data for the 1979-2012 interval shows that RICE reliably captures temperature and snow precipitation variability in the region. Trends over the past 2700 years in RICE are shown to be distinct from those in West Antarctica and the western Ross Sea captured by other ice cores. For most of this interval, the eastern Ross Sea was warming (or showing isotopic enrichment for other reasons), with increased snow accumulation and perhaps decreased sea ice concentration. However, West Antarctica cooled and the western Ross Sea showed no significant isotope temperature trend. This pattern here is referred to as the Ross Sea Dipole. Notably, during the Little Ice Age, West Antarctica and the western Ross Sea experienced colder than average temperatures, while the eastern Ross Sea underwent a period of warming or increased isotopic enrichment. From the 17th century onwards, this dipole relationship changed. All three regions show current warming, with snow accumulation declining in West Antarctica and the eastern Ross Sea but increasing in the western Ross Sea. We interpret this pattern as reflecting an increase in sea ice in the eastern Ross Sea with perhaps the establishment of a modern Roosevelt Island polynya as a local moisture source for RICE.
Authigenic gypsum in a deep sea core from Southeastern Arabian Sea
Digital Repository Service at National Institute of Oceanography (India)
Guptha, M.V.S.
Authigenic gypsum has been encountered in a deep sea core RC9-157 from the southeastern Arabian Sea at a depth of 4111 m which is a zone of lysocline. The formation of gypsum in the deep sea region is attributed to the prevailing sulphate rich...
Directory of Open Access Journals (Sweden)
Thomas David Hawkins
2016-04-01
Full Text Available Cnidarian-dinoflagellate symbioses are ecologically important and the subject of much investigation. However, our understanding of critical aspects of symbiosis physiology, such as the partitioning of total respiration between the host and symbiont, remains incomplete. Specifically, we know little about how the relationship between host and symbiont respiration varies between different holobionts (host-symbiont combinations. We applied molecular and biochemical techniques to investigate aerobic respiratory capacity in naturally symbiotic Exaiptasia pallida sea anemones, alongside animals infected with either homologous ITS2-type A4 Symbiodinium or a heterologous isolate of Symbiodinium minutum (ITS2-type B1. In naturally symbiotic anemones, host, symbiont, and total holobiont mitochondrial citrate synthase (CS enzyme activity, but not host mitochondrial copy number, were reliable predictors of holobiont respiration. There was a positive association between symbiont density and host CS specific activity (mg protein-1, and a negative correlation between host- and symbiont CS specific activities. Notably, partitioning of total CS activity between host and symbiont in this natural E. pallida population was significantly different to the host/symbiont biomass ratio. In re-infected anemones, we found significant between-holobiont differences in the CS specific activity of the algal symbionts. Furthermore, the relationship between the partitioning of total CS activity and the host/symbiont biomass ratio differed between holobionts. These data have broad implications for our understanding of cnidarian-algal symbiosis. Specifically, the long-held assumption of equivalency between symbiont/host biomass and respiration ratios can result in significant overestimation of symbiont respiration and potentially erroneous conclusions regarding the percentage of carbon translocated to the host. The interspecific variability in symbiont aerobic capacity provides
Revealing Holobiont Structure and Function of Three Red Sea Deep-Sea Corals
Yum, Lauren
2014-12-01
Deep-sea corals have long been regarded as cold-water coral; however a reevaluation of their habitat limitations has been suggested after the discovery of deep-sea coral in the Red Sea where temperatures exceed 20˚C. To gain further insight into the biology of deep-sea corals at these temperatures, the work in this PhD employed a holotranscriptomic approach, looking at coral animal host and bacterial symbiont gene expression in Dendrophyllia sp., Eguchipsammia fistula, and Rhizotrochus sp. sampled from the deep Red Sea. Bacterial community composition was analyzed via amplicon-based 16S surveys and cultured bacterial strains were subjected to bioprospecting in order to gauge the pharmaceutical potential of coralassociated microbes. Coral host transcriptome data suggest that coral can employ mitochondrial hypometabolism, anaerobic glycolysis, and surface cilia to enhance mass transport rates to manage the low oxygen and highly oligotrophic Red Sea waters. In the microbial community associated with these corals, ribokinases and retron-type reverse transcriptases are abundantly expressed. In its first application to deep-sea coral associated microbial communities, 16S-based next-generation sequencing found that a single operational taxonomic unit can comprise the majority of sequence reads and that a large number of low abundance populations are present, which cannot be visualized with first generation sequencing. Bioactivity testing of selected bacterial isolates was surveyed over 100 cytological parameters with high content screening, covering several major organelles and key proteins involved in a variety of signaling cascades. Some of these cytological profiles were similar to those of several reference pharmacologically active compounds, which suggest that the bacteria isolates produce compounds with similar mechanisms of action as the reference compounds. The sum of this work offers several mechanisms by which Red Sea deep-sea corals cope with environmental
Cziesielski, Maha J.
2018-04-18
Corals and their endosymbiotic dinoflagellates of the genus Symbiodinium have a fragile relationship that breaks down under heat stress, an event known as bleaching. However, many coral species have adapted to high temperature environments such as the Red Sea (RS). To investigate mechanisms underlying temperature adaptation in zooxanthellate cnidarians we compared transcriptome- and proteome-wide heat stress response (24 h at 32°C) of three strains of the model organism Aiptasia pallida from regions with differing temperature profiles; North Carolina (CC7), Hawaii (H2) and the RS. Correlations between transcript and protein levels were generally low but inter-strain comparisons highlighted a common core cnidarian response to heat stress, including protein folding and oxidative stress pathways. RS anemones showed the strongest increase in antioxidant gene expression and exhibited significantly lower reactive oxygen species (ROS) levels in hospite However, comparisons of antioxidant gene and protein expression between strains did not show strong differences, indicating similar antioxidant capacity across the strains. Subsequent analysis of ROS production in isolated symbionts confirmed that the observed differences of ROS levels in hospite were symbiont-driven. Our findings indicate that RS anemones do not show increased antioxidant capacity but may have adapted to higher temperatures through association with more thermally tolerant symbionts.
Cziesielski, Maha J.; Liew, Yi Jin; Cui, Guoxin; Schmidt-Roach, Sebastian; Campana, Sara; Marondedze, Claudius; Aranda, Manuel
2018-01-01
Corals and their endosymbiotic dinoflagellates of the genus Symbiodinium have a fragile relationship that breaks down under heat stress, an event known as bleaching. However, many coral species have adapted to high temperature environments such as the Red Sea (RS). To investigate mechanisms underlying temperature adaptation in zooxanthellate cnidarians we compared transcriptome- and proteome-wide heat stress response (24 h at 32°C) of three strains of the model organism Aiptasia pallida from regions with differing temperature profiles; North Carolina (CC7), Hawaii (H2) and the RS. Correlations between transcript and protein levels were generally low but inter-strain comparisons highlighted a common core cnidarian response to heat stress, including protein folding and oxidative stress pathways. RS anemones showed the strongest increase in antioxidant gene expression and exhibited significantly lower reactive oxygen species (ROS) levels in hospite However, comparisons of antioxidant gene and protein expression between strains did not show strong differences, indicating similar antioxidant capacity across the strains. Subsequent analysis of ROS production in isolated symbionts confirmed that the observed differences of ROS levels in hospite were symbiont-driven. Our findings indicate that RS anemones do not show increased antioxidant capacity but may have adapted to higher temperatures through association with more thermally tolerant symbionts.
Sea level hazards: Altimetric monitoring of tsunamis and sea level rise
Hamlington, Benjamin Dillon
Whether on the short timescale of an impending tsunami or the much longer timescale of climate change-driven sea level rise, the threat stemming from rising and inundating ocean waters is a great concern to coastal populations. Timely and accurate observations of potentially dangerous changes in sea level are vital in determining the precautionary steps that need to be taken in order to protect coastal communities. While instruments from the past have provided in situ measurements of sea level at specific locations across the globe, satellites can be used to provide improved spatial and temporal sampling of the ocean in addition to producing more accurate measurements. Since 1993, satellite altimetry has provided accurate measurements of sea surface height (SSH) with near-global coverage. Not only have these measurements led to the first definitive estimates of global mean sea level rise, satellite altimetry observations have also been used to detect tsunami waves in the open ocean where wave amplitudes are relatively small, a vital step in providing early warning to those potentially affected by the impending tsunami. The use of satellite altimetry to monitor two specific sea level hazards is examined in this thesis. The first section will focus on the detection of tsunamis in the open ocean for the purpose of providing early warning to coastal inhabitants. The second section will focus on estimating secular trends using satellite altimetry data with the hope of improving our understanding of future sea level change. Results presented here will show the utility of satellite altimetry for sea level monitoring and will lay the foundation for further advancement in the detection of the two sea level hazards considered.
Sea-level and deep-sea-temperature variability over the past 5.3 million years.
Rohling, E J; Foster, G L; Grant, K M; Marino, G; Roberts, A P; Tamisiea, M E; Williams, F
2014-04-24
Ice volume (and hence sea level) and deep-sea temperature are key measures of global climate change. Sea level has been documented using several independent methods over the past 0.5 million years (Myr). Older periods, however, lack such independent validation; all existing records are related to deep-sea oxygen isotope (δ(18)O) data that are influenced by processes unrelated to sea level. For deep-sea temperature, only one continuous high-resolution (Mg/Ca-based) record exists, with related sea-level estimates, spanning the past 1.5 Myr. Here we present a novel sea-level reconstruction, with associated estimates of deep-sea temperature, which independently validates the previous 0-1.5 Myr reconstruction and extends it back to 5.3 Myr ago. We find that deep-sea temperature and sea level generally decreased through time, but distinctly out of synchrony, which is remarkable given the importance of ice-albedo feedbacks on the radiative forcing of climate. In particular, we observe a large temporal offset during the onset of Plio-Pleistocene ice ages, between a marked cooling step at 2.73 Myr ago and the first major glaciation at 2.15 Myr ago. Last, we tentatively infer that ice sheets may have grown largest during glacials with more modest reductions in deep-sea temperature.
Dancing-drawing fields of presence in SeaUnSea
DEFF Research Database (Denmark)
Ramsgaard Thomsen, Mette
2008-01-01
Dance and architecture have much in common as both are concerned with practices of space. For a dancer, the act of choreography occurs through the unfolding of spaces by means of gesture and embodied movement, whereas for an architect, space is the medium through which form emerges and habitation...... is constructed. For both, the first space of experience is the space of the body. This essay is a writing out of the interstices of these two disciplines as they touch and inform each other in the process and production of SeaUnSea, an interactive dance installation which premiered at Siobhan Davies Studios...... as part of Dance Umbrella in London, October 2006. SeaUnSea is a collaboration between the authors, choreographer Carol Brown and architect Mette Ramsgard Thomsen, working with programmer Chiron Mottram....
DEFF Research Database (Denmark)
Gao, Jingjing; Kørnøv, Lone; Christensen, Per
Abstract: Indicators are widely used in SEA to measure, communicate and monitor impacts from a proposed policy, plan or programme, and can improve the effectiveness for the SEA by simplifying the complexity of both assessment and presentation. Indicators can be seen as part of the implementation...... and if the information requirement for different target groups is not addressed. Indicators are widely used in SEA to measure, communicate and monitor impacts from a proposed policy, plan or programme, and can improve the effectiveness for the SEA by simplifying the complexity of both assessment and presentation...... process helping to understand, communicate and, integrate important environmental issues in planning and decision-making. On the other hand, use of indicators can also limit SEA effectiveness, if the ones chosen are biased or limited, if the aggregation gives incorrect interpretation...
de Magalhães, Mariana T Q; Mambelli, Fábio S; Santos, Bruno P O; Morais, Suellen B; Oliveira, Sergio C
2018-03-31
Proteins containing a Kunitz domain have the typical serine protease inhibition function ranging from sea anemone to man. Protease inhibitors play major roles in infection, inflammation disorders and cancer. This review discusses the role of serine proteases containing a Kunitz domain in immunomodulation induced by helminth parasites. Helminth parasites are associated with protection from inflammatory conditions. Therefore, interest has raised whether worm parasites or their products hold potential as drugs for treatment of immunological disorders. Finally, we also propose the use of recombinant SmKI-1 from Schistosoma mansoni as a potential therapeutic molecule to treat inflammatory diseases. Copyright © 2018 Institut Pasteur. Published by Elsevier Masson SAS. All rights reserved.
Sea ice contribution to the air-sea CO(2) exchange in the Arctic and Southern Oceans
DEFF Research Database (Denmark)
Rysgaard...[], Søren; Bendtsen, Jørgen; Delille, B.
2011-01-01
Although salt rejection from sea ice is a key process in deep-water formation in ice-covered seas, the concurrent rejection of CO(2) and the subsequent effect on air-sea CO(2) exchange have received little attention. We review the mechanisms by which sea ice directly and indirectly controls the air......-sea CO(2) exchange and use recent measurements of inorganic carbon compounds in bulk sea ice to estimate that oceanic CO(2) uptake during the seasonal cycle of sea-ice growth and decay in ice-covered oceanic regions equals almost half of the net atmospheric CO(2) uptake in ice-free polar seas. This sea......-sea CO(2) exchange during winter, and (3) release of CO(2)-depleted melt water with excess total alkalinity during sea-ice decay and (4) biological CO(2) drawdown during primary production in sea ice and surface oceanic waters....
Zooplankton community structure in the Yellow Sea and East China Sea in autumn
Directory of Open Access Journals (Sweden)
Hongju Chen
2015-12-01
Full Text Available Abstract Study on zooplankton spatial distribution is essential for understanding food web dynamics in marine ecosystems and fishery management. Here we elucidated the composition and distribution of large mesozooplankton on the continental shelf of the Yellow Sea and East China Sea, and explored the zooplankton community structure in these water masses. Sixty vertical hauls (bottom or 200 m in deep water to surface using a ring net (diameter 0.8 m, 505-μm mesh were exploited in November 2007. The biogeographic patterns of zooplankton communities were investigated using multivariate analysis methods; copepod biodiversity was analyzed using univariate indices. Copepods and protozoans were dominate in the communities. Based on the species composition, we divided the study areas into six station groups. Significant differences in zooplankton assemblages were detected between the Yellow Sea and East China Sea. Species richness was higher in East China Sea groups than those in Yellow Sea, whereas taxonomic distinctness was higher in Yellow Sea than in East China Sea. There was a clear relationship between the species composition and water mass group.
Li, Xinzheng
2017-07-01
This paper reviews the taxonomic and biodiversity studies of deep-sea invertebrates in the South China Sea based on the samples collected by the Chinese manned deep-sea submersible Jiaolong. To date, 6 new species have been described, including the sponges Lophophysema eversa, Saccocalyx microhexactin and Semperella jiaolongae as well as the crustaceans Uroptychus jiaolongae, Uroptychus spinulosus and Globospongicola jiaolongi; some newly recorded species from the South China Sea have also been reported. The Bathymodiolus platifrons-Shinkaia crosnieri deep-sea cold seep community has been reported by Li (2015), as has the mitochondrial genome of the glass sponge L. eversa by Zhang et al. (2016). The population structures of two dominant species, the shrimp Shinkaia crosnieri and the mussel Bathymodiolus platifrons, from the cold seep Bathymodiolus platifrons-Shinkaia crosnieri community in the South China Sea and the hydrothermal vents in the Okinawa Trough, were compared using molecular analysis. The systematic position of the shrimp genus Globospongicola was discussed based on 16S rRNA gene sequences. © 2017 International Society of Zoological Sciences, Institute of Zoology/Chinese Academy of Sciences and John Wiley & Sons Australia, Ltd.
Douglas, David C.
2010-01-01
The Arctic region is warming faster than most regions of the world due in part to increasing greenhouse gases and positive feedbacks associated with the loss of snow and ice cover. One consequence has been a rapid decline in Arctic sea ice over the past 3 decades?a decline that is projected to continue by state-of-the-art models. Many stakeholders are therefore interested in how global warming may change the timing and extent of sea ice Arctic-wide, and for specific regions. To inform the public and decision makers of anticipated environmental changes, scientists are striving to better understand how sea ice influences ecosystem structure, local weather, and global climate. Here, projected changes in the Bering and Chukchi Seas are examined because sea ice influences the presence of, or accessibility to, a variety of local resources of commercial and cultural value. In this study, 21st century sea ice conditions in the Bering and Chukchi Seas are based on projections by 18 general circulation models (GCMs) prepared for the fourth reporting period by the Intergovernmental Panel on Climate Change (IPCC) in 2007. Sea ice projections are analyzed for each of two IPCC greenhouse gas forcing scenarios: the A1B `business as usual? scenario and the A2 scenario that is somewhat more aggressive in its CO2 emissions during the second half of the century. A large spread of uncertainty among projections by all 18 models was constrained by creating model subsets that excluded GCMs that poorly simulated the 1979-2008 satellite record of ice extent and seasonality. At the end of the 21st century (2090-2099), median sea ice projections among all combinations of model ensemble and forcing scenario were qualitatively similar. June is projected to experience the least amount of sea ice loss among all months. For the Chukchi Sea, projections show extensive ice melt during July and ice-free conditions during August, September, and October by the end of the century, with high agreement
Energy Technology Data Exchange (ETDEWEB)
Morton, Brian [Hong Kong Univ., Swire Inst. of Marine Science, Hong Kong (China); Hong Kong Univ., Dept. of Ecology and Biodiversity, Hong Kong (China); Blackmore, Graham [Hong Kong Univ. of Science and Technology, Dept. of Biology, Hong Kong (China)
2001-07-01
The South China Sea is poorly understood in terms of its marine biota, ecology and the human impacts upon it. What is known is most often contained in reports and workshops and conference documents that are not available to the wider scientific community. The South China Sea has an area of some 3.3 million km{sup 2} and depths range from the shallowest coastal fringe to 5377m in the Manila Trench. It is also studded with numerous islets, atolls and reefs many of which are just awash at low tide. It is largely confined within the Tropic of Cancer and, therefore, experiences a monsoonal climate being influenced by the Southwest Monsoon in summer and the Northeast Monsoon in winter. The South China Sea is a marginal sea and, therefore, largely surrounded by land. Countries that have a major influence on and claims to the sea include China, Malaysia, the Philippines and Vietnam, although Thailand, Indonesia and Taiwan have some too. The coastal fringes of the South China Sea are home to about 270 million people that have had some of the fastest developing and most vibrant economics on the globe. Consequently, anthropogenic impacts, such as over-exploitation of resources and pollution, are anticipated to be huge although, in reality, relatively little is known about them. The Indo-West Pacific biogeographic province, at the centre of which the South China Sea lies, is probably the world's most diverse shallow-water marine area. Of three major nearshore habitat types, i.e., coral reefs, mangroves and seagrasses, 45 mangrove species out of a global total of 51, most of the currently recognised 70 coral genera and 20 of 50 known seagrass species have been recorded from the South China Sea. The island groups of the South China Sea are all disputed and sovereignty is claimed over them by a number of countries. Conflicts have in recent decades arisen over them because of perceived national rights. It is perhaps because of this that so little research has been undertaken
Morton, Brian; Blackmore, Graham
2001-01-01
The South China Sea is poorly understood in terms of its marine biota, ecology and the human impacts upon it. What is known is most often contained in reports and workshop and conference documents that are not available to the wider scientific community. The South China Sea has an area of some 3.3 million km2 and depths range from the shallowest coastal fringe to 5377 m in the Manila Trench. It is also studded with numerous islets, atolls and reefs many of which are just awash at low tide. It is largely confined within the Tropic of Cancer and, therefore, experiences a monsoonal climate being influenced by the Southwest Monsoon in summer and the Northeast Monsoon in winter. The South China Sea is a marginal sea and, therefore, largely surrounded by land. Countries that have a major influence on and claims to the sea include China, Malaysia, the Philippines and Vietnam, although Thailand, Indonesia and Taiwan have some too. The coastal fringes of the South China Sea are home to about 270 million people that have had some of the fastest developing and most vibrant economies on the globe. Consequently, anthropogenic impacts, such as over-exploitation of resources and pollution, are anticipated to be huge although, in reality, relatively little is known about them. The Indo-West Pacific biogeographic province, at the centre of which the South China Sea lies, is probably the world's most diverse shallow-water marine area. Of the three major nearshore habitat types, i.e., coral reefs, mangroves and seagrasses, 45 mangrove species out of a global of 51, most of the currently recognised 70 coral genera and 20 of 50 known seagrass species have been recorded from the South China Sea. The island groups of the South China Sea are all disputed and sovereignty is claimed over them by a number of countries. Conflicts have in recent decades arisen over them because of perceived national rights. It is perhaps because of this that so little research has been undertaken on the South
International Nuclear Information System (INIS)
1999-04-01
This report provides comprehensive information on environmental conditions in the Arctic Seas as required for the study of possible radiological consequences from dumped high level radioactive wastes in the Kara Sea. The report describes the oceanography of the regions, with emphasis on the Kara and Barents Seas, including the East Novaya Zemlya Fjords. The ecological description concentrates on biological production, marine food-weds and fisheries in the Arctic Seas. The report presents data on radionuclide concentrations in the Kara and Barents Seas and uses these data to estimate the inventories of radionuclides currently in the marine environment of the Kara and Barents Seas
Late Holocene sea ice conditions in Herald Canyon, Chukchi Sea
Pearce, C.; O'Regan, M.; Rattray, J. E.; Hutchinson, D. K.; Cronin, T. M.; Gemery, L.; Barrientos, N.; Coxall, H.; Smittenberg, R.; Semiletov, I. P.; Jakobsson, M.
2017-12-01
Sea ice in the Arctic Ocean has been in steady decline in recent decades and, based on satellite data, the retreat is most pronounced in the Chukchi and Beaufort seas. Historical observations suggest that the recent changes were unprecedented during the last 150 years, but for a longer time perspective, we rely on the geological record. For this study, we analyzed sediment samples from two piston cores from Herald Canyon in the Chukchi Sea, collected during the 2014 SWERUS-C3 Arctic Ocean Expedition. The Herald Canyon is a local depression across the Chukchi Shelf, and acts as one of the main pathways for Pacific Water to the Arctic Ocean after entering through the narrow and shallow Bering Strait. The study site lies at the modern-day seasonal sea ice minimum edge, and is thus an ideal location for the reconstruction of past sea ice variability. Both sediment cores contain late Holocene deposits characterized by high sediment accumulation rates (100-300 cm/kyr). Core 2-PC1 from the shallow canyon flank (57 m water depth) is 8 meter long and extends back to 4200 cal yrs BP, while the upper 3 meters of Core 4-PC1 from the central canyon (120 mwd) cover the last 3000 years. The chronologies of the cores are based on radiocarbon dates and the 3.6 ka Aniakchak CFE II tephra, which is used as an absolute age marker to calculate the marine radiocarbon reservoir age. Analysis of biomarkers for sea ice and surface water productivity indicate stable sea ice conditions throughout the entire late Holocene, ending with an abrupt increase of phytoplankton sterols in the very top of both sediment sequences. The shift is accompanied by a sudden increase in coarse sediments (> 125 µm) and a minor change in δ13Corg. We interpret this transition in the top sediments as a community turnover in primary producers from sea ice to open water biota. Most importantly, our results indicate that the ongoing rapid ice retreat in the Chukchi Sea of recent decades was unprecedented during the
Coastal seas as resource for Blue Growth - SmartSea project
Kotilainen, Aarno; Alvi, Kimmo; Boman, Anton; Hämäläinen, Jyrki; Kaskela, Anu; Rantataro, Jyrki; Vallius, Henry; Virtasalo, Joonas
2017-04-01
Blue growth is a long term strategy of the European Union (EU) to enhance the sustainable growth of the maritime sector. Our surrounding seas have been drivers for the European economy for a long time, but still they have great potential for further exploiting of natural resources and economic growth. Especially if the growth can be achieved in an environmentally sustainable way, benefits are obvious. It has been estimated that improvement of the state of the Baltic Sea would until 2030 create 900 000 jobs in the whole Baltic Sea area, mainly in Blue Tech, tourism, real estate and building businesses (Dahlgren et al. 2015). However, coastal seas already experience multiple stressors like off-shore construction, pollution, eutrophication, shipping, over-fishing, and climate change. In order to obtain sustainable Blue Growth, it is necessary to localize and assess the current maritime activities, estimate their growth potential, and investigate their present and future effects on each other and on the marine environment. The purpose of the SmartSea project is to support the growth of commercial marine activities in the Gulf of Bothnia region, in the northern Baltic Sea. The Gulf of Bothnia is an essential resource in terms of fish farming and wind power, for example, and it is also possible to make use of the geological resources of the gulf. Moreover, the rapid growth of the commercial marine activities and the consequences of the climate change may lead to conflicts between the different activities and harm the marine ecosystem of the Gulf of Bothnia. The SmartSea project aims to identify these risks and find solutions for the sustainable use of the sea. SmartSea project is funded by the Strategic Research Council of Academy of Finland, grant No: 292 985. The project will last for six years (2015-2020) and its funding totals nearly 8 million euros. The project involves close to 40 researchers from eight different institutions: the Finnish Meteorological Institute
Cayan, Daniel R.; Bromirski, Peter; Hayhoe, Katharine; Tyree, Mary; Dettinger, Mike; Flick, Reinhard
2006-01-01
California’s coastal observations and global model projections indicate that California’s open coast and estuaries will experience increasing sea levels over the next century. Sea level rise has affected much of the coast of California, including the Southern California coast, the Central California open coast, and the San Francisco Bay and upper estuary. These trends, quantified from a small set of California tide gages, have ranged from 10–20 centimeters (cm) (3.9–7.9 inches) per century, quite similar to that estimated for global mean sea level. So far, there is little evidence that the rate of rise has accelerated, and the rate of rise at California tide gages has actually flattened since 1980, but projections suggest substantial sea level rise may occur over the next century. Climate change simulations project a substantial rate of global sea level rise over the next century due to thermal expansion as the oceans warm and runoff from melting land-based snow and ice accelerates. Sea level rise projected from the models increases with the amount of warming. Relative to sea levels in 2000, by the 2070–2099 period, sea level rise projections range from 11–54 cm (4.3–21 in) for simulations following the lower (B1) greenhouse gas (GHG) emissions scenario, from 14–61 cm (5.5–24 in) for the middle-upper (A2) emission scenario, and from 17–72 cm (6.7–28 in) for the highest (A1fi) scenario. In addition to relatively steady secular trends, sea levels along the California coast undergo shorter period variability above or below predicted tide levels and changes associated with long-term trends. These variations are caused by weather events and by seasonal to decadal climate fluctuations over the Pacific Ocean that in turn affect the Pacific coast. Highest coastal sea levels have occurred when winter storms and Pacific climate disturbances, such as El Niño, have coincided with high astronomical tides. This study considers a range of projected future
Air–Sea Interaction and Horizontal Circulation in the Red Sea
Bower, Amy S.
2015-01-01
This chapter discusses the horizontal circulation of the Red Sea and the surface meteorology that drives it, and recent satellite and in situ measurements from the region are used to illustrate properties of the Red Sea circulation and the atmospheric forcing. The surface winds over the Red Sea have rich spatial structure, with variations in speed and direction on both synoptic and seasonal timescales. Wintertime mountain-gap wind jets drive large heat losses and evaporation at some locations, with as much as 9 cm of evaporation in a week. The near-surface currents in the Red Sea exhibit similarly rich variability, with an energetic and complex flow field dominated by persistent, quasi-stationary eddies, and convoluted boundary currents. At least one quasi-stationary eddy pair is driven largely by winds blowing through a gap in the mountains (Tokar Gap), but numerical simulations suggest that much of the eddy field is driven by the interaction of the buoyancy-driven flow with topography. Recent measurements suggest that Gulf of Aden Intermediate Water (GAIW) penetrates further northward into the Red Sea than previously reported.
