
Sample records for science board ssb

  1. Fermilab Friends for Science Education | Board Tools (United States)

    Fermilab Friends for Science Education FFSE Home About Us Join Us Support Us Contact Us Board Tools Testimonials Our Donors Board of Directors Board Tools Calendar Join Us Donate Now Get FermiGear! Education FFSE Scholarship Tools Google Drive Join Us/Renew Membership Forms: Online - Print Support Us Donation

  2. 76 FR 67715 - Science Advisory Board (United States)


    ... Administration (NOAA) science programs are of the highest quality and provide optimal support to resource... Advisory Board in Reviewing NOAA's Research and Development Portfolio-Presentation and Discussion; (6) NOAA...

  3. 77 FR 1956 - National Science Board; Notice of Opportunity for Public Comment on the National Science Board... (United States)


    ... NATIONAL SCIENCE FOUNDATION National Science Board; Notice of Opportunity for Public Comment on the National Science Board Data Policies Report AGENCY: National Science Board (NSB), NSF. ACTION: Request for public comments. SUMMARY: The National Science Board seeks comments from the public on the...

  4. Board on chemical sciences and technology

    International Nuclear Information System (INIS)


    The Board on Chemical Sciences and Technology organizes and provides direction for standing and ad-hoc committees charged with addressing specific issues relevant to the continued health of the chemical sciences and technology community. Studies currently under the oversight of the BCST include a major survey of the chemical sciences, a complementary survey of chemical engineering, an examination of the problems of biohazards in the laboratory, and an analysis of the roots and magnitude of the problem of obsolescent facilities for research and teaching in departments in the chemical sciences and engineering. The Board continues to respond to specific agency requests for program assessments and advice. BCST members are designated to serve as liaison with major federal agencies or departments that support research in order to help identify ways for the Board to assist these organizations. The BCST maintains close contact with professional societies and non-governmental organizations that share the Board's concern for the health of chemical sciences and technology. Individual Board members are assigned responsibility for liaison with the American Chemical Society, the American Institute of Chemical Engineers, the American Society of Biological Chemists, the Council for Chemical Research, the NAS Chemistry and Biochemistry Sections, and the National Academy of Engineering. In the past few years, the Board has served as a focus and a forum for a variety of issues that relate specifically to the health of chemistry

  5. Board on chemical sciences and technology

    International Nuclear Information System (INIS)


    The Board on Chemical Sciences and Technology organizes and provides direction for standing and ad hoc committees charged with addressing specific issues relevant to the continued health of the chemical sciences and technology community. Studies currently under the oversight of the BCST include a major survey of chemical engineering, an examination of the problems of biohazards in the laboratory, and an analysis of the roots and magnitude of the problem of obsolescent facilities for research and teaching in departments in the chemical sciences and engineering. The Board continues to respond to specific agency requests for program assessments and advice. BCST members are designated to serve as liaison with major federal agencies or departments that support research in order to help identify ways for the board to assist the these organizations. The BCST also maintains close contact with professional societies and nongovernmental organizations that share the Board's concern for the health of chemical sciences and technology. Individual Board members are assigned responsibility for liaison with the American Chemical Society, the American Institute of Chemical Engineers, the American Society of Biological Chemists, the Council for Chemical Research, the Chemistry and Biochemistry Sections of the National Academy of Sciences (NAS), and the National Academy of Engineering (NAE). In the past few years, the Board has served as a focus and a forum for a variety of issues that relate specifically to the health of chemistry. A sampling of these concerns include: industry-university cooperation; basic research funding in DOD, DOE, NIH, and NSF; basic research in the chemistry of life processes; basic research in biochemical engineering; basic research in the science and technology of new materials; and undergraduate education in chemistry and chemical engineering

  6. 76 FR 2672 - Science Advisory Board Meeting (United States)


    ... statements. In general, each individual or group making a verbal presentation will be limited to a total time... scheduled for: Monday, January 31 from 10-11 a.m. Eastern Time. ADDRESSES: Conference call. Public access [email protected] ) SUPPLEMENTARY INFORMATION: The Science Advisory Board (SAB) was established by a Decision...

  7. Science & Engineering Indicators 2016. National Science Board (United States)

    National Science Foundation, 2016


    "Science and Engineering Indicators" (SEI) is first and foremost a volume of record comprising high-quality quantitative data on the U.S. and international science and engineering enterprise. SEI includes an overview and seven chapters that follow a generally consistent pattern. The chapter titles are as follows: (1) Elementary and…

  8. 77 FR 49462 - National Science Board; Sunshine Act Meetings (United States)


    ... NATIONAL SCIENCE FOUNDATION National Science Board; Sunshine Act Meetings The National Science Board, pursuant to NSF regulations (45 CFR Part 614), the National Science Foundation Act, as amended... regard to the scheduling of a teleconference meeting of the Audit and Oversight Committee for the...

  9. 76 FR 51064 - National Science Board; Sunshine Act Meetings; Notice (United States)


    ... NATIONAL SCIENCE FOUNDATION National Science Board; Sunshine Act Meetings; Notice The National Science Board (NSB) Committee on Audit and Oversight and the NSB Committee on Strategy and Budget, pursuant to NSF regulations (45 CFR part 614), the National Science Foundation Act, as amended (42 U.S.C...

  10. 75 FR 48996 - National Science Board; Sunshine Act Meetings; Notice (United States)


    ... NATIONAL SCIENCE FOUNDATION National Science Board; Sunshine Act Meetings; Notice The National Science Board's Committee on Audit & Oversight, pursuant to NSF regulations (45 CFR part 614), the National Science Foundation Act, as amended (42 U.S.C. 1862n-5), and the Government in the Sunshine Act (5...

  11. 76 FR 3180 - National Science Board; Sunshine Act Meetings; Notice (United States)


    ... NATIONAL SCIENCE FOUNDATION National Science Board; Sunshine Act Meetings; Notice The National Science Board's Committee on Programs and Plans and the Committee on Audit & Oversight, pursuant to NSF regulations (45 CFR part 614), the National Science Foundation Act, as amended (42 U.S.C. 1862n-5), and the...

  12. New Service Status Board

    CERN Multimedia


    On Monday 14 October, the Service Status Board for GS and IT will change. The new Status Board will be integrated with the CERN Service Portal and with the CERN Service Catalogue.   As of today, the SSB will display “Service Incidents”, “Planned Interventions” and “Service Changes”. References valid from 14 October: CERN SSB at Computing SSB (previously IT SSB) at   Nicole Cremel, IT and GS Service Management Support

  13. 75 FR 13265 - National Board for Education Sciences (United States)


    ... DEPARTMENT OF EDUCATION National Board for Education Sciences AGENCY: Institute of Education Sciences, Department of Education. ACTION: Notice of an open meeting. SUMMARY: This notice sets forth the schedule and proposed agenda of an upcoming meeting of the National Board for Education Sciences. The...

  14. 75 FR 53280 - National Board for Education Sciences (United States)


    ... DEPARTMENT OF EDUCATION National Board for Education Sciences AGENCY: Department of Education, Institute of Education Sciences. ACTION: Notice of an open meeting. SUMMARY: This notice sets forth the schedule and proposed agenda of an upcoming meeting of the National Board for Education Sciences. The...

  15. 75 FR 61779 - National Science Board: Sunshine Act Meetings; Notice (United States)


    ... Science Board's Committee on Programs and Plans, pursuant to NSF regulations (45 CFR Part 614), the... National Science Board business and other matters specified, as follows: DATE AND TIME: October 13, 2010, 1... Performance Computing Award. STATUS: Closed. LOCATION: This meeting will be held at National Science...

  16. 78 FR 33074 - Army Science Board Summer Study Session (United States)


    ...--This study evaluates what science and technology competencies the Army must maintain and/or develop as... DEPARTMENT OF DEFENSE Department of the Army Army Science Board Summer Study Session AGENCY... the Army announces the following committee meeting: 1. Name of Committee: Army Science Board (ASB). 2...

  17. Flight Hardware Virtualization for On-Board Science Data Processing (United States)

    National Aeronautics and Space Administration — Utilize Hardware Virtualization technology to benefit on-board science data processing by investigating new real time embedded Hardware Virtualization solutions and...

  18. 76 FR 44333 - National Biodefense Science Board; Call for Nominees (United States)


    ... to support the functions of the Board, (b) four individuals from the pharmaceutical, biotechnology..., and opportunities presented by advances in biological and life sciences, biotechnology, and genetic...

