75 FR 69864 - Modification of Class B Airspace; Charlotte, NC
2010-11-16
.... After consultation with a diverse cross- section of stakeholders that participated in the ad hoc... more than the current practice. When Charlotte is on a north operation, final radar airspace begins at... operation, final radar airspace begins at the airport and extends northward to the boundary with Atlanta Air...
EPA scientists are partnering with Clean Air Carolina (CAC) in Charlotte, N.C., and the Eastern Band of Cherokee Indians (EBCI) in Cherokee, N.C., to conduct a citizen science air quality project in these regions.
2013-12-19
... ``final box'' for Charlotte/Douglas International Airport (CLT) when CLT is landing to the north. The proposed modification of T-202 (see below) would provide routing through the south end of the CLT Class B... its current position. The shift would move the route to the east of the CLT Class B airspace area...
Rubin, Vera C.
2010-07-01
Charlotte Moore Sitterly was a scientist in an era when it was rare for a woman to have the opportunity to devote her life to forefront science. Following her graduation from Swarthmore College in 1920, she accepted a position at Princeton University as an assistant to Henry Norris Russell. In 1925 she started a study of the solar spectrum. She could then not know that she would devote much of her scientific career to gathering basic atomic data that are invaluable to the scientific community, even today. In 1931 she obtained a Ph.D. degree at the University of California, Berkeley, and returned to Princeton as a staff member of the Princeton University Observatory. In 1945 Moore moved to the National Bureau of Standards (NBS), to supervise preparation of the widely-used tables of atomic energy levels. Following the successful launching (1946) of a V2 rocket to obtain the ultraviolet spectrum of the Sun, she started working also with Richard Tousey and his group at the Naval Research Laboratory (NRL). Ultimately, they extended the solar spectrum down to 2200 angstroms. She continued her affiliations with both the NBS and the NRL until her death in 1990. Charlotte Moore was a rare scientist who devoted her career to obtaining accurate numbers, thus enabling the scientific community to open her tables and know that the data are reliable.
Improving Earth Science Metadata: Modernizing ncISO
O'Brien, K.; Schweitzer, R.; Neufeld, D.; Burger, E. F.; Signell, R. P.; Arms, S. C.; Wilcox, K.
2016-12-01
ncISO is a package of tools developed at NOAA's National Center for Environmental Information (NCEI) that facilitates the generation of ISO 19115-2 metadata from NetCDF data sources. The tool currently exists in two iterations: a command line utility and a web-accessible service within the THREDDS Data Server (TDS). Several projects, including NOAA's Unified Access Framework (UAF), depend upon ncISO to generate the ISO-compliant metadata from their data holdings and use the resulting information to populate discovery tools such as NCEI's ESRI Geoportal and NOAA's data.noaa.gov CKAN system. In addition to generating ISO 19115-2 metadata, the tool calculates a rubric score based on how well the dataset follows the Attribute Conventions for Dataset Discovery (ACDD). The result of this rubric calculation, along with information about what has been included and what is missing is displayed in an HTML document generated by the ncISO software package. Recently ncISO has fallen behind in terms of supporting updates to conventions such updates to the ACDD. With the blessing of the original programmer, NOAA's UAF has been working to modernize the ncISO software base. In addition to upgrading ncISO to utilize version1.3 of the ACDD, we have been working with partners at Unidata and IOOS to unify the tool's code base. In essence, we are merging the command line capabilities into the same software that will now be used by the TDS service, allowing easier updates when conventions such as ACDD are updated in the future. In this presentation, we will discuss the work the UAF project has done to support updated conventions within ncISO, as well as describe how the updated tool is helping to improve metadata throughout the earth and ocean sciences.
Charlotte Moore Sitterly: A Life of Spectroscopy
Rubin, Vera C.
2010-01-01
Dr. Charlotte Moore Sitterly was a scientist in an era when it was rare for a woman to have the opportunity to devote her life to forefront science. Following her graduation from Swarthmore College in 1920, she accepted a position at Princeton University as an assistant to Henry Norris Russell. In 1925 she started a study of the solar spectrum. She could then not know that she would devote much of her scientific career to gathering basic atomic data that are invaluable to the scientific community, even today. In 1931 she obtained a PhD degree at U. California, Berkeley, and returned to Princeton as a staff member of the Princeton University Observatory. In 1945 she moved to the National Bureau of Science (NBS), to supervise preparation of the widely used tables of atomic energy levels. Following the successful lunching (1946) of a V2 rocket to obtain the ultra violet spectrum of the sun, Moore started working with Richard Tousey and his group at the Naval Research Laboratory (NRL). Ultimately, they extended the solar spectrum down to 2200 angstroms. She continued her affiliations with NBS and NRL until her death in 1990. Charlotte Moore was rare scientist who devoted her career to obtaining accurate numbers, thus enabling the scientific community to open her tables and know that the data are accurate.
E.B. White and Charlotte's Web.
Elledge, Scott
2001-01-01
Discusses the life and work of E.B. White, describing his research on spiders, examining his development of the story, "Charlotte's Web," and explaining how "Charlotte's Web" is a fabric of memories. Notes how this book faces a variety of truths about the human condition and how it celebrates a child's generous view of and love…
40 CFR 81.75 - Metropolitan Charlotte Interstate Air Quality Control Region.
2010-07-01
... Quality Control Region. 81.75 Section 81.75 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Air Quality Control Regions § 81.75 Metropolitan Charlotte Interstate Air Quality Control Region. The Metropolitan Charlotte Interstate Air Quality Control Region (North Carolina-South Carolina) has been revised...
Full Text Available ... 17/2013) Pelvic Support Problems Anterior Repair with Processed Dermis (Carolina Urology Partners, Charlotte, NC, 7/01/ ... 17/2013) Pelvic Support Problems Anterior Repair with Processed Dermis (Carolina Urology Partners, Charlotte, NC, 7/01/ ...
33 CFR 110.250 - St. Thomas Harbor, Charlotte Amalie, V.I.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false St. Thomas Harbor, Charlotte... SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.250 St. Thomas Harbor, Charlotte Amalie.... Thomas, V.I. of the United States and approaches thereto, including all waters under its jurisdiction, as...
Charlotte koob Vanemuises võrku / Jaanika Juhanson
Juhanson, Jaanika, 1977-
2000-01-01
Elwyn Brooks White'i lasteraamatu ainetel valminud lavalugu lastele "Charlotte koob võrku", lavastaja EMA Kõrgema Lavakunstikooli XIX lennu lavastaja-diplomand Vahur Keller. Esietendus Vanemuises 8. jaan
Bedrock Geologic Map of Charlotte,�Vermont
Vermont Center for Geographic Information — Digital Data from VG09-5 Gale, M., Kim, J., Earle, H., Clark, A., Smith, T., and Petersen, K., 2009, Bedrock Geologic Map of Charlotte, Vermont: VGS Open-File Report...
Charlotte: Integrated Student Support Makes a Difference
Walter, Frank
2018-01-01
North Carolina's Charlotte-Mecklenburg School District experienced a significant improvement in its graduation rates for students from low-income families--from just 52% in 2009 to 85.2% in 2016--which has been credited to the district's shift to community schools.
33 CFR 207.600 - Rochester (Charlotte) Harbor, N.Y.; use, administration, and navigation.
2010-07-01
... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Rochester (Charlotte) Harbor, N.Y.; use, administration, and navigation. 207.600 Section 207.600 Navigation and Navigable Waters CORPS OF... (Charlotte) Harbor, N.Y.; use, administration, and navigation. (a)-(b) [Reserved] (c) No vessel shall moor or...
2013-04-02
...-AA08 Special Local Regulations; St. Thomas Carnival Watersport Activities, Charlotte Amalie Harbor; St... proposes to establish a special local regulation on the waters of Charlotte Amalie Harbor in St Thomas, USVI during the St. Thomas Carnival Watersport Activities, a high speed boat race. The event is...
Morrell, Elizabeth; Sorensen, Janni; Howarth, Joe
2015-01-01
This article describes the evolution of the Charlotte Action Research Project (CHARP), a community-university partnership founded in 2008 at the University of North Carolina at Charlotte, and focuses particularly on the program's unique organizational structure. Research findings of a project evaluation suggest that the CHARP model's unique…
Baltoscandal. Ebainimlik ja unenäoline Charlotte Engelkes / Andry Ervald
Ervald, Andry
2008-01-01
Baltoscandali teatrifestivalil Eesti päritolu Rootsi tantsija ja koreograafi Charlotte Engelkesi Schuberti muusikal põhinevast lavastusest "Forellen and Me" (dramaturg, teksti ja kontseptsiooni autor Marina Steinmo, valguskunstnik Karl Svensson)
Charlotte Amalie, Virgin Islands Tsunami Forecast Grids for MOST Model
National Oceanic and Atmospheric Administration, Department of Commerce — The Charlotte Amalie, Virgin Islands Forecast Model Grids provides bathymetric data strictly for tsunami inundation modeling with the Method of Splitting Tsunami...
Evaluation Procedures in the Charlotte-Mecklenburg Career Ladder Plan.
Schlechty, Phillip C.
1985-01-01
Describes faculty evaluation procedures used in the Charlotte-Mecklenburg (North Carolina) Public Schools in conjunction with career development. Covers the program's philosophy, purposes, and special characteristics; expectations set and competencies sought; the areas evaluation; evaluator characteristics; the observation process; teachers'…
A Responsive, Integrative Spanish Curriculum at UNC Charlotte
Doyle, Michael S.
2010-01-01
The Spanish program at UNC Charlotte is timely and responsive because it is designed to meet documented societal (job market) needs in today's and tomorrow's global village and economy by providing graduates with strong specialties in English-Spanish translating and in business Spanish. It is integrative in that it does so while maintaining its…
Prospective audit of mandibular fractures at the Charlotte Maxeke ...
African Journals Online (AJOL)
Objective. This study was a prospective cross-sectional clinical audit of patients with mandibular fractures at the Charlotte Maxeke Johannesburg Academic Hospital. Methods. Between 1 March and 31 August 2004, patients with mandibular fractures seen by one clinician had their details recorded. Results. The female:male ...
City of Charlotte, North Carolina Municipal Forest Resource Analysis
E.G. McPherson; J.R. Simpson; P.J. Peper; S.L. Gardner; K.E. Vargas; S.E. Maco; Q. Xiao
2005-01-01
Charlotte, a vibrant Southern city appreciated for its rich history and cultural wealth, maintains trees as an integral component of the urban infrastructure (Figure 1). Research indicates that healthy trees can lessen impacts associated with the built environment by reducing stormwater runoff, energy consumption, and air pollutants. Trees improve urban life, making...
2010-03-30
... Flooring Oneida, TN 03/03/10 02/26/10 Company (State). 73608 Pricewaterhouse Coopers, LLP Charlotte, NC... Charles Craft, Inc. (Comp).. Laurinburg, NC........ 03/03/10 02/23/10 73620 Ticona Polymers (Wkrs...
School Segregation and Resegregation in Charlotte and Raleigh, 1989-2010
Ayscue, Jennifer B.; Siegel-Hawley, Genevieve; Kucsera, John; Woodward, Brian
2018-01-01
Desegregated schools are linked to educational and social advantages whereas myriad harms are connected to segregated schools, yet the emphasis on school desegregation has recently receded in two North Carolina city-suburban school districts historically touted for their far-reaching efforts: Charlotte and Raleigh. In this article, we use…
Commentary: Who really wants to save the apes?
Indian Academy of Sciences (India)
2007-01-31
Jan 31, 2007 ... Permanent link: https://www.ias.ac.in/article/fulltext/jbsc/032/02/0183-0184. Keywords. AIDS; apes; chimpanzees; Great Ape Project. Author Affiliations. Jonathan Marks1. Department of Sociology and Anthropology, University of North Carolina at Charlotte, Charlotte, NC 28223, USA. Dates. Early published ...
A Conversation with Charlotte Bunch: Seeing Women's Rights as Human Rights
Directory of Open Access Journals (Sweden)
Riane Eisler
2016-10-01
Full Text Available IJPS Editor-in-Chief Riane Eisler interviews Charlotte Bunch, BA, PhD (honfounding director and senior scholar at the Center for Women’s Global Leadership at Rutgers University, where she is also a distinguished professor in the Department of Women’s and Gender Studies.
Charlotte Salomon ou l’art de l'intermédialité
Grijpma, D.
2010-01-01
In exile on the Côte d’Azur Charlotte Salomon (Berlin 1917-Auschwitz 1943) painted Leben?oder Theater? (LT). The work, an impressive life-story, comprises more than a thousand pages: gouaches, painted text and text fragments on transparent paper. Since 1971 LT has been in the collection of the
Holocene Tree Line and Climate Change on the Queen Charlotte Islands, Canada
Pellatt, Marlow G.; Mathewes, Rolf W.
1997-07-01
Palynological study of two subalpine ponds on the Queen Charlotte Islands reveals changes in tree line and climate during the Holocene. The findings agree with previous reconstructions, from nearby Louise Pond on the Queen Charlotte Islands, that suggest a warmer-than-present climate and higher-than-present tree lines in the early Holocene (ca. 9600-6600 14C yr B.P.). Basal ages at SC1 Pond and Shangri-La Bog indicate that the basins did not hold permanent water before 7200 14C yr B.P., consistent with a warmer and drier early Holocene previously inferred from Louise Pond. Pollen and plant macrofossils indicate the initial establishment of subalpine conditions by 6090 ± 90 14C yr B.P., similar to the 5790 ± 130 14C yr B.P. age for cooling inferred from Louise Pond. Conditions similar to present were established at SC1 Pond by 3460 ± 100 14C yr B.P., confirming the previous estimate of 3400 14C yr B.P. at Louise Pond. This 3400 14C yr B.P. vegetation shift on the Queen Charlotte Islands corresponds with the beginning of the Tiedemann glacial advance in the south-coastal mountains of British Columbia (ca. 3300 14C yr B.P.), the Peyto and Robson glacial advances between 3300 and 2800 14C yr B.P. in the Rocky Mountains, and climatic cooling inferred from palynological studies throughout southern British Columbia, northern Washington, and southeast Alaska. These findings confirm that changes in regional climate influenced changes in vegetation in coastal British Columbia.
Proffitt, C.E.; Milbrandt, E.C.; Travis, S.E.
2006-01-01
Reproductive aspects of life history are known to be important in recovery following disturbance in many plant species although this has not been well studied in mangroves. Hurricane Charley devastated large areas of mangroves in Charlotte Harbor, Florida, in August 2004. We surveyed 6 forests in Charlotte Harbor (2002, 2003, and 2005) and 16 in Tampa Bay, Florida (2001, 2002, 2003, and 2005) for total numbers of reproducing trees and trees heterozygotic for albinism that produce both normal and albino propagules. Tree size (estimated height and diameter at breast height) was also recorded for sentinel heterozygotic trees. Total number of reproducing trees km-1 was used as an index of reproductive output of the population, and deviation from the 3:1 (normal:albino propagules) ratio on heterozygotic trees expected with 100% selfing was used to estimate outcrossing. Numbers of Rhizophora mangle reproducing trees km-1 of shoreline in Charlotte Harbor were reduced by an order of magnitude following Hurricane Charley, while numbers of reproducing trees in Tampa Bay were similar to those of previous years. Reduced reproduction in Charlotte Harbor was accompanied by fewer new recruits in plots on Sanibel and Captiva Islands. Numbers of new recruits after the storm also tended to be fewer in plots where canopy loss was greater. More new recruits occurred in sites that had higher densities of pre-storm Rhizophora seedlings and greater relative dominance by Rhizophora. Outcrossing of sentinel trees was 2.5 times greater in Charlotte Harbor (mean site-1 = 33.6 ?? 6.7%; with 17% of forest sites completely selfing) than in Tampa Bay (mean site-1 = 13.4 ?? 4.7%; with 40% of sites completely selfing), although the implications for seedling recruitment of this difference are not known. ?? 2006 Estuarine Research Federation.
Putting the Pieces in Place: Charlotte-Mecklenburg Public Schools' Teacher Evaluation System
Curtis, Rachel
2012-01-01
The first two goals of "Teaching Our Way to the Top, the Charlotte-Mecklenburg Public Schools" (CMS) Strategic Plan 2014,--Effective Teaching and Leadership and Performance Management--make clear that the district's top two priorities are ensuring excellent instruction districtwide and creating a performance culture organized on the…
Award for Distinguished Contributions to Research in Public Policy: Charlotte J. Patterson
American Psychologist, 2009
2009-01-01
Charlotte J. Patterson, winner of the Award for Distinguished Contributions to Research in Public Policy, is cited as the world's expert on psychological research on children and youths raised by lesbian and gay parents. Her early analytic syntheses of the literature on the subject greatly influenced other researchers in child and family…
Directory of Open Access Journals (Sweden)
Elizabeth C. Delmelle
2014-06-01
Full Text Available In urban America, land development and residential real estate have passed through a number of different phases during the post-WWII era. In contemporary discourse on urban sustainability, attention is often expressed in terms of intensity of land development, lot sizes, and square-footage of housing units. In this paper, we reconstruct the land development trajectory of a rapidly growing southern city in the United States and assess whether this trajectory has experienced any reversal in the face of socio-economic transformations that have occurred over the past decade or so. Starting with current land and real estate property records, we reconstitute the urban map of Charlotte using World War II as a starting point. Results highlight a decline in the average single family lot size over the past decade, while the average home size has consistently grown, suggesting that the city of Charlotte and its county have witnessed a densification trend along a path towards greater land development. This analysis both helps situate Charlotte with respect to other U.S. urban regions, and provides support for potential land-use policies, especially densification, when a balance between urban development, environment preservation, energy savings, and the achievement of quality of life for current and future generations are concerned.
Taxi-Out Time Prediction for Departures at Charlotte Airport Using Machine Learning Techniques
Lee, Hanbong; Malik, Waqar; Jung, Yoon C.
2016-01-01
Predicting the taxi-out times of departures accurately is important for improving airport efficiency and takeoff time predictability. In this paper, we attempt to apply machine learning techniques to actual traffic data at Charlotte Douglas International Airport for taxi-out time prediction. To find the key factors affecting aircraft taxi times, surface surveillance data is first analyzed. From this data analysis, several variables, including terminal concourse, spot, runway, departure fix and weight class, are selected for taxi time prediction. Then, various machine learning methods such as linear regression, support vector machines, k-nearest neighbors, random forest, and neural networks model are applied to actual flight data. Different traffic flow and weather conditions at Charlotte airport are also taken into account for more accurate prediction. The taxi-out time prediction results show that linear regression and random forest techniques can provide the most accurate prediction in terms of root-mean-square errors. We also discuss the operational complexity and uncertainties that make it difficult to predict the taxi times accurately.
Directory of Open Access Journals (Sweden)
Harver Andrew
2009-08-01
Full Text Available Abstract Introduction The University of North Carolina at Charlotte, a doctoral/research-intensive university, is the largest institution of higher education in the Charlotte region. The university currently offers 18 doctoral, 62 master's and 90 baccalaureate programmes. Fall 2008 enrolment exceeded 23 300 students, including more than 4900 graduate students. The university's Department of Health Behavior and Administration was established on 1 July 2002 as part of a transformed College of Health & Human Services. Case description In 2003, the Department initiated a series of stakeholder activities as part of its strategic planning and programmatic realignment efforts. The Department followed an empirically derived top-down/bottom-up strategic planning process that fostered community engagement and coordination of efforts across institutional levels. This process culminated in a vision to transform the unit into a Council on Education for Public Health accredited programme in public health and, eventually, an accredited school of public health. To date, the Department has revised its Master of Science in health promotion into an Master of Science in Public Health programme, renamed itself the Department of Public Health Sciences, launched a Bachelor of Science in Public Health major, laid plans for a doctoral programme, and received accreditation from the Council on Education for Public Health as a public health programme. Furthermore, the campus has endorsed the programme's growth into a school of public health as one of its priorities. Discussion and Evaluation It is only through this rigorous and cyclical process of determining what society needs, designing a curriculum specifically to prepare graduates to meet those needs, ensuring that those graduates meet those needs, and reassessing society's needs that we can continue to advance the profession and ensure the public's health. Community stakeholders should be active contributors to
Thompson, Michael E; Harver, Andrew; Eure, Marquis
2009-08-11
The University of North Carolina at Charlotte, a doctoral/research-intensive university, is the largest institution of higher education in the Charlotte region. The university currently offers 18 doctoral, 62 master's and 90 baccalaureate programmes. Fall 2008 enrolment exceeded 23,300 students, including more than 4900 graduate students. The university's Department of Health Behavior and Administration was established on 1 July 2002 as part of a transformed College of Health & Human Services. In 2003, the Department initiated a series of stakeholder activities as part of its strategic planning and programmatic realignment efforts. The Department followed an empirically derived top-down/bottom-up strategic planning process that fostered community engagement and coordination of efforts across institutional levels. This process culminated in a vision to transform the unit into a Council on Education for Public Health accredited programme in public health and, eventually, an accredited school of public health. To date, the Department has revised its Master of Science in health promotion into an Master of Science in Public Health programme, renamed itself the Department of Public Health Sciences, launched a Bachelor of Science in Public Health major, laid plans for a doctoral programme, and received accreditation from the Council on Education for Public Health as a public health programme. Furthermore, the campus has endorsed the programme's growth into a school of public health as one of its priorities. It is only through this rigorous and cyclical process of determining what society needs, designing a curriculum specifically to prepare graduates to meet those needs, ensuring that those graduates meet those needs, and reassessing society's needs that we can continue to advance the profession and ensure the public's health. Community stakeholders should be active contributors to programme innovation. Lessons learnt from this process include: being connected to your
2013-06-20
... the core maintenance area exists; c. alternative fuel vehicle programs to include compressed natural... Promulgation of Air Quality Implementation Plans; Charlotte, Raleigh/Durham and Winston-Salem Carbon Monoxide... (CO), showing continued attainment of the 8-hour CO national ambient air quality standard for the...
2012-10-12
... ENVIRONMENTAL PROTECTION AGENCY 40 CFR Part 52 [EPA-R04-OAR-2010-0019(b); FRL-9741-1] Approval and Promulgation of Implementation Plans; North Carolina Portion of the Charlotte-Gastonia-Rock Hill, North Carolina-South Carolina 1997 8-Hour Ozone Nonattainment Area; Reasonable Further Progress Plan AGENCY...
77 FR 70162 - Ocean Transportation Intermediary License Applicants
2012-11-23
...), 900 Center Park Drive, Suite F, Charlotte, NC 28217, Officers: Paul L. Carter, Vice President (QI...), Application Type: New NVO License. Transport Partner (USA), Inc. (NVO & OFF), 2006 Cherry Hill Lane...
33 CFR 80.525 - Cape Lookout, NC to Cape Fear, NC.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Cape Lookout, NC to Cape Fear, NC... INTERNATIONAL NAVIGATION RULES COLREGS DEMARCATION LINES Fifth District § 80.525 Cape Lookout, NC to Cape Fear... southeast side of the Inlet. (g) Except as provided elsewhere in this section from Cape Lookout to Cape Fear...
They Keep Moving the Cheese: But Charlotte CTE Students Find Passionate Pathways to Prosperity
Realon, Michael S.
2012-01-01
Recent conditions in America's economy have resulted in a period of paradox as high unemployment continues to trouble America at the same time as employers complain about millions of unfilled jobs due to a serious skills gap in the nation's workforce. The prevalence of this economic situation in Charlotte, North Carolina, has caused the Olympic…
2012-05-04
... Promulgation of Implementation Plans; North Carolina; Charlotte; Ozone 2002 Base Year Emissions Inventory... final action to approve the ozone 2002 base year emissions inventory portion of the state implementation... Air Act (CAA or Act). EPA will take action on the South Carolina submission for the ozone 2002 base...
Chemical and isotopic characterisation and sedimentation rates in Princess Charlotte Bay, Queensland
International Nuclear Information System (INIS)
Torgersen, T.; Chivas, A.R.; Chapman, A.
1983-01-01
Sedimentation rates in Princess Charlotte Bay are in the range 2.3-6.1 mm/yr, with mixed layers up to 10 cm thick, as determined by the 210 Pb method. 137 Cs determinations of sedimentation rate are not in disagreement, but are likely to yield ambiguous results in the Great Barrier Reef Province, because of diffusive redistribution, owing to the low distribution coefficient, K/sub D/ = 420-800, measured in lagoonal sediments
A reexamination of some puzzling results in linearized elasticity
Indian Academy of Sciences (India)
University of North Carolina at Charlotte, Charlotte, NC 28223-0001, USA e-mail: jogc@mecheng.iisc.ernet.in; ..... ˆT (F) = C[ϵ] + o(∇u), where ϵ = [∇u+(∇u)T ]/2, and C = D ˆT (I) is the elasticity tensor, and one also linearizes the body force vector to get b = QT [ b∗ − ¨c. ] − ˙ × X − × ( × X) − 2 × v,. (5) where X is the position ...
Koopmans, M.P.; Schaeffer-Reiss, C.; De Leeuw, J. W.; Lewan, M.D.; Maxwell, J.R.; Schaeffer, P.; Sinninghe, Damste J.S.
1997-01-01
Sedimentary rock from the Gessoso-solfifera Formation (Messinian) in the Vena del Gesso Basin (northern Italy) containing immature (Ro = 0.25%) S-rich organic matter was artificially matured by hydrous pyrolysis at temperatures from 160 to 330??C for 72 h to study the diagenetic fate of n-C37 and n-C38 di-and tri-unsaturated methyl and ethyl ketones (alkenones) biosynthesised by several prymnesiophyte algae. During early diagenesis, the alkenones are incorporated into the kerogen by both sulphur and oxygen cross-linking as indicated by chemical degradation experiments with the kerogen of the unheated sample. Heating at temperatures between 160 and 260??C, which still represents early stages of thermal maturation, produces large amounts (up to 1 mg/g TOC) of S-bound, O-bound, and both S-and O-bound n-C37 and n-C38 skeletons, saturated n-C37 and n-C38 methyl, ethyl, and mid-chain ketones, C37 and C38 mid-chain 2,5-di-n-alkylthiophenes, C37 and C38 1,2-di-n-alkylbenzenes, and C37 and C38 n-alkanes. With increasing thermal maturation, three forms of the n-C37 and n-C38 skeletons are relatively stable (saturated hydrocarbons, 1,2-di-n-alkylbenzenes and saturated ketones), whereas the S-and O-bound skeletons are relatively labile. These results suggest that in natural situations saturated ketones with an n-C37 and n-C38 skeleton can be expected as well as the corresponding hydrocarbons. Copyright ?? 1997 Elsevier Science Ltd.
2013-05-16
... federal High-Speed Intercity Passenger Rail (HSIPR) program and includes the development of a Passenger.... Background The Atlanta-Charlotte Corridor faces mobility challenges. Transportation demand and travel growth... travel time and reliability, provide another reliable mode choice, create jobs, reduce dependence on...
Mueller, Andreas G.