Satellite altimetry in sea ice regions - detecting open water for estimating sea surface heights
Müller, Felix L.; Dettmering, Denise; Bosch, Wolfgang
2017-04-01
The Greenland Sea and the Farm Strait are transporting sea ice from the central Arctic ocean southwards. They are covered by a dynamic changing sea ice layer with significant influences on the Earth climate system. Between the sea ice there exist various sized open water areas known as leads, straight lined open water areas, and polynyas exhibiting a circular shape. Identifying these leads by satellite altimetry enables the extraction of sea surface height information. Analyzing the radar echoes, also called waveforms, provides information on the surface backscatter characteristics. For example waveforms reflected by calm water have a very narrow and single-peaked shape. Waveforms reflected by sea ice show more variability due to diffuse scattering. Here we analyze altimeter waveforms from different conventional pulse-limited satellite altimeters to separate open water and sea ice waveforms. An unsupervised classification approach employing partitional clustering algorithms such as K-medoids and memory-based classification methods such as K-nearest neighbor is used. The classification is based on six parameters derived from the waveform's shape, for example the maximum power or the peak's width. The open-water detection is quantitatively compared to SAR images processed while accounting for sea ice motion. The classification results are used to derive information about the temporal evolution of sea ice extent and sea surface heights. They allow to provide evidence on climate change relevant influences as for example Arctic sea level rise due to enhanced melting rates of Greenland's glaciers and an increasing fresh water influx into the Arctic ocean. Additionally, the sea ice cover extent analyzed over a long-time period provides an important indicator for a globally changing climate system.
Sea Turtle Conservation on Bonaire. Sea Turtle Club Bonaire 1997. Project Report
Schuit, M.; Put, van A.L.L.M.; Valkering, N.P.; Eijck, van T.J.W.
1998-01-01
The Sea Turtle Club Bonaire (STCB) is a non-governmental, non-profit organization. Its main goal is the conservation of the sea turtles that occur on Bonaire. To reach this goal, annual projects are undertaken, such as research and the promotion of public awareness on sea turtle conservation. The
Directory of Open Access Journals (Sweden)
N. A. N. Bertler
2018-02-01
Full Text Available High-resolution, well-dated climate archives provide an opportunity to investigate the dynamic interactions of climate patterns relevant for future projections. Here, we present data from a new, annually dated ice core record from the eastern Ross Sea, named the Roosevelt Island Climate Evolution (RICE ice core. Comparison of this record with climate reanalysis data for the 1979–2012 interval shows that RICE reliably captures temperature and snow precipitation variability in the region. Trends over the past 2700 years in RICE are shown to be distinct from those in West Antarctica and the western Ross Sea captured by other ice cores. For most of this interval, the eastern Ross Sea was warming (or showing isotopic enrichment for other reasons, with increased snow accumulation and perhaps decreased sea ice concentration. However, West Antarctica cooled and the western Ross Sea showed no significant isotope temperature trend. This pattern here is referred to as the Ross Sea Dipole. Notably, during the Little Ice Age, West Antarctica and the western Ross Sea experienced colder than average temperatures, while the eastern Ross Sea underwent a period of warming or increased isotopic enrichment. From the 17th century onwards, this dipole relationship changed. All three regions show current warming, with snow accumulation declining in West Antarctica and the eastern Ross Sea but increasing in the western Ross Sea. We interpret this pattern as reflecting an increase in sea ice in the eastern Ross Sea with perhaps the establishment of a modern Roosevelt Island polynya as a local moisture source for RICE.
Sea Reclamation Status of Countries around the South China Sea from 1975 to 2010
Directory of Open Access Journals (Sweden)
Junjue Zhang
2017-05-01
Full Text Available As a way of turning sea into land for living space for humans, the actions of sea reclamation bring about significant benefits. Nevertheless, it is also an under-recognized threat to the environment and the marine ecosystem. Based on images in two periods, sea reclamation information of countries around the South China Sea was extracted from 1975 to 2010. The spatial state and driven forces of sea reclamation are then discussed. Results show that the overall strength of sea reclamation in the South China Sea was great. New reclaimed land added up to 3264 km2. Sea reclamation for fish farming was the main reclamation type and widely distributed in the whole area, especially on the coast from the Pearl River Delta to the Red River Delta, and the coast of Ca Mau Peninsula. Sea reclamation in China and Vietnam was rather significant, which occupies 80.6% of the total reclamation area. Singapore had the highest level of sea reclamation. New reclaimed land for fish farming holds a key role in China, Vietnam, and Indonesia, while new reclaimed land for construction and docks dominated in Malaysia, Singapore, and Brunei. Areas and use-type compositions of new reclaimed land in countries varied greatly due to the differences of economic factors, policy inclination, and landscapes in the respective countries.
Horowitz, H. M.; Alexander, B.; Bitz, C. M.; Jaegle, L.; Burrows, S. M.
2017-12-01
In polar regions, sea ice is a major source of sea salt aerosol through lofting of saline frost flowers or blowing saline snow from the sea ice surface. Under continued climate warming, an ice-free Arctic in summer with only first-year, more saline sea ice in winter is likely. Previous work has focused on climate impacts in summer from increasing open ocean sea salt aerosol emissions following complete sea ice loss in the Arctic, with conflicting results suggesting no net radiative effect or a negative climate feedback resulting from a strong first aerosol indirect effect. However, the radiative forcing from changes to the sea ice sources of sea salt aerosol in a future, warmer climate has not previously been explored. Understanding how sea ice loss affects the Arctic climate system requires investigating both open-ocean and sea ice sources of sea-salt aerosol and their potential interactions. Here, we implement a blowing snow source of sea salt aerosol into the Community Earth System Model (CESM) dynamically coupled to the latest version of the Los Alamos sea ice model (CICE5). Snow salinity is a key parameter affecting blowing snow sea salt emissions and previous work has assumed constant regional snow salinity over sea ice. We develop a parameterization for dynamic snow salinity in the sea ice model and examine how its spatial and temporal variability impacts the production of sea salt from blowing snow. We evaluate and constrain the snow salinity parameterization using available observations. Present-day coupled CESM-CICE5 simulations of sea salt aerosol concentrations including sea ice sources are evaluated against in situ and satellite (CALIOP) observations in polar regions. We then quantify the present-day radiative forcing from the addition of blowing snow sea salt aerosol with respect to aerosol-radiation and aerosol-cloud interactions. The relative contributions of sea ice vs. open ocean sources of sea salt aerosol to radiative forcing in polar regions is
Arctic Sea Level Reconstruction
DEFF Research Database (Denmark)
Svendsen, Peter Limkilde
Reconstruction of historical Arctic sea level is very difficult due to the limited coverage and quality of tide gauge and altimetry data in the area. This thesis addresses many of these issues, and discusses strategies to help achieve a stable and plausible reconstruction of Arctic sea level from...... 1950 to today.The primary record of historical sea level, on the order of several decades to a few centuries, is tide gauges. Tide gauge records from around the world are collected in the Permanent Service for Mean Sea Level (PSMSL) database, and includes data along the Arctic coasts. A reasonable...... amount of data is available along the Norwegian and Russian coasts since 1950, and most published research on Arctic sea level extends cautiously from these areas. Very little tide gauge data is available elsewhere in the Arctic, and records of a length of several decades,as generally recommended for sea...
Putting SEA in context: A discourse perspective on how SEA contributes to decision-making
International Nuclear Information System (INIS)
Runhaar, Hens
2009-01-01
Over the last couple of years there is an ongoing debate in the environmental assessment literature about the contribution of Strategic Environmental Assessment (SEA) to public decision-making and how this can be understood and enhanced by better incorporating insights from policy analysis, planning theory and political sciences. By explicitly framing SEA as an element in a process where stakeholders with diverging interests struggle, acceptability of SEA processes and results by stakeholders has become an important element in SEA evaluation. In addition, the importance of other context variables, such as the institutional organisation, and the need for SEA to adapt to this context, is stressed. Thus far, publications in this area have been dealing with the operationalisation of SEA's 'contribution', typologies of roles that SEA can or should play in different policy settings and on factors that stimulate or impede SEA to play these roles. In this paper an alternative approach is suggested that starts from the deliberative processes around a particular policy issue or decision supported by SEA. Of particular interest are 'discourses': the frames through which groups of actors give meaning to aspects of the policy issues and decisions that are supported by SEA. Discourses do not only reflect conflicts of interests and power play, but also the ways in which actors perceive and understand aspects of the world. Decision-making is conceptualised as a 'system of competing discourse coalitions and their struggles to 'control shared meanings' and to gain acceptance of their framing of a policy issue' [Durning D. A review of Fischer and Forrester (1993) The argumentative turn in policy analysis and planning. Policy Sci 1995;28(1):102-8]. SEA is one of the events in this process that may impact upon dominant discourses. Discourse analysis allows for an understanding of arguments that are considered legitimate for (not) incorporating particular elements of SEA. In addition it
Sea-ice thickness from field measurements in the northwestern Barents Sea
King, Jennifer; Spreen, Gunnar; Gerland, Sebastian; Haas, Christian; Hendricks, Stefan; Kaleschke, Lars; Wang, Caixin
2017-02-01
The Barents Sea is one of the fastest changing regions of the Arctic, and has experienced the strongest decline in winter-time sea-ice area in the Arctic, at -23±4% decade-1. Sea-ice thickness in the Barents Sea is not well studied. We present two previously unpublished helicopter-borne electromagnetic (HEM) ice thickness measurements from the northwestern Barents Sea acquired in March 2003 and 2014. The HEM data are compared to ice thickness calculated from ice draft measured by ULS deployed between 1994 and 1996. These data show that ice thickness varies greatly from year to year; influenced by the thermodynamic and dynamic processes that govern local formation vs long-range advection. In a year with a large inflow of sea-ice from the Arctic Basin, the Barents Sea ice cover is dominated by thick multiyear ice; as was the case in 2003 and 1995. In a year with an ice cover that was mainly grown in situ, the ice will be thin and mechanically unstable; as was the case in 2014. The HEM data allow us to explore the spatial and temporal variability in ice thickness. In 2003 the dominant ice class was more than 2 years old; and modal sea-ice thickness varied regionally from 0.6 to 1.4 m, with the thinner ice being either first-year ice, or multiyear ice which had come into contact with warm Atlantic water. In 2014 the ice cover was predominantly locally grown ice less than 1 month old (regional modes of 0.5-0.8 m). These two situations represent two extremes of a range of possible ice thickness distributions that can present very different conditions for shipping traffic; or have a different impact on heat transport from ocean to atmosphere.
Sustainable Seas Student Intertidal Monitoring Project, Duxbury Reef, Bolinas, CA
Soave, K.; Dean, A.; Prescutti, K.; Ball, O.; Chang, E.; Darakananda, K.; Jessup, K.; Poutian, J.; Schwalbe, H.; Storm, E.
2008-12-01
The Sustainable Seas Student Monitoring Project at the Branson School in Ross, CA has monitored Duxbury Reef in Bolinas, CA since 1999, in cooperation with the Farallones Marine Sanctuary Association and the Gulf of Farallones National Marine Sanctuary. Goals of the project include: 1) To monitor the rocky intertidal habitat and develop a baseline database of invertebrates and algal density and abundance; 2) To contribute to the conservation of the rocky intertidal habitat through education of students and visitors about intertidal species and requirements for maintaining a healthy, diverse intertidal ecosystem; 3) To increase stewardship in the Gulf of the Farallones National Marine Sanctuary; and 4) To contribute abundance and population data on key algae and invertebrate species to the national database, LiMPETS (Long Term Monitoring Program and Experiential Training for Students). Student volunteers complete an intensive training course on the natural history of intertidal invertebrates and algae, identification of key species, rocky intertidal ecology, interpretation and monitoring techniques, and history of the sanctuary. Students identify and count key invertebrate and algae species along two permanent transects (A and B), and using randomly determined points within a permanent 100 m2 area, three times per year (fall, winter, and late spring). Using the data collected since 2004, we will analyze the population densities of aggregating anemones, Anthopleura elegantissima, for seasonal abundance variations as well as long-term population trends. We will also follow the seasonal and long-term population fluctuations of red algal turf, Endocladia muricata and Gelidium coulteri, and black turban snails, Tegula funebralis. Comparing populations of turf algae and the herbivorous black turban snails gathered before and after the November 7, 2007 San Francisco Bay oil spill shows very little impact on the Duxbury Reef intertidal inhabitants. Future analyses will
SeaRAM: an evaluation of the safety of RAM transport by sea
International Nuclear Information System (INIS)
McConnell, P.; Sorenson, K.B.; Carter, M.H.; Keane, M.P.; Keith, V.F.; Heid, R.J.
1995-01-01
SeaRAM is a multi-year Department of Energy (DOE) project designed to validate the safety of shipping radioactive materials (RAM) by sea. The project has an ultimate goal of developing and demonstrating analytic tools for performing comprehensive analyses to evaluate the risks to humans and the environment due to sea transport of plutonium, vitrified high-level waste (VHLW), and spent fuel associated with reprocessing and research reactors. To achieve this end, evaluations of maritime databases and structural an thermal analyses of particular severe collision and fire accidents have been and will continue to be conducted. Program management for SeaRAM is based at the DOE's Office of Environmental Restoration. Technical activities for the project are being conducted at Sandia National Laboratories (SNL). Several private organizations are also involved in providing technical support, notably Engineering Computer Optecnomics, Inc. (ECO). The technical work performed for SeaRAM also supports DOE participation in an International Atomic Energy Agency (IAEA) Cooperative Research Program (CRP) entitled Accident Severity at Sea During Transport of Radioactive Material. This paper discusses activities performed during the first year of the project
Sea level ~400 000 years ago (MIS 11: analogue for present and future sea-level?
Directory of Open Access Journals (Sweden)
D. Q. Bowen
2010-01-01
Full Text Available Comparison of the sea-level today with that of 400 000 years ago (MIS 11, when the Earth's orbital characteristics were similar may provide, under conditions of natural variability, indications of future sea-level during the present interglacial. Then, as now, orbital eccentricity was low and precession dampened. Evidence for MIS 11 sea-level occurs on uplifting coastlines where shorelines with geochronological ages have been preserved. The sea-level term and the uplift term may be separated with an "uplift correction" formula. This discovers the original sea-level at which the now uplifted shoreline was fashioned. Estimates are based on average uplift rates of the "last interglacial" sea-level (MIS 5.5 using a range of estimates for sea-level and age at that time at different locations. These, with varying secular tectonic regimes in different ocean basins, provide a band of estimates for the MIS 11 sea-level. They do not support the hypothesis of an MIS 11 sea-level at ~20 m, and instead show that it was closer to its present level.
International Nuclear Information System (INIS)
Walker, M.I.; Rose, K.S.B.
1990-01-01
The radioactivity in the world's surface sea water averages 13.6 Bq/kg of water. Over 88% of this activity arises from a single natural radionuclide, 40 K, and 7% of the remainder results from nuclear weapon test fallout. Variations in the radioactivity occur due to changes in salinity, weapon test fallout and discharges of artificial radionuclides, and are examined here on the basis of published measurements. The most radioactive sea identified by these measurements is the Dead Sea, which averages 178 Bq/kg due to its high salinity. Other enclosed, highly saline waters can be expected to have similar levels. The radioactivity in open seas varies within a much narrower range, generally within 20% of the world average. The highest averages are found in the Persian Gulf (22 Bq/kg), the Red Sea (15 Bq/kg) and the Eastern Mediterranean (14.6 Bq/kg). The Irish Sea averaged 13.7 Bq/kg in 1987, with the effect of the Sellafield discharges being partly offset by lower than average salinity. Although higher levels occurred in the Irish Sea during the 1970s when the Sellafield discharges were higher, the average level has always been much less than that in the Dead Sea, so that the Irish Sea has never been the most radioactive sea in the world. Exceptionally low levels of radioactivity (4 Bq/kg) occur in the Baltic Sea due to dilution by fresh water. (author)
Potential of sea level rise impact on South China Sea: a preliminary ...
African Journals Online (AJOL)
The effect of the sea level rise was involved the existence of sea water intrusion and coastal erosion phenomenon in the coastal of Terengganu. This study aim to determine fluctuation of high and low tides of the South China Sea in their relation to water quality value of Marang and Paka Rivers as well as from wells ...
Formation and spreading of Red Sea Outflow Water in the Red Sea
Zhai, Ping; Bower, Amy S.; Smethie, William M.; Pratt, Larry J.
2015-09-01
Hydrographic data, chlorofluorocarbon-12 (CFC-12) and sulfur hexafluoride (SF6) measurements collected in March 2010 and September-October 2011 in the Red Sea, as well as an idealized numerical experiment are used to study the formation and spreading of Red Sea Outflow Water (RSOW) in the Red Sea. Analysis of inert tracers, potential vorticity distributions, and model results confirm that RSOW is formed through mixed-layer deepening caused by sea surface buoyancy loss in winter in the northern Red Sea and reveal more details on RSOW spreading rates, pathways, and vertical structure. The southward spreading of RSOW after its formation is identified as a layer with minimum potential vorticity and maximum CFC-12 and SF6. Ventilation ages of seawater within the RSOW layer, calculated from the partial pressure of SF6 (pSF6), range from 2 years in the northern Red Sea to 15 years at 17°N. The distribution of the tracer ages is in agreement with the model circulation field which shows a rapid transport of RSOW from its formation region to the southern Red Sea where there are longer circulation pathways and hence longer residence time due to basin wide eddies. The mean residence time of RSOW within the Red Sea estimated from the pSF6 age is 4.7 years. This time scale is very close to the mean transit time (4.8 years) for particles from the RSOW formation region to reach the exit at the Strait of Bab el Mandeb in the numerical experiment.
Formation of Barents Sea Branch Water in the north-eastern Barents Sea
Directory of Open Access Journals (Sweden)
Vidar S. Lien
2013-09-01
Full Text Available The Barents Sea throughflow accounts for approximately half of the Atlantic Water advection to the Arctic Ocean, while the other half flows through Fram Strait. Within the Barents Sea, the Atlantic Water undergoes considerable modifications before entering the Arctic Ocean through the St. Anna Trough. While the inflow area in the south-western Barents Sea is regularly monitored, oceanographic data from the outflow area to the north-east are very scarce. Here, we use conductivity, temperature and depth data from August/September 2008 to describe in detail the water masses present in the downstream area of the Barents Sea, their spatial distribution and transformations. Both Cold Deep Water, formed locally through winter convection and ice-freezing processes, and Atlantic Water, modified mainly through atmospheric cooling, contribute directly to the Barents Sea Branch Water. As a consequence, it consists of a dense core characterized by a temperature and salinity maximum associated with the Atlantic Water, in addition to the colder, less saline and less dense core commonly referred to as the Barents Sea Branch Water core. The denser core likely constitutes a substantial part of the total flow, and it is more saline and considerably denser than the Fram Strait branch as observed within the St. Anna Trough. Despite the recent warming of the Barents Sea, the Barents Sea Branch Water is denser than observed in the 1990s, and the bottom water observed in the St. Anna Trough matches the potential density at 2000 m depth in the Arctic Ocean.
Sea ice contribution to the air-sea CO{sub 2} exchange in the Arctic and Southern Oceans
Energy Technology Data Exchange (ETDEWEB)
Rysgaard, Soeren (Greenland Climate Research Centre, Greenland Inst. of Natural Resources, Nuuk, Greenland (Denmark); Centre for Earth Observation Science, CHR Faculty of Environment Earth and Resources, Univ. of Manitoba, Winnipeg (Canada)), e-mail: rysgaard@natur.gl; Bendtsen, Joergen (Greenland Climate Research Centre, Greenland Inst. of Natural Resources, Nuuk, Greenland (Denmark); Centre for Ice and Climate, Niels Bohr Inst., Univ. of Copenhagen, Copenhagen O (Denmark)); Delille, Bruno (Unit' e d' Oceanographie Chimique, Interfacultary Centre for Marine Research, Universite de Liege, Liege (Belgium)); Dieckmann, Gerhard S. (Alfred Wegener Inst. for Polar and Marine Research, Bremerhaven (Germany)); Glud, Ronnie N. (Greenland Climate Research Centre, Greenland Inst. of Natural Resources, Nuuk, Greenland (Denmark); Scottish Association of Marine Sciences, Scotland UK, Southern Danish Univ. and NordCee, Odense M (Denmark)); Kennedy, Hilary; Papadimitriou, Stathys (School of Ocean Sciences, Bangor Univ., Menai Bridge, Anglesey, Wales (United Kingdom)); Mortensen, John (Greenland Climate Research Centre, Greenland Inst. of Natural Resources, Nuuk, Greenland (Denmark)); Thomas, David N. (School of Ocean Sciences, Bangor Univ., Menai Bridge, Anglesey, Wales (United Kingdom); Finnish Environment Inst. (SYKE), Marine Research Centre, Helsinki (Finland)); Tison, Jean-Louis (Glaciology Unit, Dept. of Earth and Environmental Sciences, Universite Libre de Bruxelles, Bruxelles, (Belgium))
2011-11-15
Although salt rejection from sea ice is a key process in deep-water formation in ice-covered seas, the concurrent rejection of CO{sub 2} and the subsequent effect on air-sea CO{sub 2} exchange have received little attention. We review the mechanisms by which sea ice directly and indirectly controls the air-sea CO{sub 2} exchange and use recent measurements of inorganic carbon compounds in bulk sea ice to estimate that oceanic CO{sub 2} uptake during the seasonal cycle of sea-ice growth and decay in ice-covered oceanic regions equals almost half of the net atmospheric CO{sub 2} uptake in ice-free polar seas. This sea-ice driven CO{sub 2} uptake has not been considered so far in estimates of global oceanic CO{sub 2} uptake. Net CO{sub 2} uptake in sea-ice-covered oceans can be driven by; (1) rejection during sea-ice formation and sinking of CO{sub 2}-rich brine into intermediate and abyssal oceanic water masses, (2) blocking of air-sea CO{sub 2} exchange during winter, and (3) release of CO{sub 2}-depleted melt water with excess total alkalinity during sea-ice decay and (4) biological CO{sub 2} drawdown during primary production in sea ice and surface oceanic waters
The Red Sea during the Last Glacial Maximum: implications for sea level reconstructions
Gildor, H.; Biton, E.; Peltier, W. R.
2006-12-01
The Red Sea (RS) is a semi-enclosed basin connected to the Indian Ocean via a narrow and shallow strait, and surrounded by arid areas which exhibits high sensitivity to atmospheric changes and sea level reduction. We have used the MIT GCM to investigate the changes in the hydrography and circulation in the RS in response to reduced sea level, variability in the Indian monsoons, and changes in atmospheric temperature and humidity that occurred during the Last Glacial Maximum (LGM). The model results show high sensitivity to sea level reduction especially in the salinity field (increasing with the reduction in sea level) together with a mild atmospheric impact. Sea level reduction decreases the stratification, increases subsurface temperatures, and alters the circulation pattern at the Strait of Bab el Mandab, which experiences a transition from submaximal flow to maximal flow. The reduction in sea level at LGM alters the location of deep water formation which shifts to an open sea convective site in the northern part of the RS compared to present day situation in which deep water is formed from the Gulf of Suez outflow. Our main result based on both the GCM and on a simple hydraulic control model which takes into account mixing process at the Strait of Bab El Mandeb, is that sea level was reduced by only ~100 m in the Bab El Mandeb region during the LGM, i.e. the water depth at the Hanish sill (the shallowest part in the Strait Bab el Mandab) was around 34 m. This result agrees with the recent reconstruction of the LGM low stand of the sea in this region based upon the ICE-5G (VM2) model of Peltier (2004).
Biologically-Oriented Processes in the Coastal Sea Ice Zone of the White Sea
Melnikov, I. A.
2002-12-01
The annual advance and retreat of sea ice is a major physical determinant of spatial and temporal changes in the structure and function of marine coastal biological communities. Sea ice biological data obtained in the tidal zone of Kandalaksha Gulf (White Sea) during 1996-2001 period will be presented. Previous observations in this area were mainly conducted during the ice-free summer season. However, there is little information on the ice-covered winter season (6-7 months duration), and, especially, on the sea-ice biology in the coastal zone within tidal regimes. During the January-May period time-series observations were conducted on transects along shorelines with coastal and fast ice. Trends in the annual extent of sea ice showed significant impacts on ice-associated biological communities. Three types of sea ice impact on kelps, balanoides, littorinas and amphipods are distinguished: (i) positive, when sea ice protects these populations from grinding (ii) negative, when ice grinds both fauna and flora, and (iii) a combined effect, when fast ice protects, but anchored ice grinds plant and animals. To understand the full spectrum of ecological problems caused by pollution on the coastal zone, as well as the problems of sea ice melting caused by global warming, an integrated, long-term study of the physical, chemical, and biological processes is needed.
Warming in the Nordic Seas, North Atlantic storms and thinning Arctic sea ice
Alexeev, Vladimir A.; Walsh, John E.; Ivanov, Vladimir V.; Semenov, Vladimir A.; Smirnov, Alexander V.
2017-08-01
Arctic sea ice over the last few decades has experienced a significant decline in coverage both in summer and winter. The currently warming Atlantic Water layer has a pronounced impact on sea ice in the Nordic Seas (including the Barents Sea). More open water combined with the prevailing atmospheric pattern of airflow from the southeast, and persistent North Atlantic storms such as the recent extremely strong Storm Frank in December 2015, lead to increased energy transport to the high Arctic. Each of these storms brings sizeable anomalies of heat to the high Arctic, resulting in significant warming and slowing down of sea ice growth or even melting. Our analysis indicates that the recently observed sea ice decline in the Nordic Seas during the cold season around Svalbard, Franz Joseph Land and Novaya Zemlya, and the associated heat release from open water into the atmosphere, contributed significantly to the increase in the downward longwave radiation throughout the entire Arctic. Added to other changes in the surface energy budget, this increase since the 1960s to the present is estimated to be at least 10 W m-2, which can result in thinner (up to at least 15-20 cm) Arctic ice at the end of the winter. This change in the surface budget is an important contributing factor accelerating the thinning of Arctic sea ice.
Polarimetric signatures of sea ice in the Greenland Sea
DEFF Research Database (Denmark)
Skriver, Henning; Pedersen, Leif Toudal
1995-01-01
Polarimetric SAR data of sea ice have been acquired by the Danish polarimetric SAR (EMISAR) during a mission at the Greenland Sea in August 1994. Video recordings from a low-altitude acquisition have been used for interpretation of the SAR data. Also, ERS-1 SAR data and NOAA AVHRR-data have been...
National Oceanic and Atmospheric Administration, Department of Commerce — Temperature, salinity, and nutrients data collected from North Atlantic Ocean, White Sea, Mediterranean Sea, Black Sea, and Sea of Azov from 1924-03-19 to 1989-11-19...
Raising the Dead without a Red Sea-Dead Sea project? Hydro-economics and governance
Directory of Open Access Journals (Sweden)
D. E. Rosenberg
2011-04-01
Full Text Available Seven decades of extractions have dramatically reduced Jordan River flows, lowered the Dead Sea level, opened sink holes, and caused other environmental problems. The fix Jordan, Israel, and the Palestinians propose would build an expensive multipurpose conveyance project from the Red Sea to the Dead Sea that would also generate hydropower and desalinate water. This paper compares the Red-Dead project to alternatives that may also raise the Dead Sea level. Hydro-economic model results for the Jordan-Israel-Palestinian inter-tied water systems show two restoration alternatives are more economically viable than the proposed Red-Dead project. Many decentralized new supply, wastewater reuse, conveyance, conservation, and leak reduction projects and programs in each country can together increase economic benefits and reliably deliver up to 900 MCM yr−1 to the Dead Sea. Similarly, a smaller Red-Dead project that only generates hydropower can deliver large flows to the Dead Sea when the sale price of generated electricity is sufficiently high. However, for all restoration options, net benefits fall and water scarcity rises as flows to the Dead Sea increase. This finding suggests (i each country has no individual incentive to return water to the Dead Sea, and (ii outside institutions that seek to raise the Dead must also offer countries direct incentives to deliver water to the Sea besides building the countries new infrastructure.
[Multiple scattering of visible and infrared light by sea fog over wind driving rough sea surface].
Sun, Xian-Ming; Wang, Hai-Hua; Lei, Cheng-Xin; Shen, Jin
2013-08-01
The present paper is concerned with computing the multiple scattering characteristics of a sea fog-sea surface couple system within this context. The single scattering characteristics of sea fog were studied by Mie theory, and the multiple scattering of sunlight by single sea fog layer was studied by radiative transfer theory. The reflection function of a statistically rough ocean surface was obtained using the standard Kirchhoff formulation, with shadowing effects taken into account. The reflection properties of the combined sea fog and ocean surface were obtained employing the adding method, and the results indicated that the reflected light intensity of sea fog increased with the sea background.