  19. 77 FR 49463 - National Science Board; Sunshine Act Meetings (United States)


    ... transaction of National Science Board business. AGENCY HOLDING MEETING: National Science Board. DATE AND TIME: Tuesday, August 21, 2012 from 5:00-6:00 p.m. SUBJECT MATTER: Chairman's remarks, consideration and... Meszaros, [email protected] , (703) 292-7000. Ann Bushmiller, NSB Senior Legal Counsel. [FR Doc. 2012-20197...

  20. 76 FR 6784 - Science Advisory Board Staff Office; Notification of Two Public Teleconferences of the Science... (United States)


    ... Two Public Teleconferences of the Science Advisory Board Dioxin Review Panel AGENCY: Environmental Protection Agency (EPA). ACTION: Notice. SUMMARY: The EPA Science Advisory Board (SAB) Staff Office announces... concerning the EPA Science Advisory Board can be found on the EPA Web site at

  1. 75 FR 33616 - Science Advisory Board Staff Office; Notification of Closed Meetings of the Science Advisory... (United States)


    ... Closed Meetings of the Science Advisory Board's Scientific and Technological Achievement Awards Committee... Agency's (EPA), Science Advisory Board (SAB) Staff Office announces a meeting and teleconference of . The SAB Mailing address is: U.S. EPA Science Advisory Board (1400F), U.S. Environmental...

  2. 75 FR 54628 - Science Advisory Board Staff Office; Notification of a Public Teleconference of the Science... (United States)


    ... a Public Teleconference of the Science Advisory Board; Polycyclic Aromatic Hydrocarbon (PAH... Science Advisory Board (SAB) Staff Office announces a public teleconference of the SAB Polycyclic Aromatic... EPA Science Advisory Board can be found on the EPA Web site at . SUPPLEMENTARY...

  3. 76 FR 22394 - Science Advisory Board Staff Office; Notification of a Public Teleconferences of the Science... (United States)


    ... ENVIRONMENTAL PROTECTION AGENCY [FRL-9298-6] Science Advisory Board Staff Office; Notification of a Public Teleconferences of the Science Advisory Board Panel for Review of Hydraulic Fracturing... EPA Science Advisory Board can be found at the EPA SAB Web site at . Any...

  4. 76 FR 4660 - Science Advisory Board Staff Office; Notification of a Public Teleconference of the Science... (United States)


    ... a Public Teleconference of the Science Advisory Board Lead Review Panel AGENCY: Environmental Protection Agency (EPA). ACTION: Notice. SUMMARY: The EPA Science Advisory Board (SAB) Staff Office announces... information concerning the EPA Science Advisory Board can be found on the EPA Web site at

  5. 76 FR 50728 - Science Advisory Board Staff Office; Notification of Public Teleconferences of the Science... (United States)


    ... Public Teleconferences of the Science Advisory Board Radiation Advisory Committee AGENCY: Environmental Protection Agency (EPA). ACTION: Notice. SUMMARY: The EPA Science Advisory Board (SAB) Staff Office announces... the EPA Science Advisory Board can be found at the EPA SAB Web site at http//

  6. 76 FR 44912 - Science Advisory Board Staff Office; Notification of Closed Meetings of the Science Advisory... (United States)


    ... Closed Meetings of the Science Advisory Board's Scientific and Technological Achievement Awards Committee... Agency's (EPA), Science Advisory Board (SAB) Staff Office announces a meeting and teleconference of the[email protected] . The SAB Mailing address is: U.S. EPA Science Advisory Board (1400R), U.S. Environmental...

  7. Fermilab Friends for Science Education | Board of Directors (United States)

    Fermilab Friends for Science Education FFSE Home About Us Join Us Support Us Contact Us Board of Directors Board Tools Calendar Join Us Donate Now Get FermiGear! Education Office Search Programs Calendar , Chicago, IL Join Us/Renew Membership Forms: Online - Print Support Us Donation Forms: Online - Print Tree

  8. 77 FR 4584 - Sunshine Act Meetings; National Science Board (United States)


    ... regard to the scheduling of meetings for the transaction of National Science Board business and other... Presentation: Research in Mathematics Education Committee on Strategy and Budget (CSB) Open Session: 9-10 a.m...

  9. Dicty_cDB: SSB721 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSB721 (Link to dictyBase) ssb721 G20804 DDB0230090 Contig-U04...594-1 SSB721E (Link to Original site) - - - - - - SSB721E 549 Show SSB721 Library SS (Link to library) Clone ID SSB721 (Link to dict...yBase) Atlas ID ssb721 NBRP ID G20804 dictyBase ID DDB0230090 Link to Contig Contig-...U04594-1 Original site URL update 1997.11.25 Translated Amino Acid sequence NDINSIVCKANSQCPTSHICTSSNKCIIKYSSKVGEKCTDSPLQCRVFNGEI

  10. Water Science and Technology Board annual report, 1990

    Energy Technology Data Exchange (ETDEWEB)


    This report summarizes the activities of the Water Science and Technology Board (WSTB) during 1990, its eighth year of existence. It describes current and recently completed projects, new activities scheduled to begin in 1991, and plans for the future. The WSTB is intended to be a dynamic forum, a mechanism by which the board community of water science, technology, and policy professionals can help assure high-quality national water programs. As such, the Board considers out-reach and communications of much importance.

  11. Water Science and Technology Board annual report, 1990

    Energy Technology Data Exchange (ETDEWEB)


    This report summarizes the activities of the Water Science and Technology Board (WSTB) during 1990, its eighth year of existence. It describes current and recently completed projects, new activities scheduled to begin in 1991, and plans for the future. The WSTB is intended to be a dynamic forum, a mechanism by which the board community of water science, technology, and policy professionals can help assure high-quality national water programs. As such, the Board considers out-reach and communications of much importance.

  12. Core Support of the Board on Mathematical Sciences

    Energy Technology Data Exchange (ETDEWEB)



    This proposal summarizes activities conducted by the Board on Mathematical Sciences (BMS) during the period August 1, 1994 to July 31, 1995 and describes future plans of the Board for the period August 1, 1995 to July 31, 1998. We are requesting core support in the amount of $105,000 ($35,000 each year) from the Department of Energy for the additional three-year period. The BMS activities supported exclusively by core funding are the annual Department Chairs Colloquia, the National Science and Technology Symposia, specific reports, the initiation of all projects, continuous oversight of all activities, and partial core support of the Committee on Applied and Theoretical Statistics (CATS). Other activities of the Board include giving recommendations on research directions to federal agencies, and reports on education in the mathematical sciences, interaction of mathematical sciences with other areas, health of the mathematical sciences, and emerging research directions.

  13. 76 FR 35410 - Science Advisory Board; Meeting (United States)


    ... statements. In general, each individual or group making a verbal presentation will be limited to a total time... Advisory Board (SAB) was established by a Decision Memorandum dated September 25, 1997, and is the only... management. Time and Date: The meeting will be held Wednesday, July 20, 2011, from 9:30 a.m. to 5:30 p.m. and...

  14. 77 FR 38273 - Science Advisory Board; Meeting (United States)


    ... will be limited to a total time of five (5) minutes. Individuals or groups planning to make a verbal... Advisory Board (SAB) was established by a Decision Memorandum dated September 25, 1997, and is the only... management. Time and Date: The meeting will be held Monday, July 16, 2012 from 9 a.m. to 5:30 p.m. and...

  15. 78 FR 60851 - Science Advisory Board Meeting (United States)


    ... written statements. In general, each individual or group making a verbal presentation will be limited to a... Advisory Board (SAB) was established by a Decision Memorandum dated September 25, 1997, and is the only... resource management. Time and Date: The meeting will be held Tuesday, November 19, 2013 from 10:00 a.m. to...

  16. 78 FR 38297 - Science Advisory Board (SAB) (United States)


    ... presentation will be limited to a total time of two (2) minutes. Individuals or groups planning to make a... Board (SAB) was established by a Decision Memorandum dated September 25, 1997, and is the only Federal... management. Time and Date: The meeting will be held Tuesday, July 23, 2013 from 2:00 p.m. to 5:00 p.m. EDT...

  17. 77 FR 65176 - Science Advisory Board (SAB) (United States)


    ... Atmospheric Administration (NOAA) science programs are of the highest quality and provide optimal support to... Portfolio Review Task Force; (3) Report from the Ecosystem Sciences and Management Working Group on...