2015-02-01
The Kalgoorlie district in the Archean Yilgarn Craton, Western Australia, comprises two world-class gold deposits: Mt Charlotte (144 t Au produced to 2013) in the northwest and the Golden Mile (1,670 t Au) in the southeast. Both occur in a folded greenschist-facies gabbro sill adjacent to the Golden Mile Fault (D2) in propylitic alteration associated with porphyry dikes. At Mt Charlotte, a shear array of fault-fill veins within the Golden Mile Fault indicates sinistral strike-slip during Golden Mile-type pyrite-telluride mineralization. The pipe-shaped Charlotte quartz vein stockwork, mined in bulk more than 1 km down plunge, is separated in time by barren D3 thrusts from Golden Mile mineralization and alteration, and occurs between two dextral strike-slip faults (D4). Movement on these faults generated an organized network of extension and shear fractures opened during the subsequent infiltration of high-pressure H2S-rich fluid at 2,655 ± 13 Ma (U-Pb xenotime). Gold was deposited during wall rock sulphidation in overlapping vein selvages zoned from deep albite-pyrrhotite (3 g/t Au) to upper muscovite-pyrite assemblages (5 g/t Au bulk grade). Chlorite and fluid inclusion thermometry indicate that this kilometre-scale zonation is due to fluid cooling from 410-440 °C at the base to 350-360 °C at the top of the orebody, while the greenstone terrane remained at 250 °C ambient temperature and at 300 MPa lithostatic pressure. The opened fractures filled with barren quartz and scheelite during the retrograde stage (300 °C) of the hydrothermal event. During fracture sealing, fluid flux was periodically restricted at the lower D3 thrust. Cycles of high and low up-flow, represented by juvenile H2O-CO2 and evolved H2O-CO2-CH4 fluid, respectively, are recorded by the REE and Sr isotope compositions of scheelite oscillatory zones. The temperature gradient measured in the vein stockwork points to a hot (>600 °C) fluid source 2-4 km below the mine workings, and several
Comparison of mechanical behavior of TiN, TiNC, CrN/TiNC, TiN/TiNC films on 9Cr18 steel by PVD
Feng, Xingguo; Zhang, Yanshuai; Hu, Hanjun; Zheng, Yugang; Zhang, Kaifeng; Zhou, Hui
2017-11-01
TiN, TiNC, CrN/TiNC and TiN/TiNC films were deposited on 9Cr18 steel using magnetron sputtering technique. The morphology, composition, chemical state and crystalline structure of the films were observed and analyzed by X-ray photoelectron spectroscopy (XPS), X-ray diffraction (XRD) and scanning electron microscopy (SEM). Hardness and adhesion force were tested by nanoindentation and scratch tester, respectively. The friction and wear behavior of TiN, TiNC, CrN/TiNC and TiN/TiNC films sliding against GCr15 balls were investigated and compared synthetically using ball-on-disk tribometer. It was found that Tisbnd N, Tisbnd C, Tisbnd Nsbnd C and Csbnd C bonds were formed. The TiN/TiNC film was composed of TiN, TiC and TiNC phases. Hardness and adhesion force results indicated that although the TiN film possessed the highest hardness, its adhesion force was lowest among all the films. Tribological test results showed that the friction coefficient of TiN/TiNC was much lower than that of TiN and the wear rate decreases remarkably from 2.3 × 10-15 m3/Nm to 7.1 × 10-16 m3/Nm, which indicated the TiN/TiNC film has better wear resistance.
Full Text Available ... St. Francis Hospital, Greenville, SC, 4/20/2012) Genetic Brain Disorders Treating Moyamoya Disease (Children's Hospital Boston, ... Carolina Urology Partners, Charlotte, NC, 7/01/2014) Genetics/Birth Defects Genetic Brain Disorders Treating Moyamoya Disease ( ...
Isolated posterior uveal effusion: expanding the spectrum of the uveal effusion syndrome
Directory of Open Access Journals (Sweden)
Pautler SE
2014-12-01
Full Text Available Scott E Pautler,1 David J Browning2 1Department of Ophthalmology, University of South Florida, Morsani College of Medicine, Tampa, FL, USA; 2Charlotte Ear Eye Nose and Throat Associates, Charlotte, NC, USA Abstract: Uveal effusion syndrome usually causes peripheral chorioretinal detachment, but posterior effusion may present as isolated macular edema with serous macular detachment in the setting of hyperopia and a thickened posterior choroid. Carbonic anhydrase inhibitors may be effective to treat this condition. Keywords: uveal effusion, serous, macular detachment, macular edema
76 FR 51954 - Procurement List Additions And Deletions
2011-08-19
... Services Administration. NSN: 8465-01-580-1316--Hydration System, MOLLE Components, OCP NSN: The Lighthouse..., MOLLE Components, Operation Enduring Freedom Camouflage Pattern (OCP) Multicam NSN: Lions Services, Inc., Charlotte, NC NSN: 8465-01-580-1303--Entrenching Tool [[Page 51955
Directory of Open Access Journals (Sweden)
Mariela E. Méndez
2010-03-01
Full Text Available
Drawing on the journalistic prose of two major literary figures of early-twentieth-century Argentina and the U.S., this article breaches cultural, national, and geographical frontiers by comparing the discursive gestures through which Alfonsina Storni and Charlotte Perkins Gilman re-appropriate for themselves the canonical genre of essay-writing to advance their feminist agendas. By undermining the presuppositions underlying so-called feminine publications of their time, both women carry out an intriguing disarticulation of the classic private/public divide that empowers their female readers to conceive of female subjectivity in new and innovative ways. Almost a mythic figure in the world of Latin American letters, Alfonsina Storni has achieved world renown as Argentina’s most famous “poetess of love,” thus obscuring her substantial contributions to Argentinean periodical literature. Even though Charlotte Perkins Gilman has become one of the most influential figures in the history of American First-Wave Feminism, that reputation is largely founded on her feminist fiction and her book Women and Economics, while her journalistic accomplishments have received considerably less attention. The transnational dialogue between these two writers conjured up in this article unearths this more or less neglected corpus to reveal the ways in which both subverted traditional definitions of gender through a transgressive use of discursive spaces heavily coded as “feminine” by patriarchal ideology.
Directory of Open Access Journals (Sweden)
Mariela E. Méndez
2010-03-01
Full Text Available Drawing on the journalistic prose of two major literary figures of early-twentieth-century Argentina and the U.S., this article breaches cultural, national, and geographical frontiers by comparing the discursive gestures through which Alfonsina Storni and Charlotte Perkins Gilman re-appropriate for themselves the canonical genre of essay-writing to advance their feminist agendas. By undermining the presuppositions underlying so-called feminine publications of their time, both women carry out an intriguing disarticulation of the classic private/public divide that empowers their female readers to conceive of female subjectivity in new and innovative ways. Almost a mythic figure in the world of Latin American letters, Alfonsina Storni has achieved world renown as Argentina’s most famous “poetess of love,” thus obscuring her substantial contributions to Argentinean periodical literature. Even though Charlotte Perkins Gilman has become one of the most influential figures in the history of American First-Wave Feminism, that reputation is largely founded on her feminist fiction and her book Women and Economics, while her journalistic accomplishments have received considerably less attention. The transnational dialogue between these two writers conjured up in this article unearths this more or less neglected corpus to reveal the ways in which both subverted traditional definitions of gender through a transgressive use of discursive spaces heavily coded as “feminine” by patriarchal ideology.
Assistant director of intramural sports and technology recognized for innovative contributions
Kropff, Catherine L.
2009-01-01
Jennifer Rezac, assistant director of intramural sports and technology at Virginia Tech, was recognized at the National Intramural-Recreational Sports Association (NIRSA) Annual Conference in Charlotte, N.C., in April for her contributions to the Virginia Tech Recreational Sports department.
2010-10-29
... LLP (``PwC'') Internal Firm Services Client Account Administrators Group, Charlotte, NC; Amended... Firm Services Client Account Administrators Group. Accordingly, the Department is amending this... Firm Services Client Account Administrators Group. The amended notice applicable to TA-W-73,608 is...
Eddies off the Queen Charlotte Islands
2002-01-01
The bright red, green, and turquoise patches to the west of British Columbia's Queen Charlotte Islands and Alaska's Alexander Archipelago highlight the presence of biological activity in the ocean. These colors indicate high concentrations of chlorophyll, the primary pigment found in phytoplankton. Notice that there are a number of eddies visible in the Pacific Ocean in this pseudo-color scene. The eddies are formed by strong outflow currents from rivers along North America's west coast that are rich in nutrients from the springtime snowmelt running off the mountains. This nutrient-rich water helps stimulate the phytoplankton blooms within the eddies. (For more details, read Tracking Eddies that Feed the Sea.) To the west of the eddies in the water, another type of eddy-this one in the atmosphere-forms the clouds into the counterclockwise spiral characteristic of a low pressure system in the Northern Hemisphere. (Click on the image above to see it at full resolution; or click to see the scene in true-color.) The snow-covered mountains of British Columbia are visible in the upper righthand corner of the image. This scene was constructed using SeaWiFS data collected on June 13, 2002. SeaWiFS image courtesy the SeaWiFS Project, NASA/Goddard Space Flight Center, and ORBIMAGE
2010-04-01
...”. (b) Approved maps. The appropriate maps for determining the boundaries of the Yadkin Valley...-Salem, N.C.; VA; Tenn. (1953, Limited Revision 1962), and, (2) Charlotte, North Carolina; South Carolina... North Carolina within Wilkes, Surry, Yadkin and portions of Stokes, Forsyth, Davidson, and Davie...
Female Factory Workers in Charlotte Elizabeth Tonna’s Quest
Directory of Open Access Journals (Sweden)
Fusco Carla
2016-12-01
Full Text Available Female workers represent a fundamental component of the workforce to the extent that it is true that the Industrial Revolution owes them a huge debt. However, despite the unfair exploitation of many women in factories in which conditions resembled manslaughter, they have been often neglected and reduced to liminal characters by Victorian novelists. An interesting exception in the early Victorian period is represented by the writer Charlotte Elizabeth Tonna, whose fiction works as a medium of social criticism. Her semi-fictional The Wrongs of Woman is a reform novel which sheds a controversial light on female working conditions. On the one hand she indeed deplores the inhuman treatment of female labourers, but on the other hand she also argues that female employment provokes a consequent increase in male unemployment! My paper aims to investigate the role of Tonna’s text and her attempt to alleviate working-class suffering.
Directory of Open Access Journals (Sweden)
Giovanna Tallone
2014-01-01
Full Text Available In her short story “The Secret Diary of Mrs Rochester”, Clare Boylan playfully uses a variation of the postmodern trend of “writing back” Victorian classics to create a sequel of Charlotte Brontë’s Jane Eyre (1847. Shedding light on Jane’s married life, Boylan makes a parody of Brontë’s language and narrative conventions making Jane an eccentric. In particular, the presence of closed spaces in the story replicates the claustrophobia of the red room in Jane Eyre, and from this point of view Boylan’s story bears parallelisms with Charlotte Perkins Gilman’s short story “The Yellow Wallpaper” (1892. Intertextuality and metanarrative perspectives of both stories draw attention to the textual space of the story and the elusive text that is being written/read. The “secret diary” assumed in the title is not the text that appears on the page. In both stories the protagonist and first-person narrator is engaged in writing an elusive text while confined in a secluded space.
Tomberlin, Jeffery K; Albert, A Midori; Byrd, Jason H; Hall, David W
2006-11-01
ABSTRACT Workshops are used for educating law enforcement personnel on the application of entomological, anthropological, and botanical techniques to gather forensically important information from a body recovery site. From 8 to 11 June 2004, such a workshop was conducted in the metropolitan area of Charlotte, NC, by the American Academy of Applied Forensics at Central Piedmont Community College. For this workshop, three pig carcasses weighing individually between 40 and 60 kg were placed in the field 4 June, whereas three pigs similar in size were placed in the field 7 June. During the afternoon session on 11 June, workshop participants collected three Chrysomya rufifacies (Macquart) (Diptera: Calliphoridae) third instar larvae from a pig carcass placed in the field on 7 June. These data represent the first records of this forensically important insect in North Carolina; furthermore, these data provide evidence of this species expansion into new geographic regions of the United States. This finding is an example of the benefits derived from an experiential and interdisciplinary approach to educating death scene investigators. Learners acquired new knowledge, put it into practice through the "body" recovery exercise, and ultimately contributed to science by way of the discovery and first documentation of a forensically important insect previously not known to inhabit North Carolina.
76 FR 7225 - National Institute of Environmental Health Sciences; Notice of Meetings
2011-02-09
... Environmental Health Sciences; Notice of Meetings Pursuant to section 10(a) of the Federal Advisory Committee..., National Institute of Environmental Health Sciences, 615 Davis Dr., KEY615/3112, Research Triangle Park, NC..., National Institute of Environmental Health Sciences, 615 Davis Dr., KEY615/3112, Research Triangle Park, NC...
Structural studies of n-type nc-Si-QD thin films for nc-Si solar cells
Das, Debajyoti; Kar, Debjit
2017-12-01
A wide optical gap nanocrystalline silicon (nc-Si) dielectric material is a basic requirement at the n-type window layer of nc-Si solar cells in thin film n-i-p structure on glass substrates. Taking advantage of the high atomic-H density inherent to the planar inductively coupled low-pressure (SiH4 + CH4)-plasma, development of an analogous material in P-doped nc-Si-QD/a-SiC:H network has been tried. Incorporation of C in the Si-network extracted from the CH4 widens the optical band gap; however, at enhanced PH3-dilution of the plasma spontaneous miniaturization of the nc-Si-QDs below the dimension of Bohr radius (∼4.5 nm) further enhances the band gap by virtue of the quantum size effect. At increased flow rate of PH3, dopant induced continuous amorphization of the intrinsic crystalline network is counterbalanced by the further crystallization promoted by the supplementary atomic-H extracted from PH3 (1% in H2) in the plasma, eventually holding a moderately high degree of crystallinity. The n-type wide band gap (∼1.93 eV) window layer with nc-Si-QDs in adequate volume fraction (∼52%) could furthermore be instrumental as an effective seed layer for advancing sequential crystallization in the i-layer of nc-Si solar cells with n-i-p structure in superstrate configuration.
Non-leptonic kaon decays at large Nc
Donini, Andrea; Hernández, Pilar; Pena, Carlos; Romero-López, Fernando
2018-03-01
We study the scaling with the number of colors Nc of the weak amplitudes mediating kaon mixing and decay, in the limit of light charm masses (mu = md = ms = mc). The amplitudes are extracted directly on the lattice for Nc = 3 - 7 (with preliminar results for Nc = 8 and 17) using twisted mass QCD. It is shown that the (sub-leading) 1 /Nc corrections to B\\hatk are small and that the naive Nc → ∞ limit, B\\hatk = 3/4, seems to be recovered. On the other hand, the O (1/Nc) corrections in K → ππ amplitudes (derived from K → π matrix elements) are large and fully anti-correlated in the I = 0 and I = 2 channels. This may have some implications for the understanding of the ΔI = 1/2 rule.
Pastor-Fernández, Iván; Arranz-Solís, David; Regidor-Cerrillo, Javier; Álvarez-García, Gema; Hemphill, Andrew; García-Culebras, Alicia; Cuevas-Martín, Carmen; Ortega-Mora, Luis M
2015-01-30
Currently there are no effective vaccines for the control of bovine neosporosis. During the last years several subunit vaccines based on immunodominant antigens and other proteins involved in adhesion, invasion and intracellular proliferation of Neospora caninum have been evaluated as targets for vaccine development in experimental mouse infection models. Among them, the rhoptry antigen NcROP2 and the immunodominant NcGRA7 protein have been assessed with varying results. Recent studies have shown that another rhoptry component, NcROP40, and NcNTPase, a putative dense granule antigen, exhibit higher expression levels in tachyzoites of virulent N. caninum isolates, suggesting that these could be potential vaccine candidates to limit the effects of infection. In the present work, the safety and efficacy of these recombinant antigens formulated in Quil-A adjuvant as monovalent vaccines or pair-wise combinations (rNcROP40+rNcROP2 and rNcGRA7+rNcNTPase) were evaluated in a pregnant mouse model of neosporosis. All the vaccine formulations elicited a specific immune response against their respective native proteins after immunization. Mice vaccinated with rNcROP40 and rNcROP2 alone or in combination produced the highest levels of IFN-γ and exhibited low parasite burdens and low IgG antibody levels after the challenge. In addition, most of the vaccine formulations were able to increase the median survival time in the offspring. However, pup survival only ensued in the groups vaccinated with rNcROP40+rNcROP2 (16.2%) and rNcROP2 (6.3%). Interestingly, vertical transmission was not observed in those survivor pups immunized with rNcROP40+rNcROP2, as shown by PCR analyses. These results show a partial protection against N. caninum infection after vaccination with rNcROP40+rNcROP2, suggesting a synergistic effect of the two recombinant rhoptry antigens. Copyright © 2014 Elsevier B.V. All rights reserved.
NC10 bacteria in marine oxygen minimum zones
DEFF Research Database (Denmark)
Padilla, Cory C; Bristow, Laura A; Sarode, Neha
2016-01-01
Bacteria of the NC10 phylum link anaerobic methane oxidation to nitrite denitrification through a unique O2-producing intra-aerobic methanotrophy pathway. A niche for NC10 in the pelagic ocean has not been confirmed. We show that NC10 bacteria are present and transcriptionally active in oceanic....... rRNA and mRNA transcripts assignable to NC10 peaked within the OMZ and included genes of the putative nitrite-dependent intra-aerobic pathway, with high representation of transcripts containing the unique motif structure of the nitric oxide (NO) reductase of NC10 bacteria, hypothesized...
Virtual NC machine model with integrated knowledge data
International Nuclear Information System (INIS)
Sidorenko, Sofija; Dukovski, Vladimir
2002-01-01
The concept of virtual NC machining was established for providing a virtual product that could be compared with an appropriate designed product, in order to make NC program correctness evaluation, without real experiments. This concept is applied in the intelligent CAD/CAM system named VIRTUAL MANUFACTURE. This paper presents the first intelligent module that enables creation of the virtual models of existed NC machines and virtual creation of new ones, applying modular composition. Creation of a virtual NC machine is carried out via automatic knowledge data saving (features of the created NC machine). (Author)
International Nuclear Information System (INIS)
DeForest Hauser, Cindy; Buckley, Alexandra; Porter, Juliana
2015-01-01
Charlotte, in Mecklenburg County, North Carolina, was ranked in the top ten cities with the worst air quality for ozone in the United States by the American Lung Association from 2009 to 2011. Nearby counties that may experience similar air quality do not have state or county monitors. This study utilized NO x and ozone Ogawa passive samplers and community scientists to monitor air quality in five counties surrounding Charlotte and increase public engagement in air quality issues. Community scientists deployed samplers weekly at a residential site within each county. Samples were analyzed using spectrophotometry and ion chromatography. Elevated NO x concentrations were observed in four of the five counties relative to those with existing monitors. Ozone concentrations showed little county to county variation, except Iredell and Cabarrus which had higher concentrations than Rowan. Community involvement in this work led to an increase in local dissemination of the results, thus increasing air quality awareness. - Highlights: • NO x concentrations in four adjacent counties were higher than the Mecklenburg site. • Ozone concentrations showed little county to county variation. • Passive samplers and community science can extend the air quality monitoring network. • Community science increases community awareness of air quality issues. - Regional community air quality monitoring is important in educating communities about air quality science issues that can impact personal health and behavior
A Statewide Partnership for Implementing Inquiry Science
Lytle, Charles
The North Carolina Infrastructure for Science Education (NC-ISE) is a statewide partnership for implementing standards-based inquiry science using exemplary curriculum materials in the public schools of North Carolina. North Carolina is the 11th most populous state in the USA with 8,000,000 residents, 117 school districts and a geographic area of 48,718 miles. NC-ISE partners include the state education agency, local school systems, three branches of the University of North Carolina, the state mathematics and science education network, businesses, and business groups. The partnership, based upon the Science for All Children model developed by the National Science Resources Centre, was initiated in 1997 for improvement in teaching and learning of science and mathematics. This research-based model has been successfully implemented in several American states during the past decade. Where effectively implemented, the model has led to significant improvements in student interest and student learning. It has also helped reduce the achievement gap between minority and non-minority students and among students from different economic levels. A key program element of the program is an annual Leadership Institute that helps teams of administrators and teachers develop a five-year strategic plan for their local systems. Currently 33 of the117 local school systems have joined the NC-ISE Program and are in various stages of implementation of inquiry science in grades K-8.
2013-03-18
... 33, Amdt 1 Willmar, MN, Willmar Muni-John L Rice Field, RNAV (GPS) RWY 31, Amdt 1 Charlotte, NC... Seattle, WA, Seattle-Tacoma Intl, RNAV (RNP) Z RWY 34L, Orig-A Newcastle, WY, Mondell Field, RNAV (GPS) RWY 13, Orig-A Newcastle, WY, Mondell Field, RNAV (GPS) RWY 31, Orig-A Effective 2 May 2013 Dunnellon...
Web site review. Carolinas HealthCare recognized Internet marketing potential early.
Botvin, Judith D
2005-01-01
Since the early days of the Internet, administrators Carolinas HealthCare System in Charlotte, NC, have appreciated its potential as a marketing tool. This places a lot of expectations on the Web site, www.carolinashealthcare.org, which is managed by the marketing-public relations department. Find out how the well-established site fulfills its mission and more.
Social Studies Fresh Frontier for Standards
Gewertz, Catherine
2011-01-01
Feeling that social studies has been sidelined by a test-driven focus on math and English/language arts, subject-matter specialists from more than a dozen states met last week with representatives of content-area groups to brainstorm ways to improve academic standards in that subject. The two-day gathering in Charlotte, N.C., is the third convened…
ncRNA consensus secondary structure derivation using grammar strings.
Achawanantakun, Rujira; Sun, Yanni; Takyar, Seyedeh Shohreh
2011-04-01
Many noncoding RNAs (ncRNAs) function through both their sequences and secondary structures. Thus, secondary structure derivation is an important issue in today's RNA research. The state-of-the-art structure annotation tools are based on comparative analysis, which derives consensus structure of homologous ncRNAs. Despite promising results from existing ncRNA aligning and consensus structure derivation tools, there is a need for more efficient and accurate ncRNA secondary structure modeling and alignment methods. In this work, we introduce a consensus structure derivation approach based on grammar string, a novel ncRNA secondary structure representation that encodes an ncRNA's sequence and secondary structure in the parameter space of a context-free grammar (CFG) and a full RNA grammar including pseudoknots. Being a string defined on a special alphabet constructed from a grammar, grammar string converts ncRNA alignment into sequence alignment. We derive consensus secondary structures from hundreds of ncRNA families from BraliBase 2.1 and 25 families containing pseudoknots using grammar string alignment. Our experiments have shown that grammar string-based structure derivation competes favorably in consensus structure quality with Murlet and RNASampler. Source code and experimental data are available at http://www.cse.msu.edu/~yannisun/grammar-string.
Inherent and antigen-induced airway hyperreactivity in NC mice
Directory of Open Access Journals (Sweden)
Tetsuto Kobayashi
1999-01-01
Full Text Available In order to clarify the airway physiology of NC mice, the following experiments were carried out. To investigate inherent airway reactivity, we compared tracheal reactivity to various chemical mediators in NC, BALB/c, C57BL/6 and A/J mice in vitro. NC mice showed significantly greater reactivity to acetylcholine than BALB/c and C57BL/6 mice and a reactivity comparable to that of A/J mice, which are known as high responders. Then, airway reactivity to acetylcholine was investigated in those strains in vivo. NC mice again showed comparable airway reactivity to that seen in A/J mice and a significantly greater reactivity than that seen in BALB/c and C57BL/6 mice. To investigate the effects of airway inflammation on airway reactivity to acetylcholine in vivo, NC and BALB/c mice were sensitized to and challenged with antigen. Sensitization to and challenge with antigen induced accumulation of inflammatory cells, especially eosinophils, in lung and increased airway reactivity in NC and BALB/c mice. These results indicate that NC mice exhibit inherent and antigen-induced airway hyperreactivity. Therefore, NC mice are a suitable strain to use in investigating the mechanisms underlying airway hyperreactivity and such studies will provide beneficial information for understanding the pathophysiology of asthma.
Olley, Jon; Brooks, Andrew; Spencer, John; Pietsch, Timothy; Borombovits, Daniel
2013-10-01
The Laura-Normanby River (catchment area: 24,350 km(2)), which drains into Princess Charlotte Bay, has been identified in previous studies as the third largest contributor of sediment to the Great Barrier Reef World Heritage Area. These catchment scale modelling studies also identified surface soil erosion as supplying >80% of the sediment. Here we use activity concentrations of the fallout radionuclides (137)Cs and (210)Pbex to test the hypothesis that surface soil erosion dominates the supply of fine (river systems draining into Princess Charlotte Bay. Our results contradict these previous studies, and are consistent with channel and gully erosion being the dominant source of fine sediment in this catchment. The hypothesis that surface soil erosion dominates the supply of fine sediment to Princess Charlotte Bay is rejected. River sediment samples were collected using both time-integrated samplers and sediment drape deposits. We show that there is no detectable difference in (137)Cs and (210)Pbex activity concentrations between samples collected using these two methods. Two methods were also used to collect samples to characterise (137)Cs and (210)Pbex concentrations in sediment derived from surface soil erosion; sampling of surface-wash deposits and deployment of surface runoff traps that collected samples during rain events. While there was no difference in the (137)Cs activity concentrations for samples collected using these two methods, (210)Pbex activity concentrations were significantly higher in the samples collected using the runoff traps. The higher (210)Pbex concentrations are shown to be correlated with loss-on-ignition (r(2) = 0.79) and therefore are likely to be related to higher organic concentrations in the runoff trap samples. As a result of these differences we use a three end member mixing model (channel/gully, hillslope surface-wash and hillslope runoff traps) to determine the relative contribution from surface soil erosion. Probability
Explorations of the extended ncKP hierarchy
International Nuclear Information System (INIS)
Dimakis, Aristophanes; Mueller-Hoissen, Folkert
2004-01-01
A recently obtained extension (xncKP) of the Moyal-deformed KP hierarchy (ncKP hierarchy) by a set of evolution equations in the Moyal-deformation parameters is further explored. Formulae are derived to compute these equations efficiently. Reductions of the xncKP hierarchy are treated, in particular to the extended ncKdV and ncBoussinesq hierarchies. Furthermore, a good part of the Sato formalism for the KP hierarchy is carried over to the generalized framework. In particular, the well-known bilinear identity theorem for the KP hierarchy, expressed in terms of the (formal) Baker-Akhiezer function, extends to the xncKP hierarchy. Moreover, it is demonstrated that N-soliton solutions of the ncKP equation are also solutions of the first few deformation equations. This is shown to be related to the existence of certain families of algebraic identities
Energy Technology Data Exchange (ETDEWEB)
Tu, A. [BC Hydro, Burnaby, BC (Canada)
2008-07-01
Remote communities may benefit from using tidal energy in terms of reduced diesel fuel consumption and the associated greenhouse gas emissions. A study was conducted to assess the feasibility for a tidal demonstration project on the Haida Gwaii, Queen Charlotte Islands. Candidate communities were scanned for resource potential, load profile, infrastructure distribution and community interest. This presentation focused on choosing an appropriate site for a given tidal power technology. Three hotspots in Masset Sound were identified as well as one hotspot at Juskatla Narrows. Technology providers were solicited for information on unit performance, cost, and trials to date. The presentation noted that demonstration or future commercial deployment is limited by resource and by the ability of the grid to accommodate tidal power. The presentation concluded with next steps which include publishing the study. tabs., figs.