Directory of Open Access Journals (Sweden)
K. Hara
2017-07-01
Full Text Available Sea salts and halogens in aerosols, frost flowers, and brine play an important role in atmospheric chemistry in polar regions. Simultaneous sampling and observations of frost flowers, brine, and aerosol particles were conducted around Siorapaluk in northwestern Greenland during December 2013 to March 2014. Results show that water-soluble frost flower and brine components are sea-salt components (e.g., Na+, Cl−, Mg2+, K+, Ca2+, Br−, and iodine. Concentration factors of sea-salt components of frost flowers and brine relative to seawater were 1.14–3.67. Sea-salt enrichment of Mg2+, K+, Ca2+, and halogens (Cl−, Br−, and iodine in frost flowers is associated with sea-salt fractionation by precipitation of mirabilite and hydrohalite. High aerosol number concentrations correspond to the occurrence of higher abundance of sea-salt particles in both coarse and fine modes, and blowing snow and strong winds. Aerosol number concentrations, particularly in coarse mode, are increased considerably by release from the sea-ice surface under strong wind conditions. Sulfate depletion by sea-salt fractionation was found to be limited in sea-salt aerosols because of the presence of non-sea-salt (NSS SO42−. However, coarse and fine sea-salt particles were found to be rich in Mg. Strong Mg enrichment might be more likely to proceed in fine sea-salt particles. Magnesium-rich sea-salt particles might be released from the surface of snow and slush layer (brine on sea ice and frost flowers. Mirabilite-like and ikaite-like particles were identified only in aerosol samples collected near new sea-ice areas. From the field evidence and results from earlier studies, we propose and describe sea-salt cycles in seasonal sea-ice areas.
Hara, Keiichiro; Matoba, Sumito; Hirabayashi, Motohiro; Yamasaki, Tetsuhide
2017-07-01
Sea salts and halogens in aerosols, frost flowers, and brine play an important role in atmospheric chemistry in polar regions. Simultaneous sampling and observations of frost flowers, brine, and aerosol particles were conducted around Siorapaluk in northwestern Greenland during December 2013 to March 2014. Results show that water-soluble frost flower and brine components are sea-salt components (e.g., Na+, Cl-, Mg2+, K+, Ca2+, Br-, and iodine). Concentration factors of sea-salt components of frost flowers and brine relative to seawater were 1.14-3.67. Sea-salt enrichment of Mg2+, K+, Ca2+, and halogens (Cl-, Br-, and iodine) in frost flowers is associated with sea-salt fractionation by precipitation of mirabilite and hydrohalite. High aerosol number concentrations correspond to the occurrence of higher abundance of sea-salt particles in both coarse and fine modes, and blowing snow and strong winds. Aerosol number concentrations, particularly in coarse mode, are increased considerably by release from the sea-ice surface under strong wind conditions. Sulfate depletion by sea-salt fractionation was found to be limited in sea-salt aerosols because of the presence of non-sea-salt (NSS) SO42-. However, coarse and fine sea-salt particles were found to be rich in Mg. Strong Mg enrichment might be more likely to proceed in fine sea-salt particles. Magnesium-rich sea-salt particles might be released from the surface of snow and slush layer (brine) on sea ice and frost flowers. Mirabilite-like and ikaite-like particles were identified only in aerosol samples collected near new sea-ice areas. From the field evidence and results from earlier studies, we propose and describe sea-salt cycles in seasonal sea-ice areas.
International Nuclear Information System (INIS)
Hacisalihoglu, G.; Eliyakut, F.; Anwari, M.A.; Ataman, O.Y.; Balkas, T.I.; Tuncel, G.; Olmez, I.
1991-01-01
Shipboard, high volume air particulate samples were collected from the Black Sea atmosphere and analyzed by instrumental neutron activation analysis, atomic absorption spectrophotometry and ion chromatography for about 40 elements and ions. Concentrations of elements in the eastern and western parts of the Black Sea are different at the 95% confidence level, with lower concentrations in the eastern Black Sea. Back-trajectories and concentrations of elements in trajectory groups show that Europe accounts for more than 70% of the anthropogenic elements in the atmosphere. The average sulfate concentration was 7 μg/m 3 , which is comparable with rural sulfate levels in western Europe. Fluxes of elements from the atmosphere to the Black Sea are in good agreement with the results of similar flux calculations for other regions
Sea Surface Temperature Climate Data Record for the North Sea and Baltic Sea
DEFF Research Database (Denmark)
Høyer, Jacob L.; Karagali, Ioanna
2016-01-01
A 30-yr climate data record (CDR) of sea surface temperature (SST) has been produced with daily gap-free analysis fields for the North Sea and the Baltic Sea region from 1982 to 2012 by combining the Pathfinder AVHRR satellite data record with the Along-Track Scanning Radiometer (ATSR) Reprocessing...... for Climate (ARC) dataset and with in situ observations. A dynamical bias correction scheme adjusts the Pathfinder observations toward the ARC and in situ observations. Largest Pathfinder-ARC differences are found in the summer months, when the Pathfinder observations are up to 0.4 °C colder than the ARC...... observations on average. Validation against independent in situ observations shows a very stable performance of the data record, with a mean difference of -0.06 °C compared to moored buoys and a 0.46 °C standard deviation of the differences. The mean annual biases of the SST CDR are small for all years...
Fin whales and microplastics: The Mediterranean Sea and the Sea of Cortez scenarios
International Nuclear Information System (INIS)
Fossi, Maria Cristina; Marsili, Letizia; Baini, Matteo; Giannetti, Matteo; Coppola, Daniele; Guerranti, Cristiana; Caliani, Ilaria; Minutoli, Roberta; Lauriano, Giancarlo; Finoia, Maria Grazia; Rubegni, Fabrizio; Panigada, Simone; Bérubé, Martine; Urbán Ramírez, Jorge; Panti, Cristina
2016-01-01
The impact that microplastics have on baleen whales is a question that remains largely unexplored. This study examined the interaction between free-ranging fin whales (Balaenoptera physalus) and microplastics by comparing populations living in two semi-enclosed basins, the Mediterranean Sea and the Sea of Cortez (Gulf of California, Mexico). The results indicate that a considerable abundance of microplastics and plastic additives exists in the neustonic samples from Pelagos Sanctuary of the Mediterranean Sea, and that pelagic areas containing high densities of microplastics overlap with whale feeding grounds, suggesting that whales are exposed to microplastics during foraging; this was confirmed by the observation of a temporal increase in toxicological stress in whales. Given the abundance of microplastics in the Mediterranean environment, along with the high concentrations of Persistent Bioaccumulative and Toxic (PBT) chemicals, plastic additives and biomarker responses detected in the biopsies of Mediterranean whales as compared to those in whales inhabiting the Sea of Cortez, we believe that exposure to microplastics because of direct ingestion and consumption of contaminated prey poses a major threat to the health of fin whales in the Mediterranean Sea. - Highlights: • Microplastics and phthalates were higher in the Mediterranean Sea than in the Sea of Cortez. • The overlap between the whale feeding areas and high microplastic density shows the risk of interaction. • Data suggest an increasing risk of chemical transfer from microplastic to whales during the foraging. • Mediterranean whales are exposed to higher ecotoxicological threat of than Sea of Cortez whales. - This study identified temporal and regional ecotoxicological variations in free-ranging fin whales inhabiting two seas different characterized by different microplastic abundance.
Three modes of interdecadal trends in sea surface temperature and sea surface height
Gnanadesikan, A.; Pradal, M.
2013-12-01
It might be thought that sea surface height and sea surface temperature would be tightly related. We show that this is not necessarily the case on a global scale. We analysed this relationship in a suite of coupled climate models run under 1860 forcing conditions. The models are low-resolution variants of the GFDL Earth System Model, reported in Galbraith et al. (J. Clim. 2011). 1. Correlated changes in global sea surface height and global sea surface temperature. This mode corresponds to opening and closing of convective chimneys in the Southern Ocean. As the Southern Ocean destratifies, sea ice formation is suppressed during the winter and more heat is taken up during the summer. This mode of variability is highly correlated with changes in the top of the atmosphere radiative budget and weakly correlated with changes in the deep ocean circulation. 2. Uncorrelated changes in global sea surface height and global sea surface temperature. This mode of variability is associated with interdecadal variabliity in tropical winds. Changes in the advective flux of heat to the surface ocean play a critical role in driving these changes, which also result in significant local changes in sea level. Changes sea ice over the Southern Ocean still result in changes in solar absorption, but these are now largely cancelled by changes in outgoing longwave radiation. 3. Anticorrelated changes in global sea surface height and global sea surface temperatures. By varying the lateral diffusion coefficient in the ocean model, we are able to enhance and suppress convection in the Southern and Northern Pacific Oceans. Increasing the lateral diffusion coefficients shifts the balance sources of deep water away from the warm salty deep water of the North Atlantic and towards cold fresh deep water from the other two regions. As a result, even though the planet as a whole warms, the deep ocean cools and sea level falls, with changes of order 30 cm over 500 years. The increase in solar absorption
Increased Land Use by Chukchi Sea Polar Bears in Relation to Changing Sea Ice Conditions.
Rode, Karyn D; Wilson, Ryan R; Regehr, Eric V; St Martin, Michelle; Douglas, David C; Olson, Jay
2015-01-01
Recent observations suggest that polar bears (Ursus maritimus) are increasingly using land habitats in some parts of their range, where they have minimal access to their preferred prey, likely in response to loss of their sea ice habitat associated with climatic warming. We used location data from female polar bears fit with satellite radio collars to compare land use patterns in the Chukchi Sea between two periods (1986-1995 and 2008-2013) when substantial summer sea-ice loss occurred. In both time periods, polar bears predominantly occupied sea-ice, although land was used during the summer sea-ice retreat and during the winter for maternal denning. However, the proportion of bears on land for > 7 days between August and October increased between the two periods from 20.0% to 38.9%, and the average duration on land increased by 30 days. The majority of bears that used land in the summer and for denning came to Wrangel and Herald Islands (Russia), highlighting the importance of these northernmost land habitats to Chukchi Sea polar bears. Where bears summered and denned, and how long they spent there, was related to the timing and duration of sea ice retreat. Our results are consistent with other studies supporting increased land use as a common response of polar bears to sea-ice loss. Implications of increased land use for Chukchi Sea polar bears are unclear, because a recent study observed no change in body condition or reproductive indices between the two periods considered here. This result suggests that the ecology of this region may provide a degree of resilience to sea ice loss. However, projections of continued sea ice loss suggest that polar bears in the Chukchi Sea and other parts of the Arctic may increasingly use land habitats in the future, which has the potential to increase nutritional stress and human-polar bear interactions.
Intermittent sea-level acceleration
Olivieri, M.; Spada, G.
2013-10-01
Using instrumental observations from the Permanent Service for Mean Sea Level (PSMSL), we provide a new assessment of the global sea-level acceleration for the last ~ 2 centuries (1820-2010). Our results, obtained by a stack of tide gauge time series, confirm the existence of a global sea-level acceleration (GSLA) and, coherently with independent assessments so far, they point to a value close to 0.01 mm/yr2. However, differently from previous studies, we discuss how change points or abrupt inflections in individual sea-level time series have contributed to the GSLA. Our analysis, based on methods borrowed from econometrics, suggests the existence of two distinct driving mechanisms for the GSLA, both involving a minority of tide gauges globally. The first effectively implies a gradual increase in the rate of sea-level rise at individual tide gauges, while the second is manifest through a sequence of catastrophic variations of the sea-level trend. These occurred intermittently since the end of the 19th century and became more frequent during the last four decades.
National Oceanic and Atmospheric Administration, Department of Commerce — A Group for High Resolution Sea Surface Temperature (GHRSST) Level 4 sea surface temperature analysis produced daily on an operational basis by the Danish...
Gildor, Tsvia; Hinman, Veronica; Ben-Tabou-De-Leon, Smadar
2017-01-01
It has long been argued that heterochrony, a change in relative timing of a developmental process, is a major source of evolutionary innovation. Heterochronic changes of regulatory gene activation could be the underlying molecular mechanism driving heterochronic changes through evolution. Here, we compare the temporal expression profiles of key regulatory circuits between sea urchin and sea star, representative of two classes of Echinoderms that shared a common ancestor about 500 million years ago. The morphologies of the sea urchin and sea star embryos are largely comparable, yet, differences in certain mesodermal cell types and ectodermal patterning result in distinct larval body plans. We generated high resolution temporal profiles of 17 mesodermally-, endodermally- and ectodermally-expressed regulatory genes in the sea star, Patiria miniata, and compared these to their orthologs in the Mediterranean sea urchin, Paracentrotus lividus. We found that the maternal to zygotic transition is delayed in the sea star compared to the sea urchin, in agreement with the longer cleavage stage in the sea star. Interestingly, the order of gene activation shows the highest variation in the relatively diverged mesodermal circuit, while the correlations of expression dynamics are the highest in the strongly conserved endodermal circuit. We detected loose scaling of the developmental rates of these species and observed interspecies heterochronies within all studied regulatory circuits. Thus, after 500 million years of parallel evolution, mild heterochronies between the species are frequently observed and the tight temporal scaling observed for closely related species no longer holds.
The Satellite Passive-Microwave Record of Sea Ice in the Ross Sea Since Late 1978
Parkinson, Claire L.
2009-01-01
Satellites have provided us with a remarkable ability to monitor many aspects of the globe day-in and day-out and sea ice is one of numerous variables that by now have quite substantial satellite records. Passive-microwave data have been particularly valuable in sea ice monitoring, with a record that extends back to August 1987 on daily basis (for most of the period), to November 1970 on a less complete basis (again for most of the period), and to December 1972 on a less complete basis. For the period since November 1970, Ross Sea sea ice imagery is available at spatial resolution of approximately 25 km. This allows good depictions of the seasonal advance and retreat of the ice cover each year, along with its marked interannual variability. The Ross Sea ice extent typically reaches a minimum of approximately 0.7 x 10(exp 6) square kilometers in February, rising to a maximum of approximately 4.0 x 10(exp 6) square kilometers in September, with much variability among years for both those numbers. The Ross Sea images show clearly the day-by-day activity greatly from year to year. Animations of the data help to highlight the dynamic nature of the Ross Sea ice cover. The satellite data also allow calculation of trends in the ice cover over the period of the satellite record. Using linear least-squares fits, the Ross Sea ice extent increased at an average rate of 12,600 plus or minus 1,800 square kilometers per year between November 1978 and December 2007, with every month exhibiting increased ice extent and the rates of increase ranging from a low of 7,500 plus or minus 5,000 square kilometers per year for the February ice extents to a high of 20,300 plus or minus 6,100 kilometers per year for the October ice extents. On a yearly average basis, for 1979-2007 the Ross Sea ice extent increased at a rate of 4.8 plus or minus 1.6 % per decade. Placing the Ross Sea in the context of the Southern Ocean as a whole, over the November 1978-December 2007 period the Ross Sea had
A heavy sea fog event over the Yellow Sea in March 2005: Analysis and numerical modeling
Gao, Shanhong; Lin, Hang; Shen, Biao; Fu, Gang
2007-02-01
In this paper, a heavy sea fog episode that occurred over the Yellow Sea on 9 March 2005 is investigated. The sea fog patch, with a spatial scale of several hundred kilometers at its mature stage, reduced visibility along the Shandong Peninsula coast to 100 m or much less at some sites. Satellite images, surface observations and soundings at islands and coasts, and analyses from the Japan Meteorology Agency (JMA) are used to describe and analyze this event. The analysis indicates that this sea fog can be categorized as advection cooling fog. The main features of this sea fog including fog area and its movement are reasonably reproduced by the Fifth-generation Pennsylvania State University/National Center for Atmospheric Research Mesoscale Model (MM5). Model results suggest that the formation and evolution of this event can be outlined as: (1) southerly warm/moist advection of low-level air resulted in a strong sea-surface-based inversion with a thickness of about 600 m; (2) when the inversion moved from the warmer East Sea to the colder Yellow Sea, a thermal internal boundary layer (TIBL) gradually formed at the base of the inversion while the sea fog grew in response to cooling and moistening by turbulence mixing; (3) the sea fog developed as the TIBL moved northward and (4) strong northerly cold and dry wind destroyed the TIBL and dissipated the sea fog. The principal findings of this study are that sea fog forms in response to relatively persistent southerly warm/moist wind and a cold sea surface, and that turbulence mixing by wind shear is the primary mechanism for the cooling and moistening the marine layer. In addition, the study of sensitivity experiments indicates that deterministic numerical modeling offers a promising approach to the prediction of sea fog over the Yellow Sea but it may be more efficient to consider ensemble numerical modeling because of the extreme sensitivity to model input.
Directory of Open Access Journals (Sweden)
Ulf Bickmeyer
2012-01-01
Full Text Available The brominated pyrrole-imidazole Ageladine A was used for live imaging of the jellyfish (jellies Nausithoe werneri, the sea anemone Metridium senile and the flatworm Macrostomum lignano. The fluorescence properties of Ageladine A allow for estimation of pH values in tissue and organs in living animals. The results showed that Nausithoe werneri had the most acidic areas in the tentacles and close to the mouth (pH 4–6.5, Metridium senile harbours aggregates of high acidity in the tentacles (pH 5 and in Macrostomum lignano, the rhabdoids, the gonads and areas close to the mouth were the most acidic with values down to pH 5.
Sea Ice Summer Camp: Bringing Together Arctic Sea Ice Modelers and Observers
Perovich, D. K.; Holland, M. M.
2016-12-01
The Arctic sea ice has undergone dramatic change and numerical models project this to continue for the foreseeable future. Understanding the mechanisms behind sea ice loss and its consequences for the larger Arctic and global systems is of critical importance if we are to anticipate and plan for the future. One impediment to progress is a disconnect between the observational and modeling communities. A sea ice summer camp was held in Barrow Alaska from 26 May to 1 June 2016 to overcome this impediment and better integrate the sea ice community. The 25 participants were a mix of modelers and observers from 13 different institutions at career stages from graduate student to senior scientist. The summer camp provided an accelerated program on sea ice observations and models and also fostered future collaborative interdisciplinary activities. Each morning was spent in the classroom with a daily lecture on an aspect of modeling or remote sensing followed by practical exercises. Topics included using models to assess sensitivity, to test hypotheses and to explore sources of uncertainty in future Arctic sea ice loss. The afternoons were spent on the ice making observations. There were four observational activities; albedo observations, ice thickness measurements, ice coring and physical properties, and ice morphology surveys. The last field day consisted of a grand challenge where the group formulated a hypothesis, developed an observational and modeling strategy to test the hypothesis, and then integrated the observations and model results. The impacts of changing sea ice are being felt today in Barrow Alaska. We opened a dialog with Barrow community members to further understand these changes. This included an evening discussion with two Barrow sea ice experts and a community presentation of our work in a public lecture at the Inupiat Heritage Center.
Quaternary Sea-ice history in the Arctic Ocean based on a new Ostracode sea-ice proxy
Cronin, T. M.; Gemery, L.; Briggs, W.M.; Jakobsson, M.; Polyak, L.; Brouwers, E.M.
2010-01-01
Paleo-sea-ice history in the Arctic Ocean was reconstructed using the sea-ice dwelling ostracode Acetabulastoma arcticum from late Quaternary sediments from the Mendeleyev, Lomonosov, and Gakkel Ridges, the Morris Jesup Rise and the Yermak Plateau. Results suggest intermittently high levels of perennial sea ice in the central Arctic Ocean during Marine Isotope Stage (MIS) 3 (25-45 ka), minimal sea ice during the last deglacial (16-11 ka) and early Holocene thermal maximum (11-5 ka) and increasing sea ice during the mid-to-late Holocene (5-0 ka). Sediment core records from the Iceland and Rockall Plateaus show that perennial sea ice existed in these regions only during glacial intervals MIS 2, 4, and 6. These results show that sea ice exhibits complex temporal and spatial variability during different climatic regimes and that the development of modern perennial sea ice may be a relatively recent phenomenon. ?? 2010.
Grain-size based sea-level reconstruction in the south Bohai Sea during the past 135 kyr
Yi, Liang; Chen, Yanping
2013-04-01
Future anthropogenic sea-level rise and its impact on coastal regions is an important issue facing human civilizations. Due to the short nature of the instrumental record of sea-level change, development of proxies for sea-level change prior to the advent of instrumental records is essential to reconstruct long-term background sea-level changes on local, regional and global scales. Two of the most widely used approaches for past sea-level changes are: (1) exploitation of dated geomorphologic features such as coastal sands (e.g. Mauz and Hassler, 2000), salt marsh (e.g. Madsen et al., 2007), terraces (e.g. Chappell et al., 1996), and other coastal sediments (e.g. Zong et al., 2003); and (2) sea-level transfer functions based on faunal assemblages such as testate amoebae (e.g. Charman et al., 2002), foraminifera (e.g. Chappell and Shackleton, 1986; Horton, 1997), and diatoms (e.g. Horton et al., 2006). While a variety of methods has been developed to reconstruct palaeo-changes in sea level, many regions, including the Bohai Sea, China, still lack detailed relative sea-level curves extending back to the Pleistocene (Yi et al., 2012). For example, coral terraces are absent in the Bohai Sea, and the poor preservation of faunal assemblages makes development of a transfer function for a relative sea-level reconstruction unfeasible. In contrast, frequent alternations between transgression and regression has presumably imprinted sea-level change on the grain size distribution of Bohai Sea sediments, which varies from medium silt to coarse sand during the late Quaternary (IOCAS, 1985). Advantages of grainsize-based relative sea-level transfer function approaches are that they require smaller sample sizes, allowing for replication, faster measurement and higher spatial or temporal resolution at a fraction of the cost of detail micro-palaeontological analysis (Yi et al., 2012). Here, we employ numerical methods to partition sediment grain size using a combined database of
Sea-ice dynamics strongly promote Snowball Earth initiation and destabilize tropical sea-ice margins
Directory of Open Access Journals (Sweden)
A. Voigt
2012-12-01
Full Text Available The Snowball Earth bifurcation, or runaway ice-albedo feedback, is defined for particular boundary conditions by a critical CO2 and a critical sea-ice cover (SI, both of which are essential for evaluating hypotheses related to Neoproterozoic glaciations. Previous work has shown that the Snowball Earth bifurcation, denoted as (CO2, SI*, differs greatly among climate models. Here, we study the effect of bare sea-ice albedo, sea-ice dynamics and ocean heat transport on (CO2, SI* in the atmosphere–ocean general circulation model ECHAM5/MPI-OM with Marinoan (~ 635 Ma continents and solar insolation (94% of modern. In its standard setup, ECHAM5/MPI-OM initiates a~Snowball Earth much more easily than other climate models at (CO2, SI* ≈ (500 ppm, 55%. Replacing the model's standard bare sea-ice albedo of 0.75 by a much lower value of 0.45, we find (CO2, SI* ≈ (204 ppm, 70%. This is consistent with previous work and results from net evaporation and local melting near the sea-ice margin. When we additionally disable sea-ice dynamics, we find that the Snowball Earth bifurcation can be pushed even closer to the equator and occurs at a hundred times lower CO2: (CO2, SI* ≈ (2 ppm, 85%. Therefore, the simulation of sea-ice dynamics in ECHAM5/MPI-OM is a dominant determinant of its high critical CO2 for Snowball initiation relative to other models. Ocean heat transport has no effect on the critical sea-ice cover and only slightly decreases the critical CO2. For disabled sea-ice dynamics, the state with 85% sea-ice cover is stabilized by the Jormungand mechanism and shares characteristics with the Jormungand climate states. However, there is no indication of the Jormungand bifurcation and hysteresis in ECHAM5/MPI-OM. The state with 85% sea-ice cover therefore is a soft Snowball state rather than a true
The USGS Salton Sea Science Office
Case, Harvey Lee; Barnum, Douglas A.
2007-01-01
The U.S. Geological Survey's (USGS) Salton Sea Science Office (SSSO) provides scientific information and evaluations to decisionmakers who are engaged in restoration planning and actions associated with the Salton Sea. The primary focus is the natural resources of the Salton Sea, including the sea?s ability to sustain biological resources and associated social and economic values.
XXI century projections of wind-wave conditions and sea-level rise in the Black sea
Polonsky, A.; Garmashov, A.; Fomin, V.; Valchev, N.; Trifonova, E.
2012-04-01
Projection of regional climate changes for XXI century is one of the priorities of EC environmental programme. Potential worsening of the waves' statistics, sea level rise and extreme surges are the principal negative consequences of the climate change for marine environment. That is why the main purpose of this presentation is to discuss the above issue for the Black sea region (with a strong focus to the south-west subregion because the maximum heights of waves exceeding 10 m occur just here) using output of several global coupled models (GCM) for XXI century, wave simulation, long-term observations of sea level and statistical techniques. First of all we tried to choose the best coupled model (s) simulated the Black sea climate change and variability using the control experiments for 20 century (203). The principal result is as follows. There is not one model which is simulating adequately even one atmospheric parameter for all seasons. Therefore we considered (for the climate projection) different outputs form various models. When it was possible we calculated also the ensemble mean projection for the selected model (s) and emission scenarios. To calculate the wave projection we used the output of SWAN model forced by the GCM wind projection for 2010 to 2100. To estimate the sea level rise in XXI century and future surges statistics we extrapolate the observed sea level rise tendencies, statistical relation between wave heights and sea level and wave scenarios. Results show that in general, the climate change in XXI century doesn't lead to the catastrophic change of the Black sea wind-wave statistics including the extreme waves in the S-W Black sea. The typical atmospheric pattern leading to the intense storm in the S-W Black sea is characterized by the persistent anticyclonic area to the North of the Black sea and cyclonic conditions in the Southern Black sea region. Such pressure pattern causes persistent and strong eastern or north-eastern wind which
The future for the Global Sea Level Observing System (GLOSS) Sea Level Data Rescue
Bradshaw, Elizabeth; Matthews, Andrew; Rickards, Lesley; Aarup, Thorkild
2016-04-01
Historical sea level data are rare and unrepeatable measurements with a number of applications in climate studies (sea level rise), oceanography (ocean currents, tides, surges), geodesy (national datum), geophysics and geology (coastal land movements) and other disciplines. However, long-term time series are concentrated in the northern hemisphere and there are no records at the Permanent Service for Mean Sea Level (PSMSL) global data bank longer than 100 years in the Arctic, Africa, South America or Antarctica. Data archaeology activities will help fill in the gaps in the global dataset and improve global sea level reconstruction. The Global Sea Level Observing System (GLOSS) is an international programme conducted under the auspices of the WMO-IOC Joint Technical Commission for Oceanography and Marine Meteorology. It was set up in 1985 to collect long-term tide gauge observations and to develop systems and standards "for ocean monitoring and flood warning purposes". At the GLOSS-GE-XIV Meeting in 2015, GLOSS agreed on a number of action items to be developed in the next two years. These were: 1. To explore mareogram digitisation applications, including NUNIEAU (more information available at: http://www.mediterranee.cerema.fr/logiciel-de-numerisation-des-enregistrements-r57.html) and other recent developments in scanning/digitisation software, such as IEDRO's Weather Wizards program, to see if they could be used via a browser. 2. To publicise sea level data archaeology and rescue by: • maintaining and regularly updating the Sea Level Data Archaeology page on the GLOSS website • strengthening links to the GLOSS data centres and data rescue organisations e.g. linking to IEDRO, ACRE, RDA • restarting the sea level data rescue blog with monthly posts. 3. Investigate sources of funding for data archaeology and rescue projects. 4. Propose "Guidelines" for rescuing sea level data. These action items will aid the discovery, scanning, digitising and quality control
Temporal variability in SeaWiFS derived apparent optical properties in European seas
Vantrepotte, V.; Mélin, F.
2010-02-01
The 10-year record of ocean color data provided by the SeaWiFS mission is an important asset for monitoring and research activities conducted on the optically complex European seas. This study makes use of the SeaWiFS data set of normalized water leaving radiances LWN to study the major characteristics of temporal variability associated with optical properties across the entire European domain. Specifically, the time series of LWN and associated band ratios are decomposed into terms representing a fixed seasonal cycle, irregular variations and trends, and the contribution of these components to the total variance is described for the various basins. The diversity of the European waters is fully reflected by the range of results varying with regions and wavelengths. Generally, the Mediterranean and Baltic seas appear as two end-members with, respectively, high and low contributions of the seasonal component to the total variance. The existence of linear trends affecting the satellite products is also explored for each basin. By focusing the analysis on LWN and band ratios, the validity of the results is not limited by the varying levels of uncertainty that characterize derived products such as the concentration of chlorophyll a in optically complex waters. Statistically significant, and in some cases large, trends are detected in the Atlantic Ocean west of the European western shelf, the central North Sea, the English Channel, the Black Sea, the northern Adriatic, and various regions of the Mediterranean Sea and the northern Baltic Sea, revealing changes in the concentrations of optically significant constituents in these regions.