  18. 75 FR 55617 - National Science Board; Sunshine Act Meetings Notice (United States)


    ... Dakota Science and Engineering Research. Introduction: Dr. Jack Warner, Executive Director, SD Board of... Member. Plenary Open Open Session: 8 a.m.-11:45 a.m. Jacket Legacy Room. 8 a.m. Chairman's Introduction... of Deep Underground Science and Engineering Laboratory (DUSEL) on South Dakota Graduate Education in...

  19. 75 FR 72843 - National Science Board; Sunshine Act Meetings; Notice (United States)


    ... in regard to the scheduling of meetings for the transaction of National Science Board business and... your name and place of business to request your badge, which will be ready for pick-up at the visitor's... Education in Science, Technology, Engineering, and Math (STEM) for America's Future. [cir] Speaker: Dr...

  20. 75 FR 40754 - Government in the Sunshine Act Regulations of the National Science Board (United States)


    ... NATIONAL SCIENCE FOUNDATION 45 CFR Part 614 RIN 3145-AA53 Government in the Sunshine Act Regulations of the National Science Board AGENCY: National Science Board (NSB), National Science Foundation (NSF). ACTION: Direct final rule. SUMMARY: The National Science Board (NSB) National Science Foundation...

  1. Board on chemical sciences and technology

    International Nuclear Information System (INIS)


    The Board has completed five reports since June 1988. Biosafety in the Laboratory: Prudent Practices for Handling and Disposal of Infectious Materials is a comprehensive review of the principles and practices of biological safety in the laboratory. Currently in press, it promises to be a landmark publication in this field, comparable to the Board's two previous studies on handling and disposal of chemicals in laboratories. Chemical Processes and Products in Severe Nuclear Reactor Accidents: Report of a Workshop evaluates the quality and relevance of existing high-temperature thermodynamic and kinetic data to the analysis of light-water reactor accidents. A number of areas where important data was deemed to be lacking or inadequate were identified to provide a sound basis for predicting the behavior of fission products, fuel, and other materials in nuclear reactors during a severe accident leading to radioactivity release. Training Requirements for Chemists in Nuclear Medicine, Nuclear Industry, and Related Areas assesses the training requirements for chemists in nuclear medicine, nuclear industry, and related areas. Finally, the Board's Air Force Office of Scientific Research High Energy Density Materials Panel has completed two program evaluation reports on this Air Force program

  2. Water Science and Technology Board annual report 1989

    Energy Technology Data Exchange (ETDEWEB)


    This report summarizes the activities of the Water Science and Technology Board (WSTB) and its subgroups during 1989, it seventh year of existence. It describes current and recently completed projects, new activities scheduled to begin in 1990, and plans for the future. The report also includes information on Board and committee memberships, program operational features, and reports produced during the past several years. This annual report is an introduction to the WSTB and its program for the year. 4 figs.

  3. Water Science and Technology Board annual report 1988

    Energy Technology Data Exchange (ETDEWEB)


    This annual report of the Water Science and Technology Board (WSTB) summarizes the activities of the Board and its subgroups during 1988, its sixth year of existence. Included are descriptions of current and recently completed projects, new activities scheduled to begin in 1989, and plans for the future. The report also includes information on Board and committee memberships, program operational features, and reports produced during the past several years. This annual report is intended to provide an introduction to the WSTB and summary of its program for the year.

  4. Board on chemical sciences and technology

    International Nuclear Information System (INIS)


    Current and Ongoing Projects include: Committee on Nuclear and Radiochemistry; Committee on Nuclear and Radiochemistry Workshop on Training Requirements for Chemists in Nuclear Medicine, Nuclear Industry, and Related Areas; Committee on Nuclear and Radiochemistry Workshop on High-Temperature and Nuclear Chemical Processes in Severe Reactor Accidents; Committee on Chemical Engineering Frontiers Research Needs and Opportunities; Committee on Separation Science on Technology; Panel on Future Directions for Fundamental Science in Fossil Energy Research; Committee for Handling and Disposal of Biohazards in the Laboratory (BIL); Advisory Panels to the AFSOR Chemical and Atmospheric Sciences Directorate; US National Committee for Pure and Applied Chemistry; US National Committee for Biochemistry; US National Committee for Crystallography

  5. 76 FR 4659 - Science Advisory Board Staff Office; Notification of a Public Teleconference of the Science... (United States)


    ... ENVIRONMENTAL PROTECTION AGENCY [FRL-9254-5] Science Advisory Board Staff Office; Notification of a Public Teleconference of the Science Advisory Board Nutrient Criteria Review Panel Correction In notice document 2011-1014 beginning on page 3133 in the issue of Wednesday, January 19, 2011, make the...

  6. 77 FR 58356 - Science Advisory Board (United States)


    ... Atmospheric Administration (NOAA) science programs are of the highest quality and provide optimal support to... terms for the Climate Working Group; and (5) Update from the Research and Development Portfolio Review...

  7. Dicty_cDB: SSB171 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSB171 (Link to dictyBase) ssb171 - - Contig-U02783-1 SSB171F ...nk to dictyBase) Atlas ID ssb171 NBRP ID - dictyBase ID - Link to Contig Contig-U02783-1 Original site URL h

  8. Gender Representation on Journal Editorial Boards in the Mathematical Sciences (United States)


    We study gender representation on the editorial boards of 435 journals in the mathematical sciences. Women are known to comprise approximately 15% of tenure-stream faculty positions in doctoral-granting mathematical sciences departments in the United States. Compared to this group, we find that 8.9% of the 13067 editorships in our study are held by women. We describe group variations within the editorships by identifying specific journals, subfields, publishers, and countries that significantly exceed or fall short of this average. To enable our study, we develop a semi-automated method for inferring gender that has an estimated accuracy of 97.5%. Our findings provide the first measure of gender distribution on editorial boards in the mathematical sciences, offer insights that suggest future studies in the mathematical sciences, and introduce new methods that enable large-scale studies of gender distribution in other fields. PMID:27536970

  9. 75 FR 13141 - National Science Board; Sunshine Act Meetings; Notice (United States)


    ... AND TIME: Wednesday, March 24, 2010, 11 a.m. SUBJECT MATTER: Discussion of Recent NSF Portfolio Review Materials, Issues for the Portfolio Assessment, and Next Steps. STATUS: Open. This meeting will be held by... National Science Board Web site ( ) for information or schedule updates, or contact...

  10. 75 FR 37452 - Science Board Advisory Committee; Notice of Meeting (United States)


    ... DEPARTMENT OF HEALTH AND HUMAN SERVICES Food and Drug Administration [Docket No. FDA-2010-N-0001... Safety and Applied Nutrition (CFSAN). The Science Board will hear about an interim report from the... the committee. Written submissions may be made to the contact person on or before August 9, 2010. Oral...

  11. Enhancing Science Kits with the Driving Question Board (United States)

    Nordine, Jeff; Torres, Ruben


    This article describes the driving question board (DQB), a visual organizer that supports inquiry-based instruction through the use of guiding questions. The DQB is a teaching aid designed to increase student engagement alongside science kits. Information is provided on its application to a lesson on buoyancy, highlighting how it improved…

  12. 76 FR 6766 - Meeting of the Defense Science Board (United States)


    ... resulting from ongoing Task Force activities. The Board will also discuss plans for future consideration of... Committee Act, Public Law 92-463, as amended (5 U.S.C. App. 2) and 41 CFR 102- 3.155, the Department of.... 552b(c)(1). Interested persons may submit a written statement for consideration by the Defense Science...

  13. 76 FR 21705 - Closed Meeting of the Defense Science Board (United States)


    ... ongoing Task Force activities. The Board will also discuss plans for future consideration of scientific... Committee Act, Public Law 92-463, as amended (5 U.S.C. App. 2) and 41 CFR 102- 3.155, the Department of.... 552b(c)(1). Interested persons may submit a written statement for consideration by the Defense Science...

  14. 78 FR 26399 - National Science Board; Sunshine Act Meetings; Notice (United States)


    ... business and other matters specified, as follows: AGENCY HOLDING MEETING: National Science Board. DATE AND... (LIGO) renewal proposal Information Item: Advanced Technology Solar Telescope (ATST) Committee on... Geosciences and EarthScope (GAGE) and Seismological Facilities for the Advancement of Geoscience and Earth...