Poetics of Space in Charlotte Perkins Gilman’s Story ‘Yellow Wallpaper’
Directory of Open Access Journals (Sweden)
Marina S. Berezhnaya
2017-12-01
Full Text Available The article deals with the poetics of space, system of images including the image of the yellow wallpaper in the story written by Charlotte Perkins Gilman. The story became an unconventional example and innovative writing approach of using an artistic ‘optics’ for describing women’s role and position within patriarchal society at the turn of XIX-XX centuries. The space of the room can be perceived as some disciplinary practice (panopticon endowed with peculiar units of control and suppression (bars, wallpaper pattern, nailed bed, etc. as opposed to images, retrieved from out of the depth of the protagonist’s unconsciousness. The interrelatedness of material outward environment and individual mind reveals the evolution of deeply buried and hidden imagery. Though artistic categories such as smell, color, shape (pattern Gilman render an invaluable insight into reception and interpretation of the key image of the novel.
The Defense Commissary Agency: A Business Case for Electronic Data Interchange
1993-09-01
4,818 51 33 Armour Foodd Co. Omaha, NE 2,603 21.3 1,913 114 34 Tree Top Inc. Chicago, IL 2.596 21.7 1,247 161 35 Reckitt & Colman, Inc. Lehigh Valley...Grocery Dallas, TX 1,388 46.2 1,002 195 127 Bisek And Co. Virginia Beach, VA 1,387 46.4 446 315 128 Benckiser Consultants Charlotte, NC 1,381 46.6
2006-07-13
manufacturing capabilities.” DMSMS Influences • Performance Requirement Challenges – Fabrication accuracies orders of magnitude beyond metal machining ...Conference July 11, 2006 - Charlotte, NC Background There is a global transition to lead-free Reduction of Hazardous Substances (RoHS) EU Directive banning ...Medical/Dental, 5.4% Gaming/ Vending Equipment, 0.8% Computer Peripherals, 7.7% Military/Aerospace, 20.5% Communications (RF/Wireless), 6.4% Commercial
2015-11-01
preliminary validity of the Walking and Remembering Test. Journal of geriatric physical therapy . 2009;32(1):2-9. 23. Mancini M, Salarian A, Carlson-Kuhta P...MacMillan), American Physical Therapy Association (APTA) 2014 Annual conference, Charlotte, NC 88 August 18-21, 2014 (paper) A novel dual...Multitasking Performance for Mild TBI. Federal Section, American Physical Therapy Association’s Combined Section Meeting, (Weightman, Scherer, McCulloch
An overview on STEP-NC compliant controller development
Othman, M. A.; Minhat, M.; Jamaludin, Z.
2017-10-01
The capabilities of conventional Computer Numerical Control (CNC) machine tools as termination organiser to fabricate high-quality parts promptly, economically and precisely are undeniable. To date, most CNCs follow the programming standard of ISO 6983, also called G & M code. However, in fluctuating shop floor environment, flexibility and interoperability of current CNC system to react dynamically and adaptively are believed still limited. This outdated programming language does not explicitly relate to each other to have control of arbitrary locations other than the motion of the block-by-block. To address this limitation, new standard known as STEP-NC was developed in late 1990s and is formalized as an ISO 14649. It adds intelligence to the CNC in term of interoperability, flexibility, adaptability and openness. This paper presents an overview of the research work that have been done in developing a STEP-NC controller standard and the capabilities of STEP-NC to overcome modern manufacturing demands. Reviews stated that most existing STEP-NC controller prototypes are based on type 1 and type 2 implementation levels. There are still lack of effort being done to develop type 3 and type 4 STEP-NC compliant controller.
78 FR 72009 - Establishment of Class E Airspace; Star, NC
2013-12-02
...-0440; Airspace Docket No. 13-ASO-10] Establishment of Class E Airspace; Star, NC AGENCY: Federal... at Star, NC, to accommodate a new Area Navigation (RNAV) Global Positioning System (GPS) Standard... Federal Register a notice of proposed rulemaking to establish Class E airspace at Star, NC (78 FR 54413...
78 FR 24071 - Safety Zone; Pasquotank River; Elizabeth City, NC
2013-04-24
... 1625-AA00 Safety Zone; Pasquotank River; Elizabeth City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary... Pasquotank River in Elizabeth City, NC in support of the Fireworks display for the Potato Festival. This... Guard is establishing a safety zone on the navigable waters of Pasquotank River in Elizabeth City, NC...
Software module for geometric product modeling and NC tool path generation
International Nuclear Information System (INIS)
Sidorenko, Sofija; Dukovski, Vladimir
2003-01-01
The intelligent CAD/CAM system named VIRTUAL MANUFACTURE is created. It is consisted of four intelligent software modules: the module for virtual NC machine creation, the module for geometric product modeling and automatic NC path generation, the module for virtual NC machining and the module for virtual product evaluation. In this paper the second intelligent software module is presented. This module enables feature-based product modeling carried out via automatic saving of the designed product geometric features as knowledge data. The knowledge data are afterwards applied for automatic NC program generation for the designed product NC machining. (Author)
Attack Helicopter Operations: Art or Science
1991-05-13
ATTACK HELICOPTER OPERATIONS: ART OR SCIENCE ? BY LIEUTENANT COLONEL JAN CALLEN United States Army DISTRIBUTION STATEMENT A: Approved for public release...TASK IWORK UNIT ELEMENT NO. NO. NO. ACCESSION NC 11. TITLE (Include Socurity Classification) Attack Helicopter Operations: Art or Science ? 12. PERSONAL...OPERATIONS: ART OR SCIENCE ? AN INDIVIDUAL STUDY PROJECT by Lieutenant Colonel Jan Callen United States Army Colonel Greg Snelgrove Project Adviser U.S
MOF derived Ni/Co/NC catalysts with enhanced properties for oxygen evolution reaction
Hu, Jiapeng; Chen, Juan; Lin, Hao; Liu, Ruilai; Yang, Xiaobing
2018-03-01
Designing efficient electrocatalysts for oxygen evolution reaction (OER) is very important for renewable energy storage and conversion devices. In this paper, we introduced a new strategy to synthesize Ni doped Co/NC catalysts (NC is the abbreviation of nitrogen-doped graphitic carbon), which were derived from ZIF-67. All catalysts were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscope (TEM) and oxygen evolution reaction (OER). The results show that Ni was well doped in the Ni/Co/NC catalysts and the doping of Ni has great influence on the OER activity of Ni/Co/NC catalysts. Among these catalysts, 0.50Ni/Co/NC exhibits the highest OER activity. The onset potential of 0.50Ni/Co/NC is 1.47 V, which is superior than the onset potential of Co/NC (1.54 V), 0.25Ni/Co/NC (1.48 V), 1.00Ni/Co/NC (1.53 V). The excellent OER activity of 0.50Ni/Co/NC catalyst makes its potential to be used on renewable energy storage.
Development of STEP-NC Adaptor for Advanced Web Manufacturing System
Ajay Konapala, Mr.; Koona, Ramji, Dr.
2017-08-01
Information systems play a key role in the modern era of Information Technology. Rapid developments in IT & global competition calls for many changes in basic CAD/CAM/CAPP/CNC manufacturing chain of operations. ‘STEP-NC’ an enhancement to STEP for operating CNC machines, creating new opportunities for collaborative, concurrent, adaptive works across the manufacturing chain of operations. Schemas and data models defined by ISO14649 in liaison with ISO10303 standards made STEP-NC file rich with feature based, rather than mere point to point information of G/M Code format. But one needs to have a suitable information system to understand and modify these files. Various STEP-NC information systems are reviewed to understand the suitability of STEP-NC for web manufacturing. Present work also deals with the development of an adaptor which imports STEP-NC file, organizes its information, allowing modifications to entity values and finally generates a new STEP-NC file to export. The system is designed and developed to work on web to avail additional benefits through the web and also to be part of a proposed ‘Web based STEP-NC manufacturing platform’ which is under development and explained as future scope.
Inherent and antigen-induced airway hyperreactivity in NC mice
Tetsuto Kobayashi; Toru Miura; Tomoko Haba; Miyuki Sato; Masao Takei; Isao Serizawa
1999-01-01
In order to clarify the airway physiology of NC mice, the following experiments were carried out. To investigate inherent airway reactivity, we compared tracheal reactivity to various chemical mediators in NC, BALB/c, C57BL/6 and A/J mice in vitro. NC mice showed significantly greater reactivity to acetylcholine than BALB/c and C57BL/6 mice and a reactivity comparable to that of A/J mice, which are known as high responders. Then, airway reactivity to acetylcholine was investigated in those st...
Late Miocene mollusks from the Queen Charlotte Islands, British Columbia, Canada
Addicott, Warren O.
1978-01-01
A fauna of bivalve mollusks, scattered gastropods, and an echinoid from exposures of the Skonun Formation in the northeastern part of Graham Island is indicative of an early late Miocene age and correlation with the provincial Wishkahan Stage. The molluscan assemblages are from the upper 600 of the 1800-m-thick marine and nonmarine formation, which appears to be entirely of late Miocene age. The Skonun Formation is the strandline fa.cies of marginal marine and nonmarine deposits of the northwestern part of the Queen Charlotte basin, a Nieogene embayment paralleling the modern mainland coast. The molluscan fauna and associated lignite beds are known from a few widely scattered outcrops; they are indicative of alternating marine and nonmarine to brackish-water environments in the upper part of the formation. The Skonun fauna occurs near the northern boundary of the Pacific Northwest Neogene molluscan province. It is the only marine Neogene molluscan fauna known from the British Columbia coast. The fauna has strong taxonomic ties with the fauna of the Empire Formation of southwestern Oregon and has several species in common with the upper Miocene of the Lituya district, southeastern Alaska, implying that these three faunas are coeval.
Bales, Jerad D.; Weaver, J. Curtis; Robinson, Jerald B.
1999-01-01
Streamflow and water-quality data were collected at nine sites in the city of Charlotte and Mecklenburg County, North Carolina, during 1993–97. Six of the basins drained areas having relatively homogeneous land use and were less than 0.3 square mile in size; the other three basins had mixed land use. Atmospheric wet-deposition data were collected in three of the basins during 1997–98.Streamflow yield varied by a factor of six among the sites, despite the fact that sites were in close proximity to one another. The lowest yield occurred in a residential basin having no curbs and gutters. The variability in mean flow from these small, relatively homogeneous basins is much greater than is found in streams draining basins that are 10 square miles in size or larger. The ratio of runoff to rainfall in the developing basin appears to have increased during the study period.Low-flow suspended-sediment concentrations in the study basins were about the same magnitude as median stormflow concentrations in Piedmont agricultural basins. Sediment concentrations were higher in the mixed land-use basins and in the developing basin. Median suspended-sediment concentrations in these basins generally were an order of magnitude greater than median concentrations in the other five basins, which had stable land use.Some of the highest total nitrogen concentrations occurred in residential basins. Total nitrogen concentrations detected in this study were about twice as high as concentrations in small Piedmont streams affected by agriculture and urbanization. Most of the total nitrogen consisted of organic nitrogen at all of the sites except in two residential land- use basins. The high ammonia content of lawn fertilizer may explain the higher ammonia concentration in stormflow from residential basins.The two basins with the highest median suspended-sediment concentrations also had the highest total phosphorus concentrations. Median total phosphorus concentrations measured in this study
On pseudorandom generators in NC0
DEFF Research Database (Denmark)
Cryan, Mary; Miltersen, Peter Bro
2001-01-01
In this paper we consider the question of whether NC 0 circuits can generate pseudorandom distributions. While we leave the general question unanswered, we show – • Generators computed by NC 0 circuits where each output bit depends on at most 3 input bits (i.e, DNC 3 0 circuits) and with stretch ...
Directory of Open Access Journals (Sweden)
Liner K
2018-01-01
Full Text Available Kendall Liner,1 Celeste Brown,2 Laura Y McGirt3 1Division of Dermatology, Medical College of Georgia at Augusta Health, Augusta, GA, USA; 2School of Medicine, University of North Carolina at Chapel Hill, Carolinas Medical Center, Charlotte, NC, USA; 3Department of Hematology/Oncology, Levine Cancer Institute, Carolinas Medical Center, Charlotte, NC, USA Abstract: Nitrogen mustard is a chemotherapeutic agent that has a well-documented safety and efficacy profile in the treatment of cutaneous T-cell lymphoma. Development of nitrogen mustard formulations and treatment regimens has been studied extensively over the last 40 years. In the last 5 years, a new gel formulation has been developed that is associated with a decrease in delayed hypersensitivity reactions. The authors in this review found that while the gel formulation may result in a decrease of allergic contact dermatitis, this advantage has been replaced by a higher number of irritant contact reactions and a decrease in complete response rate. The gel formulation has a complete response rate of 13.8%, which is a decrease in efficacy when compared to aqueous-based preparations of similar concentrations. Keywords: mycosis fungoides, nitrogen mustard, mechlorethamine gel, cutaneous T-cell lymphoma, CTCL, Valchlor®
Bulletin of Materials Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
... and Optronics (NILOP), Photonics Division, P.O. Nilore 45650, Islamabad, Pakistan; Trinity College Dublin (TCD), School of Physics, Dublin, Ireland; Department of Chemistry, University of Peshawar, Peshawar 45000, Pakistan; Department of Electrical and Computer Engineering, University of North Carolina at Charlotte, ...
78 FR 54413 - Proposed Establishment of Class E Airspace; Star, NC
2013-09-04
...-0440; Airspace Docket No. 13-ASO-10] Proposed Establishment of Class E Airspace; Star, NC AGENCY... action proposes to establish Class E Airspace at Star, NC, to accommodate a new Area Navigation (RNAV... establish Class E airspace at Star, NC, providing the controlled airspace required to support the new RNAV...
Characterizing ncRNAs in human pathogenic protists using high-throughput sequencing technology
Directory of Open Access Journals (Sweden)
Lesley Joan Collins
2011-12-01
Full Text Available ncRNAs are key genes in many human diseases including cancer and viral infection, as well as providing critical functions in pathogenic organisms such as fungi, bacteria, viruses and protists. Until now the identification and characterization of ncRNAs associated with disease has been slow or inaccurate requiring many years of testing to understand complicated RNA and protein gene relationships. High-throughput sequencing now offers the opportunity to characterize miRNAs, siRNAs, snoRNAs and long ncRNAs on a genomic scale making it faster and easier to clarify how these ncRNAs contribute to the disease state. However, this technology is still relatively new, and ncRNA discovery is not an application of high priority for streamlined bioinformatics. Here we summarize background concepts and practical approaches for ncRNA analysis using high-throughput sequencing, and how it relates to understanding human disease. As a case study, we focus on the parasitic protists Giardia lamblia and Trichomonas vaginalis, where large evolutionary distance has meant difficulties in comparing ncRNAs with those from model eukaryotes. A combination of biological, computational and sequencing approaches has enabled easier classification of ncRNA classes such as snoRNAs, but has also aided the identification of novel classes. It is hoped that a higher level of understanding of ncRNA expression and interaction may aid in the development of less harsh treatment for protist-based diseases.
Characterizing ncRNAs in Human Pathogenic Protists Using High-Throughput Sequencing Technology
Collins, Lesley Joan
2011-01-01
ncRNAs are key genes in many human diseases including cancer and viral infection, as well as providing critical functions in pathogenic organisms such as fungi, bacteria, viruses, and protists. Until now the identification and characterization of ncRNAs associated with disease has been slow or inaccurate requiring many years of testing to understand complicated RNA and protein gene relationships. High-throughput sequencing now offers the opportunity to characterize miRNAs, siRNAs, small nucleolar RNAs (snoRNAs), and long ncRNAs on a genomic scale, making it faster and easier to clarify how these ncRNAs contribute to the disease state. However, this technology is still relatively new, and ncRNA discovery is not an application of high priority for streamlined bioinformatics. Here we summarize background concepts and practical approaches for ncRNA analysis using high-throughput sequencing, and how it relates to understanding human disease. As a case study, we focus on the parasitic protists Giardia lamblia and Trichomonas vaginalis, where large evolutionary distance has meant difficulties in comparing ncRNAs with those from model eukaryotes. A combination of biological, computational, and sequencing approaches has enabled easier classification of ncRNA classes such as snoRNAs, but has also aided the identification of novel classes. It is hoped that a higher level of understanding of ncRNA expression and interaction may aid in the development of less harsh treatment for protist-based diseases. PMID:22303390
Yagishita, Koji
1994-01-01
Diagenesis of sediments derived from a magmatic arc provenance may greatly differ from that of sediments derived from an intracratonic- or foreland-type provenance. Sediments from the magmatic arc are compositionally immature and rich in volcanic and sedimentary rock fragments. Sandstone samples of mid- to Upper Cretaceous formations in the Queen Charlotte Islands, British Columbia, Canada, contain either large amounts of pseudomatrix or authigenic cements. An inverse relationship between the...
76 FR 7572 - National Institute of Environmental Health Sciences; Notice of Meetings
2011-02-10
... Environmental Health Sciences; Notice of Meetings Pursuant to section 10(a) of the Federal Advisory Committee..., Director, Division of Extramural Research and Training, National Institute of Environmental Health Sciences... of Environmental Health Sciences, 615 Davis Dr., KEY615/3112, Research Triangle Park, NC 27709, (919...
Design of type X-IV atmospheric pressure capsule for irradiation test based on JSME S NC-1 2005
International Nuclear Information System (INIS)
Murao, Hiroyuki; Muramatsu, Yasuyuki; Ohkawara, Masami; Shibata, Isao
2007-02-01
In NSRR (Nuclear Safety Research Reactor) experiments, test fuels are inserted in the especial capsule and the capsule will be inserted into the experimental tube which is located in the center of reactor core. In NSRR, there are 17 types of atmospheric pressure capsule, and one of them Type X-IV atmospheric pressure capsule has been produced 6 times under authorization of Ministry of Education, Culture, Sports, Science and Technology (MEXT). Application for the 7th time of authorization was submitted to the MEXT in June 2006. On this application, standard which is used to design was changed to The Japan Society of Mechanical Engineers (JSME) S NC1-2005 from the Notification 501 of the Ministry of Economy, Trade and Industry (METI). The JSME S NC1-2005 introduced the service condition in addition to the reactor condition which has been used in the Notification 501. In this application, stress limits were calculated based on the service condition. The JSME S NC1-2005 requires estimation of combined stress for Class1 support structures, which was unnecessary in the Notification 501. In this application, combined stresses were calculated and confirmed not to exceed the stress limits. (author)
The baryon vector current in the combined chiral and 1/Nc expansions
Energy Technology Data Exchange (ETDEWEB)
Flores-Mendieta, Ruben; Goity, Jose L [JLAB
2014-12-01
The baryon vector current is computed at one-loop order in large-Nc baryon chiral perturbation theory, where Nc is the number of colors. Loop graphs with octet and decuplet intermediate states are systematically incorporated into the analysis and the effects of the decuplet-octet mass difference and SU(3) flavor symmetry breaking are accounted for. There are large-Nc cancellations between different one-loop graphs as a consequence of the large-Nc spin-flavor symmetry of QCD baryons. The results are compared against the available experimental data through several fits in order to extract information about the unknown parameters. The large-Nc baryon chiral perturbation theory predictions are in very good agreement both with the expectations from the 1/Nc expansion and with the experimental data. The effect of SU(3) flavor symmetry breaking for the |Delta S|=1 vector current form factors f1(0) results in a reduction by a few percent with respect to the corresponding SU(3) symmetric values.
75 FR 9538 - Proposed Modification of Class B Airspace; Charlotte, NC
2010-03-03
... Operations, M-30, 1200 New Jersey Avenue, SE., West Building Ground Floor, RoomW12-140, Washington, DC 20590..., SW., Washington, DC 20591; telephone: (202) 267-8783. SUPPLEMENTARY INFORMATION: Comments Invited... area north of CLT from a point where the 14 NM arc intersects Highway 321 then clockwise to intersect...
33 CFR 110.170 - Lockwoods Folly Inlet, N.C.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Lockwoods Folly Inlet, N.C. 110.170 Section 110.170 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.170 Lockwoods Folly Inlet, N.C. (a) Explosives...
Koopmans, Martin P.; Schaeffer-Reiss, Christine; de Leeuw, Jan W.; Lewan, Michael D.; Maxwell, James R.; Schaeffer, Philippe; Sinninghe Damsté, Jaap S.
1997-06-01
Sedimentary rock from the Gessoso-solfifera Formation (Messinian) in the Vena del Gesso Basin (northern Italy) containing immature ( Ro = 0.25%) S-rich organic matter was artificially matured by hydrous pyrolysis at temperatures from 160 to 330°C for 72 h to study the diagenetic fate of n-C 37 and n-C 38 di- and tri-unsaturated methyl and ethyl ketones (alkenones) biosynthesised by several prymnesiophyte algae. During early diagenesis, the alkenones are incorporated into the kerogen by both sulphur and oxygen cross-linking as indicated by chemical degradation experiments with the kerogen of the unheated sample. Heating at temperatures between 160 and 260°C, which still represents early stages of thermal maturation, produces large amounts (up to 1 mg/g TOC) of S-bound, O-bound, and both S- and O-bound n-C 37 and n-C 38 skeletons, saturated n-C 37 and n-C38 methyl, ethyl, and mid-chain ketones, C 37 and C 38 mid-chain 2,5-di- n-alkylthiophenes, C 37 and C 38 1,2-di- n-alkylbenzenes, and C 37 and C 38n-alkanes. With increasing thermal maturation, three forms of the n-C 37 and n-C 38 skeletons are relatively stable (saturated hydrocarbons, 1,2-di- n-alkylbenzenes and saturated ketones), whereas the S- and O-bound skeletons are relatively labile. These results suggest that in natural situations saturated ketones with an n-C 37 and n-C 38 skeleton can be expected as well as the corresponding hydrocarbons.
2011-09-16
... Information Collection Activities: Proposed New Collection--Social Science Assessment and Geographic Analysis...: OMB Control Number: 1024-NEW. Title: Social Science Assessment and Geographic Analysis of Marine... for Coastal Science and Policy, Mail Stop 250, Flanagan, East Carolina University, Greenville, NC...
76 FR 52672 - National Institute of Environmental Health Sciences; Notice of Closed Meeting
2011-08-23
... Environmental Health Sciences; Notice of Closed Meeting Pursuant to section 10(d) of the Federal Advisory.... of Environmental Health Sciences, Keystone Building, 530 Davis Drive, Research Triangle Park, NC..., Division of Extramural Research and Training, Nat. Institute of Environmental Health Sciences, P.O. Box...
75 FR 55805 - National Institute of Environmental Health Sciences; Notice of Meeting
2010-09-14
... Environmental Health Sciences; Notice of Meeting Pursuant to section 10(a) of the Federal Advisory Committee Act... Environmental Health Sciences, 615 Davis Dr., KEY615/3112, Research Triangle Park, NC 27709. (919) 541-4980... Environmental Health Sciences; 93.113, Biological Response to Environmental Health Hazards; 93.114, Applied...
1990-11-15
FRANCISCO J. SAEZ DE LA MAZA was born Madrid 1985 in 1947. He graduated as a B.S. in 1967 at Santander Technical University. He 3. COMUNICACIONES POR...Bare Base on Shielding Materials for Underground Telephone Ca- Electrical Systems" bles" N. J. Cogelia, Bell Telephone Laboratories and G. K. La - 1976...Qorp. Charlotte, NC Pioneer Indu-trial Park, Gitto Dr. Bell Canada Leominster, MA 700 La Gauchetiere W. RM 18E2 GE Plastics Montreal, Quebec, Canada
Reliability and validity of the Safe Routes to school parent and student surveys
McDonald, Noreen C; Dwelley, Amanda E; Combs, Tabitha S; Evenson, Kelly R; Winters, Richard H
2011-01-01
Abstract Background The purpose of this study is to assess the reliability and validity of the U.S. National Center for Safe Routes to School's in-class student travel tallies and written parent surveys. Over 65,000 tallies and 374,000 parent surveys have been completed, but no published studies have examined their measurement properties. Methods Students and parents from two Charlotte, NC (USA) elementary schools participated. Tallies were conducted on two consecutive days using a hand-raisi...
77 FR 22793 - National Institute of Environmental Health Sciences; Notice of Closed Meetings
2012-04-17
... Environmental Health Sciences; Notice of Closed Meetings Pursuant to section 10(d) of the Federal Advisory.... Institute of Environmental Health Sciences, P.O. Box 12233, MD EC-30, Research Triangle Park, NC 27709, (919....D., Scientific Review Administrator, Nat. Institute of Environmental Health Sciences, Office of...
77 FR 6569 - National Institute of Environmental Health Sciences; Notice of Closed Meeting
2012-02-08
... Environmental Health Sciences; Notice of Closed Meeting Pursuant to section 10(d) of the Federal Advisory... Health Sciences, Special Emphasis Panel, Environmental Stem Cells Research. Date: February 29-March 2... of Environmental Health Sciences, P.O. Box 12233, MD EC-30, Research Triangle Park, NC 27709, (919...
77 FR 40076 - National Institute of Environmental Health Sciences; Notice of Closed Meeting
2012-07-06
... Environmental Health Sciences; Notice of Closed Meeting Pursuant to section 10(d) of the Federal Advisory... Environmental Health Sciences, P.O. Box 12233, MD EC-30 Research Triangle Park, NC 27709, (919) 541- 0752... Manpower Development in the Environmental Health Sciences; 93.113, Biological Response to Environmental...
77 FR 16844 - National Institute of Environmental Health Sciences; Notice of Closed Meetings
2012-03-22
... Environmental Health Sciences; Notice of Closed Meetings Pursuant to section 10(d) of the Federal Advisory.... Institute Environmental Health Sciences, P.O. Box 12233, MD EC-30, Research Triangle Park, NC 27709, (919) 541-1307, [email protected] . Name of Committee: National Institute of Environmental Health Sciences...
75 FR 10293 - National Institute of Environmental Health Sciences; Notice of Closed Meeting
2010-03-05
... Environmental Health Sciences; Notice of Closed Meeting Pursuant to section 10(d) of the Federal Advisory.... Institute Environmental Health Sciences, P. O. Box 12233, MD EC-30, Research Triangle Park, NC 27709, (919... Health Sciences; 93.113, Biological Response to Environmental Health Hazards; 93.114, Applied...
Directory of Open Access Journals (Sweden)
Armelle Parey
2009-10-01
Full Text Available D.M. Thomas’s rewriting of Jane Eyre in Charlotte (2000 takes the shape of a transformation of the ending which enables the second Mrs Rochester’s story to be continued in the West Indies, thus also acknowledging Jean Rhys’s Wide Sargasso Sea as another intertext. In order to challenge the narrative and ideological hierarchy of the source text by rewriting its ending, the pastiche defamiliarises it while some chapters set in 1999 move the limits of rewriting and take the reader into a narrative spiral.
78 FR 59944 - National Institute of Environmental Health Sciences; Notice of Closed Meeting
2013-09-30
... Environmental Health Sciences; Notice of Closed Meeting Pursuant to section 10(d) of the Federal Advisory... Institute of Environmental Health Sciences, P.O. Box 12233, MD EC-30, Research Triangle Park, NC 27709, (919... [[Page 59945
Noise in NC-AFM measurements with significant tip–sample interaction
Directory of Open Access Journals (Sweden)
Jannis Lübbe
2016-12-01
Full Text Available The frequency shift noise in non-contact atomic force microscopy (NC-AFM imaging and spectroscopy consists of thermal noise and detection system noise with an additional contribution from amplitude noise if there are significant tip–sample interactions. The total noise power spectral density DΔf(fm is, however, not just the sum of these noise contributions. Instead its magnitude and spectral characteristics are determined by the strongly non-linear tip–sample interaction, by the coupling between the amplitude and tip–sample distance control loops of the NC-AFM system as well as by the characteristics of the phase locked loop (PLL detector used for frequency demodulation. Here, we measure DΔf(fm for various NC-AFM parameter settings representing realistic measurement conditions and compare experimental data to simulations based on a model of the NC-AFM system that includes the tip–sample interaction. The good agreement between predicted and measured noise spectra confirms that the model covers the relevant noise contributions and interactions. Results yield a general understanding of noise generation and propagation in the NC-AFM and provide a quantitative prediction of noise for given experimental parameters. We derive strategies for noise-optimised imaging and spectroscopy and outline a full optimisation procedure for the instrumentation and control loops.