The Influence of Wind and Basin Eddies in Controlling Sea Level Variations in the Coastal Red Sea
Abualnaja, Yasser
2015-04-01
Sea level variations in the central Red Sea coastal zone span a range of roughly 1.2 m. Though relatively small, these water level changes can significantly impact the environment over the shallow reef tops prevalent in the central Red Sea, altering the water depth by a factor or two or more. Roughly half of the coastal sea level variance in central Red Sea is due to elevation changes in an \\'intermediate\\' frequency band, with periods between 2 days and 1 month. We examined the sea level signal in this band using the data from pressure sensors maintained for more than five years at a number of locations in Saudi Arabian coastal waters between 20.1 and 23.5 oN. We find that the intermediate-band sea level variations are strongly correlated with the local wind stress measured at a meteorological buoy. The maximum pressure-wind correlation occurs at wind direction closely aligned with the alongshore orientation and at a lag (wind leading) of 45 hr, which is consistent with the expected response of the coastal sea level to local wind forcing. However, less than half of the sea level variance in the intermediate band is related, through linear correlation, with local wind forcing. Our analysis indicates that the residual coastal sea level signal, not associated with wind forcing, is largely driven remotely by the passage of mesoscale eddies, revealed by satellite altimeter-derived sea level anomaly fields of the central Red Sea. These eddy-driven coastal sea level changes occur on time scales of 10-30 days. They span a range of 0.5 m, and thus constitute an import component of the sea level signal in the coastal Red Sea.
The Influence of Wind and Basin Eddies in Controlling Sea Level Variations in the Coastal Red Sea
Abualnaja, Yasser; Churchill, James H.; Nellayaputhenpeedika, Mohammedali; Limeburner, Richard
2015-01-01
Sea level variations in the central Red Sea coastal zone span a range of roughly 1.2 m. Though relatively small, these water level changes can significantly impact the environment over the shallow reef tops prevalent in the central Red Sea, altering the water depth by a factor or two or more. Roughly half of the coastal sea level variance in central Red Sea is due to elevation changes in an 'intermediate' frequency band, with periods between 2 days and 1 month. We examined the sea level signal in this band using the data from pressure sensors maintained for more than five years at a number of locations in Saudi Arabian coastal waters between 20.1 and 23.5 oN. We find that the intermediate-band sea level variations are strongly correlated with the local wind stress measured at a meteorological buoy. The maximum pressure-wind correlation occurs at wind direction closely aligned with the alongshore orientation and at a lag (wind leading) of 45 hr, which is consistent with the expected response of the coastal sea level to local wind forcing. However, less than half of the sea level variance in the intermediate band is related, through linear correlation, with local wind forcing. Our analysis indicates that the residual coastal sea level signal, not associated with wind forcing, is largely driven remotely by the passage of mesoscale eddies, revealed by satellite altimeter-derived sea level anomaly fields of the central Red Sea. These eddy-driven coastal sea level changes occur on time scales of 10-30 days. They span a range of 0.5 m, and thus constitute an import component of the sea level signal in the coastal Red Sea.
The Red Sea: An Arena for Wind-Wave Modeling in Enclosed Seas
Langodan, Sabique
2016-12-01
Wind and waves play a major role in important ocean dynamical processes, such as the exchange of heat, momentum and gases between atmosphere and ocean, that greatly contributes to the earth climate and marine lives. Knowledge on wind and wave weather and climate is crucial for a wide range of applications, including oceanographic studies, maritime activities and ocean engineering. Despite being one of the important world shipping routes, the wind-wave characteristics in the Red Sea are yet to be fully explored. Because of the scarcity of waves data in the Red Sea, numerical models become crucial and provide very powerful tools to extrapolate wind and wave data in space, and backward and forward in time. Unlike open oceans, enclosed basins wave have different characteristics, mainly because of their local generation processes. The complex orography on both sides of the Red Sea makes the local wind, and consequently wave, modeling very challenging. This thesis considers the modeling of wind-wave characteristics in the Red Sea, including their climate variability and trends using state-of-the-art numerical models and all available observations. Different approaches are investigated to model and understand the general and unusual wind and wave conditions in the basin using standard global meteorological products and customised regional wind and wave models. After studying and identifying the main characteristics of the wind-wave variability in the Red Sea, we demonstrate the importance of generating accurate atmospheric forcing through data assimilation for reliable wave simulations. In particular, we show that the state-of-the-art physical formulation of wave models is not suitable to model the unique situation of the two opposing wind-waves systems in the Red Sea Convergence Zone, and propose and successfully test a modification to the input and white-capping source functions to address this problem. We further investigate the climate variability and trends of wind
Estimating the effective nitrogen import: An example for the North Sea-Baltic Sea boundary
Radtke, H.; Maar, M.
2016-10-01
Semienclosed water bodies such as the Baltic Sea are prone to eutrophication problems. If local nutrient abatement measures are taken to tackle these problems, their success may be limited if a strong nutrient exchange with the adjacent waters exists. The quantification of this exchange is therefore essential to estimate its impact on the ecosystem status. At the example of the Baltic Sea and the North Sea, we illustrate that neither gross transports nor net transports of nutrients have a strong informative value in this context. Instead, we define an "effective import" as the import of nutrients which have not been inside the Baltic Sea before and estimate it in an ecological model with a nutrient-tagging technique. This effective import of bioreactive nitrogen from the Skagerrak to the Kattegat amounts to 103 kt/yr; from Kattegat to Belt Sea it is 54 kt/yr. The nitrogen exchange is therefore 30% stronger than other estimates, e.g., based on import in the deep water, suggest. An isolated view on the Baltic Sea and the North Sea in terms of eutrophication, as it is practiced in management today, is therefore questionable. Nitrogen imported from the North Sea typically spreads eastward up to the Bornholm Basin but can be transported into the deep waters of the Gotland Basin during Major Baltic Inflows in a significant amount.
Davy, S K; Cook, C B
2001-06-01
Symbiotic dinoflagellates (zooxanthellae) typically respond to extracts of host tissue with enhanced release of short-term photosynthetic products. We examined this "host release factor" (HRF) response using freshly isolated zooxanthellae of differing nutritional status. The nutritional status was manipulated by either feeding or starving the sea anemone Aiptasia pallida (Verrill). The release of fixed carbon from isolated zooxanthellae was measured using 14C in 30 min experiments. Zooxanthellae in filtered seawater alone released approximately 5% of photosynthate irrespective of host feeding history. When we used a 10-kDa ultrafiltrate of A. pallida host tissue as a source of HRF, approximately 14% of photosynthate was released to the medium. This increased to over 25% for zooxanthellae from anemones starved for 29 days or more. The cell-specific photosynthetic rate declined with starvation in these filtrate experiments, but the decline was offset by the increased percentage release. Indeed, the total amount of released photosynthate remained unchanged, or even increased, as zooxanthellae became more nutrient deficient. Similar trends were also observed when zooxanthellae from A. pallida were incubated in a 3-kDa ultrafiltrate of the coral Montastraea annularis, suggesting that HRF in the different filtrates operated in a similar manner. Our results support the suggestion that HRF diverts surplus carbon away from storage compounds to translocated compounds such as glycerol.
Daytime sea fog retrieval based on GOCI data: a case study over the Yellow Sea.
Yuan, Yibo; Qiu, Zhongfeng; Sun, Deyong; Wang, Shengqiang; Yue, Xiaoyuan
2016-01-25
In this paper, a new daytime sea fog detection algorithm has been developed by using Geostationary Ocean Color Imager (GOCI) data. Based on spectral analysis, differences in spectral characteristics were found over different underlying surfaces, which include land, sea, middle/high level clouds, stratus clouds and sea fog. Statistical analysis showed that the Rrc (412 nm) (Rayleigh Corrected Reflectance) of sea fog pixels is approximately 0.1-0.6. Similarly, various band combinations could be used to separate different surfaces. Therefore, three indices (SLDI, MCDI and BSI) were set to discern land/sea, middle/high level clouds and fog/stratus clouds, respectively, from which it was generally easy to extract fog pixels. The remote sensing algorithm was verified using coastal sounding data, which demonstrated that the algorithm had the ability to detect sea fog. The algorithm was then used to monitor an 8-hour sea fog event and the results were consistent with observational data from buoys data deployed near the Sheyang coast (121°E, 34°N). The goal of this study was to establish a daytime sea fog detection algorithm based on GOCI data, which shows promise for detecting fog separately from stratus.
The potential role of sea spray droplets in facilitating air-sea gas transfer
Andreas, E. L.; Vlahos, P.; Monahan, E. C.
2016-05-01
For over 30 years, air-sea interaction specialists have been evaluating and parameterizing the role of whitecap bubbles in air-sea gas exchange. To our knowledge, no one, however, has studied the mirror image process of whether sea spray droplets can facilitate air-sea gas exchange. We are therefore using theory, data analysis, and numerical modeling to quantify the role of spray on air-sea gas transfer. In this, our first formal work on this subject, we seek the rate-limiting step in spray-mediated gas transfer by evaluating the three time scales that govern the exchange: τ air , which quantifies the rate of transfer between the atmospheric gas reservoir and the surface of the droplet; τ int , which quantifies the exchange rate across the air-droplet interface; and τ aq , which quantifies gas mixing within the aqueous solution droplet.
2002-01-01
Editor's Note: The caption below, published on May 10, 2001, is incorrect. According to Masha Vorontsova, director of the International Fund for Animal Welfare in Moscow, the situation with the seal pups in the White Sea is normal. There is no disaster and there never was. For more details, refer to the article entitled 'No Danger' on the New Scientist home page. The Earth Observatory regrets the earlier errant report. Original Caption According to the Russian Polar Research Institute for Fisheries and Oceanography, between 250,000 and 300,000 Greenland seal pups face death by starvation over the next two months due to a cruel trick by mother nature. The seals, most of them less than two months old, are trapped on ice sheets that remain locked in the White Sea, located near Archangel in Northern Russia. Typically, during the spring thaw the ice sheets break up and flow with the currents northward into the Barents Sea, the seals' spring feeding grounds. The seal pups hitch a ride on the ice floes, living on their own individual stores of fat until they arrive in the Barents Sea. Their mothers departed for the Barents Sea weeks ago. In a normal year, the seal pups' trip from the White Sea out to the Barents takes about six weeks and the seals have adapted to rely upon this mechanism of mother nature. During their yearly migration, the mother seals usually stay with their pups and feed them until their pelts turn from white to grey--a sign that the pups are mature enough to swim and feed themselves. Unfortunately, this year unusually strong northerly winds created a bottleneck of ice near the mouth of the white sea, thus blocking the flow of ice and trapping the pups. These true-color images of the White Sea were acquired by the Moderate-resolution Imaging Spectroradiometer (MODIS), flying aboard NASA's Terra spacecraft. This image, taken May 2, 2000 that there is usually much less ice in the White Sea this time of year as most of it is typically en route to the
Arrigo, Kevin R.
2014-01-01
Polar sea ice is one of the largest ecosystems on Earth. The liquid brine fraction of the ice matrix is home to a diverse array of organisms, ranging from tiny archaea to larger fish and invertebrates. These organisms can tolerate high brine salinity and low temperature but do best when conditions are milder. Thriving ice algal communities, generally dominated by diatoms, live at the ice/water interface and in recently flooded surface and interior layers, especially during spring, when temperatures begin to rise. Although protists dominate the sea ice biomass, heterotrophic bacteria are also abundant. The sea ice ecosystem provides food for a host of animals, with crustaceans being the most conspicuous. Uneaten organic matter from the ice sinks through the water column and feeds benthic ecosystems. As sea ice extent declines, ice algae likely contribute a shrinking fraction of the total amount of organic matter produced in polar waters.
The SeaDAS Processing and Analysis System: SeaWiFS, MODIS, and Beyond
MacDonald, M. D.; Ruebens, M.; Wang, L.; Franz, B. A.
2005-12-01
The SeaWiFS Data Analysis System (SeaDAS) is a comprehensive software package for the processing, display, and analysis of ocean data from a variety of satellite sensors. Continuous development and user support by programmers and scientists for more than a decade has helped to make SeaDAS the most widely used software package in the world for ocean color applications, with a growing base of users from the land and sea surface temperature community. Full processing support for past (CZCS, OCTS, MOS) and present (SeaWiFS, MODIS) sensors, and anticipated support for future missions such as NPP/VIIRS, enables end users to reproduce the standard ocean archive product suite distributed by NASA's Ocean Biology Processing Group (OBPG), as well as a variety of evaluation and intermediate ocean, land, and atmospheric products. Availability of the processing algorithm source codes and a software build environment also provide users with the tools to implement custom algorithms. Recent SeaDAS enhancements include synchronization of MODIS processing with the latest code and calibration updates from the MODIS Calibration Support Team (MCST), support for all levels of MODIS processing including Direct Broadcast, a port to the Macintosh OS X operating system, release of the display/analysis-only SeaDAS-Lite, and an extremely active web-based user support forum.
Directory of Open Access Journals (Sweden)
Marco Olivieri
2016-07-01
Full Text Available Exploiting the Delaunay interpolation, we present a newly implemented 2-D sea-level reconstruction from coastal sea-level observations to open seas, with the aim of characterizing the spatial variability of the rate of sea-level change. To test the strengths and weaknesses of this method and to determine its usefulness in sea-level interpolation, we consider the case studies of the Baltic Sea and of the Pacific Ocean. In the Baltic Sea, a small basin well sampled by tide gauges, our reconstructions are successfully compared with absolute sea-level observations from altimetry during 1993-2011. The regional variability of absolute sea level observed across the Pacific Ocean, however, cannot be reproduced. We interpret this result as the effect of the uneven and sparse tide gauge data set and of the composite vertical land movements in and around the region. Useful considerations arise that can serve as a basis for developing sophisticated approaches.
NOAA NDBC SOS, 2008-present, sea_floor_depth_below_sea_surface
National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA NDBC SOS server is part of the IOOS DIF SOS Project. The stations in this dataset have sea_floor_depth_below_sea_surface data. Because of the nature of SOS...
Increased Land Use by Chukchi Sea Polar Bears in Relation to Changing Sea Ice Conditions.
Directory of Open Access Journals (Sweden)
Karyn D Rode
Full Text Available Recent observations suggest that polar bears (Ursus maritimus are increasingly using land habitats in some parts of their range, where they have minimal access to their preferred prey, likely in response to loss of their sea ice habitat associated with climatic warming. We used location data from female polar bears fit with satellite radio collars to compare land use patterns in the Chukchi Sea between two periods (1986-1995 and 2008-2013 when substantial summer sea-ice loss occurred. In both time periods, polar bears predominantly occupied sea-ice, although land was used during the summer sea-ice retreat and during the winter for maternal denning. However, the proportion of bears on land for > 7 days between August and October increased between the two periods from 20.0% to 38.9%, and the average duration on land increased by 30 days. The majority of bears that used land in the summer and for denning came to Wrangel and Herald Islands (Russia, highlighting the importance of these northernmost land habitats to Chukchi Sea polar bears. Where bears summered and denned, and how long they spent there, was related to the timing and duration of sea ice retreat. Our results are consistent with other studies supporting increased land use as a common response of polar bears to sea-ice loss. Implications of increased land use for Chukchi Sea polar bears are unclear, because a recent study observed no change in body condition or reproductive indices between the two periods considered here. This result suggests that the ecology of this region may provide a degree of resilience to sea ice loss. However, projections of continued sea ice loss suggest that polar bears in the Chukchi Sea and other parts of the Arctic may increasingly use land habitats in the future, which has the potential to increase nutritional stress and human-polar bear interactions.
Biogeochemical Cycling and Sea Ice Dynamics in the Bering Sea across the Mid-Pleistocene Transition
Detlef, H.; Sosdian, S. M.; Belt, S. T.; Smik, L.; Lear, C. H.; Hall, I. R.; Kender, S.; Leng, M. J.; Husum, K.; Cabedo-Sanz, P.
2017-12-01
Today the Bering Sea is characterized by high primary productivity (PP) along the eastern shelf, maintained by CO2 and nutrient rich upwelled deep waters and nutrient release during spring sea ice melting. As such, low oxygen concentrations are pervasive in mid-depth waters. Changes in ventilation and export productivity in the past have been shown to impact this oxygen minimum zone. On glacial/interglacial (G/IG) timescales sea ice formation plays a pivotal role on intermediate water ventilation with evidence pointing to the formation of North Pacific Intermediate Water (NPIW) in the Bering Sea during Pleistocene glacial intervals. In addition, sea ice plays a significant role in both long- and short-term climate change via associated feedback mechanisms. Thus, records of sea ice dynamics and biogeochemical cycling in the Bering Sea are necessary to fully understand the interaction between PP, circulation patterns, and past G/IG climates with potential implications for the North Pacific carbon cycle. Here we use a multi-proxy approach to study sea ice dynamics and bottom water oxygenation, across three intervals prior to, across, and after the Mid-Pleistocene Transition (MPT, 1.2-0.7 Ma) from International Ocean Discovery Program Site U1343. The MPT, most likely driven by internal climate mechanisms, is ideal to study changes in sea ice dynamics and sedimentary redox conditions on orbital timescales and to investigate the implications for associated feedback mechanisms. The sea ice record, based on various biomarkers, including IP25, shows substantial increase in sea ice extent across the MPT and the occurrence of a late-glacial/deglacial sea ice spike, with consequences for glacial NPIW formation and land glacier retreat via the temperature-precipitation feedback. U/Mn of foraminiferal authigenic coatings, a novel proxy for bottom water oxygenation, also shows distinct variability on G/IG timescales across the MPT, most likely a result of PP and water mass
Markaki, Foteini
2017-04-01
My school (1o EPAL Ymittos -Athens, Greece) is a technical school of secondary education and throughout this school year being drafted a program of environmental education. The main theme is the Mediterranean Sea, the biggest closed sea extending between three continents. Topics studied: 1. Biodiversity and the risks threat. 2. The geophysics that characterize (earthquakes, volcanoes explosions, etc). 3. The Mediterranean Sea as environment anthropogenesis, a mosaic of other cultures and even place current notions of social phenomena (refugees). Pedagogical Objectives: Cognitive/Enviromental: 1. To investigate and understand the biodiversity of the Mediterranean Sea and the risks to threaten and phenomena that characterize. 2. To understand the position of the Mediterranean Sea in the land and the role of the historical, cultural and social human environment. 3. To come in contact with texts literary, social, articles on the Mediterranean. Psychomotor: 1. To work together and collect information for the Mediterranean Sea. 2. Experiential approach to the natural environment. 3. Develop critical thinking. 4. Undertake responsibilities for the presentation of the program. Emotional: 1. To feel joy from participation in the program. 2. Being sensitized and configure attitudes and actions of respect towards the environment. Methodology implementation: Teamwork. Interdisciplinary - holistic to dissemination of program recordings to courses curriculum. Study in the field. Gathering information from newspapers, magazines, internet, maps, and photographs. Experiential method- Project. Assessment methods and self-assessment. Fields of courses: Greek language- History- Biology- Chemistry- Technology Dissemination of results: Make a page of social media (facebook), a blog, enhancing environmental awareness via video, make an electronic poster.
A Newly Recorded Sea Cucumber (Holothuroidea: Aspidochirotida: Synallactidae from East Sea, Korea
Directory of Open Access Journals (Sweden)
Lee, Taekjun
2014-04-01
Full Text Available Five sea cucumbers were collected from Gisamun and Gonghyeonjin of Gangwon-do, in the East Sea, Korea from 27 December 2009 to 14 November 2012. These specimens were classified as Synallactes nozawai Mitsukuri, 1912 belonging to the family Synallactidae of order Aspidochirotida based on morphological characteristics. The family, genus and species are recorded for the first time from Korea. The distinct morphological characteristics of this species are as follows: body flexible, with thin gelatinous body wall; presence of numerous tubercles along dorsal ambulacra table of body wall consisted of three- or four-armed disk and a spire-form pillar. This species usually inhabits the deep sea and is distributed in the Northwest Pacific from northern Japan to Bering Sea.
2006-01-01
The Dead Sea is the lowest point on Earth at 418 meters below sea level, and also one of the saltiest bodies of water on Earth with a salinity of about 300 parts-per-thousand (nine times greater than ocean salinity). It is located on the border between Jordan and Israel, and is fed by the Jordan River. The Dead Sea is located in the Dead Sea Rift, formed as a result of the Arabian tectonic plate moving northward away from the African Plate. The mineral content of the Dead Sea is significantly different from that of ocean water, consisting of approximately 53% magnesium chloride, 37% potassium chloride and 8% sodium chloride. In the early part of the 20th century, the Dead Sea began to attract interest from chemists who deduced that the Sea was a natural deposit of potash and bromine. From the Dead Sea brine, Israel and Jordan produce 3.8 million tons potash, 200,000 tons elemental bromine, 45,000 tons caustic soda, 25, 000 tons magnesium metal, and sodium chloride. Both countries use extensive salt evaporation pans that have essentially diked the entire southern end of the Dead Sea. With its 14 spectral bands from the visible to the thermal infrared wavelength region, and its high spatial resolution of 15 to 90 meters (about 50 to 300 feet), ASTER images Earth to map and monitor the changing surface of our planet. ASTER is one of five Earth-observing instruments launched December 18, 1999, on NASA's Terra satellite. The instrument was built by Japan's Ministry of Economy, Trade and Industry. A joint U.S./Japan science team is responsible for validation and calibration of the instrument and the data products. The broad spectral coverage and high spectral resolution of ASTER provides scientists in numerous disciplines with critical information for surface mapping, and monitoring of dynamic conditions and temporal change. Example applications are: monitoring glacial advances and retreats; monitoring potentially active volcanoes; identifying crop stress; determining
Autonomous Sea-Ice Thickness Survey
2016-06-01
the conductivity of an infinitely thick slab of sea ice. Ice thickness, Hice, is then obtained by subtracting the height of the ...Thickness Survey of Sea Ice Runway” ERDC/CRREL SR-16-4 ii Abstract We conducted an autonomous survey of sea -ice thickness using the Polar rover Yeti...efficiency relative to manual surveys routinely con- ducted to assess the safety of roads and runways constructed on the sea ice. Yeti executed the
New Tools for Sea Ice Data Analysis and Visualization: NSIDC's Arctic Sea Ice News and Analysis
Vizcarra, N.; Stroeve, J.; Beam, K.; Beitler, J.; Brandt, M.; Kovarik, J.; Savoie, M. H.; Skaug, M.; Stafford, T.
2017-12-01
Arctic sea ice has long been recognized as a sensitive climate indicator and has undergone a dramatic decline over the past thirty years. Antarctic sea ice continues to be an intriguing and active field of research. The National Snow and Ice Data Center's Arctic Sea Ice News & Analysis (ASINA) offers researchers and the public a transparent view of sea ice data and analysis. We have released a new set of tools for sea ice analysis and visualization. In addition to Charctic, our interactive sea ice extent graph, the new Sea Ice Data and Analysis Tools page provides access to Arctic and Antarctic sea ice data organized in seven different data workbooks, updated daily or monthly. An interactive tool lets scientists, or the public, quickly compare changes in ice extent and location. Another tool allows users to map trends, anomalies, and means for user-defined time periods. Animations of September Arctic and Antarctic monthly average sea ice extent and concentration may also be accessed from this page. Our tools help the NSIDC scientists monitor and understand sea ice conditions in near real time. They also allow the public to easily interact with and explore sea ice data. Technical innovations in our data center helped NSIDC quickly build these tools and more easily maintain them. The tools were made publicly accessible to meet the desire from the public and members of the media to access the numbers and calculations that power our visualizations and analysis. This poster explores these tools and how other researchers, the media, and the general public are using them.
Antarctic sea ice increase consistent with intrinsic variability of the Amundsen Sea Low
Turner, John; Hosking, J. Scott; Marshall, Gareth J.; Phillips, Tony; Bracegirdle, Thomas J.
2016-04-01
We investigate the relationship between atmospheric circulation variability and the recent trends in Antarctic sea ice extent (SIE) using Coupled Model Intercomparison Project Phase 5 (CMIP5) atmospheric data, ECMWF Interim reanalysis fields and passive microwave satellite data processed with the Bootstrap version 2 algorithm. Over 1979-2013 the annual mean total Antarctic SIE increased at a rate of 195 × 103 km2 dec-1 (1.6 % dec-1), p 4.0 % dec-1) has been in the Ross Sea sector. Off West Antarctica there is a high correlation between trends in SIE and trends in the near-surface winds. The Ross Sea SIE seasonal trends are positive throughout the year, but largest in spring. The stronger meridional flow over the Ross Sea has been driven by a deepening of the Amundsen Sea Low (ASL). Pre-industrial control and historical simulations from CMIP5 indicate that the observed deepening of the ASL and stronger southerly flow over the Ross Sea are within the bounds of modeled intrinsic variability. The spring trend would need to continue for another 11 years for it to fall outside the 2 standard deviation range seen in 90 % of the simulations.
Ho-Hagemann, Ha Thi Minh; Gröger, Matthias; Rockel, Burkhardt; Zahn, Matthias; Geyer, Beate; Meier, H. E. Markus
2017-12-01
This study introduces a new approach to investigate the potential effects of air-sea coupling on simulated precipitation inland over Central Europe. We present an inter-comparison of two regional climate models (RCMs), namely, the COSMO-CLM (hereafter CCLM) and RCA4 models, which are configured for the EURO-CORDEX domain in the coupled and atmosphere-only modes. Two versions of the CCLM model, namely, 4.8 and 5.0, join the inter-comparison being almost two different models while providing pronouncedly different summer precipitation simulations because of many changes in the dynamics and physics of CCLM in version 5.0. The coupling effect on the prominent summer dry bias over Central Europe is analysed using seasonal (JJA) mean statistics for the 30-year period from 1979 to 2009, with a focus on extreme precipitation under specific weather regimes. The weather regimes are compared between the coupled and uncoupled simulations to better understand the mechanism of the coupling effects. The comparisons of the coupled systems with the atmosphere-only models show that coupling clearly reduces the dry bias over Central Europe for CCLM 4.8, which has a large dry summer bias, but not for CCLM 5.0 and RCA4, which have smaller dry biases. This result implies that if the atmosphere-only model already yields reasonable summer precipitation over Central Europe, not much room for improvement exists that can be caused by the air-sea coupling over the North Sea and the Baltic Sea. However, if the atmosphere-only model shows a pronounced summer dry bias because of a lack of moisture transport from the seas into the region, the considered coupling may create an improved simulation of summer precipitation over Central Europe, such as for CCLM 4.8. For the latter, the benefit of coupling varies over the considered timescales. The precipitation simulations that are generated by the coupled system COSTRICE 4.8 and the atmosphere-only CCLM 4.8 are mostly identical for the summer mean
International Nuclear Information System (INIS)
Wu, Dong; Lu, Bo; Zhang, Tianche; Yan, Fengqi
2015-01-01
A method to detect sea fogs from the measurement data acquired by the Cloud-Aerosol Lidar with Orthogonal Polarization (CALIOP) aboard the Cloud-Aerosol Lidar and Infrared Pathfinder Satellite Observation (CALIPSO) satellite is proposed in this paper. Because of the unique capability of vertical-resolved measurements, sea fogs and low clouds can be more easily distinguished in the CALIOP data compared with passive satellite measurements. Yellow Sea where sea fogs occur frequently is selected to test the method. Nine cases of daytime sea fog events from 2008 to 2011 in the Yellow Sea are studied intensively to characterize the remotely sensed radiation properties of various targets, such as clear-sky sea surface, sea fog, low cloud and high cloud. These fog cases are then used in an attempt to evaluate sea fogs identified from the MODIS measurements. The method proposed in this paper can also be used for nighttime cases. Multi-year sea fog dataset can be made from the CALIOP measurement and used to validate the MODIS sea fog detection. - Highlights: • A method of sea fog detection from the CALIOP measurements is proposed. • CALIOP VFM and 532-nm attenuated backscatter products are integrated used. • Sea fogs and low clouds can be more easily distinguished in the CALIOP data. • 9 Cases of daytime sea fog events in the Yellow Sea are selected to test the method. • The MODIS sea fog detections are evaluated using the collocated CALIOP data
2002-01-01
CERN's anemones will soon be orphans. We are looking for someone willing to look after the aquarium in the main building, for one year. If you are interested, or if you would like more information, please call 73830. (The anemones living in the aquarium thank you in anticipation.)