  15. 75 FR 9876 - Science Advisory Board; Notice of Open Meeting (United States)


    ..., each individual or group making a verbal presentation will be limited to a total time of five (5... Science Advisory Board (SAB) was established by a Decision Memorandum dated September 25, 1997, and is the... resource management. Time and Date: The meeting will be held Tuesday March 23, 2010, from 8:30 a.m. to 5:30...

  16. 76 FR 76769 - National Science Board; Sunshine Act Meetings (United States)


    ... matters specified, as follows: AGENCY HOLDING MEETING: National Science Board DATE AND TIME: Monday.../notices/ . AGENCY CONTACT: Jennie L. Moehlmann, [email protected] , (703) 292-7000. PUBLIC AFFAIRS CONTACT... STEM education plan. Discussion of the NSF STEM education research portfolio: getting from theory to...

  17. 78 FR 55116 - National Science Board; Sunshine Act Meetings; Notice (United States)


    ... for the transaction of National Science Board business, as follows: DATE AND TIME: Thursday, September 12, 2013 at 10:30 a.m. EDT. SUBJECT MATTER: Consideration of nominations for the NSB class of 2014.... Ann Bushmiller, NSB Senior Legal Counsel. [FR Doc. 2013-21968 Filed 9-5-13; 11:15 am] BILLING CODE...

  18. 78 FR 51752 - Sunshine Act Meetings; National Science Board (United States)


    ... for the transaction of National Science Board business, as follows: DATE AND TIME: Monday, August 26, 2013 at 3:30 p.m. EST SUBJECT MATTER: Consideration of nominations for the NSB class of 2014- 2020... Bushmiller, NSB Senior Legal Counsel. [FR Doc. 2013-20485 Filed 8-19-13; 4:15 pm] BILLING CODE 7555-01-P ...

  19. 77 FR 64335 - Notification of a Public Teleconference of the Science Advisory Board; Perchlorate Advisory Panel (United States)


    ... ENVIRONMENTAL PROTECTION AGENCY [FRL--9743-2] Notification of a Public Teleconference of the Science Advisory Board; Perchlorate Advisory Panel AGENCY: Environmental Protection Agency (EPA). ACTION: Notice. SUMMARY: The Environmental Protection Agency (EPA) Science Advisory Board (SAB) Staff Office...

  20. 76 FR 40355 - Science Advisory Board Staff Office; Notification of a Public Meeting of the Science Advisory... (United States)


    ... ENVIRONMENTAL PROTECTION AGENCY [FRL-9431-7] Science Advisory Board Staff Office; Notification of a Public Meeting of the Science Advisory Board Panel for the Review of Great Lakes Restoration... information concerning the EPA Science Advisory Board can be found at the EPA SAB Web site at http://www.epa...

  1. 75 FR 33616 - Science Advisory Board Staff Office; Notification of a Public Meeting of the Science Advisory... (United States)


    ... a Public Meeting of the Science Advisory Board Exposure and Human Health Committee (EHHC) AGENCY: Environmental Protection Agency (EPA). ACTION: Notice. SUMMARY: The EPA Science Advisory Board (SAB) Staff... Science Advisory Board can be found on the SAB Web site at . SUPPLEMENTARY...

  2. 75 FR 11883 - Science Advisory Board Staff Office; Notification of a Public Meeting of the Science Advisory... (United States)


    ... ENVIRONMENTAL PROTECTION AGENCY [FRL-9126-2] Science Advisory Board Staff Office; Notification of a Public Meeting of the Science Advisory Board (SAB) AGENCY: Environmental Protection Agency (EPA). ACTION: Notice. SUMMARY: The Environmental Protection Agency (EPA) Science Advisory Board (SAB) Staff...

  3. 76 FR 22100 - Notification of a Public Teleconference of the Science Advisory Board; Drinking Water Committee... (United States)


    ... Science Advisory Board; Drinking Water Committee Augmented for the Review of the Effectiveness of Partial...: The EPA Science Advisory Board (SAB) Staff Office announces a public teleconference of the SAB... EPA Science Advisory Board can be found on the EPA Web site at . SUPPLEMENTARY...

  4. Water Science and Technology Board. Annual report 1991

    Energy Technology Data Exchange (ETDEWEB)


    This report summarizes the activities of the Water Science and Technology Board during 1991. The WSTB is intended to be a dynamic forum, a mechanism by which the broad community of water science, technology, and policy professionals can help assure high-quality national water programs. The principal products of WSTB studies are written reports which cover a wide range of water resources issues of current national concern. A few recent examples are: Restoration of aquatic ecosystems - science, technologies and public policy; Water transfers in the West - efficiency, equity and the environment; Opportunities in the hydrologic sciences; and Ground water models - scientific and regulatory applications. Projects completed, ongoing studies and published reports are described in detail in their respective sections of this report.

  5. Water Science and Technology Board annual report 1987

    Energy Technology Data Exchange (ETDEWEB)


    In 1982, the National Research Council chose to recognize the importance of water resource issues by establishing the Water Science and Technology Board (WSTB). During the five years since its first meeting in November 1982, the WSTB has grown and matured. The WSTB has met 14 times to provide guidance and plan activities. Under the WSTB's direction, committees of experts have conducted approximately 30 studies on a broad array of topics, from dam safety to irrigation-induced water quality problems to ground water protection strategies. Studies have ranged in scope from the oversight of specific agency projects and programs to broader scientific reviews, such as a disciplinary assessment of the hydrologic sciences initiated in 1987. In all cases, studies have the general theme of ultimately improving the scientific and technological bases of programs of water management and environmental quality. This fifth annual report of the WSTB summarizes the Board's accomplishments during 1987, its current activities, and its plans for the future. The report also includes information on Board and committee memberships, program organizations, and the reports produced. The report should provide the reader with a basic understanding of the WSTB's interests, achievements, and capabilities. The WSTB welcomes inquiries and suggestions concerning its activities and will provide more detailed information on any aspects of its work to those interested.

  6. 76 FR 13182 - Science Advisory Board Staff Office; Notification of a Public Meeting of the Science Advisory... (United States)


    ... a Public Meeting of the Science Advisory Board Committee on Science Integration for Decision Making... Agency (EPA or Agency) Science Advisory Board (SAB) Staff Office announces a public meeting of the SAB Committee on Science Integration for Decision Making. DATES: The meeting dates are March 29, 2011 from 9 a.m...

  7. Water Science and Technology Board. Annual report 1992-1993

    Energy Technology Data Exchange (ETDEWEB)


    This report summarizes the activities of the Water Science and Technology Board during 1992. The WSTB is intended to be a dynamic forum, a mechanism by which the broad community of water science, technology, and policy professionals can help assure high-quality national water programs. The principal products of WSTB studies are written reports which cover a wide range of water resources issues of current national concern. A few recent examples are: Managing wastewater in coastal urban areas; Ground water vulnerability assessment; Water transfers in the West - efficiency, equity and the environment; and Opportunities in the hydrologic sciences. Projects completed, ongoing studies and published reports are described in detail in their respective sections of this report.

  8. 5 CFR 5301.105 - Restrictions applicable to Members of the National Science Board. (United States)


    ... National Science Board. 5301.105 Section 5301.105 Administrative Personnel NATIONAL SCIENCE FOUNDATION SUPPLEMENTAL STANDARDS OF ETHICAL CONDUCT FOR EMPLOYEES OF THE NATIONAL SCIENCE FOUNDATION § 5301.105...) by the Chairman of the National Science Board or by the Designated Agency Ethics Official. (3) A...

  9. 76 FR 40726 - Notification of Public Teleconferences of the Science Advisory Board Radiation Advisory Committee... (United States)


    ... ENVIRONMENTAL PROTECTION AGENCY [FRL-9435-3] Notification of Public Teleconferences of the Science... Protection Agency (EPA), Science Advisory Board Staff Office. ACTION: Notice. SUMMARY: The EPA Science... information concerning the EPA Science Advisory Board can be found at the EPA SAB Web site at http// www.epa...