ORF Sequence: NC_002695 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002695 gi|15830145 >gi|15830145|ref|NP_308918.1| putative transmembrane subunit...IFVPIGALQAGEALWHWSVIPLGLAVAILSTALPYSLEMIALTRLPTRTFGTLMSMEPALAAVSGMIFLGETLTPIQLLALGAIIAASMGSTLTVRKESKIKELDIN
ORF Sequence: NC_004307 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004307 gi|23464690 >gi|23464690|ref|NP_695293.1| hypothetical transmembrane pro...LVQLCAMGFIIGYVIRSNNVWMVFSLMAVMLVAAVQIVMSRARGIPKGLAGPIFLSLVITMLLMLALVTELIVRPHPWYAPQLVVPLTGMLLGNTVSALAVGLSRFYESME
ORF Sequence: NC_005027 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005027 gi|32471017 >gi|32471017|ref|NP_864010.1| hypothetical protein-transmemb...HALISRLRIWGRETLTEMPSWLVSMVVHLTLLLVLALIGRSTSKVGQIELLFRQSSESSSMELAEFTIAAAAPLESFERSMEEERIATTQLVSIDVIDAEAEMFSLVP
ORF Sequence: NC_002942 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002942 gi|52840424 >gi|52840424|ref|YP_094223.1| probable transmembrane protein...EYKRAQKQTFVMFFKGSLKGLVTTAPVTYRGVKIGEVKVIEITENKEHSKVLIPVYVQFFVERTYGFSQDPIHLLIDNGYVANITKPNLLTGVAEIELIKPTPAVKYKQTYYHSYPVFPTHNSAEKYTSME
ORF Sequence: NC_005027 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005027 gi|32476407 >gi|32476407|ref|NP_869401.1| hypothetical protein-transmemb...IYPDDRPGWIDQPIVNDGKDYSLVVTAGPSGSMEEADELIGVYARGAVQSYVDELVSEQEWATEPEMIPLDIDWIRDELVVRRYEGVVQVGDEQQFEKAILIRIEPEDKKVFETAIADMKLKERLAATGIVILGGFSLLVGGSIVLGGLASRQKQPTAAA
75 FR 45133 - National Institute of Environmental Health Sciences; Notice of Closed Meeting
2010-08-02
... Environmental Health Sciences; Notice of Closed Meeting Pursuant to section 10(d) of the Federal Advisory.... Institute of Environmental Health Science, P.O. Box 12233, MD EC-30/Room 3170 B, Research Triangle Park, NC... Manpower Development in the Environmental Health Sciences; 93.113, Biological Response to Environmental...
77 FR 61613 - National Institute of Environmental Health Sciences; Notice of Closed Meetings
2012-10-10
... Environmental Health Sciences; Notice of Closed Meetings Pursuant to section 10(d) of the Federal Advisory... Environmental Health Sciences, P. O. Box 12233, MD EC-30, Research Triangle Park, NC 27709, (919) 541-1307, [email protected] . Name of Committee: National Institute of Environmental Health Sciences Special Emphasis...
76 FR 26311 - National Institute of Environmental Health Sciences; Notice of Closed Meeting
2011-05-06
... Environmental Health Sciences; Notice of Closed Meeting Pursuant to section 10(d) of the Federal Advisory.... Institute of Environmental Health Sciences, P.O. Box 12233, MD EC-30/Room 3171, Research Triangle Park, NC... and Education; 93.894, Resources and Manpower Development in the Environmental Health Sciences; 93.113...
Das, Debajyoti; Mondal, Praloy
2017-09-01
Growth of highly conducting nanocrystalline silicon (nc-Si) thin films of optimum crystalline volume fraction, involving dominant crystallographic preferred orientation with simultaneous low fraction of microstructures at a low substrate temperature and high growth rate, is a challenging task for its promising utilization in nc-Si solar cells. Utilizing enhanced electron density and superior ion flux densities of the high frequency (∼27.12 MHz) SiH4 plasma, improved nc-Si films have been produced by simple optimization of H2-dilution, controlling the ion damage and enhancing supply of atomic-hydrogen onto the growing surface. Single junction nc-Si p-i-n solar cells have been prepared with i-nc-Si absorber layer and optimized. The physical parameters of the absorber layer have been systematically correlated to variations of the solar cell parameters. The preferred alignment of crystallites, its contribution to the low recombination losses for conduction of charge carriers along the vertical direction, its spectroscopic correlation with the dominant growth of ultra-nanocrystalline silicon (unc-Si) component and corresponding longer wavelength absorption, especially in the neighborhood of i/n-interface region recognize scientific and technological key issues that pave the ground for imminent advancement of multi-junction silicon solar cells.
ORF Sequence: NC_005296 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005296 gi|39933242 >gi|39933242|ref|NP_945518.1| possible nicotinate-nucleotide adn...WWLVSPGNPLKDISSLREIDARVAAAQAIADDPRIQVSRLEAVIGTRYTADTLRYLRRHCPGARFVWIMGADNLAQFHRWQQWQQIAAEIPIAVIDRPPTSFRALAAPAAQRLMRMRIPNNKAATLADREPPAWVYLTGLKSLVSSTALRNPDGSWKT
ORF Sequence: NC_002162 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002162 gi|13358092 >gi|13358092|ref|NP_078366.1| cytosine-specific methyltransferase [Ureap...RILFDLQKLNQLPQFLLLENVNNMLSKQHKLDYDMWTKSLKQLGYSTCTFQLNALDYGSAQRRKRVYAISILNYDGLIDSNGNILDLEAPIFDGKQKQLKDVLKTNYK
ORF Sequence: NC_002162 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002162 gi|13358063 >gi|13358063|ref|NP_078337.1| hypothetical protein UU500 [Ureap...MGNHTWDHPDIFEILTTKTNIIRPYNIINTHQYHLVGSGSRVFYCNKKMIRVTNLLGNSIDMKGLQTNPFESLDKIIAFNEAPIHIVDFHAETTSEKNALFLDFKSKL
ORF Sequence: NC_005027 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005027 gi|32475512 >gi|32475512|ref|NP_868506.1| hypothetical protein-signal peptide and transme...VLVGLLLPAVQAAREAARRMSCSNNIAQLTLATHNYEFSMEHLPPGTTNPTGPIVNTPNGEHISFLVRLLPYIEQQGTADDFDLTASVYAPANAKVRAYQISAFLCPS
ORF Sequence: NC_003280 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003280 gi|17533935 >gi|17533935|ref|NP_496777.1| ZYXin (zyx-1) [Caenorhabditis elegans] MNQIFHVDC...FAPRCALCSKPIVPQDGEKESVRVVAMDKSFHVDCYKCEDCGMQLSSKLEGQGCYPIDNHLLCKTCNGNRLRVVSST
A Novel Type of Non-coding RNA, nc886, Implicated in Tumor Sensing and Suppression
Directory of Open Access Journals (Sweden)
Yong Sun Lee
2015-06-01
Full Text Available nc886 (=vtRNA2-1, pre-miR-886, or CBL3 is a newly identified non-coding RNA (ncRNA that represses the activity of protein kinase R (PKR. nc886 is transcribed by RNA polymerase III (Pol III and is intriguingly the first case of a Pol III gene whose expression is silenced by CpG DNA hypermethylation in several types of cancer. PKR is a sensor protein that recognizes evading viruses and induces apoptosis to eliminate infected cells. Like viral infection, nc886 silencing activates PKR and induces apoptosis. Thus, the significance of the nc886:PKR pathway in cancer is to sense and eliminate pre-malignant cells, which is analogous to PKR's role in cellular innate immunity. Beyond this tumor sensing role, nc886 plays a putative tumor suppressor role as supported by experimental evidence. Collectively, nc886 provides a novel example how epigenetic silencing of a ncRNA contributes to tumorigenesis by controlling the activity of its protein ligand.
76 FR 29645 - Safety Zone, Newport River; Morehead City, NC
2011-05-23
...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary final... the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC. This safety... Zone, Newport River; Morehead City, North Carolina in the Federal Register (33 FR 165). We received no...
76 FR 18669 - Safety Zone, Newport River; Morehead City, NC
2011-04-05
...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Notice of proposed... River under the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC... Newport River at Morehead City, North Carolina. The contract provides for cleaning, painting, and steel...
76 FR 38018 - Safety Zone, Newport River; Morehead City, NC
2011-06-29
...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary final... the main span US 70/Morehead City-Newport River high rise bridge in Carteret County, NC. This safety...) entitled Safety Zone, Newport River; Morehead City, North Carolina in the Federal Register (33 FR 165). We...
76 FR 23227 - Safety Zone, Newport River; Morehead City, NC
2011-04-26
...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Notice of proposed... River under the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC... Newport River at Morehead City, North Carolina. The contract provides for cleaning, painting, and steel...
ORF Sequence: NC_003279 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003279 gi|17507795 >gi|17507795|ref|NP_493043.1| putative protein, with at least 2 transme...YLNIQIADETTDLPVSIDRANVDMRIYRAFEMSMEKDIISLSTSNTSHAEISTPKSRKKKSRKLGLKNLEEVINSKYNSCQKQDNSMSIQ
Effects of carboxylic acids on nC60 aggregate formation
International Nuclear Information System (INIS)
Chang Xiaojun; Vikesland, Peter J.
2009-01-01
The discovery that negatively charged aggregates of C 60 fullerene (nC 60 ) are stable in water has raised concerns regarding the potential environmental and health effects of these aggregates. In this work, we show that nC 60 aggregates produced by extended mixing in the presence of environmentally relevant carboxylic acids (acetic acid, tartaric acid, citric acid) have surface charge and morphologic properties that differ from those produced by extended mixing in water alone. In general, aggregates formed in the presence of these acids have a more negative surface charge and are more homogeneous than those produced in water alone. Carboxylic acid identity, solution pH, and sodium ion concentration, which are all intricately coupled, play an important role in setting the measured surface charge. Comparisons between particle sizes determined by analysis of TEM images and those obtained by dynamic light scattering (DLS) indicate that DLS results require careful evaluation when used to describe nC 60 aggregates. - The effects of carboxylic acids on the formation of nC 60 aggregates are discussed
ORF Sequence: NC_003909 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003909 gi|42782207 >gi|42782207|ref|NP_979454.1| BclA protein [Bacillus cereus ATCC 10987] MANRLNFTGP...LGCCGISGKTGPTGPTGPTGVTGSTGPTGPTGATGFTGPTGPTGATGPTGATGPTGATGPTGATGPTGATGPTGPTGPTGATGFTGPTGPTGATGPTGATGPTGATGP...TGATGPTGATGPTGATGPTGATGPTGATGPTGATGPTGATGFTGPTGPTGATGPTGATGPTGATGPTGATGPTGATGPTGATGSTGP
ORF Sequence: NC_003070 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003070 gi|18407972 >gi|18407972|ref|NP_564823.1| no apical meristem (NAM) famil...y protein [Arabidopsis thaliana] MQAEEIICRVSDEEIIENYLRPKINGETSSIPRYVVELAEELYTVEPWLLPRQTAPILNPGEWFYFGKRNRKYSN
Kasa, Siti Norbaya; Omar, Mohd Firdaus; Ismail, Ismarul Nizam
2017-12-01
Nanocrystalline cellulose (NCC) was synthesized from banana stem through strong acid hydrolysis with measured length of approximately 287.0 ± 56.4 nm and diameter of 26.6 ± 4.8 nm. Modification of NCC was carried by acetylation reaction in order to increase the compatibility during reinforcement with polylactic acid (PLA) polymer. The reinforcing effect towards morphology, crystallinity, mechanical and thermal properties of bio-nanocomposites was investigated. Scanning Electron Microscope (SEM) micrograph reveals the uniform dispersion achieved at 1 %, 3 % and 5% aNC loading while agglomeration was found at 7 % aNC loading. Disappearance of crystallinity peak at 2θ = 22.7⁰ for low aNC loading during elemental analysis using X-Ray Diffraction (XRD) indicates the proper dispersion of aNC in PLA polymer. From the tensile test, 1 % aNC loading gives the highest mechanical properties of bio-nanocomposite film with 82.71 %, 118.7 % and 24.18 % increment in tensile strength, tensile modulus and elongation at break. However, 7 % aNC loading gives the highest increment in TGA of aNC-PLA nanocomposites which is from 310 °C to 320 °C.
Directory of Open Access Journals (Sweden)
Wong KL
2015-03-01
Full Text Available Keye L Wong,1 Scott E Pautler,2 David J Browning31Retina Associates of Sarasota, Sarasota, FL, USA; 2Retina Vitreous Associates of Florida, Tampa, FL, USA; 3Charlotte Eye Ear Nose and Throat Associates, Charlotte, NC, USAImportance: In some patients, hydroxychloroquine ocular toxicity may progress even following cessation of therapy. Any leverage the clinician may use to allow earlier detection may avert significant vision loss.Observation: We report three cases suggesting that bull’s eye maculopathy seen on near-infrared reflectance with a confocal scanning laser ophthalmoscope could be an early, objective manifestation of hydroxychloroquine ocular toxicity, and with progression of the disease this near-infrared “bull’s eye” change may disappear.Conclusion and relevance: Alerting clinicians to this observation may allow a larger case series to corroborate the hypothesis that bull’s eye maculopathy detected by near-infrared reflectance may represent an early sign of hydroxychloroquine toxicity.Keywords: confocal, scanning laser ophthalmoscope, multifocal ERG
Design and Investigation of SST/nc-Si:H/M (M = Ag, Au, Ni and M/nc-Si:H/M Multifunctional Devices
Directory of Open Access Journals (Sweden)
A. F. Qasrawi
2013-01-01
Full Text Available Hydrogenated nanocrystalline Silicon thin films prepared by the very high frequency chemical vapor deposition technique (VHF-CVD on stainless steel (SST substrates are used to design Schottky point contact barriers for the purpose of solar energy conversion and passive electronic component applications. In this process, the contact performance between SST and M (M = Ag, Au, and Ni and between Ag, Au, and Ni electrodes was characterized by means of current-voltage, capacitance-voltage, and light intensity dependence of short circuit ( current and open circuit voltage ( of the contacts. Particularly, the devices ideality factors, barrier heights were evaluated by the Schottky method and compared to the Cheung's. Best Schottky device performance with lowest ideality factor suitable for electronic applications was observed in the SST/nc-Si:H/Ag structure. This device reflects a of 229 mV with an of 1.6 mA/cm2 under an illumination intensity of ~40 klux. On the other hand, the highest being 9.0 mA/cm2 and the of 53.1 mV were observed for Ni/nc-Si:H/Au structure. As these voltages represent the maximum biasing voltage for some of the designed devices, the SST/nc-Si:H/M and M/nc-Si:H/M can be regarded as multifunctional self-energy that provided electronic devices suitable for active or passive applications.
EnviroAtlas - Durham, NC - Demo (Parent)
U.S. Environmental Protection Agency — This EnviroAtlas dataset is the base layer for the Durham, NC EnviroAtlas Area. The block groups are from the US Census Bureau and are included/excluded based on...
ORF Sequence: NC_004307 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available se/invertase); possible inulinase [Bifidobacterium longum NCC2705] MTDFTPETPVLTPIHDHAAELAKAEAGVAEMAANRNNRWYP... NC_004307 gi|23464731 >gi|23464731|ref|NP_695334.1| beta-fructofuranosidase (sucra
ORF Sequence: NC_005363 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005363 gi|42523756 >gi|42523756|ref|NP_969136.1| membrane protein necessary for nodulation/competitivene...ss [Bdellovibrio bacteriovorus HD100] MKSLMLILFVSLLSVVAKADCTTAITINEAISASTSDYLERAEKR
ORF Sequence: NC_003078 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available etitiveness [Sinorhizobium meliloti 1021] MQLSACARRREAVRYRRRMARILILLFSLLSAFAFPVTPVP... NC_003078 gi|16264863 >gi|16264863|ref|NP_437655.1| probable membrane protein necessary for nodulation comp
ORF Sequence: NC_002678 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002678 gi|13471138 >gi|13471138|ref|NP_102707.1| transcriptional regulatory protein, nodulation competit...iveness determinant [Mesorhizobium loti MAFF303099] MTNESDTRSAELAELTADIVSAYVSNNPLPV
ORF Sequence: NC_003047 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003047 gi|15964332 >gi|15964332|ref|NP_384685.1| PROBABLE PYRAZINAMIDASE/NICOTINAMIDAS...E (INCLUDES: PYRAZINAMIDASE, NICOTINAMIDASE) PROTEIN [Sinorhizobium meliloti 1021] MADAARPDLREAMADEAL
ORF Sequence: NC_002162 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002162 gi|13358146 >gi|13358146|ref|NP_078420.1| transcription antitermination factor [Ureap...lasma parvum serovar 3 str. ATCC 700970] MAYKIKDLDSKLLSDLKIDFNHRHQWYIVTVVSGNEQKVIENIKDKLNGYGYGDKLSDLKIIKEKIKEVKIYEPSEAP
77 FR 57063 - Safety Zone, Atlantic Intracoastal Waterway; Emerald Isle, NC
2012-09-17
... 1625-AA00 Safety Zone, Atlantic Intracoastal Waterway; Emerald Isle, NC AGENCY: Coast Guard, DHS... zone on the waters of the Atlantic Intracoastal Waterway at Emerald Isle, North Carolina. The safety... NC 58 Fixed Bridge crossing the Atlantic Intracoastal Waterway, mile 226, at Emerald Isle, North...
77 FR 64906 - Safety Zone, Atlantic Intracoastal Waterway; Emerald Isle, NC
2012-10-24
... 1625-AA00 Safety Zone, Atlantic Intracoastal Waterway; Emerald Isle, NC AGENCY: Coast Guard, DHS... zone on the waters of the Atlantic Intracoastal Waterway at Emerald Isle, North Carolina. The safety... NC 58 Fixed Bridge crossing the Atlantic Intracoastal Waterway, mile 226, at Emerald Isle, North...
ORF Sequence: NC_006155 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available g protein (involved in environmental [Yersinia pseudotuberculosis IP 32953] MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPTVWQHVK ... NC_006155 gi|51595328 >gi|51595328|ref|YP_069519.1| hemolysin expression modulatin
ORF Sequence: NC_002162 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002162 gi|13357802 >gi|13357802|ref|NP_078076.1| ribosomal protein L24 [Ureapla...sma parvum serovar 3 str. ATCC 700970] MNRIKKGDTVVVISGKNKNKSGVVIQVNPKEQTALVEGVNKIKRHQKKDQTHEQSGIIEKEAPIRLCKLALVDPKGKDKGKATKVKYLLKDNKKVRVARKSGSELDVNKK
CAI System with Multi-Media Text Through Web Browser for NC Lathe Programming
Mizugaki, Yoshio; Kikkawa, Koichi; Mizui, Masahiko; Kamijo, Keisuke
A new Computer Aided Instruction (CAI) system for NC lathe programming has been developed with use of multi-media texts including movies, animations, pictures, sound and texts through Web browser. Although many CAI systems developed previously for NC programming consist of text-based instructions, it is difficult for beginners to learn NC programming with use of them. In the developed CAI system, multi-media texts are adopted for the help of users' understanding, and it is available through Web browser anytime and anywhere. Also the error log is automatically recorded for the future references. According to the NC programming coded by a user, the movement of the NC lathe is animated and shown in the monitor screen in front of the user. If its movement causes the collision between a cutting tool and the lathe, some sound and the caution remark are generated. If the user makes mistakes some times at a certain stage in learning NC, the corresponding suggestion is shown in the form of movies, animations, and so forth. By using the multimedia texts, users' attention is kept concentrated during a training course. In this paper, the configuration of the CAI system is explained and the actual procedures for users to learn the NC programming are also explained too. Some beginners tested this CAI system and their results are illustrated and discussed from the viewpoint of the efficiency and usefulness of this CAI system. A brief conclusion is also mentioned.
Wang, Jianjian; Cao, Yuze; Zhang, Huixue; Wang, Tianfeng; Tian, Qinghua; Lu, Xiaoyu; Lu, Xiaoyan; Kong, Xiaotong; Liu, Zhaojun; Wang, Ning; Zhang, Shuai; Ma, Heping; Ning, Shangwei; Wang, Lihua
2017-01-04
The Nervous System Disease NcRNAome Atlas (NSDNA) (http://www.bio-bigdata.net/nsdna/) is a manually curated database that provides comprehensive experimentally supported associations about nervous system diseases (NSDs) and noncoding RNAs (ncRNAs). NSDs represent a common group of disorders, some of which are characterized by high morbidity and disabilities. The pathogenesis of NSDs at the molecular level remains poorly understood. ncRNAs are a large family of functionally important RNA molecules. Increasing evidence shows that diverse ncRNAs play a critical role in various NSDs. Mining and summarizing NSD-ncRNA association data can help researchers discover useful information. Hence, we developed an NSDNA database that documents 24 713 associations between 142 NSDs and 8593 ncRNAs in 11 species, curated from more than 1300 articles. This database provides a user-friendly interface for browsing and searching and allows for data downloading flexibility. In addition, NSDNA offers a submission page for researchers to submit novel NSD-ncRNA associations. It represents an extremely useful and valuable resource for researchers who seek to understand the functions and molecular mechanisms of ncRNA involved in NSDs. © The Author(s) 2016. Published by Oxford University Press on behalf of Nucleic Acids Research.
precision deburring using NC and robot equipment. Final report
Energy Technology Data Exchange (ETDEWEB)
Gillespie, L.K.
1980-05-01
Deburring precision miniature components is often time consuming and inconsistent. Although robots are available for deburring parts, they are not precise enough for precision miniature parts. Numerical control (NC) machining can provide edge break consistencies to meet requirements such as 76.2-..mu..m maximum edge break (chamfer). Although NC machining has a number of technical limitations which prohibits its use on many geometries, it can be an effective approach to features that are particularly difficult to deburr.
75 FR 55807 - National Institute of Environmental Health Sciences; Notice of Closed Meetings
2010-09-14
... Sciences, Office of Program Operations, Scientific Review Branch, P.O. Box 12233, Research Triangle Park..., Office of Program Operations, Scientific Review Branch, P.O. Box 12233, Research Triangle Park, NC 27709... Sciences Special Emphasis Panel; Social Environment Effect on Mental Health. Date: September 30, 2010. Time...
ORF Sequence: NC_003283 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003283 gi|17563066 >gi|17563066|ref|NP_506462.1| putative protein family member, with a transme...mbrane domain (5O433) [Caenorhabditis elegans] MWNLVSPIHISSKFSMEMAEVNVVAVPEENRQTYLETDNDRLVMAIIWLIMPPMAVFFKCRGCTKHVFINFLLYLLLVLPAYKHATWFCFVKGREFEAEDGFVRAR
ORF Sequence: NC_003280 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003280 gi|17535455 >gi|17535455|ref|NP_495314.1| putative endoplasmic reticulum protein, with a transme...mbrane domain (2G788) [Caenorhabditis elegans] MTDVRFIIWNCIALLVALMMALTSIIILSDAPHNSME
Energy Technology Data Exchange (ETDEWEB)
Takam Takougang, Eric M.; Calvert, Andrew J. [Simon Fraser University (Canada)], email: eta9@sfu.ca
2011-07-01
The Geological Survey of Canada (GSC) collected eight seismic reflection lines in 1988 across the Queen Charlotte sedimentary basin of western Canada, which is the largest tertiary basin on the west coast. This work furthers the study of the upper part of the basin by using quantitative imaging of its structure through application of 2-D waveform tomography to the limited offset seismic reflection data. With the help of waveform tomography, seismic reflection data has allowed the identification of pockmark structures and pipe-like gas chimney in the recovered velocity and attenuation models. Overall, there is an excellent match between field data and predicted data. and a good match between the sonic log and a 1-D velocity function derived from the 2-D velocity model. This shows that specific preconditioning of the data and a good inversion strategy make it possible to use waveform tomography of relatively short offset reflection data for the imaging of shallow geological features.
Bachelor of Science-Engineering Technology Program and Fuel Cell Education Program Concentration
Energy Technology Data Exchange (ETDEWEB)
Block, David L. [Florida Solar Energy Center, Cocoa, FL (United States); Sleiti, Ahmad [Univ. of North Carolina, Charlotte, NC (United States)
2011-09-19
The Hydrogen and Fuel Cell Technology education project has addressed DOE goals by supplying readily available, objective, technical, and accurate information that is available to students, industry and the public. In addition, the program has supplied educated trainers and training opportunities for the next generation workforce needed for research, development, and demonstration activities in government, industry, and academia. The project has successfully developed courses and associated laboratories, taught the new courses and labs and integrated the HFCT option into the accredited engineering technology and mechanical engineering programs at the University of North Carolina at Charlotte (UNCC). The project has also established ongoing collaborations with the UNCC energy related centers of the Energy Production & Infrastructure Center (EPIC), the NC Motorsports and Automotive Research Center (NCMARC) and the Infrastructure, Design, Environment and Sustainability Center (IDEAS). The results of the project activities are presented as two major areas – (1) course and laboratory development, offerings and delivery, and (2) program recruitment, promotions and collaborations. Over the project period, the primary activity has been the development and offering of 11 HFCT courses and accompanying laboratories. This process has taken three years with the courses first being developed and then offered each year over the timeframe.
ORF Sequence: NC_003047 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003047 gi|15965329 >gi|15965329|ref|NP_385682.1| PROBABLE CARBAMOYL-PHOSPHATE SYNTHASE LARGE CHAIN (AMMO...NIA CHAIN ARGININE BIOSYNTHESIS) PROTEIN [Sinorhizobium meliloti 1021] MPKRQDIKSILI
ORF Sequence: NC_004605 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available protein) (involved in swarmer cell regulation) [Vibrio parahaemolyticus RIMD 2210633] MKKAVKKISSKKIITISAIIV... NC_004605 gi|28901366 >gi|28901366|ref|NP_801021.1| ScrC (sensory box/GGDEF family
ORF Sequence: NC_006905 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available g protein (involved in environmental regulation of virulence factors) [Salmonella enterica subsp. enterica s... NC_006905 gi|62179085 >gi|62179085|ref|YP_215502.1| hemolysin expression modulatin
De Novo Discovery of Structured ncRNA Motifs in Genomic Sequences
DEFF Research Database (Denmark)
Ruzzo, Walter L; Gorodkin, Jan
2014-01-01
De novo discovery of "motifs" capturing the commonalities among related noncoding ncRNA structured RNAs is among the most difficult problems in computational biology. This chapter outlines the challenges presented by this problem, together with some approaches towards solving them, with an emphas...... on an approach based on the CMfinder CMfinder program as a case study. Applications to genomic screens for novel de novo structured ncRNA ncRNA s, including structured RNA elements in untranslated portions of protein-coding genes, are presented.......De novo discovery of "motifs" capturing the commonalities among related noncoding ncRNA structured RNAs is among the most difficult problems in computational biology. This chapter outlines the challenges presented by this problem, together with some approaches towards solving them, with an emphasis...