Mass-induced [|#8#|]Sea Level Variations in the Red Sea from Satellite Altimetry and GRACE
Feng, W.; Lemoine, J.; Zhong, M.; Hsu, H.
2011-12-01
We have analyzed mass-induced sea level variations (SLVs) in the Red Sea from steric-corrected altimetry and GRACE between January 2003 and December 2010. The steric component of SLVs in the Red Sea calculated from climatological temperature and salinity data is relatively small and anti-phase with the mass-induced SLV. The total SLV in the Red Sea is mainly driven by the mass-induced SLV, which increases in winter when the Red Sea gains the water mass from the Gulf of Aden and vice versa in summer. Spatial and temporal patterns of mass-induced SLVs in the Red Sea from steric-corrected altimetry agree very well with GRACE observations. Both of two independent observations show high annual amplitude in the central Red Sea (>20cm). Total mass-induced SLVs in the Red Sea from two independent observations have similar annual amplitude and phase. One main purpose of our work is to see whether GRGS's ten-day GRACE results can observe intra-seasonal mass change in the Red Sea. The wavelet coherence analysis indicates that GRGS's results show the high correlation with the steric-corrected SLVs on intra-seasonal time scale. The agreement is excellent for all the time-span until 1/3 year period and is patchy between 1/3 and 1/16 year period. Furthermore, water flux estimates from current-meter arrays and moorings show mass gain in winter and mass loss in summer, which is also consistent with altimetry and GRACE.
Seasonal regional forecast of the minimum sea ice extent in the LapteV Sea
Tremblay, B.; Brunette, C.; Newton, R.
2017-12-01
Late winter anomaly of sea ice export from the peripheral seas of the Atctic Ocean was found to be a useful predictor for the minimum sea ice extent (SIE) in the Arctic Ocean (Williams et al., 2017). In the following, we present a proof of concept for a regional seasonal forecast of the min SIE for the Laptev Sea based on late winter coastal divergence quantified using a Lagrangian Ice Tracking System (LITS) forced with satellite derived sea-ice drifts from the Polar Pathfinder. Following Nikolaeva and Sesterikov (1970), we track an imaginary line just offshore of coastal polynyas in the Laptev Sea from December of the previous year to May 1 of the following year using LITS. Results show that coastal divergence in the Laptev Sea between February 1st and May 1st is best correlated (r = -0.61) with the following September minimum SIE in accord with previous results from Krumpen et al. (2013, for the Laptev Sea) and Williams et a. (2017, for the pan-Arctic). This gives a maximum seasonal predictability of Laptev Sea min SIE anomalies from observations of approximately 40%. Coastal ice divergence leads to formation of thinner ice that melts earlier in early summer, hence creating areas of open water that have a lower albedo and trigger an ice-albedo feedback. In the Laptev Sea, we find that anomalies of coastal divergence in late winter are amplified threefold to result in the September SIE. We also find a correlation coefficient r = 0.49 between February-March-April (FMA) anomalies of coastal divergence with the FMA averaged AO index. Interestingly, the correlation is stronger, r = 0.61, when comparing the FMA coastal divergence anomalies to the DJFMA averaged AO index. It is hypothesized that the AO index at the beginning of the winter (and the associated anomalous sea ice export) also contains information that impact the magnitude of coastal divergence opening later in the winter. Our approach differs from previous approaches (e.g. Krumpen et al and Williams et al
Response of Antarctic sea surface temperature and sea ice to ozone depletion
Ferreira, D.; Gnanadesikan, A.; Kostov, Y.; Marshall, J.; Seviour, W.; Waugh, D.
2017-12-01
The influence of the Antarctic ozone hole extends all the way from the stratosphere through the troposphere down to the surface, with clear signatures on surface winds, and SST during summer. In this talk we discuss the impact of these changes on the ocean circulation and sea ice state. We are notably motivated by the observed cooling of the surface Southern Ocean and associated increase in Antarctic sea ice extent since the 1970s. These trends are not reproduced by CMIP5 climate models, and the underlying mechanism at work in nature and the models remain unexplained. Did the ozone hole contribute to the observed trends?Here, we review recent advances toward answering these issues using "abrupt ozone depletion" experiments. The ocean and sea ice response is rather complex, comprising two timescales: a fast ( 1-2y) cooling of the surface ocean and sea ice cover increase, followed by a slower warming trend, which, depending on models, flip the sign of the SST and sea ice responses on decadal timescale. Although the basic mechanism seems robust, comparison across climate models reveal large uncertainties in the timescales and amplitude of the response to the extent that even the sign of the ocean and sea ice response to ozone hole and recovery remains unconstrained. After briefly describing the dynamics and thermodynamics behind the two-timescale response, we will discuss the main sources of uncertainties in the modeled response, namely cloud effects and air-sea heat exchanges, surface wind stress response and ocean eddy transports. Finally, we will consider the implications of our results on the ability of coupled climate models to reproduce observed Southern Ocean changes.
Diverse deep-sea fungi from the South China Sea and their antimicrobial activity.
Zhang, Xiao-Yong; Zhang, Yun; Xu, Xin-Ya; Qi, Shu-Hua
2013-11-01
We investigated the diversity of fungal communities in nine different deep-sea sediment samples of the South China Sea by culture-dependent methods followed by analysis of fungal internal transcribed spacer (ITS) sequences. Although 14 out of 27 identified species were reported in a previous study, 13 species were isolated from sediments of deep-sea environments for the first report. Moreover, these ITS sequences of six isolates shared 84-92 % similarity with their closest matches in GenBank, which suggested that they might be novel phylotypes of genera Ajellomyces, Podosordaria, Torula, and Xylaria. The antimicrobial activities of these fungal isolates were explored using a double-layer technique. A relatively high proportion (56 %) of fungal isolates exhibited antimicrobial activity against at least one pathogenic bacterium or fungus among four marine pathogenic microbes (Micrococcus luteus, Pseudoaltermonas piscida, Aspergerillus versicolor, and A. sydowii). Out of these antimicrobial fungi, the genera Arthrinium, Aspergillus, and Penicillium exhibited antibacterial and antifungal activities, while genus Aureobasidium displayed only antibacterial activity, and genera Acremonium, Cladosporium, Geomyces, and Phaeosphaeriopsis displayed only antifungal activity. To our knowledge, this is the first report to investigate the diversity and antimicrobial activity of culturable deep-sea-derived fungi in the South China Sea. These results suggest that diverse deep-sea fungi from the South China Sea are a potential source for antibiotics' discovery and further increase the pool of fungi available for natural bioactive product screening.
Fairbanks, R. G.; Mortlock, R. A.; Abdul, N. A.; Wright, J. D.; Cao, L.; Mey, J. L.
2013-12-01
Additional offshore drill cores, nearly 100 new radiometric dates, and more than 1000 kilometers of Multibeam mapping greatly enhance the Barbados Sea Level record. Extensive Multibeam mapping around the entire island covers approximately 2650 km2 of the sea bottom and now integrates the offshore reef topography and Barbados Sea Level Record with the unparalleled onshore core collection, digital elevation maps, and Pleistocene sea level record spanning the past one million years. The reef crest coral, Acropora palmata, remains the stalwart indicator of sea level for many reasons that are validated by our redundant sea level records and redundant dating via Th/U and Pa/U analyses. Microanalysis and densitometry studies better explain why Acropora palmata is so well preserved in the Pleistocene reef records and therefore why it is the species of choice for sea level reconstructions and radiometric dating. New drill cores into reefs that formed during Marine Isotope Stage 3 lead us to a model of diagenesis that allows us to better prospect for unaltered coral samples in older reefs that may be suitable for Th/U dating. Equally important, our diagenesis model reinforces our rigorous sample quality criteria in a more quantitative manner. The Barbados Sea Level record has a sampling resolution of better than 100 years throughout much of the last deglaciation showing unprecedented detail in redundant drill cores. The Melt Water Pulses (MWP1A and MWP1B) are well resolved and the intervening interval that includes the Younger Dryas reveals sea level changes in new detail that are consistent with the terrestrial records of ice margins (see Abdul et al., this section). More than 100 paired Th/U and radiocarbon ages place the Barbados Sea Level Record unambiguously on the radiocarbon time scale for direct comparisons with the terrestrial records of ice margin changes.
Calibration of sea ice dynamic parameters in an ocean-sea ice model using an ensemble Kalman filter
Massonnet, F.; Goosse, H.; Fichefet, T.; Counillon, F.
2014-07-01
The choice of parameter values is crucial in the course of sea ice model development, since parameters largely affect the modeled mean sea ice state. Manual tuning of parameters will soon become impractical, as sea ice models will likely include more parameters to calibrate, leading to an exponential increase of the number of possible combinations to test. Objective and automatic methods for parameter calibration are thus progressively called on to replace the traditional heuristic, "trial-and-error" recipes. Here a method for calibration of parameters based on the ensemble Kalman filter is implemented, tested and validated in the ocean-sea ice model NEMO-LIM3. Three dynamic parameters are calibrated: the ice strength parameter P*, the ocean-sea ice drag parameter Cw, and the atmosphere-sea ice drag parameter Ca. In twin, perfect-model experiments, the default parameter values are retrieved within 1 year of simulation. Using 2007-2012 real sea ice drift data, the calibration of the ice strength parameter P* and the oceanic drag parameter Cw improves clearly the Arctic sea ice drift properties. It is found that the estimation of the atmospheric drag Ca is not necessary if P* and Cw are already estimated. The large reduction in the sea ice speed bias with calibrated parameters comes with a slight overestimation of the winter sea ice areal export through Fram Strait and a slight improvement in the sea ice thickness distribution. Overall, the estimation of parameters with the ensemble Kalman filter represents an encouraging alternative to manual tuning for ocean-sea ice models.
Cazenave, Anny; Llovel, William
2010-01-01
Measuring sea level change and understanding its causes has considerably improved in the recent years, essentially because new in situ and remote sensing observations have become available. Here we report on most recent results on contemporary sea level rise. We first present sea level observations from tide gauges over the twentieth century and from satellite altimetry since the early 1990s. We next discuss the most recent progress made in quantifying the processes causing sea level change on timescales ranging from years to decades, i.e., thermal expansion of the oceans, land ice mass loss, and land water-storage change. We show that for the 1993-2007 time span, the sum of climate-related contributions (2.85 +/- 0.35 mm year(-1)) is only slightly less than altimetry-based sea level rise (3.3 +/- 0.4 mm year(-1)): approximately 30% of the observed rate of rise is due to ocean thermal expansion and approximately 55% results from land ice melt. Recent acceleration in glacier melting and ice mass loss from the ice sheets increases the latter contribution up to 80% for the past five years. We also review the main causes of regional variability in sea level trends: The dominant contribution results from nonuniform changes in ocean thermal expansion.
Directory of Open Access Journals (Sweden)
J. Olafsson
2010-03-01
Full Text Available This paper describes the ways and means of assembling and quality controling the Irminger Sea and Iceland Sea time-series biogeochemical data which are included in the CARINA data set. The Irminger Sea and the Iceland Sea are hydrographically different regions where measurements of sea water carbon and nutrient chemistry were started in 1983. The sampling is seasonal, four times a year. The carbon chemistry is studied with measurements of the partial pressure of carbon dioxide in seawater, pCO2, and total dissolved inorganic carbon, TCO2. The carbon chemistry data are for surface waters only until 1991 when water column sampling was initiated. Other measured parameters are salinity, dissolved oxygen and the inorganic nutrients nitrate, phosphate and silicate. Because of the CARINA criteria for secondary quality control, depth >1500 m, the IRM-TS could not be included in the routine QC and the IS-TS only in a limited way. However, with the information provided here, the quality of the data can be assessed, e.g. on the basis of the results obtained with the use of reference materials.
Operational SAR-based sea ice drift monitoring over the Baltic Sea
Directory of Open Access Journals (Sweden)
J. Karvonen
2012-07-01
Full Text Available An algorithm for computing ice drift from pairs of synthetic aperture radar (SAR images covering a common area has been developed at FMI. The algorithm has been developed based on the C-band SAR data over the Baltic Sea. It is based on phase correlation in two scales (coarse and fine with some additional constraints. The algorithm has been running operationally in the Baltic Sea from the beginning of 2011, using Radarsat-1 ScanSAR wide mode and Envisat ASAR wide swath mode data. The resulting ice drift fields are publicly available as part of the MyOcean EC project. The SAR-based ice drift vectors have been compared to the drift vectors from drifter buoys in the Baltic Sea during the first operational season, and also these validation results are shown in this paper. Also some navigationally useful sea ice quantities, which can be derived from ice drift vector fields, are presented.
Estimation of directional sea wave spectra from radar images. A Mediterranean Sea case study
International Nuclear Information System (INIS)
Corsini, G.; Grasso, R.; Manara, G.; Monorchio, A.
2001-01-01
An inversion technique for estimating sea wave directional spectra from Synthetic Aperture Radar (SAR) images is applied to a set of ERS-1 data relevant to selected Mediterranean areas. The approach followed is based on the analytical definition of the transform which maps the sea wave spectrum onto the corresponding SAR image spectrum. The solution of the inverse problem is determined through a numerical procedure which minimises a proper functional. A suitable iterative scheme is adopted, involving the use of the above transform. Although widely applied to the ocean case, the method has not been yet extensively tested widely applied to the ocean case, the method has not been yet extensively tested in smaller scale basins, as for instance the Mediterranean sea. The results obtained demonstrate the effectiveness of the numerical procedure discussed for retrieving the sea wave spectrum from SAR images. This work provides new experimental data relevant to the Mediterranean Sea, discusses the results obtained by the above inversion technique and compares them with buoy derived sea truth measurements
LePage, Véronique; Dutton, Christopher J; Kummrow, Maya; McLelland, David J; Young, Karrie; Lumsden, John S
2012-03-01
Syngnathidae is the family of fish that includes sea horses, pipefish, and sea dragons. To date, only a single publication has described neoplasia in syngnathids, a fibrosarcoma of the brood pouch in an aquarium-reared lined sea horse (Hippocampus erectus). From 1998 until 2010, the Toronto Zoo submitted 172 syngnathids for postmortem; species included the spotted or yellow sea horse (Hippocampus kuda), the pot-bellied sea horse (Hippocampus abdominalis) and the weedy sea dragon (Phyllopteryx taeniolatus). Seven neoplasms and two neoplastic-like lesions were identified from these cases. Under light microscopy, the neoplasms had morphological characteristics of a cardiac rhabdomyosarcoma, renal adenocarcinoma, renal adenoma, renal round cell tumors, which were likely lymphomas, exocrine pancreatic carcinoma, and intestinal carcinoma. Of these neoplasms, four had clear evidence of metastasis: the pancreatic and intestinal carcinomas and both round cell tumors. As syngnathids are highly fastidious animals, they can be difficult to maintain in captivity. In order to improve their husbandry, preventative and palliative care, as well as treatment, it is important to investigate and document the types of diseases affecting syngnathids.
Takei, Y.
2008-01-01
The present study examines the legal regime of high seas fisheries with a view to identifying regulatory gaps. The main research questions are as follows: 1. What general principles are applicable to high seas fisheries?; 2. What implications do these general principles have for new challenges in
Lopes, Rosaly
2013-01-01
In the early days of planetary observation, oceans were thought to exist in all corners of the Solar System. Carbonated seas percolated beneath the clouds of Venus. Features on the Moon's surface were given names such as "the Bay of Rainbows” and the "Ocean of Storms." With the advent of modern telescopes and spacecraft exploration these ancient concepts of planetary seas have been replaced by the reality of something even more exotic. Alien Seas serves up the current research, past beliefs, and new theories to offer a rich array of the "seas" on other worlds. It is organized by location and by the material composing the oceans under discussion, with expert authors penning chapters on their specialty. Each chapter features new original art depicting alien seas, as well as the latest ground-based and spacecraft images. With the contributors as guides, readers can explore the wild seas of Jupiter's watery satellite Europa, believed similar in composition to battery acid. Saturn's planet-sized moon Titan see...
Atmospheric Forcing of the Winter Air–Sea Heat Fluxes over the Northern Red Sea
Papadopoulos, Vassilis P.; Abualnaja, Yasser; Josey, Simon A.; Bower, Amy; Raitsos, Dionysios E.; Kontoyiannis, Harilaos; Hoteit, Ibrahim
2013-01-01
The influence of the atmospheric circulation on the winter air–sea heat fluxes over the northern Red Sea is investigated during the period 1985–2011. The analysis based on daily heat flux values reveals that most of the net surface heat exchange variability depends on the behavior of the turbulent components of the surface flux (the sum of the latent and sensible heat). The large-scale composite sea level pressure (SLP) maps corresponding to turbulent flux minima and maxima show distinct atmospheric circulation patterns associated with each case. In general, extreme heat loss (with turbulent flux lower than −400 W m−2) over the northern Red Sea is observed when anticyclonic conditions prevail over an area extending from the Mediterranean Sea to eastern Asia along with a recession of the equatorial African lows system. Subcenters of high pressure associated with this pattern generate the required steep SLP gradient that enhances the wind magnitude and transfers cold and dry air masses from higher latitudes. Conversely, turbulent flux maxima (heat loss minimization with values from −100 to −50 W m−2) are associated with prevailing low pressures over the eastern Mediterranean and an extended equatorial African low that reaches the southern part of the Red Sea. In this case, a smooth SLP field over the northern Red Sea results in weak winds over the area that in turn reduce the surface heat loss. At the same time, southerlies blowing along the main axis of the Red Sea transfer warm and humid air northward, favoring heat flux maxima.
Atmospheric Forcing of the Winter Air–Sea Heat Fluxes over the Northern Red Sea
Papadopoulos, Vassilis P.
2013-03-01
The influence of the atmospheric circulation on the winter air–sea heat fluxes over the northern Red Sea is investigated during the period 1985–2011. The analysis based on daily heat flux values reveals that most of the net surface heat exchange variability depends on the behavior of the turbulent components of the surface flux (the sum of the latent and sensible heat). The large-scale composite sea level pressure (SLP) maps corresponding to turbulent flux minima and maxima show distinct atmospheric circulation patterns associated with each case. In general, extreme heat loss (with turbulent flux lower than −400 W m−2) over the northern Red Sea is observed when anticyclonic conditions prevail over an area extending from the Mediterranean Sea to eastern Asia along with a recession of the equatorial African lows system. Subcenters of high pressure associated with this pattern generate the required steep SLP gradient that enhances the wind magnitude and transfers cold and dry air masses from higher latitudes. Conversely, turbulent flux maxima (heat loss minimization with values from −100 to −50 W m−2) are associated with prevailing low pressures over the eastern Mediterranean and an extended equatorial African low that reaches the southern part of the Red Sea. In this case, a smooth SLP field over the northern Red Sea results in weak winds over the area that in turn reduce the surface heat loss. At the same time, southerlies blowing along the main axis of the Red Sea transfer warm and humid air northward, favoring heat flux maxima.
Macdonald, Kenneth C.
Forty-foot, storm-swept seas, Spitzbergen polar bears roaming vast expanses of Arctic ice, furtive exchanges of forbidden manuscripts in Cold War Moscow, the New York city fashion scene, diving in mini-subs to the sea floor hot srings, life with the astronauts, romance and heartbreak, and invading the last bastions of male exclusivity: all are present in this fast-moving, non-fiction account of one woman' fascinating adventures in the world of marine geology and oceanography.
Impacts of Climate Modes on Air–Sea Heat Exchange in the Red Sea
Abualnaja, Yasser
2015-04-01
The impacts of various climate modes on the Red Sea surface heat exchange are investigated using the MERRA reanalysis and the OAFlux satellite reanalysis datasets. Seasonality in the atmospheric forcing is also explored. Mode impacts peak during boreal winter [December–February (DJF)] with average anomalies of 12–18 W m−2 to be found in the northern Red Sea. The North Atlantic Oscillation (NAO), the east Atlantic–west Russia (EAWR) pattern, and the Indian monsoon index (IMI) exhibit the strongest influence on the air–sea heat exchange during the winter. In this season, the largest negative anomalies of about −30 W m−2 are associated with the EAWR pattern over the central part of the Red Sea. In other seasons, mode-related anomalies are considerably lower, especially during spring when the mode impacts are negligible. The mode impacts are strongest over the northern half of the Red Sea during winter and autumn. In summer, the southern half of the basin is strongly influenced by the multivariate ENSO index (MEI). The winter mode–related anomalies are determined mostly by the latent heat flux component, while in summer the shortwave flux is also important. The influence of the modes on the Red Sea is found to be generally weaker than on the neighboring Mediterranean basin.
Eustatic and Relative Sea Level Changes
Rovere, A.; Stocchi, P.; Vacchi, M.
2016-01-01
Sea level changes can be driven by either variationsin the masses or volume of the oceans, or bychanges of the land with respect to the sea surface. Inthe first case, a sea level change is defined ‘eustatic’;otherwise, it is defined ‘relative’. Several techniques canbe used to observe changes in sea
Mechanisms of long-term mean sea level variability in the North Sea
Dangendorf, Sönke; Calafat, Francisco; Øie Nilsen, Jan Even; Richter, Kristin; Jensen, Jürgen
2015-04-01
We examine mean sea level (MSL) variations in the North Sea on timescales ranging from months to decades under the consideration of different forcing factors since the late 19th century. We use multiple linear regression models, which are validated for the second half of the 20th century against the output of a state-of-the-art tide+surge model (HAMSOM), to determine the barotropic response of the ocean to fluctuations in atmospheric forcing. We demonstrate that local atmospheric forcing mainly triggers MSL variability on timescales up to a few years, with the inverted barometric effect dominating the variability along the UK and Norwegian coastlines and wind (piling up the water along the coast) controlling the MSL variability in the south from Belgium up to Denmark. However, in addition to the large inter-annual sea level variability there is also a considerable fraction of decadal scale variability. We show that on decadal timescales MSL variability in the North Sea mainly reflects steric changes, which are mostly remotely forced. A spatial correlation analysis of altimetry observations and baroclinic ocean model outputs suggests evidence for a coherent signal extending from the Norwegian shelf down to the Canary Islands. This supports the theory of longshore wind forcing along the eastern boundary of the North Atlantic causing coastally trapped waves to propagate along the continental slope. With a combination of oceanographic and meteorological measurements we demonstrate that ~80% of the decadal sea level variability in the North Sea can be explained as response of the ocean to longshore wind forcing, including boundary wave propagation in the Northeast Atlantic. These findings have important implications for (i) detecting significant accelerations in North Sea MSL, (ii) the conceptual set up of regional ocean models in terms of resolution and boundary conditions, and (iii) the development of adequate and realistic regional climate change projections.
Barents Sea Monitoring with a SEA EXPLORER Glider
Field, Michael; Béguery, Laurent; Oziel, Laurent; Gascard, Jean-Claude
2015-01-01
International audience; The use of gliders in the Polar Regions offers clever and inexpensive methods for large scale monitoring and exploration. In August and September of 2014, a SEA EXPLORER glider successfully completed a 388 km mission in the central Barents Sea to monitor the physical and biological features over a transect between 72° 30' N and 74° 30' N latitude and between 32° E and 33° E longitude, as part of the European FP7 ACCESS project and in cooperation with the Institute of M...
Atmospheric circulation and storm events in the Black Sea and Caspian Sea
Surkova, Galina V.; Arkhipkin, Victor S.; Kislov, Alexander V.
2013-12-01
Extreme sea storms are dangerous and a potential source of damage. In this study, we examine storm events in the Black Sea and Caspian Sea, the atmosphere circulation patterns associated with the sea storm events, and their changes in the present (1961-2000) and future (2046-2065) climates. A calendar of storms for the present climate is derived from results of wave model SWAN (Simulating WAves Nearshore) experiments. On the basis of this calendar, a catalog of atmospheric sea level pressure (SLP) fields was prepared from the NCEP/NCAR reanalysis dataset for 1961-2000. The SLP fields were subjected to a pattern recognition algorithm which employed empirical orthogonal decomposition followed by cluster analysis. The NCEP/NCAR reanalysis data is used to evaluate the occurring circulation types (CTs) within the ECHAM5-MPI/OM Atmosphere and Ocean Global Circulation Model (AOGCM) for the period 1961-2000. Our analysis shows that the ECHAM5-MPI/OM model is capable of reproducing circulation patterns for the storm events. The occurrence of present and future ECHAM5-MPI/OM CTs is investigated. It is shown that storm CTs are expected to occur noticeably less frequently in the middle of the 21st century.
Sea ice draft in the Weddell Sea, measured by upward looking sonars
Directory of Open Access Journals (Sweden)
A. Behrendt
2013-06-01
Full Text Available The presented database contains time-referenced sea ice draft values from upward looking sonar (ULS measurements in the Weddell Sea, Antarctica. The sea ice draft data can be used to infer the thickness of the ice. They were collected during the period 1990–2008. In total, the database includes measurements from 13 locations in the Weddell Sea and was generated from more than 3.7 million measurements of sea ice draft. The files contain uncorrected raw drafts, corrected drafts and the basic parameters measured by the ULS. The measurement principle, the data processing procedure and the quality control are described in detail. To account for the unknown speed of sound in the water column above the ULS, two correction methods were applied to the draft data. The first method is based on defining a reference level from the identification of open water leads. The second method uses a model of sound speed in the oceanic mixed layer and is applied to ice draft in austral winter. Both methods are discussed and their accuracy is estimated. Finally, selected results of the processing are presented. The data can be downloaded from doi:10.1594/PANGAEA.785565.
Estimates of ikaite export from sea ice to the underlying seawater in a sea ice-seawater mesocosm
Geilfus, Nicolas-Xavier; Galley, Ryan J.; Else, Brent G. T.; Campbell, Karley; Papakyriakou, Tim; Crabeck, Odile; Lemes, Marcos; Delille, Bruno; Rysgaard, Søren
2016-09-01
The precipitation of ikaite and its fate within sea ice is still poorly understood. We quantify temporal inorganic carbon dynamics in sea ice from initial formation to its melt in a sea ice-seawater mesocosm pool from 11 to 29 January 2013. Based on measurements of total alkalinity (TA) and total dissolved inorganic carbon (TCO2), the main processes affecting inorganic carbon dynamics within sea ice were ikaite precipitation and CO2 exchange with the atmosphere. In the underlying seawater, the dissolution of ikaite was the main process affecting inorganic carbon dynamics. Sea ice acted as an active layer, releasing CO2 to the atmosphere during the growth phase, taking up CO2 as it melted and exporting both ikaite and TCO2 into the underlying seawater during the whole experiment. Ikaite precipitation of up to 167 µmol kg-1 within sea ice was estimated, while its export and dissolution into the underlying seawater was responsible for a TA increase of 64-66 µmol kg-1 in the water column. The export of TCO2 from sea ice to the water column increased the underlying seawater TCO2 by 43.5 µmol kg-1, suggesting that almost all of the TCO2 that left the sea ice was exported to the underlying seawater. The export of ikaite from the ice to the underlying seawater was associated with brine rejection during sea ice growth, increased vertical connectivity in sea ice due to the upward percolation of seawater and meltwater flushing during sea ice melt. Based on the change in TA in the water column around the onset of sea ice melt, more than half of the total ikaite precipitated in the ice during sea ice growth was still contained in the ice when the sea ice began to melt. Ikaite crystal dissolution in the water column kept the seawater pCO2 undersaturated with respect to the atmosphere in spite of increased salinity, TA and TCO2 associated with sea ice growth. Results indicate that ikaite export from sea ice and its dissolution in the underlying seawater can potentially hamper
SeaTrack: Ground station orbit prediction and planning software for sea-viewing satellites
Lambert, Kenneth S.; Gregg, Watson W.; Hoisington, Charles M.; Patt, Frederick S.