  10. Dicty_cDB: SSB322 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSB322 (Link to dictyBase) - - - Contig-U03539-1 SSB322Z (Link... to Original site) - - SSB322Z 393 - - - - Show SSB322 Library SS (Link to library) Clone ID SSB322 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U03539-1 Original site URL http://dict...KGKXYILQDKQYKERGVGTIRVNKDLEEKXRIIMNAD GSKKNILNVNIFPKMKVTSPNEKTLTFIAFEDDKICTFVLIAKPEEIKNFSTVINKQISS LEVA*nfil...NAD GSKKNILNVNIFPKMKVTSPNEKTLTFIAFEDDKICTFVLIAKPEEIKNFSTVINKQISS LEVA*nfilkkkk Homology vs CSM-cDNA Score E

  11. Water Science and Technology Board. Annual report 1993-1994

    Energy Technology Data Exchange (ETDEWEB)


    This report summarizes the activities of the Water Science and Technology Board during 1993-1994. The WSTB is intended to be a dynamic forum, a mechanism by which the broad community of water science, technology, and policy professionals can help assure high-quality national water programs. The principal products of WSTB studies are written reports which cover a wide range of water resources issues of current national concern. A few recent examples are: Alternatives for ground water cleanup; Managing wastewater in coastal urban areas; and, Water transfers in the West - efficiency, equity and the environment. Projects completed, ongoing studies and published reports are described in detail in their respective sections of this report.

  12. 76 FR 7199 - Science Advisory Board Staff Office; Notification of a Public Meeting of the Science Advisory... (United States)


    ... ENVIRONMENTAL PROTECTION AGENCY [FRL-9264-5] Science Advisory Board Staff Office; Notification of a Public Meeting of the Science Advisory Board Panel for the Review of EPA's Hydraulic Fracturing...-2098 or via e-mail at [email protected] . General information concerning the EPA Science Advisory...

  13. 77 FR 41185 - Notification of Public Teleconferences of the Science Advisory Board Animal Feeding Operations... (United States)


    ... ENVIRONMENTAL PROTECTION AGENCY [FRL-9699-7] Notification of Public Teleconferences of the Science...). ACTION: Notice. SUMMARY: The Environmental Protection Agency (EPA or Agency) Science Advisory Board (SAB... concerning the EPA Science Advisory Board can be found at the EPA SAB Web site at

  14. 75 FR 43943 - Defense Science Board; Task Force on Counter Insurgency (COIN) Intelligence, Surveillance and... (United States)


    ... and what emerging science and technology would have the greatest intelligence potential in this type... DEPARTMENT OF DEFENSE Office of the Secretary Defense Science Board; Task Force on Counter... Defense (DoD). ACTION: Notice of advisory committee meetings. SUMMARY: The Defense Science Board Task...

  15. Butanol biorefineries: Use of novel technologies to produce biofuel butanol from sweet sorghum bagasse (SSB) (United States)

    In order to produce butanol biofuel at a competitive price, agricultural residues such as SSB should be used. This feedstock was studied as a substitute to corn to lower feedstock costs and broaden beyond a food crop. In addition, cutting edge science & technology was applied. In these studies we us...

  16. Flight Hardware Virtualization for On-Board Science Data Processing Project (United States)

    National Aeronautics and Space Administration — Utilize Hardware Virtualization technology to benefit on-board science data processing by investigating new real time embedded Hardware Virtualization solutions and...

  17. 75 FR 28018 - Science Advisory Board Staff Office; Notification of a Public Teleconference of the Science... (United States)


    ... nitrogen in the environment. At the global scale, reactive nitrogen from human activities now exceeds that... in the environment and that nitrogen cycling through biogeochemical pathways has a variety of... a Public Teleconference of the Science Advisory Board Integrated Nitrogen Committee AGENCY...

  18. Water Science and Technology Board Annual Report 2001-2002

    Energy Technology Data Exchange (ETDEWEB)

    None, None


    This annual report marks the twentieth anniversary of the Water Science and Technology Board (WSTB) (1982-2002). The WSTB oversees studies of water issues. The principal products of studies are written reports. These reports cover a wide range of water resources issues of national concern. The following three recently issued reports illustrate the scope of the WSTB's studies: Envisioning the Agenda for Water Resources Research in the Twenty-first Century. The Missouri River Ecosystem: Exploring the Prospects for Recovery, and Assessing the TMDL Approach to Water Quality Management. The WSTB generally meets three times each year where discussions are held on ongoing projects, strategic planning, and developing new initiatives. The meetings also foster communication within the water resources community. The annual report includes a discussion on current studies, completed studies 2001-2002, and future plans, as well as a listing of published reports (1983-2002).

  19. Ssb1 and Ssb2 cooperate to regulate mouse hematopoietic stem and progenitor cells by resolving replicative stress. (United States)

    Shi, Wei; Vu, Therese; Boucher, Didier; Biernacka, Anna; Nde, Jules; Pandita, Raj K; Straube, Jasmin; Boyle, Glen M; Al-Ejeh, Fares; Nag, Purba; Jeffery, Jessie; Harris, Janelle L; Bain, Amanda L; Grzelak, Marta; Skrzypczak, Magdalena; Mitra, Abhishek; Dojer, Norbert; Crosetto, Nicola; Cloonan, Nicole; Becherel, Olivier J; Finnie, John; Skaar, Jeffrey R; Walkley, Carl R; Pandita, Tej K; Rowicka, Maga; Ginalski, Krzysztof; Lane, Steven W; Khanna, Kum Kum


    Hematopoietic stem and progenitor cells (HSPCs) are vulnerable to endogenous damage and defects in DNA repair can limit their function. The 2 single-stranded DNA (ssDNA) binding proteins SSB1 and SSB2 are crucial regulators of the DNA damage response; however, their overlapping roles during normal physiology are incompletely understood. We generated mice in which both Ssb1 and Ssb2 were constitutively or conditionally deleted. Constitutive Ssb1/Ssb2 double knockout (DKO) caused early embryonic lethality, whereas conditional Ssb1/Ssb2 double knockout (cDKO) in adult mice resulted in acute lethality due to bone marrow failure and intestinal atrophy featuring stem and progenitor cell depletion, a phenotype unexpected from the previously reported single knockout models of Ssb1 or Ssb2 Mechanistically, cDKO HSPCs showed altered replication fork dynamics, massive accumulation of DNA damage, genome-wide double-strand breaks enriched at Ssb-binding regions and CpG islands, together with the accumulation of R -loops and cytosolic ssDNA. Transcriptional profiling of cDKO HSPCs revealed the activation of p53 and interferon (IFN) pathways, which enforced cell cycling in quiescent HSPCs, resulting in their apoptotic death. The rapid cell death phenotype was reproducible in in vitro cultured cDKO-hematopoietic stem cells, which were significantly rescued by nucleotide supplementation or after depletion of p53. Collectively, Ssb1 and Ssb2 control crucial aspects of HSPC function, including proliferation and survival in vivo by resolving replicative stress to maintain genomic stability. © 2017 by The American Society of Hematology.

  20. 77 FR 16846 - National Science Advisory Board for Biosecurity Meeting; Office of Biotechnology Activities... (United States)


    ... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health National Science Advisory Board for Biosecurity Meeting; Office of Biotechnology Activities, Office of Science Policy, Office of.... Contact Person: Ronna Hill, NSABB Program Assistant, NIH Office of Biotechnology Activities, 6705...

  1. 75 FR 57967 - Science Advisory Board to the National Center for Toxicological Research Notice of Meeting (United States)


    ...] Science Advisory Board to the National Center for Toxicological Research Notice of Meeting AGENCY: Food... closed to the public. Name of Committee: Science Advisory Board (SAB) to the National Center for Toxicological Research (NCTR). General Function of the Committee: To provide advice and recommendations to the...

  2. 77 FR 57569 - Science Advisory Board to the National Center for Toxicological Research; Notice of Meeting (United States)


    ...] Science Advisory Board to the National Center for Toxicological Research; Notice of Meeting AGENCY: Food... closed to the public. Name of Committee: Science Advisory Board (SAB) to the National Center for Toxicological Research (NCTR). General Function of the Committee: To provide advice and recommendations to the...

  3. 77 FR 21772 - Notification of Two Public Teleconferences of the Science Advisory Board Biogenic Carbon... (United States)


    ...). ACTION: Notice. SUMMARY: The Environmental Protection Agency (EPA or Agency) Science Advisory Board ([email protected] . General information concerning the EPA Science Advisory Board can be found at the EPA... ENVIRONMENTAL PROTECTION AGENCY [FRL-9658-7] Notification of Two Public Teleconferences of the...