ORF Sequence: NC_000913 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available erobacterial common antigen (ECA) [Escherichia coli K12] MKVLTVFGTRPEAIKMAPLVHALAKD... NC_000913 gi|49176409 >gi|49176409|ref|YP_026253.1| UDP-N-acetyl glucosamine -2-epimerase; synthesis of ent
ORF Sequence: NC_003282 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003282 gi|17540144 >gi|17540144|ref|NP_500824.1| feminization 1 homolog a, FEMinization of XX and XO ani...mals FEM-1 (fem-1) [Caenorhabditis elegans] MTPNGHHFRTVIYNAAAVGNLQRIKVFTINSRNDRQWII
ORF Sequence: NC_000913 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_000913 gi|16128606 >gi|16128606|ref|NP_415156.1| RNA chaperone, transcription antiterm...inator, affects expression of rpoS and uspA [Escherichia coli K12] MSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQTNGFKTLAEGQRVEFEITNGAKGPSAANVIAL
ORF Sequence: NC_001137 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ull mutation has global effects on transcription; Yer064cp [Saccharomyces cerevisiae] MIDDTENSKIHLEGSHKTGKYT... NC_001137 gi|6320907 >gi|6320907|ref|NP_010986.1| Non-essential nuclear protein; n
ORF Sequence: NC_000913 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_000913 gi|16128858 >gi|16128858|ref|NP_415411.1| periplasmic chaperone effects translocation of lipoprot...eins from inner membrane to outer membrane [Escherichia coli K12] MMKKIAITCALLSSLVA
ORF Sequence: NC_006905 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006905 gi|62179485 >gi|62179485|ref|YP_215902.1| periplasmic protein effects translocation of lipoprotei...ns from inner membrane to outer membrane [Salmonella enterica subsp. enterica serov
Explicit flow equations and recursion operator of the ncKP hierarchy
International Nuclear Information System (INIS)
He, Jingsong; Wang, Lihong; Tu, Junyi; Li, Xiaodong
2011-01-01
The explicit expression of the flow equations of the noncommutative Kadomtsev–Petviashvili (ncKP) hierarchy is derived. Compared with the flow equations of the KP hierarchy, our result shows that the additional terms in the flow equations of the ncKP hierarchy indeed consist of commutators of dynamical coordinates {u i }. The recursion operator for the flow equations under n-reduction is presented. Further, under 2-reduction, we calculate a nonlocal recursion operator Φ(2) of the noncommutative Korteweg–de Vries(ncKdV) hierarchy, which generates a hierarchy of local, higher-order flows. Thus we solve the open problem proposed by Olver and Sokolov (1998 Commun. Math. Phys. 193 245–68)
Testing the QCD string at large Nc from the thermodynamics of the hadronic phase
Cohen, Thomas D.
2007-02-01
It is generally believed that in the limit of a large number of colors (Nc) the description of confinement via flux tubes becomes valid and QCD can be modeled accurately via a hadronic string theory—at least for highly excited states. QCD at large Nc also has a well-defined deconfinement transition at a temperature Tc. In this talk it is shown how the thermodyanmics of the metastable hadronic phase of QCD (above Tc) at large NC can be related directly to properties of the effective QCD string. The key points in the derivation is the weakly interacting nature of hadrons at large Nc and the existence of a Hagedorn temperature TH for the effective string theory. From this it can be seen at large Nc and near TH, the energy density and pressure of the hadronic phase scale as E ˜ (TH - T)-(D⊥-6)/2 (for D⊥ TH - T)-(D⊥-4)/2 (for D⊥ TH > Tc this behavior is of relevance only to the metastable phase. The prospect of using this result to extract D⊥ via lattice simulations of the metastable hadronic phase at moderately large Nc is discussed.
Hayashi, Miwa; Hoang, Ty; Jung, Yoon C.; Malik, Waqar; Lee, Hanbong; Dulchinos, Victoria L.
2015-01-01
This paper proposes a new departure pushback decision-support tool (DST) for airport ramp-tower controllers. It is based on NASA's Spot and Runway Departure Advisor (SARDA) collaborative decision-making concept, except with the modification that the gate releases now are controlled by tactical pushback (or gate-hold) advisories instead of strategic pre-assignments of target pushback times to individual departure flights. The proposed ramp DST relies on data exchange with the airport traffic control tower (ATCT) to coordinate pushbacks with the ATCT's flow-management intentions under current operational constraints, such as Traffic Management Initiative constraints. Airlines would benefit in reduced taxi delay and fuel burn. The concept was evaluated in a human-in-the-loop simulation experiment with current ramp-tower controllers at the Charlotte Douglas International Airport as participants. The results showed that the tool helped reduce taxi time by one minute per flight and overall departure flight fuel consumption by 10-12% without reducing runway throughput. Expect Departure Clearance Time (EDCT) conformance also was improved when advisories were provided. These benefits were attained without increasing the ramp-tower controllers' workload. Additionally, the advisories reduced the ATCT controllers' workload.
Taxi Time Prediction at Charlotte Airport Using Fast-Time Simulation and Machine Learning Techniques
Lee, Hanbong
2016-01-01
Accurate taxi time prediction is required for enabling efficient runway scheduling that can increase runway throughput and reduce taxi times and fuel consumptions on the airport surface. Currently NASA and American Airlines are jointly developing a decision-support tool called Spot and Runway Departure Advisor (SARDA) that assists airport ramp controllers to make gate pushback decisions and improve the overall efficiency of airport surface traffic. In this presentation, we propose to use Linear Optimized Sequencing (LINOS), a discrete-event fast-time simulation tool, to predict taxi times and provide the estimates to the runway scheduler in real-time airport operations. To assess its prediction accuracy, we also introduce a data-driven analytical method using machine learning techniques. These two taxi time prediction methods are evaluated with actual taxi time data obtained from the SARDA human-in-the-loop (HITL) simulation for Charlotte Douglas International Airport (CLT) using various performance measurement metrics. Based on the taxi time prediction results, we also discuss how the prediction accuracy can be affected by the operational complexity at this airport and how we can improve the fast time simulation model before implementing it with an airport scheduling algorithm in a real-time environment.
ORF Sequence: NC_006905 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available of cations and cationic drugs [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] MFYWILL... NC_006905 gi|62180070 >gi|62180070|ref|YP_216487.1| putative membrane transporter
ORF Sequence: NC_006905 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available of cations and cationic drugs [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] MQQFEWI... NC_006905 gi|62180071 >gi|62180071|ref|YP_216488.1| putative membrane transporter
ORF Sequence: NC_000913 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_000913 gi|16131649 >gi|16131649|ref|NP_418241.1| TDP-Fuc4NAc:lipidII transferase; synthesis of enterobac...terial common antigen (ECA) [Escherichia coli K12] MSLLQFSGLFVVWLLCTLFIATLTWFEFRRVR
ORF Sequence: NC_001147 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_001147 gi|6324442 >gi|6324442|ref|NP_014511.1| Plasma membrane Mg(2+) transporter, expression and turnov...er are regulated by Mg(2+) concentration; overexpression confers increased toleranc
ORF Sequence: NC_001134 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ivery of heterogeneous nuclear ribonucleoproteins to the nucleoplasm, binds rg-nucl... NC_001134 gi|6319491 >gi|6319491|ref|NP_009573.1| Transportin, cytosolic karyopherin beta 2 involved in del
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Keywords. Mycobacterium tuberculosis; mycobacteriophages; I3. Author Affiliations. Kavitha Sarvepalli1 M E Sandeepa2. Department of Microbiology and Cell Biology, Indian Institute of Science, Bangalore 560 012, India. Post Doctoral Research Fellow, Department of Cell Biology, Lerner Research Institute / NC10, ...
International Nuclear Information System (INIS)
Olley, Jon; Brooks, Andrew; Spencer, John; Pietsch, Timothy; Borombovits, Daniel
2013-01-01
The Laura–Normanby River (catchment area: 24,350 km 2 ), which drains into Princess Charlotte Bay, has been identified in previous studies as the third largest contributor of sediment to the Great Barrier Reef World Heritage Area. These catchment scale modelling studies also identified surface soil erosion as supplying >80% of the sediment. Here we use activity concentrations of the fallout radionuclides 137 Cs and 210 Pb ex to test the hypothesis that surface soil erosion dominates the supply of fine ( 137 Cs and 210 Pb ex activity concentrations between samples collected using these two methods. Two methods were also used to collect samples to characterise 137 Cs and 210 Pb ex concentrations in sediment derived from surface soil erosion; sampling of surface-wash deposits and deployment of surface runoff traps that collected samples during rain events. While there was no difference in the 137 Cs activity concentrations for samples collected using these two methods, 210 Pb ex activity concentrations were significantly higher in the samples collected using the runoff traps. The higher 210 Pb ex concentrations are shown to be correlated with loss-on-ignition (r 2 = 0.79) and therefore are likely to be related to higher organic concentrations in the runoff trap samples. As a result of these differences we use a three end member mixing model (channel/gully, hillslope surface-wash and hillslope runoff traps) to determine the relative contribution from surface soil erosion. Probability distributions for 137 Cs and 210 Pb ex concentrations were determined for each of the end members, with these distributions then used to estimate the surface soil contribution to each of the collected river sediment samples. The mean estimate of contribution of surface derived sediment for all river samples (n = 70) is 16 ± 2%. This study reinforces the importance of testing model predictions before they are used to target investment in remedial action and adds to the body of evidence
ORF Alignment: NC_002977 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002977 gi|53804693 >1fgjA 20 492 48 517 e-179 ... gb|AAU92745.1| hydroxylamine oxy...doreductase [Methylococcus capsulatus str. Bath] ... ref|YP_113436.1| hydroxylamine oxydoreductase ...
ORF Alignment: NC_006569 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006569 gi|56708985 >1fgjA 5 498 32 521 0.0 ... ref|YP_165030.1| hydroxylamine oxid...oreductase [Silicibacter pomeroyi DSS-3] ... gb|AAV97335.1| hydroxylamine oxidoreductase ... [
ORF Alignment: NC_004307 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004307 gi|23465117 >1g5aA 80 628 2 589 5e-59 ... gb|AAL05573.1| alpha-glucosidase [Bifidobacterium adolesce...ntis] ... Length = 588 ... Query: 1 ... MTANNLNDDWWKQAVVYQIYPRSFKDVNGDGLGDIAGVTEK
ORF Sequence: NC_002945 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002945 gi|31792282 >gi|31792282|ref|NP_854775.1| PROBABLE CELLULASE CELA2A (ENDO-1,4-BETA-GLUCA...NASE) (ENDOGLUCANASE) (CARBOXYMETHYL CELLULASE) [Mycobacterium bovis AF2122/97] MNGAAPTNGAPLSYPSICEGVHWGHLVGGHQPAY
ORF Sequence: NC_000962 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_000962 gi|57116825 >gi|57116825|ref|YP_177638.1| PROBABLE CELLULASE CELA2A (ENDO-1,4-BETA-GLUCA...NASE) (ENDOGLUCANASE) (CARBOXYMETHYL CELLULASE) [Mycobacterium tuberculosis H37Rv] MNGAAPTNGAPLSYPSICEGVHWGHLVGGHQPAY
ORF Sequence: NC_006905 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006905 gi|62181272 >gi|62181272|ref|YP_217689.1| H inversion: regulation of fla...gellar gene expression by site-specific inversion of DNA [Salmonella enterica subsp. enterica serovar Choler
ORF Alignment: NC_003295 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003295 gi|17546028 >1fjgR 2 71 22 91 5e-16 ... emb|CAD15011.1| PROBABLE PRIMOSOMAL REPLICATION... PROTEIN [Ralstonia solanacearum] ... ref|NP_519430.1| PROBABLE PRIMOSOMAL REPLICATION ...
ORF Alignment: NC_003228 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003228 gi|60681683 >1gntA 1 551 3 543 0.0 ... emb|CAH07898.1| hydroxylamine reduct...ase [Bacteroides fragilis NCTC 9343] ... ref|YP_211827.1| hydroxylamine reductase [Bacteroides ...
ORF Sequence: NC_003281 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003281 gi|25151987 >gi|25151987|ref|NP_499440.2| TRAnsformer : XX animals trans...formed into males TRA-1, HERmaphrodization of XO animals HER-2, sex determination zinc-finger protein, alter
ORF Sequence: NC_003282 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available inization of XX and XO animals FEM-3 (46.2 kD) (fem-3) [Caenorhabditis elegans] MEVDPGSDDVEADRETRAQKLKLKRNVK... NC_003282 gi|17540880 >gi|17540880|ref|NP_501587.1| sex determination protein, FEM
ORF Alignment: NC_005296 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005296 gi|39936477 >1kmoA 7 661 92 753 2e-72 ... emb|CAE28855.1| putative hydroxamate-type ferris... ... putative hydroxamate-type ferrisiderophore receptor ... [Rhodopseudomonas palustris CGA009] ...
ORF Alignment: NC_006155 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006155 gi|51597538 >1kmoA 5 661 59 714 9e-71 ... ref|YP_071729.1| putative hydroxamate-type ferris...ive ... hydroxamate-type ferrisiderophore receptor. [Yersinia ... pseudotuberculosis IP 32953
ORF Alignment: NC_006274 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006274 gi|52142162 >1gpuA 4 663 4 663 0.0 ... ref|YP_084669.1| transketolase (glycoal...dehyde transferase) [Bacillus cereus ZK] ... gb|AAU17181.1| transketolase (glycoaldehyde transfera
ORF Alignment: NC_003888 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003888 gi|21219041 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce
ORF Alignment: NC_003306 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003306 gi|17938860 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce
ORF Alignment: NC_003064 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003064 gi|16119505 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce
ORF Sequence: NC_001145 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_001145 gi|6323710 >gi|6323710|ref|NP_013781.1| Protein required for nuclear mem...brane fusion during karyogamy, localizes to the membrane with a soluble portion in the endoplasmic reticulum
ORF Alignment: NC_003919 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003919 gi|21242752 >1iwlA 2 180 23 207 3e-47 ... gb|AAM36870.1| outer-membrane lipoproteins... ... outer-membrane lipoproteins carrier protein precursor ... [Xanthomonas axonopodis pv. citr
ORF Alignment: NC_006370 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006370 gi|54308356 >1iwlA 4 181 22 199 2e-52 ... ref|YP_129376.1| hypothetical outer membrane lipoproteins... ... hypothetical outer membrane lipoproteins carrier protein ... [Photobacterium profundum] ... L
ORF Sequence: NC_002655 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002655 gi|15800754 >gi|15800754|ref|NP_286768.1| periplasmic protein effects translocation of lipoprotei...ns from inner membrane to outer [Escherichia coli O157:H7 EDL933] MMKKIAITCALLSSLVA
EPRI research program NDE techniques for crack initiation of steam turbine rotor
International Nuclear Information System (INIS)
Goto, T.; Kimura, J.; Kawamoto, K.; Kadoya, Y.; Viswanathan, R.
1990-01-01
EPRI RP 2481-8 aims at the development of nondestructive methods for the life assessment of steam turbine rotor for its crack initiation caused by creep and/or fatigue. As a part of the research project, the demonstration of the state of the art NDE techniques was conducted during June to August of 1988 at EPRI NDE Center, Charlotte, N.C. by Mitsubishi Heavy Industries, Ltd. using four rotors retired after long term service (16-22x10 4 hr). This paper introduces the results of the demonstration
46 CFR 7.55 - Cape Henry, VA to Cape Fear, NC.
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false Cape Henry, VA to Cape Fear, NC. 7.55 Section 7.55 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY PROCEDURES APPLICABLE TO THE PUBLIC BOUNDARY LINES Atlantic Coast § 7.55 Cape Henry, VA to Cape Fear, NC. (a) A line drawn from Rudee Inlet Jetty Light “2” to...
Directory of Open Access Journals (Sweden)
Moore JM
2014-12-01
Full Text Available It is my distinct pleasure to make this presentation of the TSRC Lifetime Achievement Award to Dr Bill Collins from NC State University. Bill is well known in academic and industry circles for his contributions to Tobacco Science. Some have suggested that Bill Collins is the single person most identified with flue-cured tobacco at NC State and probably world-wide.
ORF Alignment: NC_006371 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006371 gi|54302237 >1r690 2 63 15 79 7e-05 ... ref|YP_132230.1| hypotethical trans...criptional regulator [Photobacterium profundum ... SS9] emb|CAG22430.1| hypotethical transcriptional ...
ORF Alignment: NC_002947 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002947 gi|26988182 >1rwrA 1 265 36 293 1e-50 ... ref|NP_743607.1| surface colonization... ... gb|AAN67071.1| surface colonization protein, putative ... [Pseudomonas putida KT2440] ...
ORF Sequence: NC_001139 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_001139 gi|6321518 >gi|6321518|ref|NP_011595.1| Protein of unknown function; deletion... mutant has synthetic fitness defect with an sgs1 deletion mutant; Slx9p [Saccharomyces cerevisiae] MVA
ORF Alignment: NC_004461 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004461 gi|27467238 >1kolA 35 391 30 342 2e-04 ... ref|NP_763875.1| xylitol dehydro...genase [Staphylococcus epidermidis ATCC 12228] ... gb|AAO03917.1| xylitol dehydrogenase [Staphylococc
ORF Sequence: NC_002655 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available erobacterial common antigen (ECA) [Escherichia coli O157:H7 EDL933] MSAKALAAYSKRIDV... NC_002655 gi|15804377 >gi|15804377|ref|NP_290417.1| UDP-N-acetyl glucosamine -2-epimerase; synthesis of ent
ORF Alignment: NC_003075 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003075 gi|42566272 >1ogqA 3 270 31 261 6e-05 ... ref|NP_192248.2| leucine-rich repeat transme...ery: 151 XXXXXXXGELPDVFQNLVGLINLDISSNNISGTLPPSMENLLTLTTLRVQNNQLSGTLDV 210 ... GELPDVFQNLVGLINLDISSNNISGTLPPSME...NLLTLTTLRVQNNQLSGTLDV Sbjct: 121 LNDNLLSGELPDVFQNLVGLINLDISSNNISGTLPPSMENLLTLTTLRVQNNQLSGTLDV 180 ...
ORF Alignment: NC_003295 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003295 gi|17546366 >1bxdA 1 144 297 447 7e-18 ... emb|CAD15349.1| PROBABLE OXIDATIVE STRESS...PROTEIN ... [Ralstonia solanacearum] ref|NP_519768.1| PROBABLE ... OXIDATIVE STRESS RESISTANCE
ORF Alignment: NC_003295 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003295 gi|17546366 >1joyA 1 67 230 295 9e-16 ... emb|CAD15349.1| PROBABLE OXIDATIVE STRESS...ROTEIN ... [Ralstonia solanacearum] ref|NP_519768.1| PROBABLE ... OXIDATIVE STRESS RESISTANCE
ORF Alignment: NC_002928 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002928 gi|33596933 >1kmoA 7 661 65 702 8e-60 ... ref|NP_884576.1| putative ferrisi...derophore receptor [Bordetella parapertussis 12822] ... emb|CAE37631.1| putative ferrisiderophore rec
ORF Alignment: NC_003155 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003155 gi|29832733 >1chkA 1 236 48 283 9e-87 ... dbj|BAC73902.1| putative chitosan...ase [Streptomyces avermitilis MA-4680] ... ref|NP_827367.1| putative chitosanase [Streptomyces ...
ORF Alignment: NC_003155 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003155 gi|29828557 >1chkA 1 236 35 270 4e-95 ... dbj|BAC69726.1| putative chitosan...ase [Streptomyces avermitilis MA-4680] ... ref|NP_823191.1| putative chitosanase [Streptomyces ...
ORF Alignment: NC_003888 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available tide synthetase [Actinoplanes teichomyceticus] ... Length = 427 ... Query: 12 ... LSPLQEGMLFHNLFDEEELDAYNVQ... NC_003888 gi|32141196 >1l5aA 1 423 12 438 2e-57 ... emb|CAE53352.1| non-ribosomal pep
ORF Alignment: NC_005363 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005363 gi|42523916 >1a12A 35 375 64 376 3e-39 ... emb|CAE53335.1| putative RCC1 repeats protein [Actinoplan...es teichomyceticus] ... Length = 313 ... Query: 425 GVGFACALYDNNDLKCFGANDYGQLGD
ORF Alignment: NC_005090 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005090 gi|34558174 >1wcv1 4 239 4 244 2e-25 ... ref|NP_907989.1| SEPTUM SITE-DETERMINING...| SEPTUM ... SITE-DETERMINING PROTEIN MIND CELL DIVISION INHIBITOR ... MIND [Wolinella succino
ORF Alignment: NC_005090 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005090 gi|34557077 >1vdkA 1 459 5 463 e-135 ... ref|NP_906892.1| ASPARTATE AMMONIA...-LYASE [Wolinella succinogenes DSM 1740] ... emb|CAE09792.1| ASPARTATE AMMONIA-LYASE [Wolinella ...
ORF Alignment: NC_003450 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003450 gi|19553429 >1v4aA 22 435 620 1034 4e-69 ... ref|YP_226470.1| GLUTAMATE-AMMONIA...mb|CAF20569.1| ... GLUTAMATE-AMMONIA-LIGASE ADENYLYLTRANSFERASE ... [Corynebacterium glutami
ORF Alignment: NC_003295 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003295 gi|17547365 >1gkmA 3 497 10 504 e-143 ... emb|CAD16353.1| PROBABLE HISTIDINE AMMONIA...-LYASE (HISTIDASE) PROTEIN [Ralstonia ... solanacearum] ref|NP_520767.1| PROBABLE HISTIDINE ... AMMONIA
ORF Alignment: NC_003047 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003047 gi|15966456 >1gkmA 2 501 3 499 e-107 ... emb|CAC47282.1| PUTATIVE HISTIDINE AMMONIA...-LYASE PROTEIN [Sinorhizobium meliloti] ... ref|NP_386809.1| PUTATIVE HISTIDINE AMMONIA-LYASE
ORF Alignment: NC_003450 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003450 gi|19552717 >1vdkA 1 459 57 516 e-127 ... ref|YP_225787.1| ASPARTATE AMMONIA...ynebacterium glutamicum ATCC 13032] emb|CAF21511.1| ... ASPARTATE AMMONIA-LYASE (ASPARTASE) [Coryneba
ORF Alignment: NC_005085 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005085 gi|34497787 >1f39A 3 98 107 198 1e-23 ... gb|AAQ60004.1| SOS mutagenesis [C...hromobacterium violaceum ATCC 12472] ... ref|NP_902002.1| SOS mutagenesis [Chromobacterium ...
ORF Alignment: NC_006840 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006840 gi|59712585 >1bxwA 8 170 21 215 9e-07 ... ref|NP_800205.1| accessory colonization... factor AcfA [Vibrio parahaemolyticus RIMD ... 2210633] dbj|BAC62038.1| accessory colonization
ORF Alignment: NC_004605 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004605 gi|28900550 >1bxwA 8 170 21 215 9e-07 ... ref|NP_800205.1| accessory colonization... factor AcfA [Vibrio parahaemolyticus RIMD ... 2210633] dbj|BAC62038.1| accessory colonization
ORF Alignment: NC_006085 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006085 gi|50842772 >1qr0A 1 205 2 202 3e-27 ... ref|YP_055999.1| biosurfactants pr...oduction protein [Propionibacterium acnes ... KPA171202] gb|AAT83041.1| biosurfactants production ...
ORF Sequence: NC_002655 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002655 gi|15804385 >gi|15804385|ref|NP_290425.1| TDP-Fuc4NAc:lipidII transferase; synthesis of enterobac...terial common antigen (ECA) [Escherichia coli O157:H7 EDL933] MSLLQFSGLFVVWLLCTLFIA
ORF Alignment: NC_002678 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002678 gi|13474471 >1gkpA 2 454 5 422 3e-10 ... ref|NP_106039.1| creatinine deamin...ase [Mesorhizobium loti MAFF303099] ... dbj|BAB51825.1| creatinine deaminase [Mesorhizobium loti ...
ORF Alignment: NC_004463 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004463 gi|27381528 >1uzbA 40 515 6 475 3e-74 ... ref|NP_773057.1| vanillin: NAD ox...idoreductase [Bradyrhizobium japonicum USDA 110] ... dbj|BAC51682.1| vanillin: NAD oxidoreductase ...
ORF Alignment: NC_004463 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004463 gi|27377799 >1uzbA 40 515 5 474 3e-69 ... ref|NP_769328.1| vanillin: NAD ox...idoreductase [Bradyrhizobium japonicum USDA 110] ... dbj|BAC47953.1| vanillin: NAD oxidoreductase ...
ORF Alignment: NC_006361 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006361 gi|54024866 >1jmvA 2 140 154 297 6e-16 ... ref|YP_227183.1| UNIVERSAL STRESS...icum ATCC 13032] ... emb|CAF20967.1| UNIVERSAL STRESS PROTEIN FAMILY ... [Corynebacterium glut
ORF Alignment: NC_003450 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003450 gi|19554128 >1jmvA 2 140 154 297 6e-16 ... ref|YP_227183.1| UNIVERSAL STRESS...icum ATCC 13032] ... emb|CAF20967.1| UNIVERSAL STRESS PROTEIN FAMILY ... [Corynebacterium glut
ORF Alignment: NC_003295 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003295 gi|17546367 >1kgsA 3 221 7 234 1e-40 ... emb|CAD15350.1| PROBABLE OXIDATIVE STRESS... ... solanacearum] ref|NP_519769.1| PROBABLE OXIDATIVE STRESS ... RESISTANCE TWO-COMPONENT RESPON
ORF Alignment: NC_005027 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005027 gi|32475765 >1zrn0 11 219 5 254 2e-04 ... ref|NP_868759.1| N-acetylglucosamine-6-phosha... ... N-acetylglucosamine-6-phoshatase or p-nitrophenyl ... phosphatase [Pirellula sp.] ... Len
ORF Alignment: NC_002939 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002939 gi|39996821 >1v7zA 3 252 1 232 3e-42 ... ref|NP_952772.1| creatinine amidoh...ydrolase [Geobacter sulfurreducens PCA] ... gb|AAR35099.1| creatinine amidohydrolase [Geobacter ...
ORF Alignment: NC_003888 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003888 gi|21225320 >1k12A 3 151 580 722 8e-15 ... dbj|BAC69434.1| putative mycodextrana...se [Streptomyces avermitilis MA-4680] ... ref|NP_822899.1| putative mycodextranase [Streptomyces
ORF Alignment: NC_003888 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003888 gi|21225300 >1k12A 3 151 580 722 8e-15 ... dbj|BAC69434.1| putative mycodextrana...se [Streptomyces avermitilis MA-4680] ... ref|NP_822899.1| putative mycodextranase [Streptomyces
ORF Alignment: NC_002929 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002929 gi|33592999 >1kmoA 7 661 65 702 1e-60 ... ref|NP_880643.1| putative ferrisi...derophore receptor [Bordetella pertussis Tohama I] ... emb|CAE42244.1| putative ferrisiderophore rece
ORF Alignment: NC_002927 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002927 gi|33600770 >1kmoA 7 661 65 702 2e-60 ... ref|NP_888330.1| putative ferrisi...derophore receptor [Bordetella bronchiseptica RB50] ... emb|CAE32282.1| putative ferrisiderophore rec
ORF Alignment: NC_003888 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003888 gi|21219207 >1chkA 2 236 45 279 3e-87 ... ref|NP_624986.1| secreted chitosan...ase [Streptomyces coelicolor A3(2)] ... emb|CAB61194.1| secreted chitosanase [Streptomyces ...