1993-01-01
An orbit prediction software package (Sea Track) was designed to assist High Resolution Picture Transmission (HRPT) stations in the acquisition of direct broadcast data from sea-viewing spacecraft. Such spacecraft will be common in the near future, with the launch of the Sea viewing Wide Field-of-view Sensor (SeaWiFS) in 1994, along with the continued Advanced Very High Resolution Radiometer (AVHRR) series on NOAA platforms. The Brouwer-Lyddane model was chosen for orbit prediction because it meets the needs of HRPT tracking accuracies, provided orbital elements can be obtained frequently (up to within 1 week). Sea Track requires elements from the U.S. Space Command (NORAD Two-Line Elements) for the satellite's initial position. Updated Two-Line Elements are routinely available from many electronic sources (some are listed in the Appendix). Sea Track is a menu-driven program that allows users to alter input and output formats. The propagation period is entered by a start date and end date with times in either Greenwich Mean Time (GMT) or local time. Antenna pointing information is provided in tabular form and includes azimuth/elevation pointing angles, sub-satellite longitude/latitude, acquisition of signal (AOS), loss of signal (LOS), pass orbit number, and other pertinent pointing information. One version of Sea Track (non-graphical) allows operation under DOS (for IBM-compatible personal computers) and UNIX (for Sun and Silicon Graphics workstations). A second, graphical, version displays orbit tracks, and azimuth-elevation for IBM-compatible PC's, but requires a VGA card and Microsoft FORTRAN.
Effects of Sea-Surface Waves and Ocean Spray on Air-Sea Momentum Fluxes
Zhang, Ting; Song, Jinbao
2018-04-01
The effects of sea-surface waves and ocean spray on the marine atmospheric boundary layer (MABL) at different wind speeds and wave ages were investigated. An MABL model was developed that introduces a wave-induced component and spray force to the total surface stress. The theoretical model solution was determined assuming the eddy viscosity coefficient varied linearly with height above the sea surface. The wave-induced component was evaluated using a directional wave spectrum and growth rate. Spray force was described using interactions between ocean-spray droplets and wind-velocity shear. Wind profiles and sea-surface drag coefficients were calculated for low to high wind speeds for wind-generated sea at different wave ages to examine surface-wave and ocean-spray effects on MABL momentum distribution. The theoretical solutions were compared with model solutions neglecting wave-induced stress and/or spray stress. Surface waves strongly affected near-surface wind profiles and sea-surface drag coefficients at low to moderate wind speeds. Drag coefficients and near-surface wind speeds were lower for young than for old waves. At high wind speeds, ocean-spray droplets produced by wind-tearing breaking-wave crests affected the MABL strongly in comparison with surface waves, implying that wave age affects the MABL only negligibly. Low drag coefficients at high wind caused by ocean-spray production increased turbulent stress in the sea-spray generation layer, accelerating near-sea-surface wind. Comparing the analytical drag coefficient values with laboratory measurements and field observations indicated that surface waves and ocean spray significantly affect the MABL at different wind speeds and wave ages.
Biopolymers form a gelatinous microlayer at the air-sea interface when Arctic sea ice melts.
Galgani, Luisa; Piontek, Judith; Engel, Anja
2016-07-20
The interface layer between ocean and atmosphere is only a couple of micrometers thick but plays a critical role in climate relevant processes, including the air-sea exchange of gas and heat and the emission of primary organic aerosols (POA). Recent findings suggest that low-level cloud formation above the Arctic Ocean may be linked to organic polymers produced by marine microorganisms. Sea ice harbors high amounts of polymeric substances that are produced by cells growing within the sea-ice brine. Here, we report from a research cruise to the central Arctic Ocean in 2012. Our study shows that microbial polymers accumulate at the air-sea interface when the sea ice melts. Proteinaceous compounds represented the major fraction of polymers supporting the formation of a gelatinous interface microlayer and providing a hitherto unrecognized potential source of marine POA. Our study indicates a novel link between sea ice-ocean and atmosphere that may be sensitive to climate change.
Quach, N.; Huang, T.; Boening, C.; Gill, K. M.
2016-12-01
Research related to sea level rise crosses multiple disciplines from sea ice to land hydrology. The NASA Sea Level Change Portal (SLCP) is a one-stop source for current sea level change information and data, including interactive tools for accessing and viewing regional data, a virtual dashboard of sea level indicators, and ongoing updates through a suite of editorial products that include content articles, graphics, videos, and animations. The architecture behind the SLCP makes it possible to integrate web content and data relevant to sea level change that are archived across various data centers as well as new data generated by sea level change principal investigators. The Extensible Data Gateway Environment (EDGE) is incorporated into the SLCP architecture to provide a unified platform for web content and science data discovery. EDGE is a data integration platform designed to facilitate high-performance geospatial data discovery and access with the ability to support multi-metadata standard specifications. EDGE has the capability to retrieve data from one or more sources and package the resulting sets into a single response to the requestor. With this unified endpoint, the Data Analysis Tool that is available on the SLCP can retrieve dataset and granule level metadata as well as perform geospatial search on the data. This talk focuses on the architecture that makes it possible to seamlessly integrate and enable discovery of disparate data relevant to sea level rise.
Two centuries of extreme events over the Baltic Sea and North Sea regions
Stendel, Martin; den Besselaar Else, van; Abdel, Hannachi; Jaak, Jaagus; Elizabeth, Kent; Christiana, Lefebvre; Gudrun, Rosenhagen; Anna, Rutgersson; Frederik, Schenk; der Schrier Gerard, van; Tim, Woolings
2017-04-01
Two centuries of extreme events over the Baltic Sea and North Sea regions In the framework of the BACC 2 (for the Baltic Sea) and NOSCCA projects (for the North Sea region), studies of past and present variability and changes in atmospheric variables within the North Sea region over the instrumental period (roughly the past 200 years) have been investigated. Findings on trends in temperature and precipitation have already been presented. Here we focus on data homogeneity issues and examine how reliable reanalyses are in this context. Unlike most other regions in the world, there is a wealth of old observations available for the Baltic and North Sea regions, most of it in handwritten form in meteorological journals and other publications. These datasets need to be carefully digitised and homogenized. For this, a thorough quality control must be applied; otherwise the digitised datasets may prove useless or even counterproductive. We present evidence that this step cannot be conducted without human interference and thus cannot be fully automated. Furthermore, inhomogeneities due to e.g. instrumentation and station relocations need to be addressed. A wealth of reanalysis products is available, which can help detect such inhomogeneities in observed time series, but at the same time are prone to biases and/or spurious trends themselves e.g. introduced by changes in the availability and quality of the underlying assimilated data. It therefore in general remains unclear in how far we can simulate the pre-satellite era with respect to homogeneity with reanalyses based only on parts of the observing system. Extreme events and changes in extreme situations are more important and of greater (societal) significance than changes in mean climate. However, changes in extreme weather events are difficult to assess not only because they are, per definition, rare events, but also due to the homogeneity issues outlined above. Taking these into account, we present evidence for changes
Sea Cucumber (Holothuroidea Species of Turkey
Directory of Open Access Journals (Sweden)
Mehmet AYDIN
2016-11-01
Full Text Available There are nearly 1200 sea cucumber species in the world oceans, while only 37 species from Holothuroidea class lives in the Mediterranean Sea. This preliminary study aims identification sea cucumbers species of the Turkish waters. The sea cucumber samples used in this study were obtained from a series of different studies between the years of 2008 and 2014. Identification of the species are mainly based on the morphometric characteristics while some of species are determined from their calcareous spicules. Eight sea species were identified in this research which are; Holothuria tubulosa, Holothuria polii, Holothuria mammata, Holothuria (Platyperona sanctori, Holothuria forskali, Stichopus regalis, Synaptula reciprocans and Stereoderma kirschbergi. There are limited number of studies in the literature focusing on the identification of the sea cucumber species spread in our seas. Therefore, this study is believed to play an important role in guiding future researches.
MIS 5e relative sea-level changes in the Mediterranean Sea: Contribution of isostatic disequilibrium
Stocchi, Paolo; Vacchi, Matteo; Lorscheid, Thomas; de Boer, Bas; Simms, Alexander R.; van de Wal, Roderik S. W.; Vermeersen, Bert L. A.; Pappalardo, Marta; Rovere, Alessio
2018-04-01
Sea-level indicators dated to the Last Interglacial, or Marine Isotope Stage (MIS) 5e, have a twofold value. First, they can be used to constrain the melting of Greenland and Antarctic Ice Sheets in response to global warming scenarios. Second, they can be used to calculate the vertical crustal rates at active margins. For both applications, the contribution of glacio- and hydro-isostatic adjustment (GIA) to vertical displacement of sea-level indicators must be calculated. In this paper, we re-assess MIS 5e sea-level indicators at 11 Mediterranean sites that have been generally considered tectonically stable or affected by mild tectonics. These are found within a range of elevations of 2-10 m above modern mean sea level. Four sites are characterized by two separate sea-level stands, which suggest a two-step sea-level highstand during MIS 5e. Comparing field data with numerical modeling we show that (i) GIA is an important contributor to the spatial and temporal variability of the sea-level highstand during MIS 5e, (ii) the isostatic imbalance from the melting of the MIS 6 ice sheet can produce a >2.0 m sea-level highstand, and (iii) a two-step melting phase for the Greenland and Antarctic Ice Sheets reduces the differences between observations and predictions. Our results show that assumptions of tectonic stability on the basis of the MIS 5e records carry intrinsically large uncertainties, stemming either from uncertainties in field data and GIA models. The latter are propagated to either Holocene or Pleistocene sea-level reconstructions if tectonic rates are considered linear through time.
Deep-sea biodiversity in the Mediterranean Sea: the known, the unknown, and the unknowable.
Directory of Open Access Journals (Sweden)
Roberto Danovaro
Full Text Available Deep-sea ecosystems represent the largest biome of the global biosphere, but knowledge of their biodiversity is still scant. The Mediterranean basin has been proposed as a hot spot of terrestrial and coastal marine biodiversity but has been supposed to be impoverished of deep-sea species richness. We summarized all available information on benthic biodiversity (Prokaryotes, Foraminifera, Meiofauna, Macrofauna, and Megafauna in different deep-sea ecosystems of the Mediterranean Sea (200 to more than 4,000 m depth, including open slopes, deep basins, canyons, cold seeps, seamounts, deep-water corals and deep-hypersaline anoxic basins and analyzed overall longitudinal and bathymetric patterns. We show that in contrast to what was expected from the sharp decrease in organic carbon fluxes and reduced faunal abundance, the deep-sea biodiversity of both the eastern and the western basins of the Mediterranean Sea is similarly high. All of the biodiversity components, except Bacteria and Archaea, displayed a decreasing pattern with increasing water depth, but to a different extent for each component. Unlike patterns observed for faunal abundance, highest negative values of the slopes of the biodiversity patterns were observed for Meiofauna, followed by Macrofauna and Megafauna. Comparison of the biodiversity associated with open slopes, deep basins, canyons, and deep-water corals showed that the deep basins were the least diverse. Rarefaction curves allowed us to estimate the expected number of species for each benthic component in different bathymetric ranges. A large fraction of exclusive species was associated with each specific habitat or ecosystem. Thus, each deep-sea ecosystem contributes significantly to overall biodiversity. From theoretical extrapolations we estimate that the overall deep-sea Mediterranean biodiversity (excluding prokaryotes reaches approximately 2805 species of which about 66% is still undiscovered. Among the biotic components
Yum, Lauren K; Baumgarten, Sebastian; Röthig, Till; Roder, Cornelia; Roik, Anna; Michell, Craig; Voolstra, Christian R
2017-07-25
Despite the importance of deep-sea corals, our current understanding of their ecology and evolution is limited due to difficulties in sampling and studying deep-sea environments. Moreover, a recent re-evaluation of habitat limitations has been suggested after characterization of deep-sea corals in the Red Sea, where they live at temperatures of above 20 °C at low oxygen concentrations. To gain further insight into the biology of deep-sea corals, we produced reference transcriptomes and studied gene expression of three deep-sea coral species from the Red Sea, i.e. Dendrophyllia sp., Eguchipsammia fistula, and Rhizotrochus typus. Our analyses suggest that deep-sea coral employ mitochondrial hypometabolism and anaerobic glycolysis to manage low oxygen conditions present in the Red Sea. Notably, we found expression of genes related to surface cilia motion that presumably enhance small particle transport rates in the oligotrophic deep-sea environment. This is the first study to characterize transcriptomes and in situ gene expression for deep-sea corals. Our work offers several mechanisms by which deep-sea corals might cope with the distinct environmental conditions present in the Red Sea As such, our data provide direction for future research and further insight to organismal response of deep-sea coral to environmental change and ocean warming.
Yum, Lauren
2017-07-19
Despite the importance of deep-sea corals, our current understanding of their ecology and evolution is limited due to difficulties in sampling and studying deep-sea environments. Moreover, a recent re-evaluation of habitat limitations has been suggested after characterization of deep-sea corals in the Red Sea, where they live at temperatures of above 20 °C at low oxygen concentrations. To gain further insight into the biology of deep-sea corals, we produced reference transcriptomes and studied gene expression of three deep-sea coral species from the Red Sea, i.e. Dendrophyllia sp., Eguchipsammia fistula, and Rhizotrochus typus. Our analyses suggest that deep-sea coral employ mitochondrial hypometabolism and anaerobic glycolysis to manage low oxygen conditions present in the Red Sea. Notably, we found expression of genes related to surface cilia motion that presumably enhance small particle transport rates in the oligotrophic deep-sea environment. This is the first study to characterize transcriptomes and in situ gene expression for deep-sea corals. Our work offers several mechanisms by which deep-sea corals might cope with the distinct environmental conditions present in the Red Sea As such, our data provide direction for future research and further insight to organismal response of deep-sea coral to environmental change and ocean warming.
Yum, Lauren; Baumgarten, Sebastian; Rö thig, Till; Roder, Cornelia; Roik, Anna Krystyna; Michell, Craig; Voolstra, Christian R.
2017-01-01
Despite the importance of deep-sea corals, our current understanding of their ecology and evolution is limited due to difficulties in sampling and studying deep-sea environments. Moreover, a recent re-evaluation of habitat limitations has been suggested after characterization of deep-sea corals in the Red Sea, where they live at temperatures of above 20 °C at low oxygen concentrations. To gain further insight into the biology of deep-sea corals, we produced reference transcriptomes and studied gene expression of three deep-sea coral species from the Red Sea, i.e. Dendrophyllia sp., Eguchipsammia fistula, and Rhizotrochus typus. Our analyses suggest that deep-sea coral employ mitochondrial hypometabolism and anaerobic glycolysis to manage low oxygen conditions present in the Red Sea. Notably, we found expression of genes related to surface cilia motion that presumably enhance small particle transport rates in the oligotrophic deep-sea environment. This is the first study to characterize transcriptomes and in situ gene expression for deep-sea corals. Our work offers several mechanisms by which deep-sea corals might cope with the distinct environmental conditions present in the Red Sea As such, our data provide direction for future research and further insight to organismal response of deep-sea coral to environmental change and ocean warming.
Atmospheric forcing of sea ice leads in the Beaufort Sea
Lewis, B. J.; Hutchings, J.; Mahoney, A. R.; Shapiro, L. H.
2016-12-01
Leads in sea ice play an important role in the polar marine environment where they allow heat and moisture transfer between the oceans and atmosphere and act as travel pathways for both marine mammals and ships. Examining AVHRR thermal imagery of the Beaufort Sea, collected between 1994 and 2010, sea ice leads appear in repeating patterns and locations (Eicken et al 2005). The leads, resolved by AVHRR, are at least 250m wide (Mahoney et al 2012), thus the patterns described are for lead systems that extend up to hundreds of kilometers across the Beaufort Sea. We describe how these patterns are associated with the location of weather systems relative to the coastline. Mean sea level pressure and 10m wind fields from ECMWF ERA-Interim reanalysis are used to identify if particular lead patterns can be uniquely forecast based on the location of weather systems. Ice drift data from the NSIDC's Polar Pathfinder Daily 25km EASE-Grid Sea Ice Motion Vectors indicates the role shear along leads has on the motion of ice in the Beaufort Gyre. Lead formation is driven by 4 main factors: (i) coastal features such as promontories and islands influence the origin of leads by concentrating stresses within the ice pack; (ii) direction of the wind forcing on the ice pack determines the type of fracture, (iii) the location of the anticyclone (or cyclone) center determines the length of the fracture for certain patterns; and (iv) duration of weather conditions affects the width of the ice fracture zones. Movement of the ice pack on the leeward side of leads originating at promontories and islands increases, creating shear zones that control ice transport along the Alaska coast in winter. . Understanding how atmospheric conditions influence the large-scale motion of the ice pack is needed to design models that predict variability of the gyre and export of multi-year ice to lower latitudes.
Sea spray aerosol fluxes in the Baltic Sea region: Comparison of the WAM model with measurements
Markuszewski, Piotr; Kosecki, Szymon; Petelski, Tomasz
2017-08-01
Sea spray aerosol flux is an important element of sub-regional climate modeling. The majority of works related to this topic concentrate on open ocean research rather than on smaller, inland seas, e.g., the Baltic Sea. The Baltic Sea is one of the largest brackish inland seas by area, where major inflows of oceanic waters are rare. Furthermore, surface waves in the Baltic Sea have a relatively shorter lifespan in comparison with oceanic waves. Therefore, emission of sea spray aerosol may differ greatly from what is known from oceanic research and should be investigated. This article presents a comparison of sea spray aerosol measurements carried out on-board the s/y Oceania research ship with data calculated in accordance to the WAM model. The measurements were conducted in the southern region of the Baltic Sea during four scientific cruises. The gradient method was used to determinate aerosol fluxes. The fluxes were calculated for particles of diameter in range of 0.5-47 μm. The correlation between wind speed measured and simulated has a good agreement (correlation in range of 0.8). The comparison encompasses three different sea spray generation models. First, function proposed by Massel (2006) which is based only on wave parameters, such as significant wave height and peak frequency. Second, Callaghan (2013) which is based on Gong (2003) model (wind speed relation), and a thorough experimental analysis of whitecaps. Third, Petelski et al. (2014) which is based on in-situ gradient measurements with the function dependent on wind speed. The two first models which based on whitecaps analysis are insufficient. Moreover, the research shows strong relation between aerosol emission and wind speed history.
Antifouling potentials of eight deep-sea-derived fungi from the South China Sea.
Zhang, Xiao-Yong; Xu, Xin-Ya; Peng, Jiang; Ma, Chun-Feng; Nong, Xu-Hua; Bao, Jie; Zhang, Guang-Zhao; Qi, Shu-Hua
2014-04-01
Marine-derived microbial secondary metabolites are promising potential sources of nontoxic antifouling agents. The search for environmentally friendly and low-toxic antifouling components guided us to investigate the antifouling potentials of eight novel fungal isolates from deep-sea sediments of the South China Sea. Sixteen crude ethyl acetate extracts of the eight fungal isolates showed distinct antibacterial activity against three marine bacteria (Loktanella hongkongensis UST950701-009, Micrococcus luteus UST950701-006 and Pseudoalteromonas piscida UST010620-005), or significant antilarval activity against larval settlement of bryozoan Bugula neritina. Furthermore, the extract of Aspergillus westerdijkiae DFFSCS013 displayed strong antifouling activity in a field trial lasting 4 months. By further bioassay-guided isolation, five antifouling alkaloids including brevianamide F, circumdatin F and L, notoamide C, and 5-chlorosclerotiamide were isolated from the extract of A. westerdijkiae DFFSCS013. This is the first report about the antifouling potentials of metabolites of the deep-sea-derived fungi from the South China Sea, and the first stage towards the development of non- or low-toxic antifouling agents from deep-sea-derived fungi.
DEFF Research Database (Denmark)
Williamson, M; Hauser, F; Grimmelikhuijzen, C J
2000-01-01
Cnidarians are primitive animals that use neuropeptides as their transmitters. All the numerous cnidarian neuropeptides isolated, so far, have a carboxy-terminal amide group that is essential for their actions. This strongly suggests that alpha-amidating enzymes are essential for the functioning ...
Schaap, Dick M. A.; Fichaut, Michele
2017-04-01
SeaDataCloud marks the third phase of developing the pan-European SeaDataNet infrastructure for marine and ocean data management. The SeaDataCloud project is funded by EU and runs for 4 years from 1st November 2016. It succeeds the successful SeaDataNet II (2011 - 2015) and SeaDataNet (2006 - 2011) projects. SeaDataNet has set up and operates a pan-European infrastructure for managing marine and ocean data and is undertaken by National Oceanographic Data Centres (NODC's) and oceanographic data focal points from 34 coastal states in Europe. The infrastructure comprises a network of interconnected data centres and central SeaDataNet portal. The portal provides users a harmonised set of metadata directories and controlled access to the large collections of datasets, managed by the interconnected data centres. The population of directories has increased considerably in cooperation with and involvement in many associated EU projects and initiatives such as EMODnet. SeaDataNet at present gives overview and access to more than 1.9 million data sets for physical oceanography, chemistry, geology, geophysics, bathymetry and biology from more than 100 connected data centres from 34 countries riparian to European seas. SeaDataNet is also active in setting and governing marine data standards, and exploring and establishing interoperability solutions to connect to other e-infrastructures on the basis of standards of ISO (19115, 19139), and OGC (WMS, WFS, CS-W and SWE). Standards and associated SeaDataNet tools are made available at the SeaDataNet portal for wide uptake by data handling and managing organisations. SeaDataCloud aims at further developing standards, innovating services & products, adopting new technologies, and giving more attention to users. Moreover, it is about implementing a cooperation between the SeaDataNet consortium of marine data centres and the EUDAT consortium of e-infrastructure service providers. SeaDataCloud aims at considerably advancing services and
International Nuclear Information System (INIS)
Karbstein, Felix
2009-01-01
We introduce a new method for dealing with fermionic quantum field theories amenable to a mean-field-type approximation. In this work we focus on the relativistic Hartree approximation. Our aim is to integrate out the Dirac sea and derive a no-sea effective theory'' with positive energy single particle states only. As the derivation of the no-sea effective theory involves only standard Feynman diagrams, our approach is quite general and not restricted to particular space-time dimensions. We develop and illustrate the approach in the ''large N'' limit of the Gross-Neveu model family in 1+1 dimensions. As the Gross-Neveu model has been intensely studied and several analytical solutions are known for this model, it is an ideal testing ground for our no-sea effective theory approach. The chiral Gross-Neveu model, also referred to as 1+1 dimensional Nambu-Jona-Lasinio model, turns out to be of particular interest. In this case, we explicitly derive a consistent effective theory featuring both elementary ''π meson'' fields and (positive energy) ''quark'' fields, starting from a purely fermionic quantum field theory. In the second part of this work, we apply our approach to the Walecka model in 1+1 and 3+1 dimensions. As the Dirac sea caused considerable difficulties in attempts to base nuclear physics on field theoretic models like the Walecka model, mean-field calculations were typically done without the sea. We confront several of these mean-field theory results with our no-sea effective theory approach. The potential of our approach is twofold. While the no-sea effective theory can be utilized to provide new analytical insights in particular parameter regimes, it also sheds new light on more fundamental issues as the explicit emergence of effective, Dirac-sea induced multi-fermion interactions in an effective theory with positive energy states only. (orig.)
von Hillebrandt-Andrade, C.; Crespo Jones, H.
2012-12-01
Over the past 500 years almost 100 tsunamis have been observed in the Caribbean and Western Atlantic, with at least 3510 people having lost their lives to this hazard since 1842. Furthermore, with the dramatic increase in population and infrastructure along the Caribbean coasts, today, millions of coastal residents, workers and visitors are vulnerable to tsunamis. The UNESCO IOC Intergovernmental Coordination Group for Tsunamis and other Coastal Hazards for the Caribbean and Adjacent Regions (CARIBE EWS) was established in 2005 to coordinate and advance the regional tsunami warning system. The CARIBE EWS focuses on four areas/working groups: (1) Monitoring and Warning, (2) Hazard and Risk Assessment, (3) Communication and (4) Education, Preparedness and Readiness. The sea level monitoring component is under Working Group 1. Although in the current system, it's the seismic data and information that generate the initial tsunami bulletins, it is the data from deep ocean buoys (DARTS) and the coastal sea level gauges that are critical for the actual detection and forecasting of tsunamis impact. Despite multiple efforts and investments in the installation of sea level stations in the region, in 2004 there were only a handful of sea level stations operational in the region (Puerto Rico, US Virgin Islands, Bermuda, Bahamas). Over the past 5 years there has been a steady increase in the number of stations operating in the Caribbean region. As of mid 2012 there were 7 DARTS and 37 coastal gauges with additional ones being installed or funded. In order to reach the goal of 100 operational coastal sea level stations in the Caribbean, the CARIBE EWS recognizes also the importance of maintaining the current stations. For this, a trained workforce in the region for the installation, operation and data analysis and quality control is considered to be critical. Since 2008, three training courses have been offered to the sea level station operators and data analysts. Other
International Nuclear Information System (INIS)
Stoessel, A.; Owens, W.B.
1992-10-01
The general purpose of the model is to simulate sea ice dynamically as well as thermodynamically. Pure sea-ice models are generally highly dependent on the specified atmospheric and oceanic forcing, especially on the winds and the vertical oceanic heat flux. In order to reduce these dependencies, the sea-ice [SI] model was extended to optionally include a prognostic oceanic mixed layer [OML], a diagnostic atmospheric surface layer [ASL] and/or a diagnostic atmospheric boundary layer [ABL], thus shifting the forcing levels further away from the surface (i.e. from the sea ice) and simultaneously providing a modification of the forcing considering boundary-layer adjustments to the instantaneous sea-ice conditions given by the SI model. A further major extension of the model is the (optional) employment of a prognostic snow layer. The special application characterising the present code was sea-ice simulation in the Southern Ocean, employing a spherical, circumpolar grid with a resolution of 2.5 in latitude and 5 in longitude, extending from 50 S to 80 S and using a daily time step. (orig.)
Directory of Open Access Journals (Sweden)
J. Frigola
2012-06-01
Full Text Available Borehole PRGL1-4 drilled in the upper slope of the Gulf of Lion provides an exceptional record to investigate the impact of late Pleistocene orbitally-driven glacio-eustatic sea-level oscillations on the sedimentary outbuilding of a river fed continental margin. High-resolution grain-size and geochemical records supported by oxygen isotope chronostratigraphy allow reinterpreting the last 500 ka upper slope seismostratigraphy of the Gulf of Lion. Five main sequences, stacked during the sea-level lowering phases of the last five glacial-interglacial 100-kyr cycles, form the upper stratigraphic outbuilding of the continental margin. The high sensitivity of the grain-size record down the borehole to sea-level oscillations can be explained by the great width of the Gulf of Lion continental shelf. Sea level driven changes in accommodation space over the shelf cyclically modified the depositional mode of the entire margin. PRGL1-4 data also illustrate the imprint of sea-level oscillations at millennial time-scale, as shown for Marine Isotopic Stage 3, and provide unambiguous evidence of relative high sea-levels at the onset of each Dansgaard-Oeschger Greenland warm interstadial. The PRGL1-4 grain-size record represents the first evidence for a one-to-one coupling of millennial time-scale sea-level oscillations associated with each Dansgaard-Oeschger cycle.
Zhang, Lianxin; Zhang, Xuefeng; Chu, P. C.; Guan, Changlong; Fu, Hongli; Chao, Guofang; Han, Guijun; Li, Wei
2017-10-01
Strong winds lead to large amounts of sea spray in the lowest part of the atmospheric boundary layer. The spray droplets affect the air-sea heat fluxes due to their evaporation and the momentum due to the change of sea surface, and in turn change the upper ocean thermal structure. In this study, impact of sea spray on upper ocean temperatures in the Yellow and East China Seas (YES) during typhoon Rammasun's passage is investigated using the POMgcs ocean model with a sea spray parameterization scheme, in which the sea spray-induced heat fluxes are based on an improved Fairall's sea spray heat fluxes algorithm, and the sea spray-induced momentum fluxes are derived from an improved COARE version 2.6 bulk model. The distribution of the sea spray mediated turbulent fluxes was primarily located at Rammasun eye-wall region, in accord with the maximal wind speeds regions. When Rammasun enters the Yellow sea, the sea spray mediated latent (sensible) heat flux maximum is enhanced by 26% (13.5%) compared to that of the interfacial latent (sensible) heat flux. The maximum of the total air-sea momentum fluxes is enhanced by 43% compared to the counterpart of the interfacial momentum flux. Furthermore, the sea spray plays a key role in enhancing the intensity of the typhoon-induced "cold suction" and "heat pump" processes. When the effect of sea spray is considered, the maximum of the sea surface cooling in the right side of Rammasun's track is increased by 0.5°C, which is closer to the available satellite observations.