  4. 77 FR 30528 - Notification of a Public Teleconference of the Science Advisory Board; Libby Amphibole Asbestos... (United States)


    ...). ACTION: Notice. SUMMARY: The Environmental Protection Agency (EPA or Agency) Science Advisory Board (SAB... information concerning the EPA Science Advisory Board can be found at the EPA SAB Web site at http://www.epa... ENVIRONMENTAL PROTECTION AGENCY [FRL-9675-4] Notification of a Public Teleconference of the...

  5. 77 FR 18808 - Notification of Two Public Teleconferences of the Science Advisory Board; Libby Amphibole... (United States)


    ...). ACTION: Notice. SUMMARY: The Environmental Protection Agency (EPA or Agency) Science Advisory Board (SAB... Science Advisory Board can be found at the EPA SAB Web site at . SUPPLEMENTARY... ENVIRONMENTAL PROTECTION AGENCY [FRL-9653-1] Notification of Two Public Teleconferences of the...


    Directory of Open Access Journals (Sweden)

    Bagus Arif Wicaksono


    Full Text Available The purpose of this study to determine the purpose of the establishment of SSB , organization , training programs , facilities and infrastructure , human resources , the role of parents and the community , funding , distribution athlete in SSB Tugu Muda Semarang in 2013. The approach in this study uses a qualitative descriptive approach. Instruments and methods of data collection by observation, interviews , and documentation. The results showed that the SSB Tugu Muda Semarang existing board of management of systematic organization , in carrying out organizational activities carried out by organizations that exist. Based on the results penilitian , the suggestion that the author can say is keep the existing guidance systems , maintain the achievements that have been achieved so that it can attract more new athletes anymore.

  7. 76 FR 51364 - Notification of a Public Teleconference of the Science Advisory Board Panel for the Review of the... (United States)


    ... Science Advisory Board Panel for the Review of the Great Lakes Restoration Initiative Action Plan AGENCY... Agency) Science Advisory Board (SAB) Staff Office announces a public teleconference of the SAB Panel to... information concerning the EPA Science Advisory Board can be found at the EPA SAB Web site at http://www.epa...

  8. 78 FR 73852 - Army Science Board Winter Plenary Meeting (United States)


    ... Board to review the results of the FY13 study titled, ``Creating an Innovation Culture in the Army'' in... the Fiscal Year 2013 ``Creating an Innovation Culture'' Study. The ASB board members will cast a"> or Ms. Carolyn German at (703) 545-8654 or email...

  9. 78 FR 57136 - National Board for Education Sciences; Meeting (United States)


    ... discussion. From 11:00 a.m. to 12:30 p.m., the Board will consider the topic, ``Supporting English Language... roundtable discussion of the issues raised. The meeting will break for lunch from 12:30 to 1:30 p.m. The... What Works Clearinghouse--Postsecondary Topics, the Board will engage in roundtable discussion of the...

  10. 77 FR 43064 - Defense Science Board; Notice of Advisory Committee Meetings (United States)


    ... Science Board 2012 Summer Study on Technology and Innovation Enablers for Superiority in 2030 will meet in closed session August 20-24, 2012, from 8:00 a.m. to 5:00 p.m. at the Charles Stark Draper Laboratory... meeting, the Board will discuss interim finding and recommendations resulting from ongoing Task Force...

  11. 76 FR 1641 - Meeting of the Office of Justice Programs' Science Advisory Board (United States)


    ... and By-Laws, a review of ethics rules applicable to the Board's activities, and briefings from OJP... DEPARTMENT OF JUSTICE Office of Justice Programs [OJP (OJP) Docket No. 1543] Meeting of the Office of Justice Programs' Science Advisory Board AGENCY: Office of Justice Programs (OJP), Justice. ACTION...

  12. 77 FR 22316 - Notification of a Public Teleconference of the Science Advisory Board Ecological Processes and... (United States)


    ... (EPA). ACTION: Notice. SUMMARY: The Environmental Protection Agency (EPA or Agency) Science Advisory... . General information concerning the EPA Science Advisory Board can be found at the EPA SAB Web site at http... appropriate SAB Staff Office procedural policies. EPA's Office of the Science Advisor has requested that the...

  13. 77 FR 4319 - Notification of Two Public Teleconferences of the Science Advisory Board Ecological Processes and... (United States)


    ... (EPA). ACTION: Notice. SUMMARY: The Environmental Protection Agency (EPA or Agency) Science Advisory... . General information concerning the EPA Science Advisory Board can be found at the EPA SAB Web site at http... to recommendations in a 2007 SAB Report, ``Advice to EPA on Advancing the Science and Application of...

  14. 77 FR 45604 - Notification of Two Public Teleconferences of the Science Advisory Board; Environmental Economics... (United States)


    ... Science Advisory Board; Environmental Economics Advisory Committee AGENCY: Environmental Protection Agency...) Staff Office announces two public teleconferences of the SAB Environmental Economics Advisory Committee...., notice is hereby given that the SAB Environmental Economics Advisory Committee (EEAC) will hold public...

  15. [National Academies' Board on Mathematical Sciences and their Application] Final technical report

    Energy Technology Data Exchange (ETDEWEB)

    Scott T. Weidman


    The National Academies' Board on Mathematical Sciences and their Applications (BMSA) is a primary interface between the research enterprise and federal agencies that rely on the mathematical sciences. The Board provides objective and authoritative advice on how best to apply the tools of mathematics, statistics, operations research, financial engineering, computational modeling, computational science, information analysis, and decision analysis to practical problems of national importance. In so doing, the Board strengthens the policy-making process and increases the visibility of, and appreciation for, the mathematical sciences while also identifying growth areas for the discipline. The Board consists of 18 pro bono experts from a broad range of quantitative fields, with experience in academia, industry, and national laboratories.

  16. Report of the Defense Science Board Task Force on Strategic Communication

    National Research Council Canada - National Science Library


    The 2007 Defense Science Board (DSB) Task Force on Strategic Communication has written this report within the context of a larger study, the DSB 2007 Summer Study on Challenges to Military Operations in Support of National Interests...

  17. 77 FR 1072 - Meeting of the National Biodefense Science Board (United States)


    ... site for the most up-to-date information on the meeting. ADDRESSES: Omni Shoreham Hotel, Palladian... NBSB Web site at prior to the...

  18. 76 FR 34069 - National Board for Education Sciences; Meeting (United States)


    .... Following lunch the Board will turn to the topic, ``Communications: What are effective ways to communicate... Stanford University and Dr. Robert Slavin of Johns Hopkins University and the Success for All Foundation...

  19. 75 FR 69920 - (NOAA) Science Advisory Board (SAB) (United States)


    ... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration (NOAA) Science Advisory... Administration (NOAA), Department of Commerce (DOC). ACTION: Notice of open meeting. SUMMARY: The Science... Administration (NOAA) science programs are of the highest quality and provide optimal support to resource...

  20. 78 FR 16254 - (NOAA) Science Advisory Board (SAB) (United States)


    ... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration (NOAA) Science Advisory... Administration (NOAA), Department of Commerce (DOC). ACTION: Notice of open meeting. SUMMARY: The Science... Administration (NOAA) science programs are of the highest quality and provide optimal support to resource...

  1. 76 FR 9054 - National Science Board; Sunshine Act Meetings; Impromptu Notice of Change (Addition of Agenda Item) (United States)


    ... NATIONAL SCIENCE FOUNDATION National Science Board; Sunshine Act Meetings; Impromptu Notice of Change (Addition of Agenda Item) The National Science Board's (NSB) Audit & Oversight (A&O) Committee..., National Science Foundation, 4201 Wilson Blvd., Arlington, VA 22230. Telephone: (703) 292-7000. Daniel A...

  2. 77 FR 6789 - National Board for Education Sciences; Meeting (United States)


    ... Evaluation in the Administration for Children and Families in the Department of Health and Human Services... Director, and the Commissioners of the national centers will give an overview of recent developments at IES... Board will consider the topic, ``The Importance of Disseminating Research Results: How can we better...

  3. 76 FR 8381 - National Science Board; Sunshine Act Meetings; Impromptu Notice of Time & Location Change (United States)


    ... Time & Location Change The National Science Board's Committee on Program and Plans, pursuant to NSF... MATTER: No change. STATUS: No change. ORIGINAL LOCATION: Room 1295 or 1235, National Science Foundation, 4201Wilson Blvd., Arlington, VA 22230. NEW LOCATION: Room 1295. Public overflow room for the open session...