ORF Alignment: NC_003911 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003911 gi|56696447 >1dlwA 19 115 21 125 4e-12 ... gb|AAV94850.1| protozoan/cyanoba...cterial globin family protein [Silicibacter ... pomeroyi DSS-3] ref|YP_166804.1| ... protozoan
ORF Alignment: NC_002977 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002977 gi|53804116 >1dlwA 19 113 26 120 5e-13 ... gb|AAU92168.1| protozoan/cyanoba...cterial globin family protein [Methylococcus ... capsulatus str. Bath] ref|YP_114018.1| ... protozoa
ORF Alignment: NC_005296 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005296 gi|39933534 >1rkd0 3 296 29 346 6e-36 ... emb|CAE25901.1| possible cabohydr...ate kinases [Rhodopseudomonas palustris CGA009] ... ref|NP_945810.1| possible cabohydrate kinases ...
ORF Alignment: NC_003296 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003296 gi|17548586 >1gkmA 10 504 26 526 e-118 ... ref|NP_521926.1| PROBABLE HISTIDINE AMMONIA...-LYASE PROTEIN [Ralstonia solanacearum ... GMI1000] emb|CAD17516.1| PROBABLE HISTIDINE ... AMMONIA
ORF Alignment: NC_003902 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003902 gi|21231422 >1iwlA 2 180 23 207 3e-47 ... ref|NP_637339.1| outer-membrane lipoproteins... ... gb|AAM41263.1| outer-membrane lipoproteins carrier ... protein precursor [Xanthomonas campest
ORF Alignment: NC_003902 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003902 gi|21232942 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put
ORF Alignment: NC_003919 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21242877 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put
ORF Alignment: NC_004663 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004663 gi|29348666 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put
ORF Alignment: NC_004578 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004578 gi|28867366 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put
ORF Alignment: NC_005139 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_005139 gi|37678876 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put
ORF Alignment: NC_003919 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21241391 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put
ORF Alignment: NC_006177 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006177 gi|51892124 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put
ORF Alignment: NC_006349 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006349 gi|53716793 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put
ORF Alignment: NC_006840 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006840 gi|59711756 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put
ORF Alignment: NC_006370 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006370 gi|54310137 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put
ORF Alignment: NC_003919 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21243399 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put
ORF Alignment: NC_003869 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003869 gi|20807352 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put
ORF Alignment: NC_006351 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006351 gi|53722013 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put
ORF Alignment: NC_004459 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004459 gi|27363966 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put
ORF Alignment: NC_004461 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004461 gi|27467672 >1pwgA 4 344 72 389 1e-36 ... ref|NP_764309.1| autolysis and me...thicillin resistant-related protein [Staphylococcus ... epidermidis ATCC 12228] gb|AAO04351.1| autolysis
ORF Alignment: NC_006834 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006834 gi|58583632 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put
ORF Sequence: NC_001136 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_001136 gi|6320573 >gi|6320573|ref|NP_010653.1| Nucleolar protein involved in pre-rRNA processing; deplet...ion causes severely decreased 18S rRNA levels; Esf1p [Saccharomyces cerevisiae] MAG
ORF Alignment: NC_000964 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_000964 gi|16078891 >1jmkC 6 230 1056 1270 2e-59 ... ref|NP_389712.1| plipastatin s...ynthetase [Bacillus subtilis subsp. subtilis str. 168] ... emb|CAB13713.1| plipastatin synthetase [B
ORF Alignment: NC_006841 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006841 gi|59714046 >1gntA 1 552 1 553 0.0 ... ref|YP_206821.1| hydroxylamine reduc...tase [Vibrio fischeri ES114] gb|AAW87933.1| ... hydroxylamine reductase [Vibrio fischeri ES114] ...
ORF Alignment: NC_006677 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006677 gi|58039331 >1hxhA 1 247 2 262 8e-39 ... pir||JC7939 xylitol dehydrogenase ...(EC 1.1.1.-) - Gluconobacter oxydans (Strain ... ATCC621) dbj|BAC16227.1| xylitol dehydrogenase ...
ORF Alignment: NC_002570 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002570 gi|15612789 >1v7zA 3 254 1 238 1e-53 ... dbj|BAB03945.1| creatinine amidohy...drolase [Bacillus halodurans C-125] ... ref|NP_241092.1| creatinine amidohydrolase [Bacillus ...
ORF Alignment: NC_004463 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004463 gi|27377041 >1xewY 1 130 1026 1153 2e-37 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta
ORF Alignment: NC_000909 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_000909 gi|15669839 >1gxlA 2 204 475 685 1e-34 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta
ORF Alignment: NC_003237 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003237 gi|19075000 >1xewY 1 130 1026 1153 2e-37 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta
ORF Alignment: NC_000909 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_000909 gi|15669839 >1xewY 1 130 1026 1153 2e-37 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus jannaschii ... DSM 2661] gb|AAB99663.1| chromosome segreta
ORF Alignment: NC_003485 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003485 gi|19746967 >1g5aA 98 625 11 538 6e-94 ... gb|AAL98602.1| putative dextran ...glucosidase [Streptococcus pyogenes MGAS8232] ... ref|NP_608103.1| putative dextran glucosidase ...
ORF Alignment: NC_005090 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005090 gi|34556965 >1mzbA 1 134 1 130 7e-21 ... ref|NP_906780.1| PEROXIDE STRESS R...EGULATOR [Wolinella succinogenes DSM 1740] ... emb|CAE09680.1| PEROXIDE STRESS REGULATOR [Wolinella ...
ORF Alignment: NC_006395 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006395 gi|55376664 >1v7zA 1 249 5 243 8e-44 ... ref|YP_134515.1| creatinine amidoh...ydrolase [Haloarcula marismortui ATCC 43049] ... gb|AAV44809.1| creatinine amidohydrolase [Haloarcula
ORF Alignment: NC_005296 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005296 gi|39933548 >1v7zA 10 254 14 256 2e-44 ... emb|CAE25915.1| putative creatin...e amidohydrolase [Rhodopseudomonas palustris ... CGA009] ref|NP_945824.1| putative creatine ...
ORF Alignment: NC_002928 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002928 gi|33596750 >1v7zA 3 253 1 251 8e-40 ... ref|NP_884393.1| putative creatini...ne amidohydrolase [Bordetella parapertussis 12822] ... emb|CAE37436.1| putative creatinine amidohydro
ORF Alignment: NC_006576 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006576 gi|56750058 >1v7zA 4 251 11 256 7e-49 ... ref|YP_170759.1| creatinine amido...hydrolase [Synechococcus elongatus PCC 6301] ... dbj|BAD78239.1| creatinine amidohydrolase [Synechoco
ORF Alignment: NC_006395 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006395 gi|55376890 >1v7zA 5 250 13 257 5e-37 ... ref|YP_134741.1| creatinine amido...hydrolase [Haloarcula marismortui ATCC 43049] ... gb|AAV45035.1| creatinine amidohydrolase [Haloarcul
ORF Alignment: NC_004311 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004311 gi|23500710 >1v7zA 10 254 1 242 2e-43 ... gb|AAN34155.1| creatinine amidohy...drolase, putative [Brucella suis 1330] ... ref|NP_700150.1| creatinine amidohydrolase, putative ...
ORF Alignment: NC_002771 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002771 gi|15829246 >1nm8A 15 579 43 592 3e-82 ... ref|NP_326606.1| CARNITINE O-ACE...TYLTRANSFERASE [Mycoplasma pulmonis UAB CTIP] ... emb|CAC13948.1| CARNITINE O-ACETYLTRANSFERASE ...
ORF Alignment: NC_006677 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006677 gi|58039110 >1kmoA 11 661 79 730 2e-52 ... ref|YP_191074.1| Hydroxamate-type ferris...iderophore receptor [Gluconobacter oxydans ... 621H] gb|AAW60418.1| Hydroxamate-type ferrisid
ORF Alignment: NC_006677 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006677 gi|58039006 >1kmoA 12 661 92 773 1e-43 ... ref|YP_190970.1| Hydroxamate-type ferris...iderophore receptor [Gluconobacter oxydans ... 621H] gb|AAW60314.1| Hydroxamate-type ferrisid
ORF Alignment: NC_006370 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006370 gi|54310050 >1r0wC 43 281 30 288 6e-50 ... ref|YP_131070.1| putative ABC-type oligopeptide transport...putative ... ABC-type oligopeptide transportsystem, ATPase component ... [Photobacterium profu
ORF Alignment: NC_006361 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006361 gi|54022220 >1y7yA 7 68 12 73 3e-05 ... ref|YP_132230.1| hypotethical trans...criptional regulator [Photobacterium profundum ... SS9] emb|CAG22430.1| hypotethical transcriptional ...
ORF Sequence: NC_001141 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_001141 gi|6322114 >gi|6322114|ref|NP_012189.1| Part of a heptameric protein complex that regulates retro...grade Golgi-to-ER protein traffic in eukaryotic cells; coatomer forms the COP I ves
ORF Alignment: NC_005085 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005085 gi|34499386 >1qgiA 1 259 102 360 4e-95 ... gb|AAQ61593.1| probable chitosan...ase A [Chromobacterium violaceum ATCC 12472] ... ref|NP_903601.1| probable chitosanase A [Chromobacte
ORF Alignment: NC_006274 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006274 gi|52142820 >1kwfA 3 362 53 435 5e-85 ... ref|YP_084010.1| chitosanase; gly...cosyl hydrolases family 8; endoglucanase [Bacillus ... cereus ZK] gb|AAU17839.1| chitosanase; glycosy
ORF Alignment: NC_006348 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006348 gi|53725407 >1dlwA 1 115 25 145 1e-19 ... ref|YP_103467.1| protozoan/cyanob...acterial globin family protein [Burkholderia mallei ... ATCC 23344] gb|AAU49423.1| protozoan/cyanobac
ORF Alignment: NC_002976 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002976 gi|57866545 >1dlwA 19 115 47 146 6e-19 ... ref|YP_188173.1| protozoan/cyano...bacterial globin family protein [Staphylococcus ... epidermidis RP62A] gb|AAW53991.1| ... protozoa
ORF Alignment: NC_002951 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002951 gi|57650195 >1dlwA 19 115 21 120 3e-19 ... ref|YP_185875.1| protozoan/cyano...bacterial globin family protein [Staphylococcus ... aureus subsp. aureus COL] gb|AAW36475.1| ... protozoa
ORF Alignment: NC_006350 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006350 gi|53718816 >1dlwA 1 115 25 145 1e-19 ... ref|YP_103467.1| protozoan/cyanob...acterial globin family protein [Burkholderia mallei ... ATCC 23344] gb|AAU49423.1| protozoan/cyanobac
ORF Alignment: NC_006087 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006087 gi|50955733 >1exqA 11 145 176 318 6e-09 ... ref|YP_063021.1| transposase, undefined... [Leifsonia xyli subsp. xyli str. CTCB07] ... gb|AAT89916.1| transposase, undefined [Leifsoni
ORF Alignment: NC_004668 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004668 gi|29376585 >1pq4B 1 288 29 305 1e-52 ... ref|NP_815739.1| endocarditis spe...cific antigen [Enterococcus faecalis V583] ... gb|AAO81809.1| endocarditis specific antigen ...
ORF Alignment: NC_000921 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_000921 gi|15612352 >1mwmA 3 314 14 329 4e-45 ... ref|NP_224005.1| ROD SHAPE-DETERMINING... PROTEIN [Helicobacter pylori J99] ... gb|AAD06861.1| ROD SHAPE-DETERMINING PROTEIN ... [
ORF Alignment: NC_003295 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003295 gi|17544778 >1mwmA 4 314 14 329 3e-49 ... emb|CAD13587.1| PROBABLE ROD SHAPE-DETERMINING... PROTEIN [Ralstonia solanacearum] ... ref|NP_518180.1| PROBABLE ROD SHAPE-DETERMINING PR
ORF Alignment: NC_003295 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003295 gi|17548082 >1wcv1 2 241 2 249 7e-27 ... emb|CAD16862.1| PROBABLE SEPTUM SITE-DETERMINING... PROTEIN MIND [Ralstonia ... solanacearum] ref|NP_521484.1| PROBABLE SEPTUM ... SITE-DETERMINING
ORF Alignment: NC_003295 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003295 gi|17547375 >1v4aA 29 433 25 452 2e-95 ... emb|CAD16363.1| PROBABLE GLUTAMATE-AMMONIA... ... [Ralstonia solanacearum] ref|NP_520777.1| PROBABLE ... GLUTAMATE-AMMONIA-LIGASE ADENYLYLTRANSFERAS
ORF Alignment: NC_003317 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003317 gi|17987610 >1v4aA 20 435 2 420 e-106 ... gb|AAL52508.1| GLUTAMATE-AMMONIA-...LIGASE ADENYLYLTRANSFERASE [Brucella melitensis ... 16M] ref|NP_540244.1| GLUTAMATE-AMMONIA-LIGASE ...
ORF Alignment: NC_005126 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005126 gi|37525549 >1iwlA 1 182 22 203 4e-57 ... ref|NP_928893.1| outer-membrane lipoproteins... ... emb|CAE13895.1| outer-membrane lipoproteins carrier ... protein precursor (P20) [Photorhabdus
ORF Alignment: NC_004603 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004603 gi|28897880 >1iwlA 4 181 30 207 4e-54 ... ref|NP_797485.1| outer membrane lipoproteins... carrier protein [Vibrio ... parahaemolyticus RIMD 2210633] dbj|BAC59369.1| outer ... membrane lipoproteins
ORF Alignment: NC_005966 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005966 gi|50085964 >1iwlA 2 180 37 230 6e-44 ... ref|YP_047474.1| outer-membrane lipoproteins... carrier protein [Acinetobacter sp. ... ADP1] emb|CAG69652.1| outer-membrane lipoproteins
ORF Alignment: NC_005139 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005139 gi|37679507 >1iwlA 4 181 20 197 6e-54 ... ref|NP_934116.1| outer membrane lipoproteins...tein ... carrier protein precursor dbj|BAC94087.1| outer membrane ... lipoproteins carrier pro
ORF Alignment: NC_005085 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005085 gi|34497069 >1iwlA 2 178 25 203 1e-46 ... gb|AAQ59290.1| outer membrane lipoproteins... carrier protein [Chromobacterium ... violaceum ATCC 12472] ref|NP_901284.1| outer membrane ... lipoproteins
Directory of Open Access Journals (Sweden)
André Bénit
2017-11-01
Full Text Available 150 years ago, in June 1867, the execution of Maximilian of Habsburg by Benito Juarez’s men marked the end of the Second Mexican Empire. One year earlier, the Empress Carlota had returned to Europe to request from Napoleon III that he maintain his troops in Mexico and from Pope Pius IX that he sign a concordat to save the Empire, but to no avail. With these setbacks, Carlota’s mental breakdown became increasingly obvious and noto- rious… In these pages, we recount the Belgian princess’s progressive descent into madness as told by novelists in French language. A tragic fairy tale… Il y a 150 ans, en juin 1867, l’exécution de Maximilien de Habsbourgar les hommes de Benito Juarez mettait fin au Second Empire mexicain. Un an avant, l’impératrice Charlotte de Belgique était rentrée en Europe pour prier Napoléon III de maintenir ses troupes au Mexique et le pape Pie IX de signer un concordat dans le but de sauver leur empire. En vain. Suite à ces échecs, la santé mentale de Charlotte se détériora indiscutablement... Dans ces pages, nous tentons de relater la progressive plongée de la princesse belge dans les ténèbres de la folie ainsi que la racontent les romanciers/romancières en langue fran- çaise. Un conte de fées tragique...
ORF Alignment: NC_004331 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004331 gi|23619306 >1wfiA 3 125 209 328 1e-34 ... ref|NP_705268.1| nuclear movement... protein, putative [Plasmodium falciparum 3D7] ... emb|CAD52505.1| nuclear movement protein, putativ
ORF Alignment: NC_003911 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003911 gi|56698151 >1wy2A 3 347 27 396 7e-44 ... gb|AAV96554.1| creatinase [Silici...bacter pomeroyi DSS-3] ref|YP_168523.1| ... creatinase [Silicibacter pomeroyi DSS-3] ... Length
ORF Alignment: NC_003366 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003366 gi|18309739 >1v7zA 1 255 3 250 3e-61 ... dbj|BAB80463.1| creatinase [Clostr...idium perfringens str. 13] ref|NP_561673.1| ... creatinase [Clostridium perfringens str. 13] ...
ORF Alignment: NC_005090 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005090 gi|34557929 >1kmoA 12 661 39 664 3e-52 ... ref|NP_907744.1| RECEPTOR PRECURSOR-Most...ly Fe transport [Wolinella succinogenes DSM ... 1740] emb|CAE10644.1| RECEPTOR PRECURSOR-Most
ORF Alignment: NC_003155 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003155 gi|29828632 >1w1oA 22 489 11 408 6e-19 ... dbj|BAC69801.1| putative xylitol... oxidase [Streptomyces avermitilis MA-4680] ... ref|NP_823266.1| putative xylitol oxidase [Streptomyc
ORF Alignment: NC_004605 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004605 gi|28900808 >1l3wA 6 536 1265 1798 3e-11 ... ref|NP_800463.1| putative biofilm...-associated surface protein [Vibrio parahaemolyticus ... RIMD 2210633] dbj|BAC62296.1| putative biofilm
ORF Alignment: NC_003070 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003070 gi|15221381 >1bq00 2 77 15 90 4e-20 ... ref|NP_177004.1| gravity-responsive... protein / altered response to gravity protein ... (ARG1) [Arabidopsis thaliana] gb|AAD13758.1| Altere
ORF Alignment: NC_000909 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_000909 gi|15669839 >1ii8A 3 194 4 202 2e-10 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta
ORF Alignment: NC_002947 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002947 gi|26990072 >1uzbA 37 513 3 472 6e-68 ... ref|NP_745497.1| vanillin dehydro...genase [Pseudomonas putida KT2440] gb|AAN68961.1| ... vanillin dehydrogenase [Pseudomonas putida KT24
ORF Alignment: NC_002737 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002737 gi|15675767 >1g5aA 89 627 2 535 3e-86 ... gb|AAK34662.1| dextran glucosidas...e [Streptococcus pyogenes M1 GAS] ... ref|NP_269941.1| dextran glucosidase [Streptococcus ...
ORF Alignment: NC_003485 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003485 gi|19746879 >1g5aA 89 627 2 535 1e-86 ... gb|AAL98514.1| putative dextran g...lucosidase [Streptococcus pyogenes MGAS8232] ... ref|NP_608015.1| putative dextran glucosidase ...
ORF Alignment: NC_002737 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002737 gi|15675852 >1g5aA 98 625 11 538 9e-95 ... gb|AAK34747.1| putative dextran ...glucosidase [Streptococcus pyogenes M1 GAS] ... ref|NP_270026.1| putative dextran glucosidase ...
ORF Alignment: NC_002927 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002927 gi|33600518 >1v7zA 3 253 1 251 1e-39 ... ref|NP_888078.1| putative creatini...ne amidohydrolase [Bordetella bronchiseptica RB50] ... emb|CAE32030.1| putative creatinine amidohydro
ORF Alignment: NC_000853 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_000853 gi|15643179 >1v7zA 3 256 7 270 9e-43 ... ref|NP_228223.1| creatinine amidoh...ydrolase, putative [Thermotoga maritima MSB8] ... gb|AAD35498.1| creatinine amidohydrolase, putative
ORF Alignment: NC_004307 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004307 gi|23464642 >1v7zA 5 255 7 250 1e-55 ... ref|NP_695245.1| creatinine amidohydrolase; creatin...inase [Bifidobacterium longum ... NCC2705] gb|AAN23881.1| creatinine amidohydrolase; ... creatin
ORF Alignment: NC_002944 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002944 gi|41407994 >4uagA 7 413 12 470 1e-38 ... ref|NP_960830.1| MurC [Mycobacter... ... ligase (UDP-N-acetylmuramoyl-L-alanine synthetase) ... gb|AAS04213.1| MurC [Mycobacterium
ORF Alignment: NC_002678 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002678 gi|13471241 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris ... CGA009] ref|NP_948814.1| possible energy transducer ...
ORF Alignment: NC_000117 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_000117 gi|15605507 >2bjiA 3 266 5 313 9e-29 ... ref|NP_220293.1| Sulfite Synthesis.../biphosphate phosphatase [Chlamydia trachomatis ... D/UW-3/CX] gb|AAC68369.1| Sulfite Synthesis/bipho
ORF Alignment: NC_003280 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003280 gi|25149956 >1qauA 5 99 56 151 2e-04 ... gb|AAN38752.1| axon identity speci...rm b ... [Caenorhabditis elegans] ref|NP_495592.2| SYnapse ... Defective SYD-1, axon identity
ORF Alignment: NC_004722 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004722 gi|30021592 >1vkpA 12 368 2 333 2e-83 ... ref|NP_833223.1| Agmatine deimina...se [Bacillus cereus ATCC 14579] gb|AAP10424.1| ... Agmatine deiminase [Bacillus cereus ATCC 14579] ...
ORF Alignment: NC_002952 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002952 gi|49483165 >1dlwA 19 115 21 120 3e-19 ... ref|YP_040389.1| protozoan/cyano...bacterial globin family protein [Staphylococcus ... aureus subsp. aureus MRSA252] emb|CAG39975.1| ... protozoa
ORF Alignment: NC_005090 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005090 gi|34556511 >1mwmA 3 314 14 327 1e-46 ... ref|NP_906326.1| PUTATIVE ROD SHAPE-DETERMINING... PROTEIN [Wolinella succinogenes DSM ... 1740] emb|CAE09226.1| PUTATIVE ROD SHAPE-DETERMINING
ORF Alignment: NC_000921 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_000921 gi|15611661 >1vdkA 1 460 2 461 e-141 ... ref|NP_223312.1| ASPARTATE AMMONIA...-LYASE [Helicobacter pylori J99] gb|AAD06167.1| ... ASPARTATE AMMONIA-LYASE [Helicobacter pylori J99
ORF Alignment: NC_003317 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003317 gi|17986393 >1vdkA 1 459 12 469 e-123 ... gb|AAL51291.1| ASPARTATE AMMONIA-...LYASE [Brucella melitensis 16M] ref|NP_539027.1| ... ASPARTATE AMMONIA-LYASE [Brucella melitensis 16M
ORF Alignment: NC_006348 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006348 gi|53726032 >1iwlA 3 178 47 236 2e-42 ... ref|YP_109199.1| probable outer-membrane lipoproteins... ATCC 23344] ... emb|CAH36611.1| probable outer-membrane lipoproteins ... carrier protein [Bur
ORF Alignment: NC_006840 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006840 gi|59711513 >1iwlA 4 181 21 198 9e-49 ... ref|YP_204289.1| outer-membrane lipoproteins... carrier protein [Vibrio fischeri ES114] ... gb|AAW85401.1| outer-membrane lipoproteins ca
ORF Alignment: NC_006350 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006350 gi|53720213 >1iwlA 3 178 47 236 2e-42 ... ref|YP_109199.1| probable outer-membrane lipoproteins... ATCC 23344] ... emb|CAH36611.1| probable outer-membrane lipoproteins ... carrier protein [Bur
Solar Maps | Geospatial Data Science | NREL
Solar Maps Solar Maps These solar maps provide average daily total solar resource information on disability, contact the Geospatial Data Science Team. U.S. State Solar Resource Maps Access state maps of MT NE NV NH NJ NM NY NC ND OH OK OR PA RI SC SD TN TX UT VT VA WA WV WI WY Ã U.S. Solar Resource
ORF Alignment: NC_005085 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005085 gi|34495619 >1t06A 1 193 1 205 2e-24 ... gb|AAQ57843.1| DNA alkylation repa...ir enzyme [Chromobacterium violaceum ATCC 12472] ... ref|NP_899834.1| DNA alkylation repair enzyme ...
ORF Alignment: NC_004307 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004307 gi|23466169 >1u94A 19 326 67 387 5e-28 ... ref|NP_696772.1| alkylation dama...ge repair protein [Bifidobacterium longum NCC2705] ... gb|AAN25408.1| alkylation damage repair protei
ORF Alignment: NC_005027 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005027 gi|32477023 >1t06A 1 191 9 220 1e-24 ... ref|NP_870017.1| probable DNA alkylation... repair enzyme [Rhodopirellula baltica SH 1] ... emb|CAD79170.1| probable DNA alkylation repair
ORF Alignment: NC_004350 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004350 gi|24378587 >1t06A 1 191 11 210 3e-32 ... gb|AAN57848.1| DNA alkylation rep...air enzyme [Streptococcus mutans UA159] ... ref|NP_720542.1| DNA alkylation repair enzyme ...
ORF Alignment: NC_002945 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002945 gi|31791180 >1ii8A 1 187 1 168 2e-14 ... ref|NP_853673.1| DNA REPLICATION A...D92865.1| ... DNA REPLICATION AND REPAIR PROTEIN RECF (SINGLE-STRAND ... DNA BINDING PROTEIN)
ORF Alignment: NC_003317 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003317 gi|17987645 >1j1vA 4 94 20 109 8e-10 ... gb|AAL52543.1| CHROMOSOMAL REPLICATION... INITIATOR PROTEIN DNAA [Brucella melitensis ... 16M] ref|NP_540279.1| CHROMOSOMAL REPLICATION IN
ORF Alignment: NC_003232 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003232 gi|19173617 >1ltlE 7 224 22 242 3e-38 ... ref|NP_597420.1| DNA REPLICATION ...LICENSING FACTOR OF THE MCM FAMILY (MCM6) ... [Encephalitozoon cuniculi] emb|CAD26597.1| DNA ... REPLICATION
ORF Alignment: NC_003071 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003071 gi|18403860 >1rl1A 4 90 215 300 7e-09 ... ref|NP_705268.1| nuclear movement... protein, putative [Plasmodium falciparum 3D7] ... emb|CAD52505.1| nuclear movement protein, putative
ORF Alignment: NC_003902 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003902 gi|21229523 >1p6rA 5 81 4 80 4e-10 ... ref|NP_635440.1| methicillin resista...nce protein [Xanthomonas campestris pv. ... campestris str. ATCC 33913] gb|AAM39364.1| methicillin ...
ORF Alignment: NC_003919 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003919 gi|21240843 >1p6rA 5 81 4 80 8e-10 ... gb|AAM34961.1| methicillin resistanc...e protein [Xanthomonas axonopodis pv. citri ... str. 306] ref|NP_640425.1| methicillin resistance ...