Sea-ice indicators of polar bear habitat
Stern, Harry L.; Laidre, Kristin L.
2016-09-01
Nineteen subpopulations of polar bears (Ursus maritimus) are found throughout the circumpolar Arctic, and in all regions they depend on sea ice as a platform for traveling, hunting, and breeding. Therefore polar bear phenology - the cycle of biological events - is linked to the timing of sea-ice retreat in spring and advance in fall. We analyzed the dates of sea-ice retreat and advance in all 19 polar bear subpopulation regions from 1979 to 2014, using daily sea-ice concentration data from satellite passive microwave instruments. We define the dates of sea-ice retreat and advance in a region as the dates when the area of sea ice drops below a certain threshold (retreat) on its way to the summer minimum or rises above the threshold (advance) on its way to the winter maximum. The threshold is chosen to be halfway between the historical (1979-2014) mean September and mean March sea-ice areas. In all 19 regions there is a trend toward earlier sea-ice retreat and later sea-ice advance. Trends generally range from -3 to -9 days decade-1 in spring and from +3 to +9 days decade-1 in fall, with larger trends in the Barents Sea and central Arctic Basin. The trends are not sensitive to the threshold. We also calculated the number of days per year that the sea-ice area exceeded the threshold (termed ice-covered days) and the average sea-ice concentration from 1 June through 31 October. The number of ice-covered days is declining in all regions at the rate of -7 to -19 days decade-1, with larger trends in the Barents Sea and central Arctic Basin. The June-October sea-ice concentration is declining in all regions at rates ranging from -1 to -9 percent decade-1. These sea-ice metrics (or indicators of habitat change) were designed to be useful for management agencies and for comparative purposes among subpopulations. We recommend that the National Climate Assessment include the timing of sea-ice retreat and advance in future reports.
Dukhovniy, Viktor; Stulina, Galina; Eshchanov, Odylbek
2013-04-01
The tragedy of disappearing of Aral Sea is well known to the World. Before and after collapse of Soviet Union, a huge quantity of scientific and popular editions described with grief the situation around the Aral Sea. After the NIS states became independent, World Bank, UNDP, UNEP in proper competition with each other had provided some assessment of the situation through presentation of some small and medium grants, but after 2000, the local population remained alone with own problems. Although on the eyes of the present generation a unique transformation of great water body into deserts took place, the global scientific community did not find forces and financing for real and detail investigation of the processes accompanying the Sea shrinking and land formation. We should acknowledge and give big respect to NATO, later to German Government that through GTZ (now GIZ) - German International Collaboration Agency - and GFZ (Potzdam) paid attention to this area of environment crisis and organized scientific and protective design in the so-called Priaralie - the territory around the drying Sea and delta of the two rivers - Amudarya and Syrdarya. Thank to this assistance, the local specialists in collaboration with limited a number of foreign scientists (N.Aladin, P.Zavialov, Joop de Schutter, Hans Wilps, Hedi Oberhansli) organized significant works for detail socioeconomic, ecological and hydrological assessment situation in Priaralie and on the Aral sea coast. On this base, Ministry of Agriculture and Water resources of Uzbekistan and State Committee of Water resources of Kazakhstan developed a plan of rehabilitation of Amudarya and Syrdarya deltas and started implementation of these projects. If Kazakh water authority moved ahead in wetland restoration faster, a forestation of delta and drying bed of Aral Sea got big success in Uzbek territory. 244 thousands hectares of saxsaul and tamarix were planted for protection of the Priaralie. By request of GTZ SIC, ICWC
Energy Technology Data Exchange (ETDEWEB)
NONE
1971-07-01
Water covers a little more than two-thirds of the earth's surface. What is thrown into the sea from a ship may be washed up on a shore thousands of miles away; wastes discharged into the seas or into rivers flowing into them can affect marine life and possibly also the health of man. The study, prevention and control of pollution of the seas and oceans by radionuclides introduced as by-products of man's use of nuclear energy is thus of global interest. (author)
Do pelagic grazers benefit from sea ice? Insights from the Antarctic sea ice proxy IPSO25
Directory of Open Access Journals (Sweden)
K. Schmidt
2018-04-01
Full Text Available Sea ice affects primary production in polar regions in multiple ways. It can dampen water column productivity by reducing light or nutrient supply, provide a habitat for ice algae and condition the marginal ice zone (MIZ for phytoplankton blooms on its seasonal retreat. The relative importance of three different carbon sources (sea ice derived, sea ice conditioned, non-sea-ice associated for the polar food web is not well understood, partly due to the lack of methods that enable their unambiguous distinction. Here we analysed two highly branched isoprenoid (HBI biomarkers to trace sea-ice-derived and sea-ice-conditioned carbon in Antarctic krill (Euphausia superba and relate their concentrations to the grazers' body reserves, growth and recruitment. During our sampling in January–February 2003, the proxy for sea ice diatoms (a di-unsaturated HBI termed IPSO25, δ13C = −12.5 ± 3.3 ‰ occurred in open waters of the western Scotia Sea, where seasonal ice retreat was slow. In suspended matter from surface waters, IPSO25 was present at a few stations close to the ice edge, but in krill the marker was widespread. Even at stations that had been ice-free for several weeks, IPSO25 was found in krill stomachs, suggesting that they gathered the ice-derived algae from below the upper mixed layer. Peak abundances of the proxy for MIZ diatoms (a tri-unsaturated HBI termed HBI III, δ13C = −42.2 ± 2.4 ‰ occurred in regions of fast sea ice retreat and persistent salinity-driven stratification in the eastern Scotia Sea. Krill sampled in the area defined by the ice edge bloom likewise contained high amounts of HBI III. As indicators for the grazer's performance we used the mass–length ratio, size of digestive gland and growth rate for krill, and recruitment for the biomass-dominant calanoid copepods Calanoides acutus and Calanus propinquus. These indices consistently point to blooms in the MIZ as an important feeding
Do pelagic grazers benefit from sea ice? Insights from the Antarctic sea ice proxy IPSO25
Schmidt, Katrin; Brown, Thomas A.; Belt, Simon T.; Ireland, Louise C.; Taylor, Kyle W. R.; Thorpe, Sally E.; Ward, Peter; Atkinson, Angus
2018-04-01
Sea ice affects primary production in polar regions in multiple ways. It can dampen water column productivity by reducing light or nutrient supply, provide a habitat for ice algae and condition the marginal ice zone (MIZ) for phytoplankton blooms on its seasonal retreat. The relative importance of three different carbon sources (sea ice derived, sea ice conditioned, non-sea-ice associated) for the polar food web is not well understood, partly due to the lack of methods that enable their unambiguous distinction. Here we analysed two highly branched isoprenoid (HBI) biomarkers to trace sea-ice-derived and sea-ice-conditioned carbon in Antarctic krill (Euphausia superba) and relate their concentrations to the grazers' body reserves, growth and recruitment. During our sampling in January-February 2003, the proxy for sea ice diatoms (a di-unsaturated HBI termed IPSO25, δ13C = -12.5 ± 3.3 ‰) occurred in open waters of the western Scotia Sea, where seasonal ice retreat was slow. In suspended matter from surface waters, IPSO25 was present at a few stations close to the ice edge, but in krill the marker was widespread. Even at stations that had been ice-free for several weeks, IPSO25 was found in krill stomachs, suggesting that they gathered the ice-derived algae from below the upper mixed layer. Peak abundances of the proxy for MIZ diatoms (a tri-unsaturated HBI termed HBI III, δ13C = -42.2 ± 2.4 ‰) occurred in regions of fast sea ice retreat and persistent salinity-driven stratification in the eastern Scotia Sea. Krill sampled in the area defined by the ice edge bloom likewise contained high amounts of HBI III. As indicators for the grazer's performance we used the mass-length ratio, size of digestive gland and growth rate for krill, and recruitment for the biomass-dominant calanoid copepods Calanoides acutus and Calanus propinquus. These indices consistently point to blooms in the MIZ as an important feeding ground for pelagic grazers. Even though ice
International Nuclear Information System (INIS)
Yamazaki, Hiroshi; Kitamura, Toshikatus; Mizushima, Toshihiko
1992-01-01
The sea trial of the first Japan nuclear Ship 'MUTSU' was conducted from the end of October to December in 1990. The purpose of the sea trial was to verify the nuclear propulsive performances and maneuverabilities. The present report describes the results of the sea trial. These results are classified into four items: 1. Speed test and engineering performance tests 2. Maneuvering performance tests 3. Vibration tests 4. Other tests. Acceptable performances were demonstrated, as expected in the original design. The experience of the use of the Global Positioning System (GPS), which were newly adopted for the sea trial, is also reported. (author)
Thermal biology of sea snakes and sea kraits.
Heatwole, Harold; Grech, Alana; Monahan, John F; King, Susan; Marsh, Helene
2012-08-01
Temperature probably had no direct effect on the evolution of sea kraits within their center of origin, a geologically stable thermal zone straddling the equator, but may have indirectly affected expansions and contractions in distributions beyond that zone through global fluctuations that caused alternation of higher and lower sea levels. The northern limit of the Laticauda colubrina complex seems to be the 20°C isotherm; in the south, the range does not reach that isotherm because there is no land (also a habitat requirement of sea kraits) within the zone of suitable temperature. The relationship of temperature to the pattern of geographic variation in morphology supports either the hypothesis of peripheral convergence or the developmental hypothesis but does not distinguish between them. Quadratic surfaces relating cumulative scores for coloration and morphological characters to global position showed a strong latitudinal component and an even stronger longitudinal one in which the direction of the latitudinal effect was reversed between east and west. A multivariate analysis revealed that while morphological characters vary significantly by location and climate when tested separately, when the influence of location on morphology is taken into account, no residual relationship between climate and morphology remains. Most marine snakes have mean upper temperature tolerances between 39°C and 40°C and operate at temperatures much nearer their upper thermal limits than their lower limits but still avoid deleterious extremes by diving from excessively hot water to deeper, cooler strata, and by surfacing when water is cold. At the surface in still water in sunlight, Pelamis can maintain its body temperature slightly above that of the water, but whether this is significant in nature is questionable. As temperature falls below 18-20°C, survival time is progressively reduced, accompanied by the successive occurrence of cessation of feeding, cessation of swimming, and
Cho, K. H.; Chang, E. C.
2017-12-01
In this study, we performed sensitivity experiments by utilizing the Global/Regional Integrated Model system with different conditions of the sea ice concentration over the Kara-Barents (KB) Sea in autumn, which can affect winter temperature variability over East Asia. Prescribed sea ice conditions are 1) climatological autumn sea ice concentration obtained from 1982 to 2016, 2) reduced autumn sea ice concentration by 50% of the climatology, and 3) increased autumn sea ice concentration by 50% of climatology. Differently prescribed sea ice concentration changes surface albedo, which affects surface heat fluxes and near-surface air temperature. The reduced (increased) sea ice concentration over the KB sea increases (decreases) near-surface air temperature that leads the lower (higher) sea level pressure in autumn. These patterns are maintained from autumn to winter season. Furthermore, it is shown that the different sea ice concentration over the KB sea has remote effects on the sea level pressure patterns over the East Asian region. The lower (higher) sea level pressure over the KB sea by the locally decreased (increased) ice concentration is related to the higher (lower) pressure pattern over the Siberian region, which induces strengthened (weakened) cold advection over the East Asian region. From these sensitivity experiments it is clarified that the decreased (increased) sea ice concentration over the KB sea in autumn can lead the colder (warmer) surface air temperature over East Asia in winter.
Sea ice and millennial-scale climate variability in the Nordic seas 90 kyr ago to present.
Hoff, Ulrike; Rasmussen, Tine L; Stein, Ruediger; Ezat, Mohamed M; Fahl, Kirsten
2016-07-26
In the light of rapidly diminishing sea ice cover in the Arctic during the present atmospheric warming, it is imperative to study the distribution of sea ice in the past in relation to rapid climate change. Here we focus on glacial millennial-scale climatic events (Dansgaard/Oeschger events) using the sea ice proxy IP25 in combination with phytoplankton proxy data and quantification of diatom species in a record from the southeast Norwegian Sea. We demonstrate that expansion and retreat of sea ice varies consistently in pace with the rapid climate changes 90 kyr ago to present. Sea ice retreats abruptly at the start of warm interstadials, but spreads rapidly during cooling phases of the interstadials and becomes near perennial and perennial during cold stadials and Heinrich events, respectively. Low-salinity surface water and the sea ice edge spreads to the Greenland-Scotland Ridge, and during the largest Heinrich events, probably far into the Atlantic Ocean.
National Oceanic and Atmospheric Administration, Department of Commerce — California sea lions pup and breed at four of the nine Channel Islands in southern California. Since 1981, SWFSC MMTD has been conducting a diet study of sea lions...
Directory of Open Access Journals (Sweden)
Bohdan Pac
2012-12-01
Full Text Available Replenishment at sea is a process which plays the key role in the contemporary naval logistics during military and crisis operations. As the last element of the supply chain, it must use specific standards within the areas of procedures, technical equipment, logistic assets and resources, as well as safety, especially in multinational operations. The methods applied enable ships to operate at sea in the long term without logistic support provided by sea ports. The paper explains all the methods of the solids and liquids replenishment, and also gives an idea how to estimate the resupply process, using the measures. The level of standardization of procedures and assets implemented by NATO, the EU and other willing states has been described.
Dynamic and static elastic moduli of North Sea and deep sea chalk
DEFF Research Database (Denmark)
Gommesen, Lars; Fabricius, Ida Lykke
2001-01-01
We have established an empirical relationship between the dynamic and the static mechanical properties of North Sea and deep sea chalk for a large porosity interval with respect to porosity, effective stress history and textural composition. The chalk investigated is from the Tor and Hod Formatio...
Mechanisms controlling the air–sea CO2 flux in the North Sea
Prowe, A.E.F.; Thomas, Helmuth; Pätsch, Johannes; Kühn, Wilfried; Bozec, Yann; Schiettecatte, Laure-Sophie; Borges, Alberto V.; Baar, Hein J.W. de; Paetsch, J; Kuehn, W
2009-01-01
The mechanisms driving the air–sea exchange of carbon dioxide (CO2) in the North Sea are investigated using the three-dimensional coupled physical–biogeochemical model ECOHAM (ECOlogical-model, HAMburg). We validate our simulations using field data for the years 2001–2002 and identify the controls
How Much Are Floridians Willing to Pay for Protecting Sea Turtles from Sea Level Rise?
Hamed, Ahmed; Madani, Kaveh; Von Holle, Betsy; Wright, James; Milon, J Walter; Bossick, Matthew
2016-01-01
Sea level rise (SLR) is posing a great inundation risk to coastal areas. Some coastal nesting species, including sea turtle species, have experienced diminished habitat from SLR. Contingent valuation method (CVM) was used in an effort to assess the economic loss impacts of SLR on sea turtle nesting habitats for Florida coasts; and to elicit values of willingness to pay (WTP) of Central Florida residents to implement certain mitigation strategies, which would protect Florida's east coast sea turtle nesting areas. Using the open-ended and dichotomous choice CVM, we sampled residents of two Florida communities: Cocoa Beach and Oviedo. We estimated the WTP of households from these two cities to protect sea turtle habitat to be between $42 and $57 per year for 5 years. Additionally, we attempted to assess the impact of the both the respondents' demographics and their perception toward various situations on their WTP value. Findings include a negative correlation between the age of a respondent and the probability of an individual willing to pay the hypothetical WTP amount. We found that WTP of an individual was not dependent on prior knowledge of the effects of SLR on sea turtle habitat. The greatest indicators of whether or not an individual was willing to pay to protect sea turtle habitat were the respondents' perception regarding the trustworthiness and efficiency of the party which will implement the conservation measures and their confidence in the conservation methods used. Respondents who perceive sea turtles having an effect on their life were also more likely to pay.
Lange, Martin; Paul, Gerhard; Potthast, Roland
2014-05-01
Sea ice cover is a crucial parameter for surface fluxes of heat and moisture over water areas. The isolating effect and the much higher albedo strongly reduces the turbulent exchange of heat and moisture from the surface to the atmosphere and allows for cold and dry air mass flow with strong impact on the stability of the whole boundary layer and consequently cloud formation as well as precipitation in the downstream regions. Numerical weather centers as, ECMWF, MetoFrance or DWD use external products to initialize SST and sea ice cover in their NWP models. To the knowledge of the author there are mainly two global sea ice products well established with operational availability, one from NOAA NCEP that combines measurements with satellite data, and the other from OSI-SAF derived from SSMI/S sensors. The latter one is used in the Ostia product. DWD additionally uses a regional product for the Baltic Sea provided by the national center for shipping and hydrografie which combines observations from ships (and icebreakers) for the German part of the Baltic Sea and model analysis from the hydrodynamic HIROMB model of the Swedish meteorological service for the rest of the domain. The temporal evolution of the three different products are compared for a cold period in Februar 2012. Goods and bads will be presented and suggestions for a harmonization of strong day to day jumps over large areas are suggested.
National Oceanic and Atmospheric Administration, Department of Commerce — The dataset contains satellite-derived sea-surface ocean color (chlorophyll-a) measurements collected by means of the Sea-viewing Wide Field-of-view Sensor (SeaWiFS)...
Sea level change along the Black Sea coast from satellite altimetry, tide gauge and GPS observations
Directory of Open Access Journals (Sweden)
Nevin B. Avsar
2016-01-01
Full Text Available Sea level change affects human living conditions, particularly ocean coasts. However, sea level change is still unclear along the Black Sea coast due to lack of in-situ measurements and low resolution satellite data. In this paper, sea level change along the Black Sea coast is investigated from joint satellite altimetry, tide gauge (TG and Global Positioning System (GPS observations. The linear trend and seasonal components of sea level change are estimated at 8 TG stations (Amasra, Igneada, Trabzon-II, Sinop, Sile, Poti, Tuapse, and Batumi located along the Black Sea coast, which are compared with Satellite Altimetry and GPS. At the tide gauge stations with long-term records such as Poti (about 21 years and Tuapse (about 19 years, the results obtained from the satellite altimetry and tide gauge observations show a remarkably good agreement. While some big differences are existed between Satellite Altimetry and TG at other stations, after adding vertical motion from GPS, correlation coefficients of the trend have been greatly improved from 0.37 to 0.99 at 3 co-located GPS and TG stations (Trabzon-II, Sinop and Sile.
Re-initiation of bottom water formation in the East Sea (Japan Sea) in a warming world.
Yoon, Seung-Tae; Chang, Kyung-Il; Nam, SungHyun; Rho, TaeKeun; Kang, Dong-Jin; Lee, Tongsup; Park, Kyung-Ae; Lobanov, Vyacheslav; Kaplunenko, Dmitry; Tishchenko, Pavel; Kim, Kyung-Ryul
2018-01-25
The East Sea (Japan Sea), a small marginal sea in the northwestern Pacific, is ventilated deeply down to the bottom and sensitive to changing surface conditions. Addressing the response of this marginal sea to the hydrological cycle and atmospheric forcing would be helpful for better understanding present and future environmental changes in oceans at the global and regional scales. Here, we present an analysis of observations revealing a slowdown of the long-term deepening in water boundaries associated with changes of water formation rate. Our results indicate that bottom (central) water formation has been enhanced (reduced) with more (less) oxygen supply to the bottom (central) layer since the 2000s. This paper presents a new projection that allows a three-layered deep structure, which retains bottom water, at least until 2040, contrasting previous results. This projection considers recent increase of slope convections mainly due to the salt supply via air-sea freshwater exchange and sea ice formation and decrease of open-ocean convections evidenced by reduced mixed layer depth in the northern East Sea, resulting in more bottom water and less central water formations. Such vigorous changes in water formation and ventilation provide certain implications on future climate changes.
Wahr, John; Smeed, David; Leuliette, Eric; Swenson, Sean
2014-05-01
Seasonal variability of sea surface height and mass within the Red Sea, occurs mostly through the exchange of heat with the atmosphere and wind-driven inflow and outflow of water through the strait of Bab el Mandab that opens into the Gulf of Aden to the south. The seasonal effects of precipitation and evaporation, of water exchange through the Suez Canal to the north, and of runoff from the adjacent land, are all small. The flow through the Bab el Mandab involves a net mass transfer into the Red Sea during the winter and a net transfer out during the summer. But that flow has a multi-layer pattern, so that in the summer there is actually an influx of cool water at intermediate (~100 m) depths. Thus, summer water in the southern Red Sea is warmer near the surface due to higher air temperatures, but cooler at intermediate depths (especially in the far south). Summer water in the northern Red Sea experiences warming by air-sea exchange only. The temperature profile affects the water density, which impacts the sea surface height but has no effect on vertically integrated mass. Here, we study this seasonal cycle by combining GRACE time-variable mass estimates, altimeter (Jason-1, Jason-2, and Envisat) measurements of sea surface height, and steric sea surface height contributions derived from depth-dependent, climatological values of temperature and salinity obtained from the World Ocean Atlas. We find good consistency, particularly in the northern Red Sea, between these three data types. Among the general characteristics of our results are: (1) the mass contributions to seasonal SSHT variations are much larger than the steric contributions; (2) the mass signal is largest in winter, consistent with winds pushing water into the Red Sea through the Strait of Bab el Mandab in winter, and out during the summer; and (3) the steric signal is largest in summer, consistent with summer sea surface warming.
Modelling the atmospheric transport of trace metals from Europe to the North Sea and the Baltic Sea
Energy Technology Data Exchange (ETDEWEB)
Petersen, G; Weber, H; Grassl, H [GKSS-Forschungszentrum Geesthacht G.m.b.H., Geesthacht-Tesperhude (Germany, F.R.). Inst. fuer Physik
1989-01-01
Within the framework of a research contract with the German Federal Environmental Agency the long range transport of trace metals over Europe and the deposition of trace metals into the North Sea and the Baltic Sea are estimated using the EMEP- (European Monitoring and Evaluation Programme) trajectory model. The methodology for the model calculations is explained. Preliminary results for the total deposition of lead into the North Sea and the Baltic Sea show, that the calculated values are lower than previous estimates based on extrapolations from measurements at coastal sites and ship measurements in the southern Baltic Sea, respectively. (orig.).
Polarimetric C-Band SAR Observations of Sea Ice in the Greenland Sea
DEFF Research Database (Denmark)
Thomsen, Bjørn Bavnehøj; Nghiem, S.V.; Kwok, R.
1998-01-01
The fully polarimetric EMISAR acquired C-band radar signatures of sea ice in the Greenland Sea during a campaign in March 1995. The authors present maps of polarimetric signatures over an area containing various kinds of ice and discuss the use of polarimetric SAR for identification of ice types...
Chen, Yanfeng; Hu, Chaoqun; Ren, Chunhua
2015-02-01
In the present study, the applicability of the wet waste collected from shrimp ( Litopenaeus vannamei) to the culture of sea cucumber ( Stichopus monotuberculatus) was determined. The effects of dietary wet shrimp waste on the survival, specific growth rate (SGR), fecal production rate (FPR), ammonia- and nitrite-nitrogen productions of sea cucumber were studied. The total organic matter (TOM) level in the feces of sea cucumber was compared with that in corresponding feeds. Diet C (50% wet shrimp waste and 50% sea mud mash) made sea cucumber grow faster than other diets. Sea cucumber fed with either diet D (25% wet shrimp waste and 75% sea mud mash) or sole sea mud exhibited negative growth. The average lowest total FPR of sea cucumber occurred in diet A (wet shrimp waste), and there was no significant difference in total FPR between diet C and diet E (sea mud mash) ( P > 0.05). The average ammonia-nitrogen production of sea cucumber in different diet treatments decreased gradually with the decrease of crude protein content in different diets. The average highest nitrite-nitrogen production occurred in diet E treatment, and there was no significant difference in nitrite-nitrogen production among diet A, diet B (75% wet shrimp waste and 25% sea mud mash) and diet C treatments ( P > 0.05). In each diet treatment, the total organic matter (TOM) level in feces decreased to different extent compared with that in corresponding feeds.
There goes the sea ice: following Arctic sea ice parcels and their properties.
Tschudi, M. A.; Tooth, M.; Meier, W.; Stewart, S.
2017-12-01
Arctic sea ice distribution has changed considerably over the last couple of decades. Sea ice extent record minimums have been observed in recent years, the distribution of ice age now heavily favors younger ice, and sea ice is likely thinning. This new state of the Arctic sea ice cover has several impacts, including effects on marine life, feedback on the warming of the ocean and atmosphere, and on the future evolution of the ice pack. The shift in the state of the ice cover, from a pack dominated by older ice, to the current state of a pack with mostly young ice, impacts specific properties of the ice pack, and consequently the pack's response to the changing Arctic climate. For example, younger ice typically contains more numerous melt ponds during the melt season, resulting in a lower albedo. First-year ice is typically thinner and more fragile than multi-year ice, making it more susceptible to dynamic and thermodynamic forcing. To investigate the response of the ice pack to climate forcing during summertime melt, we have developed a database that tracks individual Arctic sea ice parcels along with associated properties as these parcels advect during the summer. Our database tracks parcels in the Beaufort Sea, from 1985 - present, along with variables such as ice surface temperature, albedo, ice concentration, and convergence. We are using this database to deduce how these thousands of tracked parcels fare during summer melt, i.e. what fraction of the parcels advect through the Beaufort, and what fraction melts out? The tracked variables describe the thermodynamic and dynamic forcing on these parcels during their journey. This database will also be made available to all interested investigators, after it is published in the near future. The attached image shows the ice surface temperature of all parcels (right) that advected through the Beaufort Sea region (left) in 2014.
Discriminating Sea Spikes in Incoherent Radar Measurements of Sea Clutter
2008-03-01
het detecteren echter niet te verwachten dat bet gebruik van sea spikes te onderzoeken. Een van deze modellen zal leiden tot een Auteur (s) dergelijk...report I TNO-DV 2008 A067 6/33 Abbreviations CFAR Constant False-Alarm Rate CST Composite Surface Theory FFT Fast Fourier Transform PDF Probability Density...described by the composite surface theory (CST). This theory describes the sea surface as small Bragg-resonant capillary waves riding on top of
Sea-ice indicators of polar bear habitat
Directory of Open Access Journals (Sweden)
H. L. Stern
2016-09-01
Full Text Available Nineteen subpopulations of polar bears (Ursus maritimus are found throughout the circumpolar Arctic, and in all regions they depend on sea ice as a platform for traveling, hunting, and breeding. Therefore polar bear phenology – the cycle of biological events – is linked to the timing of sea-ice retreat in spring and advance in fall. We analyzed the dates of sea-ice retreat and advance in all 19 polar bear subpopulation regions from 1979 to 2014, using daily sea-ice concentration data from satellite passive microwave instruments. We define the dates of sea-ice retreat and advance in a region as the dates when the area of sea ice drops below a certain threshold (retreat on its way to the summer minimum or rises above the threshold (advance on its way to the winter maximum. The threshold is chosen to be halfway between the historical (1979–2014 mean September and mean March sea-ice areas. In all 19 regions there is a trend toward earlier sea-ice retreat and later sea-ice advance. Trends generally range from −3 to −9 days decade−1 in spring and from +3 to +9 days decade−1 in fall, with larger trends in the Barents Sea and central Arctic Basin. The trends are not sensitive to the threshold. We also calculated the number of days per year that the sea-ice area exceeded the threshold (termed ice-covered days and the average sea-ice concentration from 1 June through 31 October. The number of ice-covered days is declining in all regions at the rate of −7 to −19 days decade−1, with larger trends in the Barents Sea and central Arctic Basin. The June–October sea-ice concentration is declining in all regions at rates ranging from −1 to −9 percent decade−1. These sea-ice metrics (or indicators of habitat change were designed to be useful for management agencies and for comparative purposes among subpopulations. We recommend that the National Climate Assessment include the timing of sea-ice retreat and advance in
[Reflectance of sea ice in Liaodong Bay].