  4. 78 FR 33416 - Notification of a Public Meeting of the Science Advisory Board Environmental Justice Technical... (United States)


    ... ENVIRONMENTAL PROTECTION AGENCY [FRL--9819-3] Notification of a Public Meeting of the Science... Agency (EPA). ACTION: Notice. SUMMARY: The EPA Science Advisory Board (SAB) Staff Office announces a public meeting of the SAB Environmental Justice Technical Guidance Review Panel to provide advice through...

  5. 78 FR 14299 - Notification of a Public Meeting of the Science Advisory Board Chemical Assessment Advisory... (United States)


    ... ENVIRONMENTAL PROTECTION AGENCY [FRL-9786-6] Notification of a Public Meeting of the Science...: Notice. SUMMARY: The Environmental Protection Agency (EPA or agency) Science Advisory Board (SAB) Staff Office announces a public meeting of the SAB Chemical Assessment Advisory Committee (CAAC) to receive a...

  6. The EGSE science software of the IBIS instrument on-board INTEGRAL satellite

    International Nuclear Information System (INIS)

    La Rosa, Giovanni; Fazio, Giacomo; Segreto, Alberto; Gianotti, Fulvio; Stephen, John; Trifoglio, Massimo


    IBIS (Imager on Board INTEGRAL Satellite) is one of the key instrument on-board the INTEGRAL satellite, the follow up mission of the high energy missions CGRO and Granat. The EGSE of IBIS is composed by a Satellite Interface Simulator, a Control Station and a Science Station. Here are described the solutions adopted for the architectural design of the software running on the Science Station. Some preliminary results are used to show the science functionality, that allowed to understand the instrument behavior, all along the test and calibration campaigns of the Engineering Model of IBIS

  7. 76 FR 7198 - Science Advisory Board Staff Office; Notification of a Public Meeting of a Science Advisory Board... (United States)


    ..., preferably at least 10 days prior to the meeting, to give EPA as much time as possible to process your... Board can be found on the SAB Web site at . SUPPLEMENTARY INFORMATION: The SAB... light of EPA's research needs. Previous SAB budget advisories are on the SAB Web site at http://www.epa...

  8. 77 FR 71453 - National Science Board; Sunshine Act Meetings; Notice (United States)


    ... December 4, 2012 8:00-8:05 a.m. (Chairman's introduction) 8:05 a.m.-12:00 p.m. (CPP) 1:30-2:00 p.m... Committee on Science & Engineering Indicators (SEI) Open Session: 3:45-5:00 p.m. Chairman's Remarks Approval... Science and Engineering Indicators 2014 Narrative Chapter Outlines Update on Science and Engineering...

  9. 75 FR 30832 - National Biodefense Science Board; Call for Nominees (United States)


    ...) four individuals from the pharmaceutical, biotechnology and device industries, (c) four academicians... opportunities presented by advances in biological and life sciences, biotechnology, and genetic engineering with...

  10. 76 FR 80368 - Notification of a Public Meeting of the Science Advisory Board Libby Amphibole Asbestos Review Panel (United States)


    ... ENVIRONMENTAL PROTECTION AGENCY [FRL-9610-8] Notification of a Public Meeting of the Science...: Notice. SUMMARY: The Environmental Protection Agency (EPA or Agency) Science Advisory Board (SAB) [email protected] . General information concerning the EPA Science Advisory Board can be found at the EPA SAB...

  11. Automating ATLAS Computing Operations using the Site Status Board

    CERN Document Server

    Andreeva, J; The ATLAS collaboration; Campana, S; Di Girolamo, A; Espinal Curull, X; Gayazov, S; Magradze, E; Nowotka, MM; Rinaldi, L; Saiz, P; Schovancova, J; Stewart, GA; Wright, M


    The automation of operations is essential to reduce manpower costs and improve the reliability of the system. The Site Status Board (SSB) is a framework which allows Virtual Organizations to monitor their computing activities at distributed sites and to evaluate site performance. The ATLAS experiment intensively uses SSB for the distributed computing shifts, for estimating data processing and data transfer efficiencies at a particular site, and for implementing automatic exclusion of sites from computing activities, in case of potential problems. ATLAS SSB provides a real-time aggregated monitoring view and keeps the history of the monitoring metrics. Based on this history, usability of a site from the perspective of ATLAS is calculated. The presentation will describe how SSB is integrated in the ATLAS operations and computing infrastructure and will cover implementation details of the ATLAS SSB sensors and alarm system, based on the information in SSB. It will demonstrate the positive impact of the use of SS...

  12. 77 FR 41204 - Sunshine Act Meetings; National Science Board (United States)


    ... Activities Introduction of Chapter Authors and Discussion of Science and Engineering Indicators 2014... introduction) 8:20-8:30 a.m. (SCF) 8:30-11:00 a.m. (previously noticed continuation of CPP meeting) 11:00-11:45... Chairman's Closing Remarks Committee on Science & Engineering Indicators (SEI) Open Session: 1:30-4:00 p.m...

  13. 75 FR 51291 - National Science Board: Sunshine Act Meetings; Notice (United States)


    ... Engineering Indicators 2012. Introduction of Chapter Authors and Discussion of Science and Engineering.... Introduction of Chapter Authors and Discussion of Science and Engineering Indicators 2012. Narrative Chapter... Chairman's Introduction Open Session: 7:30 a.m.-7:35 a.m., Room 1235 Committee on Programs and Plans (CPP...

  14. 75 FR 71465 - National Science Board; Sunshine Act Meetings (United States)


    ...'s Remarks. NSB Action Items: Science of Learning Centers: Extension of Funding for Two Centers. [cir] Learning in Informal and Formal Environments (LIFE) Center. [cir] Center of Excellence for Learning in... two Science of Learning Centers. Closed Committee Reports. Plenary Open Session: 1 p.m.-3 p.m., Room...

  15. 78 FR 4838 - Science Advisory Board; Notice of Public Meeting (United States)


    ... Atmospheric Administration (NOAA) science programs are of the highest quality and provide optimal support to...) Presentation of the final report from Research and Development Portfolio Review Task Force; and (2) Review of...

  16. 76 FR 42750 - National Science Board: Sunshine Act Meetings; Notice (United States)


    ... DISCUSSED: Thursday, July 28, 2011 Chairman's Introduction Open Session: 7:40-7:45 a.m., Room 1235...: Authorization to Fund Petascale Computing Committee on Science and Engineering Indicators (SEI) Open Session: 11...

  17. Ssb1 chaperone is a [PSI+] prion-curing factor. (United States)

    Chacinska, A; Szczesniak, B; Kochneva-Pervukhova, N V; Kushnirov, V V; Ter-Avanesyan, M D; Boguta, M


    Yeast SUP7' or SUP11 nonsense suppressors have no phenotypic expression in strains deficient in the isopentenylation of A37 in tRNA. Here we show that such strains spontaneously produce cells with a nonsense suppressor phenotype which is related to the cytoplasmically inherited determinant and manifests all the key features of the [PSI+] prion. A screen of a multicopy yeast genomic library for genes that inactivate the [PSI+]-related suppressor phenotype resulted in the isolation of the SSB1 gene. Moreover, we demonstrate that multicopy plasmid encoding the Ssb1 chaperone cures cells of the [PSI+] prion.

  18. Dicty_cDB: SSB373 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSB373 (Link to dictyBase) - G00609 DDB0216216 Contig-U04543-1...nk to library) Clone ID SSB373 (Link to dictyBase) Atlas ID - NBRP ID G00609 dictyBase ID DDB0216216 Link to... Contig Contig-U04543-1 Original site URL N AB016728 |AB016728.1 Dictyostelium discoideum sapA mRNA for saposin A, co... 44 7e-04 12 AC116330 |AC116330.2 Dictyostelium discoideum chromosome 2 map 3191214-3323468 strain AX4, comp

  19. INTS3 controls the hSSB1-mediated DNA damage response


    Skaar, Jeffrey R.; Richard, Derek J.; Saraf, Anita; Toschi, Alfredo; Bolderson, Emma; Florens, Laurence; Washburn, Michael P.; Khanna, Kum Kum; Pagano, Michele


    Human SSB1 (single-stranded binding protein 1 [hSSB1]) was recently identified as a part of the ataxia telangiectasia mutated (ATM) signaling pathway. To investigate hSSB1 function, we performed tandem affinity purifications of hSSB1 mutants mimicking the unphosphorylated and ATM-phosphorylated states. Both hSSB1 mutants copurified a subset of Integrator complex subunits and the uncharacterized protein LOC58493/c9orf80 (henceforth minute INTS3/hSSB-associated element [MISE]). The INTS3?MISE?h...