ORF Alignment: NC_002952 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002952 gi|49483221 >1pwgA 4 329 74 373 1e-38 ... ref|YP_040445.1| autolysis and me...thicillin resistant-related protein [Staphylococcus ... aureus subsp. aureus MRSA252] emb|CAG40034.1| autolysis
ORF Alignment: NC_002947 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002947 gi|26990378 >1wy2A 3 347 23 393 2e-45 ... ref|NP_745803.1| creatinase [Pseu...domonas putida KT2440] gb|AAN69267.1| creatinase ... [Pseudomonas putida KT2440] ... Length = 3
ORF Alignment: NC_002946 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002946 gi|59800954 >1ub4B 4 109 2 113 3e-22 ... ref|YP_207666.1| putative plasmid stable inheritance... ... gb|AAW89254.1| putative plasmid stable inheritance ... protein putative phage associated prote
ORF Alignment: NC_002745 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002745 gi|15925959 >1kolA 35 389 28 338 2e-04 ... dbj|BAB56418.1| similar to xylitol... ... SA0246 [Staphylococcus aureus subsp. aureus N315] ... ref|NP_370780.1| similar to xylitol
ORF Alignment: NC_002758 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002758 gi|15923246 >1kolA 35 389 28 338 2e-04 ... dbj|BAB56418.1| similar to xylitol... ... SA0246 [Staphylococcus aureus subsp. aureus N315] ... ref|NP_370780.1| similar to xylitol
ORF Alignment: NC_005296 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005296 gi|39936538 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T
ORF Alignment: NC_003075 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003075 gi|30692533 >3ullA 5 115 1 104 8e-18 ... ref|YP_063478.1| ssb1 [Campylobact...er jejuni] gb|AAR29567.1| ssb1 [Campylobacter ... jejuni] ... Length = 104 ... Query: 31 ... GQDSDVS
ORF Alignment: NC_003070 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003070 gi|42572131 >1ig6A 3 105 144 247 2e-18 ... ref|NP_177777.3| ARID/BRIGHT DNA...-binding domain-containing protein [Arabidopsis ... thaliana] ref|NP_974156.1| ARID/BRIGHT DNA-bindin
ORF Alignment: NC_003070 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003070 gi|42563264 >1ig6A 3 105 144 247 2e-18 ... ref|NP_177777.3| ARID/BRIGHT DNA...-binding domain-containing protein [Arabidopsis ... thaliana] ref|NP_974156.1| ARID/BRIGHT DNA-bindin
ORF Alignment: NC_003106 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003106 gi|15922820 >1n62B 24 793 4 684 e-115 ... ref|NP_378489.1| hypothetical nicotine... dehydrogenase subunit C [Sulfolobus tokodaii ... str. 7] dbj|BAB67598.1| 685aa long hypothetical nicotine
ORF Alignment: NC_006509 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006509 gi|56410456 >1n62C 1 286 1 287 4e-70 ... ref|YP_145830.1| nicotine dehydrog...enase chain A [Geobacillus kaustophilus HTA426] ... dbj|BAD74262.1| nicotine dehydrogenase chain A ...
ORF Alignment: NC_004310 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004310 gi|23502014 >1y7mA 26 161 48 214 1e-16 ... gb|AAL52029.1| PROBABLE CARNITINE... OPERON OXIDOREDUCTASE CAIA [Brucella melitensis ... 16M] ref|NP_539765.1| PROBABLE CARNITINE OPERON
ORF Alignment: NC_003317 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003317 gi|17987131 >1y7mA 26 161 48 214 1e-16 ... gb|AAL52029.1| PROBABLE CARNITINE... OPERON OXIDOREDUCTASE CAIA [Brucella melitensis ... 16M] ref|NP_539765.1| PROBABLE CARNITINE OPERON
ORF Alignment: NC_006370 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006370 gi|54310056 >1r0wC 45 273 39 283 1e-54 ... ref|YP_131076.1| putative ABC-type metal ion transports...ative ... ABC-type metal ion transportsystem, ATPase component ... [Photobacterium profundum
ORF Alignment: NC_001137 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ograde regulon which ... consists of genes whose expression is stimulated by... NC_001137 gi|6320764 >1wvfA 13 508 29 496 1e-67 ... ref|NP_010843.1| D-lactate dehydrogenase, part of the retr
ORF Alignment: NC_002939 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002939 gi|39995137 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T
ORF Alignment: NC_004463 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004463 gi|27379019 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T
ORF Alignment: NC_003280 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003280 gi|25149956 >1tx4A 1 170 679 853 1e-24 ... gb|AAN38752.1| axon identity spe...form b ... [Caenorhabditis elegans] ref|NP_495592.2| SYnapse ... Defective SYD-1, axon identity
ORF Alignment: NC_006348 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006348 gi|53726196 >1umqA 5 59 22 76 8e-06 ... ref|ZP_00216666.1| COG2901: Factor for inversion...ef|ZP_00221526.1| COG2901: Factor for inversion ... stimulation Fis, transcriptional activator ...
ORF Alignment: NC_004459 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004459 gi|27364633 >1etoB 1 98 1 98 7e-29 ... ref|YP_131497.1| putative factor-for-inversion... stimulation protein [Photobacterium ... profundum SS9] emb|CAG21695.1| putative ... factor-for-inversion
ORF Alignment: NC_004603 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004603 gi|28899659 >1etoB 1 98 1 98 7e-29 ... ref|YP_131497.1| putative factor-for-inversion... stimulation protein [Photobacterium ... profundum SS9] emb|CAG21695.1| putative ... factor-for-inversion
ORF Alignment: NC_004061 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004061 gi|21672661 >1etoB 1 98 1 99 3e-23 ... ref|NP_660728.1| factor-for-inversion... stimulation protein [Buchnera aphidicola ... str. Sg (Schizaphis graminum)] gb|AAM67939.1| ... factor-for-inversion
ORF Alignment: NC_006350 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006350 gi|53720503 >1umqA 5 59 22 76 8e-06 ... ref|ZP_00216666.1| COG2901: Factor for inversion...ef|ZP_00221526.1| COG2901: Factor for inversion ... stimulation Fis, transcriptional activator ...
ORF Alignment: NC_005139 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005139 gi|37681323 >1etoB 1 98 1 98 7e-29 ... ref|YP_131497.1| putative factor-for-inversion... stimulation protein [Photobacterium ... profundum SS9] emb|CAG21695.1| putative ... factor-for-inversion
ORF Alignment: NC_006370 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006370 gi|54310477 >1etoB 1 98 1 98 7e-29 ... ref|YP_131497.1| putative factor-for-inversion... stimulation protein [Photobacterium ... profundum SS9] emb|CAG21695.1| putative ... factor-for-inversion
ORF Alignment: NC_004578 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004578 gi|28871348 >1dlwA 1 114 25 138 3e-25 ... ref|NP_793967.1| protozoan/cyanob...acterial globin family protein [Pseudomonas ... syringae pv. tomato str. DC3000] gb|AAO57662.1| ... protozoa
ORF Sequence: NC_001146 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_001146 gi|6324141 >gi|6324141|ref|NP_014211.1| Essential protein involved in karyoga...he spindle pole body, interacts with Spc72p during karyogamy, also interacts with Cdc31p; Kar1p [Saccharomyc
ORF Sequence: NC_001139 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_001139 gi|50593217 >gi|50593217|ref|NP_011747.2| Subunit of the prohibitin complex (Phb1p-Phb2p...sized proteins; determinant of replicative life span; involved in mitochondrial segregation; Phb2p [Saccharo
ORF Alignment: NC_004917 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004917 gi|32265815 >1iwlA 11 178 23 174 4e-23 ... gb|AAP76913.1| outer membrane lipoproteins... carrier protein LolA [Helicobacter ... hepaticus ATCC 51449] ref|NP_859847.1| outer membrane ... lipoprotein
National Research Council Canada - National Science Library
Kim, Byung
1997-01-01
.... In Phase II, a pilot-scale crossflow membrane filtration system was constructed to: (1) investigate the concentration polarization and fouling mechanism caused by NC fines during crossflow filtration of NC wastewater, (2...
Anaïs Vernède
2011-01-01
On Tuesday 18 January 2011, artist Pipilotti Rist came to CERN to find out how science could provide her with a source of inspiration for her art and perhaps to get ideas for future work. Pipilotti, who is an eclectic artist always on the lookout for an original source of inspiration, is almost as passionate about physics as she is about art. Ever Is Over All, 1997, audio video installation by Pipilotti Rist. View of the installation at the National Museum for Foreign Art, Sofia, Bulgaria. © Pipilotti Rist. Courtesy the artist and Hauser & Wirth. Photo by Angel Tzvetanov. Swiss video-maker Pipilotti Rist (her real name is Elisabeth Charlotte Rist), who is well-known in the international art world for her highly colourful videos and creations, visited CERN for the first time on Tuesday 18 January 2011. Her visit represented a trip down memory lane, since she originally studied physics before becoming interested in pursuing a career as an artist and going on to de...
Journal of Rehabilitation Research and Development, Volume 30, Number 1, 1993
1993-01-01
MS; A. Maynard Engebretson, DSc 26 Intelligibility of frequency-lowered speech produced by a channel vocoder Miles P. Posen, MS; Charlotte M. Reed, PhD...Intelligibility of frequency-lowered speech produced by a channel vocoder Miles P. Posen, MS; Charlotte M. Reed, PhD; Louis D. Braida, PhD Research...Deafness. Ezzell C, Sci News 141(18):296-297, 1992. Luttmann A, Ergonomics 35(7/8):783-805, 1992. Contact: Carol Ezzell , c/o Science News 1719 N St
Salhi, Adil
2017-04-07
Noncoding RNAs (ncRNAs), particularly microRNAs (miRNAs) and long ncRNAs (lncRNAs), are important players in diseases and emerge as novel drug targets. Thus, unraveling the relationships between ncRNAs and other biomedical entities in cells are critical for better understanding ncRNA roles that may eventually help develop their use in medicine. To support ncRNA research and facilitate retrieval of relevant information regarding miRNAs and lncRNAs from the plethora of published ncRNA-related research, we developed DES-ncRNA ( www.cbrc.kaust.edu.sa/des_ncrna ). DES-ncRNA is a knowledgebase containing text- and data-mined information from public scientific literature and other public resources. Exploration of mined information is enabled through terms and pairs of terms from 19 topic-specific dictionaries including, for example, antibiotics, toxins, drugs, enzymes, mutations, pathways, human genes and proteins, drug indications and side effects, mutations, diseases, etc. DES-ncRNA contains approximately 878,000 associations of terms from these dictionaries of which 36,222 (5,373) are with regards to miRNAs (lncRNAs). We provide several ways to explore information regarding ncRNAs to users including controlled generation of association networks as well as hypotheses generation. We show an example how DES-ncRNA can aid research on Alzheimer\\'s disease and suggest potential therapeutic role for Fasudil. DES-ncRNA is a powerful tool that can be used on its own or as a complement to the existing resources, to support research in human ncRNA. To our knowledge, this is the only knowledgebase dedicated to human miRNAs and lncRNAs derived primarily through literature-mining enabling exploration of a broad spectrum of associated biomedical entities, not paralleled by any other resource.
Salhi, Adil; Essack, Magbubah; Alam, Tanvir; Bajic, Vladan P; Ma, Lina; Radovanovic, Aleksandar; Marchand, Benoit; Schmeier, Sebastian; Zhang, Zhang; Bajic, Vladimir B
2017-07-03
Noncoding RNAs (ncRNAs), particularly microRNAs (miRNAs) and long ncRNAs (lncRNAs), are important players in diseases and emerge as novel drug targets. Thus, unraveling the relationships between ncRNAs and other biomedical entities in cells are critical for better understanding ncRNA roles that may eventually help develop their use in medicine. To support ncRNA research and facilitate retrieval of relevant information regarding miRNAs and lncRNAs from the plethora of published ncRNA-related research, we developed DES-ncRNA ( www.cbrc.kaust.edu.sa/des_ncrna ). DES-ncRNA is a knowledgebase containing text- and data-mined information from public scientific literature and other public resources. Exploration of mined information is enabled through terms and pairs of terms from 19 topic-specific dictionaries including, for example, antibiotics, toxins, drugs, enzymes, mutations, pathways, human genes and proteins, drug indications and side effects, mutations, diseases, etc. DES-ncRNA contains approximately 878,000 associations of terms from these dictionaries of which 36,222 (5,373) are with regards to miRNAs (lncRNAs). We provide several ways to explore information regarding ncRNAs to users including controlled generation of association networks as well as hypotheses generation. We show an example how DES-ncRNA can aid research on Alzheimer disease and suggest potential therapeutic role for Fasudil. DES-ncRNA is a powerful tool that can be used on its own or as a complement to the existing resources, to support research in human ncRNA. To our knowledge, this is the only knowledgebase dedicated to human miRNAs and lncRNAs derived primarily through literature-mining enabling exploration of a broad spectrum of associated biomedical entities, not paralleled by any other resource.
Salhi, Adil; Essack, Magbubah; Alam, Tanvir; Bajic, Vladan P.; Ma, Lina; Radovanovic, Aleksandar; Marchand, Benoit; Schmeier, Sebastian; Zhang, Zhang; Bajic, Vladimir B.
2017-01-01
Noncoding RNAs (ncRNAs), particularly microRNAs (miRNAs) and long ncRNAs (lncRNAs), are important players in diseases and emerge as novel drug targets. Thus, unraveling the relationships between ncRNAs and other biomedical entities in cells are critical for better understanding ncRNA roles that may eventually help develop their use in medicine. To support ncRNA research and facilitate retrieval of relevant information regarding miRNAs and lncRNAs from the plethora of published ncRNA-related research, we developed DES-ncRNA ( www.cbrc.kaust.edu.sa/des_ncrna ). DES-ncRNA is a knowledgebase containing text- and data-mined information from public scientific literature and other public resources. Exploration of mined information is enabled through terms and pairs of terms from 19 topic-specific dictionaries including, for example, antibiotics, toxins, drugs, enzymes, mutations, pathways, human genes and proteins, drug indications and side effects, mutations, diseases, etc. DES-ncRNA contains approximately 878,000 associations of terms from these dictionaries of which 36,222 (5,373) are with regards to miRNAs (lncRNAs). We provide several ways to explore information regarding ncRNAs to users including controlled generation of association networks as well as hypotheses generation. We show an example how DES-ncRNA can aid research on Alzheimer's disease and suggest potential therapeutic role for Fasudil. DES-ncRNA is a powerful tool that can be used on its own or as a complement to the existing resources, to support research in human ncRNA. To our knowledge, this is the only knowledgebase dedicated to human miRNAs and lncRNAs derived primarily through literature-mining enabling exploration of a broad spectrum of associated biomedical entities, not paralleled by any other resource.
ORF Alignment: NC_004547 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004547 gi|50121646 >1kmoA 14 661 37 705 8e-56 ... ref|YP_050813.1| exogenous ferri...c siderophore TonB-dependent receptor [Erwinia ... carotovora subsp. atroseptica SCRI1043] emb|CAG75622.1| ... exogenou
ORF Alignment: NC_003364 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003364 gi|18312259 >1g8pA 7 306 385 684 6e-05 ... emb|CAD25272.1| DNA REPLICATION ...LICENSING FACTOR MCM2 [Encephalitozoon cuniculi ... GB-M1] ref|NP_584768.1| DNA REPLICATION LICENSING
ORF Alignment: NC_003236 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003236 gi|19074669 >1jmcA 1 238 213 445 1e-62 ... emb|CAD25779.1| DNA REPLICATION ...FACTOR A PROTEIN 1 [Encephalitozoon cuniculi GB-M1] ... ref|NP_586175.1| DNA REPLICATION FACTOR A PRO
ORF Alignment: NC_002607 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002607 gi|15791012 >1g8pA 7 306 385 684 6e-05 ... emb|CAD25272.1| DNA REPLICATION ...LICENSING FACTOR MCM2 [Encephalitozoon cuniculi ... GB-M1] ref|NP_584768.1| DNA REPLICATION LICENSING
ORF Alignment: NC_005861 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005861 gi|46446610 >1f39A 5 95 55 141 1e-16 ... ref|YP_007975.1| probable SOS mutagenesis... and repair protein UmuD [Parachlamydia sp. ... UWE25] emb|CAF23700.1| probable SOS mutagenesis
ORF Alignment: NC_005070 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005070 gi|33865578 >1f39A 4 97 54 143 4e-22 ... ref|NP_897137.1| putative SOS mutagenesis... protein UmuD [Synechococcus sp. WH 8102] ... emb|CAE07559.1| putative SOS mutagenesis protein
ORF Alignment: NC_002678 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002678 gi|13472874 >1b4uB 49 289 86 299 5e-14 ... ref|NP_104441.1| encapsulation p...rotein CapA [Mesorhizobium loti MAFF303099] ... dbj|BAB50227.1| encapsulation protein; CapA ...
ORF Alignment: NC_006177 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006177 gi|51893967 >1b4uB 49 289 86 299 5e-14 ... ref|NP_104441.1| encapsulation p...rotein CapA [Mesorhizobium loti MAFF303099] ... dbj|BAB50227.1| encapsulation protein; CapA ...
ORF Alignment: NC_002967 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002967 gi|42528039 >1b4uB 49 289 86 299 5e-14 ... ref|NP_104441.1| encapsulation p...rotein CapA [Mesorhizobium loti MAFF303099] ... dbj|BAB50227.1| encapsulation protein; CapA ...
ORF Alignment: NC_002945 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002945 gi|31792055 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION
ORF Alignment: NC_002945 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002945 gi|31793631 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION
ORF Alignment: NC_002755 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002755 gi|15841974 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION
ORF Alignment: NC_002755 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002755 gi|15840280 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION
ORF Alignment: NC_000962 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_000962 gi|15609587 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION
ORF Alignment: NC_003155 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003155 gi|29830077 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION
ORF Alignment: NC_000962 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_000962 gi|15608007 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION
ORF Alignment: NC_006582 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006582 gi|56962048 >1sd4A 2 99 6 103 1e-24 ... ref|YP_173770.1| methicillin resist...ance regulatory protein MecI [Bacillus clausii ... KSM-K16] dbj|BAD62809.1| methicillin resistance ...
ORF Alignment: NC_005363 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005363 gi|42524871 >1tjlA 27 144 16 133 6e-10 ... ref|NP_970251.1| dnaK deletion s...uppressor protein [Bdellovibrio bacteriovorus HD100] ... emb|CAE78310.1| dnaK deletion suppressor pro
ORF Alignment: NC_004463 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004463 gi|27380945 >1tjlA 26 141 1 116 7e-32 ... ref|NP_772474.1| dnaK deletion su...ppressor protein [Bradyrhizobium japonicum USDA ... 110] dbj|BAC51099.1| dnaK deletion suppressor pro
ORF Alignment: NC_003921 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003921 gi|21264213 >1ub4C 1 63 1 63 4e-10 ... gb|AAM39232.1| plasmid stable inheritance... protein I [Xanthomonas axonopodis pv. ... citri str. 306] ref|NP_644714.1| plasmid stable ... inheritance
ORF Alignment: NC_003921 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003921 gi|21264212 >1m1fA 1 109 2 110 1e-34 ... gb|AAM39231.1| plasmid stable inheritance... protein K [Xanthomonas axonopodis pv. ... citri str. 306] ref|NP_644713.1| plasmid stable ... inheritance
ORF Alignment: NC_005791 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005791 gi|45358156 >1wcv1 4 241 4 235 5e-21 ... ref|NP_987713.1| walker type ATPas...e [Methanococcus maripaludis S2] emb|CAF30149.1| ... walker type ATPase [Methanococcus maripaludis S2
ORF Alignment: NC_003283 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003283 gi|17561408 >1bor0 2 53 282 342 3e-04 ... ref|NP_757385.1| synoviolin 1 iso...form b [Homo sapiens] gb|AAH30530.1| Synoviolin 1, ... isoform b [Homo sapiens] ... Length = 61
ORF Alignment: NC_002745 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002745 gi|15925955 >1n8kA 34 374 26 339 4e-06 ... dbj|BAB56414.1| similar to xylitol... ... SA0242 [Staphylococcus aureus subsp. aureus N315] ... ref|NP_370776.1| similar to xylitol
ORF Alignment: NC_002758 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002758 gi|15923242 >1n8kA 34 374 26 339 4e-06 ... dbj|BAB56414.1| similar to xylitol... ... SA0242 [Staphylococcus aureus subsp. aureus N315] ... ref|NP_370776.1| similar to xylitol
ORF Alignment: NC_003284 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003284 gi|17551448 >1rw3A 32 443 156 555 3e-25 ... gb|AAF64414.1| Pol [equine foam...y virus] ref|NP_054716.1| Pol [equine foamy virus] ... Length = 400 ... Query: 980 ... KLRIVLD--ASSPPGPEPSL
ORF Alignment: NC_005126 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005126 gi|37527217 >1b12A 1 247 78 326 7e-74 ... ref|NP_930561.1| Signal peptidase I (SPase I) (Leader...| ... Signal peptidase I (SPase I) (Leader peptidase I) ... [Photorhabdus luminescens subsp. l
ORF Alignment: NC_006905 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006905 gi|62179485 >1iwlA 1 182 23 204 2e-69 ... ref|YP_215902.1| periplasmic protein effects...ica ... subsp. enterica serovar Choleraesuis str. SC-B67] ... gb|AAX64821.1| periplasmic protein effects
ORF Alignment: NC_004557 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004557 gi|28211518 >1v7zA 1 255 3 250 2e-62 ... ref|NP_782462.1| creatininase [Clo...stridium tetani E88] gb|AAO36399.1| creatininase ... [Clostridium tetani E88] ... Length = 248
ORF Sequence: NC_001136 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_001136 gi|6320230 >gi|6320230|ref|NP_010310.1| Component of the GARP (Golgi-associated retrograde... protein) complex, Vps51p-Vps52p-Vps53p-Vps54p, which is required for retrograde transport
ORF Alignment: NC_006300 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006300 gi|52425721 >1p3dA 1 463 15 477 e-153 ... ref|YP_088858.1| MurC protein [Ma...nnheimia succiniciproducens MBEL55E] gb|AAU38273.1| ... MurC protein [Mannheimia succiniciproducens M
ORF Alignment: NC_006300 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006300 gi|52425669 >4uagA 6 428 2 453 3e-46 ... ref|YP_088806.1| MurC protein [Man...nheimia succiniciproducens MBEL55E] gb|AAU38221.1| ... MurC protein [Mannheimia succiniciproducens MB
ORF Alignment: NC_002663 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002663 gi|15602008 >1p3dA 1 463 17 479 e-156 ... ref|NP_245080.1| MurC [Pasteurell...a multocida subsp. multocida str. Pm70] ... gb|AAK02227.1| MurC [Pasteurella multocida subsp. ...
ORF Alignment: NC_002678 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002678 gi|13473528 >1u07A 4 89 172 254 2e-09 ... ref|NP_105096.1| energy transduce...r TonB [Mesorhizobium loti MAFF303099] ... dbj|BAB50882.1| energy transducer; TonB [Mesorhizobium ...
ORF Alignment: NC_005296 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005296 gi|39935198 >1u07A 9 88 204 283 1e-12 ... emb|CAE27570.1| possible energy t...ransducer TonB, C-terminal region ... [Rhodopseudomonas palustris CGA009] ref|NP_947474.1| ... possible energy
ORF Alignment: NC_006905 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006905 gi|62180303 >1u07A 2 90 193 281 2e-32 ... ref|YP_216720.1| energy transduce...terica ... serovar Choleraesuis str. SC-B67] gb|AAX65639.1| energy ... transducer; uptake of i
ORF Alignment: NC_006511 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006511 gi|56413338 >1u07A 2 90 193 281 2e-32 ... ref|YP_216720.1| energy transduce...terica ... serovar Choleraesuis str. SC-B67] gb|AAX65639.1| energy ... transducer; uptake of i
ORF Alignment: NC_002939 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002939 gi|39996799 >1u07A 9 88 204 283 1e-12 ... emb|CAE27570.1| possible energy t...ransducer TonB, C-terminal region ... [Rhodopseudomonas palustris CGA009] ref|NP_947474.1| ... possible energy
ORF Alignment: NC_002940 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002940 gi|33151562 >1u07A 8 84 201 279 1e-08 ... gb|AAP95304.1| TobB energy transd...ucing protein [Haemophilus ducreyi 35000HP] ... ref|NP_872915.1| TobB energy transducing protein ...
ORF Alignment: NC_003197 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003197 gi|16765081 >1u07A 2 90 193 281 2e-32 ... ref|YP_216720.1| energy transduce...terica ... serovar Choleraesuis str. SC-B67] gb|AAX65639.1| energy ... transducer; uptake of i
ORF Alignment: NC_000117 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_000117 gi|15605545 >1u7nA 1 327 4 316 2e-67 ... ref|NP_220331.1| FA/Phospholipid Synthesis... Protein [Chlamydia trachomatis D/UW-3/CX] ... gb|AAC68407.1| FA/Phospholipid Synthesis Prote
ORF Alignment: NC_000907 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_000907 gi|16272918 >1etoB 1 97 1 98 9e-28 ... ref|ZP_00320663.1| COG2901: Factor for inversion... ... ref|ZP_00156839.1| COG2901: Factor for inversion ... stimulation Fis, transcriptional activator [Hae
ORF Alignment: NC_006512 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006512 gi|56461389 >1etoB 1 98 1 97 7e-25 ... ref|YP_156670.1| Factor for inversion... stimulation Fis, transcriptional activator ... [Idiomarina loihiensis L2TR] gb|AAV83121.1| Factor for ... inversion
ORF Alignment: NC_006511 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006511 gi|56414667 >1hcrA 1 48 25 72 5e-05 ... ref|YP_151742.1| inversion of adjac... ... 9150] gb|AAV78430.1| inversion of adjacent DNA; at ... locus of e14 element [Salmonella ent
ORF Alignment: NC_003281 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003281 gi|17554732 >1yovB 5 426 11 433 e-114 ... ref|NP_498534.1| UBiquitin Activating enzme related, ectop...ic membrane RuFfLes in ... embryo RFL-1, CYtoKinesis defect CYK-5 (rfl-1) ...
ORF Alignment: NC_000963 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_000963 gi|15604602 >1mwmA 4 314 14 327 1e-47 ... ref|NP_221120.1| ROD SHAPE-DETERMINING... PROTEIN MREB (mreB) [Rickettsia prowazekii ... str. Madrid E] emb|CAA15196.1| ROD SHAPE-DETERMINING
Electrochemical characteristics of nc-Si/SiC composite for anode electrode of lithium ion batteries
International Nuclear Information System (INIS)
Jeon, Bup Ju; Lee, Joong Kee
2014-01-01
Graphical abstract: Cycling performances and coulombic efficiencies of the nc-Si/SiC composite anodes at different CH 4 /SiH 4 mole ratios. -- Highlights: • Our work has focused on irreversible discharge capacity and capacity retention of nc-Si/SiC composite particles. • Particles comprised a mixed construction of nc-Si/SiC structure with dual phases. • The SiC phase acted as retarding media, leading to enhanced cycle stability. -- Abstract: nc-Si/SiC composite particles were prepared as an anode material for lithium ion batteries using a plasma jet with DC arc discharge. The composition of the nc-Si/SiC composite particles was controlled by setting the mole ratio of CH 4 and SiH 4 precursor gases. X-ray diffraction, TEM images, and Raman shift analyses revealed that the synthesized nc-Si/SiC composite particles comprised a construction of nano-nocaled structure with crystalline phases of active silicon, highly disordered amorphous carbon of graphite and crystalline phases of β-SiC. In the experimental range examined, the nc-Si/SiC composite particles showed good coulombic efficiency in comparison with particles high Si–Si bonding content due to the interplay of particles with a small proportion of carbon and the buffering effect against volume expansion by structural stabilization, and played a role as retarding media for the rapid electrochemical reactions of the SiC crystal against lithium
Electrochemical characteristics of nc-Si/SiC composite for anode electrode of lithium ion batteries
Energy Technology Data Exchange (ETDEWEB)
Jeon, Bup Ju [Department of Energy Resources, Shinhan University, 233-1, Sangpae-dong, Dongducheon, Gyeonggi-do, 483-777 (Korea, Republic of); Lee, Joong Kee, E-mail: leejk@kist.re.kr [Advanced Energy Materials Processing Laboratory, Center for Energy Convergence Research, Green City Technology Institute, Korea Institute of Science and Technology, Hwarangno 14-gil 5, Seongbuk-gu, Seoul 136-791 (Korea, Republic of)
2014-03-25
Graphical abstract: Cycling performances and coulombic efficiencies of the nc-Si/SiC composite anodes at different CH{sub 4}/SiH{sub 4} mole ratios. -- Highlights: • Our work has focused on irreversible discharge capacity and capacity retention of nc-Si/SiC composite particles. • Particles comprised a mixed construction of nc-Si/SiC structure with dual phases. • The SiC phase acted as retarding media, leading to enhanced cycle stability. -- Abstract: nc-Si/SiC composite particles were prepared as an anode material for lithium ion batteries using a plasma jet with DC arc discharge. The composition of the nc-Si/SiC composite particles was controlled by setting the mole ratio of CH{sub 4} and SiH{sub 4} precursor gases. X-ray diffraction, TEM images, and Raman shift analyses revealed that the synthesized nc-Si/SiC composite particles comprised a construction of nano-nocaled structure with crystalline phases of active silicon, highly disordered amorphous carbon of graphite and crystalline phases of β-SiC. In the experimental range examined, the nc-Si/SiC composite particles showed good coulombic efficiency in comparison with particles high Si–Si bonding content due to the interplay of particles with a small proportion of carbon and the buffering effect against volume expansion by structural stabilization, and played a role as retarding media for the rapid electrochemical reactions of the SiC crystal against lithium.