Xu, Zhan-tang; Yang, Yue-zhong; Wang, Gui-fen; Cao, Wen-xi; Kong, Xiang-peng
2010-07-01
In the present study, the relationships between sea ice albedo and the bidirectional reflectance distribution in Liaodong Bay were investigated. The results indicate that: (1) sea ice albedo alpha(lambda) is closely related to the components of sea ice, the higher the particulate concentration in sea ice surface is, the lower the sea ice albedo alpha(lambda) is. On the contrary, the higher the bubble concentration in sea ice is, the higher sea ice albedo alpha(lambda) is. (2) Sea ice albedo alpha(lambda) is similar to the bidirectional reflectance factor R(f) when the probe locates at nadir. The R(f) would increase with the increase in detector zenith theta, and the correlation between R(f) and the detector azimuth would gradually increase. When the theta is located at solar zenith 63 degrees, the R(f) would reach the maximum, and the strongest correlation is also shown between the R(f) and the detector azimuth. (3) Different types of sea ice would have the different anisotropic reflectance factors.
Directory of Open Access Journals (Sweden)
Estrella Olmedo
2018-03-01
Full Text Available A new methodology using a combination of debiased non-Bayesian retrieval, DINEOF (Data Interpolating Empirical Orthogonal Functions and multifractal fusion has been used to obtain Soil Moisture and Ocean Salinity (SMOS Sea Surface Salinity (SSS fields over the North Atlantic Ocean and the Mediterranean Sea. The debiased non-Bayesian retrieval mitigates the systematic errors produced by the contamination of the land over the sea. In addition, this retrieval improves the coverage by means of multiyear statistical filtering criteria. This methodology allows obtaining SMOS SSS fields in the Mediterranean Sea. However, the resulting SSS suffers from a seasonal (and other time-dependent bias. This time-dependent bias has been characterized by means of specific Empirical Orthogonal Functions (EOFs. Finally, high resolution Sea Surface Temperature (OSTIA SST maps have been used for improving the spatial and temporal resolution of the SMOS SSS maps. The presented methodology practically reduces the error of the SMOS SSS in the Mediterranean Sea by half. As a result, the SSS dynamics described by the new SMOS maps in the Algerian Basin and the Balearic Front agrees with the one described by in situ SSS, and the mesoscale structures described by SMOS in the Alboran Sea and in the Gulf of Lion coincide with the ones described by the high resolution remotely-sensed SST images (AVHRR.
Sea ice-albedo climate feedback mechanism
Energy Technology Data Exchange (ETDEWEB)
Schramm, J.L.; Curry, J.A. [Univ. of Colorado, Boulder, CO (United States); Ebert, E.E. [Bureau of Meterology Research Center, Melbourne (Australia)
1995-02-01
The sea ice-albedo feedback mechanism over the Arctic Ocean multiyear sea ice is investigated by conducting a series of experiments using several one-dimensional models of the coupled sea ice-atmosphere system. In its simplest form, ice-albedo feedback is thought to be associated with a decrease in the areal cover of snow and ice and a corresponding increase in the surface temperature, further decreasing the area cover of snow and ice. It is shown that the sea ice-albedo feedback can operate even in multiyear pack ice, without the disappearance of this ice, associated with internal processes occurring within the multiyear ice pack (e.g., duration of the snow cover, ice thickness, ice distribution, lead fraction, and melt pond characteristics). The strength of the ice-albedo feedback mechanism is compared for several different thermodynamic sea ice models: a new model that includes ice thickness distribution., the Ebert and Curry model, the Mayjut and Untersteiner model, and the Semtner level-3 and level-0 models. The climate forcing is chosen to be a perturbation of the surface heat flux, and cloud and water vapor feedbacks are inoperative so that the effects of the sea ice-albedo feedback mechanism can be isolated. The inclusion of melt ponds significantly strengthens the ice-albedo feedback, while the ice thickness distribution decreases the strength of the modeled sea ice-albedo feedback. It is emphasized that accurately modeling present-day sea ice thickness is not adequate for a sea ice parameterization; the correct physical processes must be included so that the sea ice parameterization yields correct sensitivities to external forcing. 22 refs., 6 figs., 1 tab.
Fin whales and microplastics: The Mediterranean Sea and the Sea of Cortez scenarios.
Fossi, Maria Cristina; Marsili, Letizia; Baini, Matteo; Giannetti, Matteo; Coppola, Daniele; Guerranti, Cristiana; Caliani, Ilaria; Minutoli, Roberta; Lauriano, Giancarlo; Finoia, Maria Grazia; Rubegni, Fabrizio; Panigada, Simone; Bérubé, Martine; Urbán Ramírez, Jorge; Panti, Cristina
2016-02-01
The impact that microplastics have on baleen whales is a question that remains largely unexplored. This study examined the interaction between free-ranging fin whales (Balaenoptera physalus) and microplastics by comparing populations living in two semi-enclosed basins, the Mediterranean Sea and the Sea of Cortez (Gulf of California, Mexico). The results indicate that a considerable abundance of microplastics and plastic additives exists in the neustonic samples from Pelagos Sanctuary of the Mediterranean Sea, and that pelagic areas containing high densities of microplastics overlap with whale feeding grounds, suggesting that whales are exposed to microplastics during foraging; this was confirmed by the observation of a temporal increase in toxicological stress in whales. Given the abundance of microplastics in the Mediterranean environment, along with the high concentrations of Persistent Bioaccumulative and Toxic (PBT) chemicals, plastic additives and biomarker responses detected in the biopsies of Mediterranean whales as compared to those in whales inhabiting the Sea of Cortez, we believe that exposure to microplastics because of direct ingestion and consumption of contaminated prey poses a major threat to the health of fin whales in the Mediterranean Sea. Copyright © 2015 Elsevier Ltd. All rights reserved.
Sea Level Changes: Determination and Effects
Woodworth, P. L.; Pugh, D. T.; DeRonde, J. G.; Warrick, R. G.; Hannah, J.
The measurement of sea level is of fundamental importance to a wide range of research in climatology, oceanography, geology and geodesy. This volume attempts to cover many aspects of the field. The volume opens with a description by Bolduc and Murty of one of the products stemming from the development of tide gauge networks in the northern and tropical Atlantic. This work is relevant to the growth of the Global Sea Level Observing System (GLOSS), the main goal of which is to provide the world with an efficient, coherent sea level monitoring system for océanographie and climatological research. The subsequent four papers present results from the analysis of existing tide gauge data, including those datasets available from the Permanent Service for Mean Sea Level and the TOGA Sea Level Center. Two of the four, by Wroblewski and by Pasaric and Orlic, are concerned with European sea level changes, while Yu Jiye et al. discuss inter-annual changes in the Pacific, and Wang Baocan et al. describe variability in the Changjiang estuary in China. The papers by El- Abd and A wad, on Red Sea levels, are the only contributions to the volume from the large research community of geologists concerned with sea level changes.
Interannual Variability of the Sea-Ice-Induced Salt Flux in the Greenland Sea
DEFF Research Database (Denmark)
Pedersen, Leif Toudal; Coon, M.D.
2001-01-01
The Greenland Sea is one of the few places in the World Ocean where deep convection takes place. The convection process is initiated by a density increase originating from rapid cooling and/or a salt flux to the upper layer of the ocean due to brine rejection from ice formation (Rudels, 1990......; Visbeck and others, 1995). The predominant ice types in the Greenland Sea arc frazil/grease ice and pancake ice. A numerical model has been developed relating ice formation and decay of these ice types as observed by the SMMR and SSM/I microwave radiometers and evaluating their contribution to salt...... redistribution in the Greenland Sea. The model has been used to calculate spatial distribution of the annual integrated net salt flux to the Greenland Sea from ice production and advection for the period 1979-97....
A deep sea community at the Kebrit brine pool in the Red Sea
Vestheim, Hege; Kaartvedt, Stein
2015-01-01
Approximately 25 deep sea brine pools occur along the mid axis of the Red Sea. These hypersaline, anoxic, and acidic environments have previously been reported to host diverse microbial communities. We visited the Kebrit brine pool in April 2013
International Nuclear Information System (INIS)
Ehlers, P.; Kunig, P.
1987-01-01
The waste disposal at sea is regulated for the most part by national administrative law, which mainly is based on international law rules supplemented by EC-law. The dumping of low-level radioactive waste into the sea is more and more called into question. The disposal of high-level radioactive waste into the subsoil of the sea does not correspond to the London Convention. (WG) [de
DEFF Research Database (Denmark)
Cheng, Yongcun; Xu, Qing; Andersen, Ole Baltazar
2014-01-01
The sea-level trend in the South China Sea (SCS) is investigated based on 20 years of along-track data from TOPEX and Jason-1/2 satellite altimetry. The average sea-level rise over all the regions in the study area is observed to have a rate of 5.1 ± 0.8 mm year-1 for the period from 1993 to 2012....... The steric sea level contributes 45% to the observed sea-level trend. These results are consistent with previous studies. In addition, the results demonstrate that the maximum sea-level rise rate of 8.4 mm year-1 is occurring off the east coast of Vietnam and eastern part of SCS. During 2010-2011, the La...... Niña event was highly correlated with the dramatic sea-level rise in the SCS; La Niña events were also associated with the maximum rate of sea rise off the east coast of Vietnam, which occurred during 1993 and 2012. We also evaluated the trends in the geophysical (e.g. dynamical atmospheric correction...
Liu, J.; Milliman, J. D.
2002-12-01
Both post-glacial sea-level and climatic changes are preserved in the the shallow, low gradient, sediment-dominated Yellow Sea. As a result of rapid flooding during melt-water pulse (MWP) 1A, 14.3-14.1 ka BP, sea level reached the southern edge of the North Yellow Sea (NYS), and after MWP-1B (11.6-11.4 ka BP) sea level entered the Bohai Sea. The first major Yellow River-derived deltaic deposit formed in the NYS during decelerated transgression following MWP-1B and increased river discharge in response to re-intensification of the summer monsoon about 11 ka cal BP. A second subaqueous delta formed in the South Yellow Sea about 9-7 ka BP during decelerated transgression after MWP-1C flooding and in response to the southern shift of the Yellow River mouth. The modern subaqueous and subaerial deltas in the west Bahai Gulf and (to a lesser extent) along the Jiangus coast have formed during the modern sea-level highstand. These changing Holocene patterns are most clearly illustrated by a short film clip.
An overview of sea otter studies
Ballachey, Brenda E.; Bodkin, James L.; DeGange, Anthony R.; Loughlin, Thomas R.
1994-01-01
The Exxron Valdez oil spill (EVOS) on 24 March 1989 threatened extensive areas of prime sea otter (Enhydra lutris) habitat along the coasts of south-central Alaska. The spill occurred in northeastern Prince William Sound (PWS), and oil moved rapidly south and west through PWS into the Gulf of Alaska. Much of the coastline of western PWS was heavily oiled, and the slick eventually spread as far southwest as Kodiak Island and the Alaska Peninsula (Galt and Payton 1990; Morris and Loughlin, Chapter 1). All coastal waters affected by the spill were inhabited by sea otters.Concern for the survival of sea otters following the oil spill was immediate and well founded. Sea otters are particularly vulnerable to oil contamination because they rely on pelage rather than blubber for insulation, and oiling drastically reduces the insulative value of the fur (Costa and Kooyman 1982; Siniff et al. 1982; Geraci and Williams 1990). Within days of the spill, recovery of oiled live otters and carcasses began. During the several months following the spill, sea otters became symbolic of the mortality associated with the spilled oil, and of the hope for rescue and recovery of injured wildlife (Batten 1990).An extensive sea otter rescue and rehabilitation effort was mounted in the weeks and months following the spill. Handling and treatment of the captive sea otters posed an enormous and difficult challenge, given the large number of otters held at the facilities and minimal prior experience in caring for oiled sea otters. Rehabilitation of sea otters was a separate effort from the postspill studies designed to evaluate injury to the otter populations and is not addressed in this chapter only as it relates to evaluation of damage assessment studies. Detailed information on the rehabilitation effort is presented in Bayha and Kormendy (1990) and Williams and Davis (1990).Sea otters retained a high profile in the Natural Resource Damage Assessment (NRDA) studies largely because the initial
Energy Technology Data Exchange (ETDEWEB)
Karbstein, Felix
2009-07-08
We introduce a new method for dealing with fermionic quantum field theories amenable to a mean-field-type approximation. In this work we focus on the relativistic Hartree approximation. Our aim is to integrate out the Dirac sea and derive a no-sea effective theory'' with positive energy single particle states only. As the derivation of the no-sea effective theory involves only standard Feynman diagrams, our approach is quite general and not restricted to particular space-time dimensions. We develop and illustrate the approach in the ''large N'' limit of the Gross-Neveu model family in 1+1 dimensions. As the Gross-Neveu model has been intensely studied and several analytical solutions are known for this model, it is an ideal testing ground for our no-sea effective theory approach. The chiral Gross-Neveu model, also referred to as 1+1 dimensional Nambu-Jona-Lasinio model, turns out to be of particular interest. In this case, we explicitly derive a consistent effective theory featuring both elementary ''{pi} meson'' fields and (positive energy) ''quark'' fields, starting from a purely fermionic quantum field theory. In the second part of this work, we apply our approach to the Walecka model in 1+1 and 3+1 dimensions. As the Dirac sea caused considerable difficulties in attempts to base nuclear physics on field theoretic models like the Walecka model, mean-field calculations were typically done without the sea. We confront several of these mean-field theory results with our no-sea effective theory approach. The potential of our approach is twofold. While the no-sea effective theory can be utilized to provide new analytical insights in particular parameter regimes, it also sheds new light on more fundamental issues as the explicit emergence of effective, Dirac-sea induced multi-fermion interactions in an effective theory with positive energy states only. (orig.)
International Nuclear Information System (INIS)
Kholujskij, S.N.; Anikiev, V.V.; Popov, N.I.
1995-01-01
Determination of velocity coefficient for gas flow transfer across the natural sea surface into the atmosphere (K v ) was attempted by means of radon method on board the SRS Academician Alexander Nesmeyanov (July-August 1992). The measurements were conducted in the Bering Sea, the Okhotsk Sea and in the North Pacific Ocean. It is shown that the total range of the K v observed values equaled from 1.8 up to 5.4 m.day, which is within the known limits for other regions of the world ocean. 9 refs., 1 fig
Lebedev, S. A.; Zilberstein, O. I.; Popov, S. K.; Tikhonova, O. V.
2003-04-01
The problem of retrieving of the sea level anomalies in the Barents and White Seas from satellite can be considered as two different problems. The first one is to calculate the anomalies of sea level along the trek taking into account all amendments including tidal heights. The second one is to obtain of fields of the sea level anomalies on the grid over one cycle of the exact repeat altimetry mission. Experience results show that there is preferable to use the regional tidal model for calculating tidal heights. To construct of the anomalies fields of the sea level during the exact repeat mission (cycle 35 days for ERS-1 and ERS-2), when a density of the coverage of the area of water of the Barents and White Seas by satellite measurements achieves maximum. It is necessary to solve the problem of the error minimum. This error is based by the temporal difference of the measurements over one cycle and by the specific of the hydrodynamic regime of the both seas (tidal, storm surge variations, tidal currents). To solve this problem it is assumed to use the results of the hydrodynamic modeling. The error minimum is preformed by the regression of the model results and satellite measurements. As a version it is considered the possibility of the utilizing of the neuronet obtained by the model results to construct maps of the sea level anomalies. The comparison of the model results and the calculation of the satellite altimetry variability of the sea level of Barents and White Seas shows a good coincidence between them. The satellite altimetry data of ERS-1/2 and TOPEX/POSEIDON of Ocean Altimeter Pathfinder Project (NASA/GSFC) has been used in this study. Results of the regional tidal model computations and three dimensional baroclinic model created in the Hydrometeocenter have been used as well. This study also exploited the atmosphere date of the Project REANALYSIS. The research was undertaken with partial support from the Russian Basic Research Foundation (Project No. 01-07-90106).
Digital Repository Service at National Institute of Oceanography (India)
Vora, K.H.
-wide have been affected to a considerable extent by Pleistocene glaciations (Emery, 1968). The rate of sea-level rise has varied frequently and the sea-level still stands produced wave-cut terraces and platforms. In other words, the surface of a terrace... Merh (1992) while reviewing Quaternary sea level changes along India’s coasts observed that the Last Glacial Stage was a period of regression when the sea level went down to almost -150 m. With the advent of the Holocene, the sea started rising...
Caraivan, Glicherie; Corneliu, Cerchia
2016-04-01
Some Black Sea researchers still support the idea of no other connection to the Mediterranean Sea between LGM and Karangatian Stage (Riss - Wurm). We try to clarify the source of these disagreements. C14 AMS age data (HERAS Project) made on undisturbed samples from a new Mamaia drilling hole where compared with the classical Black Sea stratigraphic schemes. A first transgressive event (Zone D) is found between 38.00 - 20.20 m depth. Zone D4 shows a fairly rapid rise of sea level, about 10 m below the present one indicating an inner shelf marine polyhaline environment. AMS age data show 14C ages between 53690 - 47359 y (MIS 1), corresponding to the "Surozhian Beds" of Popov. The "beach rock" from Zone E marks the decrease of the sea level after the maximum reached in Zone D4. Zone E mollusc shells AMS data, indicate 14C ages of 48724 - 44604 y, suggesting a long-time reworked material from the previous D4 zone sediments, and represents the beginning of the "regressive Tarkankutian" sequence.The Last Glacial Maximum (LGM) led to the retreat of the sea level down to about 100 m below the current one (27-17 ky BP), followed by an retreat of the shoreline to the present position. At the beginning of the Holocene - MIS 1 (8408-8132 cal. y BP), Black Sea brackish water level grew rapidly, up to -14 m below the present one (Zone F: 22, 57-20, 20 m). Zone F deposits could be correlated with the Bugazian strata. Then, a continuous rising of the Black Sea level is recorded up to a maximum of -2 m under the present one, about 6789 - 7063 cal. y BP, when a transgressive spurt ("Neolithic transgression") may have taken place. After that, given a weak Danubian sedimentary input, coastal erosion intensified. The coarse sandy sediments were reworked and pushed over the previous peat deposits, and suggest a classical "sedimentary regression", not a sea-level decrease. During the last 1.5 ky, sea level has risen towards the current one. Previous C14 dates from "Karangatian
The origin of sea salt in snow on Arctic sea ice and in coastal regions
Directory of Open Access Journals (Sweden)
F. Domine
2004-01-01
Full Text Available Snow, through its trace constituents, can have a major impact on lower tropospheric chemistry, as evidenced by ozone depletion events (ODEs in oceanic polar areas. These ODEs are caused by the chemistry of bromine compounds that originate from sea salt bromide. Bromide may be supplied to the snow surface by upward migration from sea ice, by frost flowers being wind-blown to the snow surface, or by wind-transported aerosol generated by sea spray. We investigate here the relative importance of these processes by analyzing ions in snow near Alert and Ny-Ålesund (Canadian and European high Arctic in winter and spring. Vertical ionic profiles in the snowpack on sea ice are measured to test upward migration of sea salt ions and to seek evidence for ion fractionation processes. Time series of the ionic composition of surface snow layers are investigated to quantify wind-transported ions. Upward migration of unfractionated sea salt to heights of at least 17cm was observed in winter snow, leading to Cl- concentration of several hundred µM. Upward migration thus has the potential to supply ions to surface snow layers. Time series show that wind can deposit aerosols to the top few cm of the snow, leading also to Cl- concentrations of several hundred µM, so that both diffusion from sea ice and wind transport can significantly contribute ions to snow. At Ny-Ålesund, sea salt transported by wind was unfractionated, implying that it comes from sea spray rather than frost flowers. Estimations based on our results suggest that the marine snowpack contains about 10 times more Na+ than the frost flowers, so that both the marine snowpack and frost flowers need to be considered as sea salt sources. Our data suggest that ozone depletion chemistry can significantly enhance the Br- content of snow. We speculate that this can also take place in coastal regions and contribute to propagate ODEs inland. Finally, we stress the need to measure snow physical parameters
Csanady, G. T.
2001-03-01
In recent years air-sea interaction has emerged as a subject in its own right, encompassing small-scale and large-scale processes in both air and sea. Air-Sea Interaction: Laws and Mechanisms is a comprehensive account of how the atmosphere and the ocean interact to control the global climate, what physical laws govern this interaction, and its prominent mechanisms. The topics covered range from evaporation in the oceans, to hurricanes, and on to poleward heat transport by the oceans. By developing the subject from basic physical (thermodynamic) principles, the book is accessible to graduate students and research scientists in meteorology, oceanography, and environmental engineering. It will also be of interest to the broader physics community involved in the treatment of transfer laws, and thermodynamics of the atmosphere and ocean.
The North Sea field development guide. V.1: Northern North Sea. V.2: Southern North Sea. 6. ed.
International Nuclear Information System (INIS)
Anon.
1996-08-01
The 1997/8, sixth edition is the first to be divided into two volumes. Volume 1 covers the central and northern North Sea areas; volume 2 contains the southern North Sea as well as the Irish and German sectors. The pages are numbered consecutively over the two volumes, with page numbers greater than 702 contained in the second volume. There are three index sections. Main index. Arranged by national sector (UK, Norway etc.) Within each sector the entries are alphabetical by operator name. This index contains page numbers for the book entries: the other two index sections should be used with the main index to find the exact location of an entry; Index by field. If the reader knows a field name (e.g. Kittiwake) but not the operator or the national sector, this index will reference them; Index by installation. Each installation (''Fulmar SALM'', ''Togi'') is named, giving the operator, field and national sector where it is located. This index is also useful for locating particular kinds of installations, such as subsea completions; The book is intended to provide a factual overview of field development activity in the North Sea (a term loosely used to include the Irish Sea and the Baltic Sea). The aim is therefore to provide some background, specifications and history on every offshore installation in that area. Speculative or evaluative commentary is avoided where possible. No attempt has been made to forecast the form or probability of future developments, except in those few instances where announcements have been made by the oil company itself, and these are, clearly indicated. (UK)
A. A. Marks; M. D. King
2013-01-01
Black carbon in sea ice will decrease sea ice surface albedo through increased absorption of incident solar radiation, exacerbating sea ice melting. Previous literature has reported different albedo responses to additions of black carbon in sea ice and has not considered how a snow cover may mitigate the effect of black carbon in sea ice. Sea ice is predominately snow covered. Visible light absorption and light scattering coefficients are calculated for a typical first year and multi-y...
Cornils, Astrid; Wend-Heckmann, Britta
2015-06-01
In October 2010, specimens of Oithona were taken from the List Tidal Basin in the northern Wadden Sea (North Sea) for a biogeographic study on Oithona similis. These specimens could not be assigned to O. similis or any of the other Oithona species known from the North Sea genetically. These specimens were identified as Oithona davisae Ferrari and Orsi 1984, a Northwest Pacific species, known as an invasive species from the Black Sea and the northwestern Mediterranean Sea. Recent sampling provided evidence that O. davisae is still present in the northern Wadden Sea and may thus now be a permanent plankton species.
Caspian sea: petroleum challenges
International Nuclear Information System (INIS)
2005-01-01
The Caspian sea is one of the world areas the most promising in terms of investments and petroleum development. This study presents the petroleum challenges generated by this hydrocarbons reserve. The first part discusses the juridical status (sea or lake), the petroleum and the gas reserves, the ecosystem and the today environment (fishing and caviar), the geostrategic situation and the transport of gas and oil. It provides also a chronology from 1729 to 2005, a selection of Internet sites, books and reports on the subject and identity sheets of the countries around the Caspian sea. (A.L.B.)
Release strategies for rehabilitated sea otters
DeGange, Anthony R.; Ballachey, Brenda E.; Bayha, Keith; Williams, Terrie M.; Davis, Randall W.
1995-01-01
According to the U.S. Fish and Wildlife Services’ (USFWS) Response Plan for sea otters (USFWS, in preparation), in the event of an oil spill, the decision to release sea otters from rehabilitation centers following treatment will be linked to the decision on whether to capture sea otters for treatment. Assuming a scenario similar to the Exxon Valdez oil spill (EVOS), once the decision to capture sea otters is made, the ultimate goal is to return as many sea otters to the wild as possible, even though the rescue may not be expected to produce results significant at the population level. The decision by the USFWS to proceed with capture, rehabilitation, and release will be made on a case-by-case basis (USFWS, in preparation). Many factors will influence the decision. Perhaps the most important factors in deciding when and where to release sea otters are the location and availability of suitable release sites and verification that the otters are free of diseases that might be transmitted to the wild population.Alternative release strategies for sea otters will be contained in the sea otter response portion of the USFWS’s oil spill contingency plans for Alaska and California that are being developed as required by the Oil Pollution Act of 1990. Public review of these plans before they are implemented will help to reduce public concern about the survival of rehabilitated otters, their biological effect on the release area, and the potential introduction or spread of disease into the wild sea otter population.The objective of this chapter is to review alternative strategies for the disposition of rehabilitated sea otters. Our assumption is that returning as many animals to the wild as possible, whether it be for humanitarian or biological reasons, is the ultimate goal of this effort (Figure 10.1).
Checking contamination of the sea
Energy Technology Data Exchange (ETDEWEB)
NONE
1972-07-01
In July, 133 scientists from 15 countries attended an IAEA symposium on the Interaction of Radioactive Contaminants with the Constituents of the Marine Environment. It was held at the University of Washington, with the USAEC acting as host. Representatives from five international organisations, the CEC, OECD-NEA, WFUNA, WHO and the IAEA attended. The symposium was primarily aimed at elucidating the influence of radioactivity on the marine ecosystem and providing some background material for estimation of the capacity of the sea to accept radioactive waste without any significant harmful effects on man and the ecosystem. At the U. N. Conference on Human Environment held in Stockholm in June this year, a special concern was expressed regarding the international waters, such as the seas and oceans, and the need to conserve the resources of the sea. For the past 14 years the Agency has conducted an intensive programme on the discharge of radioactive waste into the sea, and the behaviour of radionuclides in the sea. (author)
Black, H. D.; Anderson, W. T., Jr.
2017-12-01
Inorganic and organic matter concentrations as well as the stable isotopes of nitrogen and organic carbon are presented for continuous sedimentary sequences collected during Integrated Ocean Drilling Program (IODP) Expedition 346 in the Japan Sea/East Sea in 2013. During major glacioeustatic sea level changes, the paleoceanographic conditions within the Japan Sea/East Sea widely vary due to the shallow, narrow straights connecting the sea to surrounding waters limiting an influx of oceanic currents. During glacial sea level low-stands the sea can be nearly isolated, creating a highly-stratified water column and hypoxic to anoxic bottom water conditions. Meanwhile during sea level high-stands, the Tsushima Warm Current (TWC) flows into the sea bringing warmer, nutrient-rich inputs, leading to vertical mixing and oxic conditions. This study aims to better understand the role of orbital cycling within the organic matter and stable isotope contents of these Late Pleistocene sediments. A total of 192 samples were analyzed each for %CaCO3, %TOC, δ13C, %N, and δ15N from two Expedition 346 sampling sites (U1426 and U1427) during the last 430,000 years and statistical analyses were completed using wavelet and time series analyses. Carbonate concentration ranges from 0-44.3%, total organic carbon 0.2 to 6.4%, δ13C -25.8 to -19.6‰, %N 0.04 to 0.4%, and δ15N 3.8 to 13.1‰. These results are well correlated with b* color values of the sediment and generally show increased productivity during interglacial periods, likely through increased vertical mixing and deepwater ventilation, when compared to glacial periods within the Japan Sea/East Sea when the sea may be partially isolated.
Salish Sea Genetics - Salish Sea genetic inventory
National Oceanic and Atmospheric Administration, Department of Commerce — The Salish Sea comprises most of the Puget Sound water area. Marine species are generally assemblages of discrete populations occupying various ecological niches....
Flavor Structure of Intrinsic Nucleon Sea
International Nuclear Information System (INIS)
Peng, Jen-Chieh; Chang, Wen-Chen; Cheng, Hai-Yang; Liu, Keh-Fei
2015-01-01
The concept of intrinsic charm suggested by Brodsky et al. is extended to lighter quarks. Extraction of the intrinsic ū, d-macron, and s-macron seas is obtained from an analysis of the d-macron − ū, s + s-macron, and ū + d-macron − s −s-macron distributions. The connection between the intrinsic/extrinsic seas and the connected/disconnected seas in lattice QCD is also examined. It is shown that the connected and disconnected components for the ū(x) + d-macron(x) sea can be separated. The striking x-dependence of the [s(x) + s-macron(x)]/[ū(x) + d-macron(x)] ratio is interpreted as an interplay between the connected and disconnected seas. (author)