ORF Alignment: NC_006087 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006087 gi|50955643 >1u94A 24 325 68 337 3e-32 ... ref|YP_062931.1| alkylation dama...ge DNA repair protein [Leifsonia xyli subsp. xyli ... str. CTCB07] gb|AAT89826.1| alkylation damage D
ORF Alignment: NC_006142 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006142 gi|51473766 >1xvqA 17 163 40 196 7e-07 ... ref|YP_067523.1| Sco2-like prote...in [Rickettsia typhi str. Wilmington] gb|AAU04041.1| ... Sco2-like protein [Rickettsia typhi str. Wil
ORF Alignment: NC_003233 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003233 gi|19074284 >1ltlE 10 233 29 251 7e-31 ... emb|CAD25394.1| DNA REPLICATION ...LICENSING FACTOR OF THE MCM FAMILY MCM5 ... [Encephalitozoon cuniculi GB-M1] ref|NP_585790.1| DNA ... REPLICATION
ORF Alignment: NC_003236 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003236 gi|19074669 >1ewiA 5 113 54 161 1e-18 ... emb|CAD25779.1| DNA REPLICATION F...ACTOR A PROTEIN 1 [Encephalitozoon cuniculi GB-M1] ... ref|NP_586175.1| DNA REPLICATION FACTOR A PROT
ORF Alignment: NC_003238 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003238 gi|19173256 >1ltlE 44 240 100 302 2e-23 ... emb|CAD27107.1| DNA REPLICATION... LICENSING FACTOR OF THE MCM FAMILY MCM7 ... [Encephalitozoon cuniculi GB-M1] ref|NP_597059.1| DNA ... REPLICATION
ORF Alignment: NC_003229 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003229 gi|19074034 >1ltlE 2 242 49 290 7e-40 ... emb|CAD25144.1| DNA REPLICATION L...ICENSING FACTOR OF THE MCM FAMILY (MCM4) ... [Encephalitozoon cuniculi GB-M1] ref|NP_584640.1| DNA ... REPLICATION
ORF Alignment: NC_003236 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003236 gi|19074669 >1l1oC 2 175 456 623 1e-43 ... emb|CAD25779.1| DNA REPLICATION ...FACTOR A PROTEIN 1 [Encephalitozoon cuniculi GB-M1] ... ref|NP_586175.1| DNA REPLICATION FACTOR A PRO
ORF Alignment: NC_000917 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_000917 gi|11498546 >1yozA 1 116 1 116 6e-47 ... pdb|1YOZ|B Chain B, Predicted Coding... Region Af0941 From Archaeoglobus Fulgidus ... pdb|1YOZ|A Chain A, Predicted Coding Region Af0941 F
ORF Alignment: NC_000909 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_000909 gi|15669589 >1vhtA 3 200 2 186 2e-14 ... ref|NP_248402.1| alignment in /usr/local/projects...408.1| ... alignment in ... /usr/local/projects/ARG/Intergenic/ARG_R584_orf2.nr ... [Me
ORF Alignment: NC_003070 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003070 gi|18397761 >1wocC 2 96 2 97 5e-15 ... ref|YP_063428.1| ssb1 [Campylobacter... ... gb|EAL55921.1| single-strand binding protein, putative ... [Campylobacter coli RM2228] gb|AAR29517.1| ssb1
ORF Alignment: NC_002695 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002695 gi|15830716 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu
ORF Alignment: NC_002655 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002655 gi|15801201 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu
ORF Alignment: NC_003197 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003197 gi|16764541 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu
ORF Alignment: NC_006511 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006511 gi|56413828 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu
ORF Alignment: NC_003198 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003198 gi|16760062 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu
ORF Alignment: NC_004631 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004631 gi|29142167 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu
ORF Alignment: NC_000913 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_000913 gi|16129047 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu
ORF Alignment: NC_004741 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004741 gi|30062618 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu
ORF Alignment: NC_006905 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006905 gi|62179702 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu
ORF Alignment: NC_004337 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004337 gi|56479819 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu
ORF Alignment: NC_004431 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004431 gi|26247224 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu
ORF Alignment: NC_003318 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003318 gi|17988654 >1v7zA 9 254 21 263 2e-44 ... ref|NP_541287.1| creatininase [Br...ucella melitensis 16M] gb|AAL53551.1| creatininase ... [Brucella melitensis 16M] pir||AD3548 creatini
ORF Alignment: NC_005363 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005363 gi|42522087 >3ncmA 2 92 125 205 3e-07 ... gb|AAQ14642.1| HK97 major tail subunit [Bacteriophage Feli...x 01] ref|NP_944848.1| ... HK97 major tail subunit [Bacteriophage Felix 01
ORF Alignment: NC_004310 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004310 gi|23502301 >1p3dA 28 461 27 463 e-121 ... ref|YP_222116.1| MurC, UDP-N-ace...tylmuramate--alanine ligase [Brucella abortus biovar ... 1 str. 9-941] gb|AAX74755.1| MurC, ...
ORF Alignment: NC_002942 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002942 gi|52842820 >1p3dA 3 461 10 467 e-125 ... ref|YP_096619.1| UDP-N-acetylmuramate:L-alanine ligase Mur...28672.1| ... UDP-N-acetylmuramate:L-alanine ligase MurC [Legionella ... pneumophila subsp. pne
ORF Alignment: NC_003317 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003317 gi|17986863 >1p3dA 28 461 27 463 e-121 ... ref|YP_222116.1| MurC, UDP-N-ace...tylmuramate--alanine ligase [Brucella abortus biovar ... 1 str. 9-941] gb|AAX74755.1| MurC, ...
ORF Alignment: NC_006513 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006513 gi|56476897 >1r0wC 2 267 324 600 2e-59 ... ref|YP_158486.1| putative composite... ATP-binding transmembrane ABC transporter ... protein [Azoarcus sp. EbN1] emb|CAI07585.1| putative ... composite
ORF Alignment: NC_002678 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002678 gi|13475854 >1el5A 4 378 18 430 4e-33 ... ref|NP_107424.1| agaE protein, conversion of agropini...c acid to mannopinic acid ... [Mesorhizobium loti MAFF303099] dbj|BAB53210.1| Aga
ORF Alignment: NC_002678 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002678 gi|13475930 >1el5A 6 379 7 420 7e-42 ... ref|NP_107500.1| AgaE protein, conversion of agropini...c acid to mannopinic acid ... [Mesorhizobium loti MAFF303099] dbj|BAB53286.1| AgaE
ORF Alignment: NC_002679 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002679 gi|13488188 >1el5A 4 377 26 437 3e-36 ... ref|NP_085608.1| agaE(conversion of agropini...c acid to mannopinic acid) ... [Mesorhizobium loti MAFF303099] dbj|BAB54449.1| AgaE ...
ORF Alignment: NC_005810 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005810 gi|45441793 >1u07A 1 89 164 251 4e-26 ... ref|NP_669352.1| energy transduce...] ... ref|NP_993332.1| TonB protein [Yersinia pestis biovar ... Medievalis str. 91001] gb|AAM85603.1| energy
ORF Alignment: NC_004088 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004088 gi|22125929 >1u07A 1 89 164 251 4e-26 ... ref|NP_669352.1| energy transduce...] ... ref|NP_993332.1| TonB protein [Yersinia pestis biovar ... Medievalis str. 91001] gb|AAM85603.1| energy
ORF Alignment: NC_006576 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006576 gi|56751418 >1kgsA 3 222 4 231 2e-39 ... ref|YP_172119.1| two-component response regulator for energ... ... PCC 6301] dbj|BAD79599.1| two-component response ... regulator for energy transfer from ph
ORF Alignment: NC_003143 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003143 gi|16122423 >1u07A 1 89 164 251 4e-26 ... ref|NP_669352.1| energy transduce...] ... ref|NP_993332.1| TonB protein [Yersinia pestis biovar ... Medievalis str. 91001] gb|AAM85603.1| energy
ORF Alignment: NC_006155 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006155 gi|51596443 >1u07A 1 89 164 251 4e-26 ... ref|NP_669352.1| energy transduce...] ... ref|NP_993332.1| TonB protein [Yersinia pestis biovar ... Medievalis str. 91001] gb|AAM85603.1| energy
Directory of Open Access Journals (Sweden)
Cornelius JB
2016-04-01
Full Text Available Judith B Cornelius,1 Josephine A Appiah2 1School of Nursing, 2Health Services Research Doctoral Program, College of Health and Human Services, University of North Carolina at Charlotte, Charlotte, NC, USA Abstract: Youth and young adults (19–24 years of age shoulder the burden of sexually transmitted infections accounting for nearly half of all new infections annually. Mobile technology is one way that we have reached this population with safer sex information but challenges exist with the delivery process. The literature between 2010 and 2015 was reviewed for data on safe sex and sexual health information delivered using mobile cell phone devices. A search for relevant databases revealed that 17 articles met our inclusion criteria. Findings suggest that mobile cell phone interventions are an effective mode for delivering safe sex and sexual health information to youth; those at the highest risk may not be able to access cell phones based on availability and cost of the text messages or data plans. Keywords: mobile, safe sex, sexual health, practices, recommendations
External electric field effects on Schottky barrier at Gd3N@C80/Au interface
Onishi, Koichi; Nakashima, Fumihiro; Jin, Ge; Eto, Daichi; Hattori, Hayami; Miyoshi, Noriko; Kirimoto, Kenta; Sun, Yong
2017-08-01
The effects of the external electric field on the height of the Schottky barrier at the Gd3N@C80/Au interface were studied by measuring current-voltage characteristics at various temperatures from 200 K to 450 K. The Gd3N@C80 sample with the conduction/forbidden/valence energy band structure had a face-centered cubic crystal structure with the average grain size of several nanometers. The height of the Gd3N@C80/Au Schottky barrier was confirmed to be 400 meV at a low electric field at room temperature. Moreover, the height decreases with the increasing external electric field through a change of permittivity in the Gd3N@C80 sample due to a polarization of the [Gd3] 9 +-[N3 -+("separators="|C80 ) 6 -] dipoles in the Gd3N@C80 molecule. The field-dependence of the barrier height can be described using a power math function of the electric field strength. The results of the field-dependent barrier height indicate that the reduction in the Schottky barrier is due to an image force effect of the transport charge carrier at the Gd3N@C80/Au interface.
Ultraconserved regions encoding ncRNAs are altered in human leukemias and carcinomas.
Calin, George A; Liu, Chang-gong; Ferracin, Manuela; Hyslop, Terry; Spizzo, Riccardo; Sevignani, Cinzia; Fabbri, Muller; Cimmino, Amelia; Lee, Eun Joo; Wojcik, Sylwia E; Shimizu, Masayoshi; Tili, Esmerina; Rossi, Simona; Taccioli, Cristian; Pichiorri, Flavia; Liu, Xiuping; Zupo, Simona; Herlea, Vlad; Gramantieri, Laura; Lanza, Giovanni; Alder, Hansjuerg; Rassenti, Laura; Volinia, Stefano; Schmittgen, Thomas D; Kipps, Thomas J; Negrini, Massimo; Croce, Carlo M
2007-09-01
Noncoding RNA (ncRNA) transcripts are thought to be involved in human tumorigenesis. We report that a large fraction of genomic ultraconserved regions (UCRs) encode a particular set of ncRNAs whose expression is altered in human cancers. Genome-wide profiling revealed that UCRs have distinct signatures in human leukemias and carcinomas. UCRs are frequently located at fragile sites and genomic regions involved in cancers. We identified certain UCRs whose expression may be regulated by microRNAs abnormally expressed in human chronic lymphocytic leukemia, and we proved that the inhibition of an overexpressed UCR induces apoptosis in colon cancer cells. Our findings argue that ncRNAs and interaction between noncoding genes are involved in tumorigenesis to a greater extent than previously thought.
ORF Alignment: NC_003238 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003238 gi|19173253 >1a5t0 17 316 29 298 4e-25 ... emb|CAD27104.1| REPLICATION FACT...OR C (ACTIVATOR 1) 37kDa SUBUNIT [Encephalitozoon ... cuniculi GB-M1] ref|NP_597056.1| REPLICATION FA
ORF Alignment: NC_003238 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003238 gi|19173256 >1g8pA 7 311 329 597 1e-04 ... emb|CAD27107.1| DNA REPLICATION ...LICENSING FACTOR OF THE MCM FAMILY MCM7 ... [Encephalitozoon cuniculi GB-M1] ref|NP_597059.1| DNA ... REPLICATION
ORF Alignment: NC_005787 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005787 gi|45198873 >1g8pA 7 311 329 597 1e-04 ... emb|CAD27107.1| DNA REPLICATION ...LICENSING FACTOR OF THE MCM FAMILY MCM7 ... [Encephalitozoon cuniculi GB-M1] ref|NP_597059.1| DNA ... REPLICATION
ORF Alignment: NC_003229 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003229 gi|19073988 >1a5t0 2 324 6 283 2e-17 ... emb|CAD25098.1| DNA REPLICATION FA...CTOR (ACTIVATOR 1) 36 kDa SUBUNIT ... [Encephalitozoon cuniculi GB-M1] ref|NP_584594.1| DNA ... REPLICATION
Large-Nc quantum chromodynamics and harmonic sums
Indian Academy of Sciences (India)
2012-06-08
Jun 8, 2012 ... This has led us to consider a class of analytic number theory .... The self-energy function LR(Q2) in the chiral limit vanishes order by order in QCD ... the 1/Nc expansion, the Goldstone loop corrections are subleading and, ...
ORF Alignment: NC_006905 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006905 gi|62179784 >1j9iA 1 68 1 68 5e-21 ... ref|YP_216201.1| Gifsy-1 prophage DNA packaging... ... gb|AAX65120.1| Gifsy-1 prophage DNA packaging protein ... [Phage Gifsy-1] ... Length = 68 ... Q
ORF Alignment: NC_006351 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006351 gi|53722258 >1kolA 2 388 1 341 4e-33 ... ref|YP_111243.1| putative zinc-binding xylitol... ... zinc-binding xylitol/sorbitol dehydrogenase ... [Burkholderia pseudomallei K96243] ... .../sorbitol dehydrogenase [Burkholderia ... pseudomallei K96243] emb|CAH38702.1| putative ...
ORF Alignment: NC_005791 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005791 gi|45359158 >1q7hA 13 141 446 567 8e-09 ... ref|NP_248016.1| alignment in /usr/local/projects...B99026.1| ... alignment in ... /usr/local/projects/ARG/Intergenic/ARG_R428_orf1.nr ...
ORF Alignment: NC_000909 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_000909 gi|15669211 >1q7hA 13 141 446 567 8e-09 ... ref|NP_248016.1| alignment in /usr/local/projects...B99026.1| ... alignment in ... /usr/local/projects/ARG/Intergenic/ARG_R428_orf1.nr ...
ORF Alignment: NC_003282 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003282 gi|17540144 >1n0rA 2 124 89 212 5e-26 ... gb|AAA96093.1| Feminization of xx and xo animals... ... homolog a, FEMinization of XX and XO animals FEM-1 ... (fem-1) [Caenorhabditis elegans] pir||
ORF Alignment: NC_004337 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004337 gi|56480239 >1us0A 2 305 26 295 5e-61 ... pdb|1MZR|B Chain B, Structure Of Dkga From E.Coli...re ... Of Dkga From E.Coli At 2.13 A Resolution Solved By ... Molecular Replacement ...
ORF Alignment: NC_000913 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_000913 gi|49176300 >1us0A 2 305 26 295 5e-61 ... pdb|1MZR|B Chain B, Structure Of Dkga From E.Coli...re ... Of Dkga From E.Coli At 2.13 A Resolution Solved By ... Molecular Replacement ...
ORF Alignment: NC_004463 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004463 gi|27377726 >1k4iA 2 216 3 205 5e-67 ... ref|NP_769255.1| 3,4-dihydroxy-2-butanone-4-phosha...0.1| ... 3,4-dihydroxy-2-butanone-4-phoshate synthase/GTP ... cyclohydrolase II [Bradyrhizobiu
ORF Alignment: NC_006322 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006322 gi|52786856 >4uagA 8 419 4 423 5e-47 ... ref|YP_092685.1| MurC [Bacillus li...cheniformis ATCC 14580] gb|AAU41992.1| MurC ... [Bacillus licheniformis DSM 13] sp|Q65G22|MURC_BACLD
ORF Sequence: NC_001135 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available h Lrs4p, located in the nucleolus; Lrs4p-Csm1p heterodimer binds to Mam1p at kinetochores during meiosis I t... NC_001135 gi|6319928 >gi|6319928|ref|NP_010009.1| Protein that forms a complex wit
33 CFR 117.822 - Beaufort Channel, NC.
2010-07-01
... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements North Carolina § 117.822 Beaufort Channel, NC. The... bridge need not open between the hours of 6:30 a.m. to 8 a.m. and 4:30 p.m. to 6 p.m. (b) From 10 p.m. to...
ORF Alignment: NC_003047 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003047 gi|15964777 >1v4aA 24 435 49 467 e-101 ... emb|CAC45596.1| PUTATIVE GLUTAMATE-AMMONIA...-LIGASE ADENYLYLTRANSFERASE PROTEIN ... [Sinorhizobium meliloti] ref|NP_385130.1| PUTATIVE ... GLUTAMATE-AMMO...NIA-LIGASE ADENYLYLTRANSFERASE PROTEIN ... [Sinorhizobium meliloti 1021] sp|
Author Guidelines: The Arab Journal of Forensic Sciences and Forensic Medicine (AJFSFM)
Arab Journal of Forensic Sciences & Forensic Medicine
2017-01-01
The Arab Journal of Forensic Sciences and Forensic Medicine (AJFSFM) is a peer-reviewed, open access (CC BY-NC), international journal for publishing original contributions in various fields of forensic science. These fields include, but are not limited to forensic pathology and histochemistry, toxicology(drugs, alcohol, etc.), forensic biology (serology, human DNA profiling, entomology, population genetics), forensic chemistry(inks, paints, dyes, explosives, fire accelerants), psychiatry and...
Large Nc from Seiberg–Witten curve and localization
Directory of Open Access Journals (Sweden)
Jorge G. Russo
2015-09-01
Full Text Available When N=2 gauge theories are compactified on S4, the large Nc limit then selects a unique vacuum of the theory determined by saddle-point equations, which remains determined even in the flat-theory limit. We show that exactly the same equations can be reproduced purely from Seiberg–Witten theory, describing a vacuum where magnetically charged particles become massless, and corresponding to a specific degenerating limit of the Seiberg–Witten spectral curve where 2Nc−2 branch points join pairwise giving aDn=0, n=1,…,Nc−1. We consider the specific case of N=2 SU(Nc SQCD coupled with 2Nf massive fundamental flavors. We show that the theory exhibits a quantum phase transition where the critical point describes a particular Argyres–Douglas point of the Riemann surface.
ORF Alignment: NC_002696 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002696 gi|16126641 >1uzbA 58 515 12 462 8e-77 ... ref|NP_421205.1| vanillin dehydr...ogenase [Caulobacter crescentus CB15] gb|AAK24373.1| ... vanillin dehydrogenase [Caulobacter crescent...us CB15] ... pir||A87547 vanillin dehydrogenase [imported] - ... Caulobacter crescentus ...
ORF Alignment: NC_003305 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003305 gi|17938192 >1v7zA 16 254 17 254 3e-36 ... ref|NP_534981.1| creatinine amid...ohydrolase [Agrobacterium tumefaciens str. C58] ... gb|AAL45297.1| creatinine amidohydrolase [Agrobac... C58] pir||AC3110 ... creatinine amidohydrolase [imported] - Agrobacterium
ORF Alignment: NC_003063 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003063 gi|15890482 >1v7zA 16 254 17 254 3e-36 ... ref|NP_534981.1| creatinine amid...ohydrolase [Agrobacterium tumefaciens str. C58] ... gb|AAL45297.1| creatinine amidohydrolase [Agrobac... C58] pir||AC3110 ... creatinine amidohydrolase [imported] - Agrobacterium
ORF Alignment: NC_005364 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... emb|CAE77440.1| phosphoglycerate mutase ... (2,3-diphosphoglycerate-independent) [Mycoplasma ... NC_005364 gi|42561347 >1o98A 2 508 4 528 e-163 ... ref|NP_975798.1| phosphoglycerate mutase (2,3-diphosphoglyc...erate-independent) ... [Mycoplasma mycoides subsp. mycoides SC str. PG1] ...
ORF Alignment: NC_005090 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005090 gi|34557359 >1mwmA 3 314 11 322 5e-28 ... ref|NP_907174.1| PUTATIVE ROD SHAPE-DETERMINING... PROTEIN (FRAGMENT) [Wolinella ... succinogenes DSM 1740] emb|CAE10074.1| PUTATIVE ROD ... SHAPE-DETERMIN...ING PROTEIN (FRAGMENT) [Wolinella ... succinogenes] ... Length = 312 ...
Evaluation of uranium geochemical anomalies in the Charlotte 10 x 20 NTMS quadrangle
International Nuclear Information System (INIS)
Carpenter, R.H.
1981-11-01
This report contains a synthesis of published geological, geophysical, and geochemical information for portions of Cabarrus and Rowan Counties, NC, where uranium geochemical anomalies have been described by Heffner and Ferguson (1978). The results of a ground radiation survey in selected areas are also described. Based on an evaluation of published information and the data obtained in the field study, conclusions are made regarding the possible occurrence of uranium concentration. Recommendations for detailed surveys in certain areas are also presented
BChPT x 1/Nc: masses and currents
Energy Technology Data Exchange (ETDEWEB)
Goity, Jose L. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Hampton Univ., Hampton, VA (United States); Fernando, Ishara P. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Hampton Univ., Hampton, VA (United States)
2018-04-01
A summary of the implementation of the combined BChPT X 1/Nc expansion for three flavors is presented, along with its applications to the octet and decuplet baryon masses, SU(3) charges and axial couplings.
ORF Alignment: NC_002927 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002927 gi|33603734 >1kmoA 3 661 60 754 2e-50 ... ref|NP_891294.1| exogenous ferric... siderophore receptor [Bordetella bronchiseptica ... RB50] gb|AAB51774.1| exogenous ferric siderophor...e ... receptor emb|CAE35124.1| exogenous ferric siderophore ... receptor [Bordetella bronchise
ORF Alignment: NC_000117 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_000117 gi|15605324 >1jgmA 39 326 7 260 4e-33 ... ref|NP_220110.1| PHP superfamily hydrolase [Chlamydia trachomatis D/UW-3/CX] ... gb|AAC68196.1| PHP... ... trachomatis D/UW-3/CX] pir||G71494 probable php ... hydrolase - Chlamydia trachomatis (sero
ORF Alignment: NC_002929 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002929 gi|33592330 >1uynX 1 299 352 647 5e-40 ... ref|NP_879974.1| tracheal colonization... factor precursor [Bordetella pertussis Tohama ... I] emb|CAA08832.2| tracheal colonization fac...tor ... [Bordetella pertussis] emb|CAE41497.1| tracheal ... colonization factor precursor [Bor
ORF Alignment: NC_006370 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available pothetical stbA Plasmid stable inheritance protein ... [Photobacterium profundum] ... Length = ... NC_006370 gi|54307287 >1mwmA 2 317 24 344 3e-96 ... ref|YP_128307.1| Hypothetical stbA Plasmid stable inherita...nce protein ... [Photobacterium profundum SS9] emb|CAG18505.1| ... Hy
ORF Alignment: NC_004337 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004337 gi|24115225 >1e94E 1 443 7 449 e-162 ... pdb|1E94|F Chain F, Hslv-Hslu From E.Coli... pdb|1E94|E Chain E, Hslv-Hslu From ... E.Coli pdb|1HQY|F Chain F, Nucleotide-Dependent ...
ORF Alignment: NC_000913 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available outer ... membrane receptor for iron transport; outer membrane ... porin protein, putative ferris...porin protein, putative ferrisiderophore receptor ... [Escherichia coli K12] gb|AAC73892.1| putative ... NC_000913 gi|16128773 >1kmoA 12 661 63 760 6e-50 ... ref|NP_415326.1| outer membrane
ORF Alignment: NC_003888 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003888 gi|21218662 >1cxqA 5 133 141 282 2e-06 ... ref|NP_624441.1| putative noncomposite... transposon transposase [Streptomyces ... coelicolor A3(2)] emb|CAB52910.1| putative noncomposite... ... transposon transposase [Streptomyces coelicolor A3(2)] ... pir||T36996 probable noncomposite
ORF Alignment: NC_003911 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003911 gi|56698296 >1eljA 1 332 19 332 1e-06 ... gb|AAV96699.1| polyamine ABC trasnporte...snporter, periplasmic polyamine-binding protein ... [Silicibacter pomeroyi D...r, periplasmic polyamine-binding protein ... [Silicibacter pomeroyi DSS-3] ref|YP_168669.1| polyamine ... ABC tra
ORF Alignment: NC_002528 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002528 gi|15617004 >1etoB 1 98 1 98 1e-23 ... ref|NP_240217.1| factor-for-inversion... ... DNA-binding protein fis dbj|BAB13103.1| ... factor-for-inversion stimulation protein [Buchnera ... ... aphidicola str. APS (Acyrthosiphon pisum)] pir||G84976 ... factor-for-inversion
ORF Alignment: NC_003318 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003318 gi|17988713 >1gkpA 3 425 8 405 2e-19 ... ref|NP_541346.1| IMIDAZOLONEPROPIONASE / HISTIDINE AMMONIA...-LYASE [Brucella ... melitensis 16M] gb|AAL53610.1| IMIDAZOLONEPROPIONASE / ... HISTIDINE AMMON...IA-LYASE [Brucella melitensis 16M] ... pir||AG3555 histidine ammonia-lyase (
ORF Alignment: NC_004311 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004311 gi|23500656 >1gkpA 3 425 8 405 2e-19 ... ref|NP_541346.1| IMIDAZOLONEPROPIONASE / HISTIDINE AMMONIA...-LYASE [Brucella ... melitensis 16M] gb|AAL53610.1| IMIDAZOLONEPROPIONASE / ... HISTIDINE AMMON...IA-LYASE [Brucella melitensis 16M] ... pir||AG3555 histidine ammonia-lyase (