  20. 75 FR 47030 - National Science Board; Sunshine Act Meetings; Notice (United States)


    ... Committee on Programs and Plans. STATUS: Open. LOCATION: This meeting will be held by teleconference... Programs and Plans, pursuant to NSF regulations (45 CFR part 614), the National Science Foundation Act, as... business and other matters specified, as follows: DATE AND TIME: August 12, 2010 at 3 p.m. EDT. SUBJECT...

  1. 76 FR 55422 - National Science Board; Sunshine Act Meetings; Notice (United States)


    ...: Jennie L. Moehlmann, [email protected] , (703) 292-7000. PUBLIC AFFAIRS CONTACT: Dana Topousis, dtopousi.... Phil Stokes, SAGUARO Program. Dr. Jennie Scott, Director of Curriculum and Articulation Services, Pima... Professor, School of Life Science, Arizona State University. CSB Subcommittee on Facilities (SCF) Open...

  2. 76 FR 12718 - National Board for Education Sciences Meeting (United States)


    ... Sciences (IES) on, among other things, the establishment of activities to be supported by the Institute..., in text or Adobe Portable Document Format (PDF) on the Internet at the following site: http://www.ed... version of this document is the document published in the Federal Register. Free Internet access to the...

  3. 77 FR 57079 - National Board for Education Sciences; Meeting (United States)


    ... of Education Sciences (IES) on, among other things, the establishment of activities to be supported... in the Federal Register, in text or Adobe Portable Document Format (PDF) on the Internet at the...: The official version of this document is the document published in the Federal Register. Free Internet...

  4. 75 FR 65305 - National Board for Education Sciences (United States)


    ... Sciences (IES) on, among other things, the establishment of activities to be supported by the Institute, on... Document Format (PDF) on the Internet at the following site: document published in the Federal Register. Free Internet access to the official edition of the Federal...

  5. 77 FR 20805 - National Board for Education Sciences; Meeting (United States)


    ... Sciences (IES) on, among other things, the establishment of activities to be supported by the Institute, on... Portable Document Format (PDF) on the Internet at the following site: document published in the Federal Register. Free Internet access to the official edition of the Federal...

  6. 76 FR 35216 - Science Advisory Board Staff Office Notification of a Public Teleconference of the Chartered... (United States)


    ... disability, please contact Dr. Nugent preferably at least ten days prior to the teleconference to give EPA as... concerning the EPA Science Advisory Board can be found on the EPA Web site at advisory activity, including its meetings and teleconferences, can be found on the SAB Web site at http...

  7. 77 FR 52024 - Notification of a Public Teleconference of the Chartered Science Advisory Board (United States)


    ... disability, please contact Dr. Nugent preferably at least 10 days prior to the teleconference, to give EPA as... the EPA Science Advisory Board can be found on the SAB Web site at about this advisory activity can be found on the SAB Web site at

  8. 76 FR 26720 - Science Advisory Board Staff Office; Notification of a Public Teleconference of the Chartered... (United States)


    ... contact Dr. Stallworth preferably at least ten days prior to the teleconference to give EPA as much time... information concerning the EPA Science Advisory Board can be found on the EPA Web site at report. Background information about this SAB advisory activity can be found on the SAB Web site at http...

  9. 76 FR 26290 - Science Advisory Board Staff Office; Notification of a Public Teleconference of the Chartered... (United States)


    ... the teleconference to give EPA as much time as possible to process your request. Dated: April 26, 2011.... General information concerning the EPA Science Advisory Board can be found on the EPA Web site at http... NAS Comments.'' Background information about this SAB advisory activity can be found on the SAB Web...

  10. 76 FR 39104 - Science Advisory Board Staff Office; Notification of a Public Teleconference of the Chartered... (United States)


    ... disability, please contact Dr. Nugent preferably at least ten days prior to the teleconference to give EPA as... concerning the EPA Science Advisory Board can be found on the EPA Web site at advisory activity, including its meetings and teleconferences, can be found on the SAB Web site at http...

  11. 76 FR 41245 - Science Advisory Board Staff Office; Notification of a Public Teleconference of the Chartered... (United States)


    ... Dr. Nugent preferably at least ten days prior to the teleconference to give EPA as much time as... concerning the EPA Science Advisory Board can be found on the EPA Web site at found on the SAB Web site at

  12. 75 FR 4407 - Science Board to the Food and Drug Administration; Notice of Meeting (United States)


    ... DEPARTMENT OF HEALTH AND HUMAN SERVICES Food and Drug Administration [Docket No. FDA-2010-N-0001... subcommittee reviewing research at the Center for Food Safety and Applied Nutrition. The Science Board will... person on or before Monday, February 15, 2010. Oral presentations from the public will be scheduled...

  13. 76 FR 77268 - National Science Board; Sunshine Act Meetings; Notice Revised (United States)


    ... business and other matters specified, as follows: AGENCY HOLDING MEETING: National Science Board. DATE AND... portfolio: getting from theory to scale Task Force on Merit Review (MR) Open Session: 2:30 p.m.-3:30 p.m... Report Human Capital Management Update OIG FY 2012 Audit Plan Update on Procedures re Personally...

  14. 75 FR 81268 - Science Advisory Board Staff Office; Notification of Two Public Quality Review Teleconferences of... (United States)


    ... ``Reactive Nitrogen in the United States; an Analysis of Inputs, Flows, Consequences, and Management Options... information concerning the EPA Science Advisory Board can be found on the SAB Web site at information about this advisory activity can be found on the SAB Web site at

  15. 77 FR 15996 - Science Advisory Board (SAB); Notice of Open Meeting (United States)


    ... limited to a total time of five (5) minutes. Individuals or groups planning to make a verbal presentation... Science Advisory Board (SAB) was established by a Decision Memorandum dated September 25, 1997, and is the... resource management. Time and Date: The meeting will be held Thursday, April 5, 2012 from 9 a.m. to 5:15 p...

  16. 76 FR 10888 - Science Advisory Board (SAB); Notice of Open Meeting (United States)


    ... general, each individual or group making a verbal presentation will be limited to a total time of five (5... meeting. SUMMARY: The Science Advisory Board (SAB) was established by a Decision Memorandum dated... quality and provide optimal support to resource management. TIME AND DATE: The meeting will be held...

  17. Computer science security research and human subjects: emerging considerations for research ethics boards. (United States)

    Buchanan, Elizabeth; Aycock, John; Dexter, Scott; Dittrich, David; Hvizdak, Erin


    This paper explores the growing concerns with computer science research, and in particular, computer security research and its relationship with the committees that review human subjects research. It offers cases that review boards are likely to confront, and provides a context for appropriate consideration of such research, as issues of bots, clouds, and worms enter the discourse of human subjects review.

  18. 78 FR 58536 - Notification of a Public Meeting of the Science Advisory Board Panel for the Review of the EPA... (United States)


    ... ENVIRONMENTAL PROTECTION AGENCY [FRL--9901-26-OA] Notification of a Public Meeting of the Science Advisory Board Panel for the Review of the EPA Water Body Connectivity Report AGENCY: Environmental Protection Agency (EPA). ACTION: Notice. SUMMARY: The EPA Science Advisory Board (SAB) Staff Office announces...

  19. Exploring the meaning of practicing classroom inquiry from the perspectives of National Board Certified Science Teachers (United States)

    Karaman, Ayhan

    Inquiry has been one of the most prominent terms of the contemporary science education reform movement (Buck, Latta, & Leslie-Pelecky, 2007; Colburn, 2006; Settlage, 2007). Practicing classroom inquiry has maintained its central position in science education for several decades because science education reform documents promote classroom inquiry as the potential savior of science education from its current problems. Likewise, having the capabilities of teaching science through inquiry has been considered by National Board for Professional Teaching Standards [NBPTS] as one of the essential elements of being an accomplished science teacher. Successful completion of National Board Certification [NBC] assessment process involves presenting a clear evidence of enacting inquiry with students. Despite the high-profile of the word inquiry in the reform documents, the same is not true in schools (Crawford, 2007). Most of the science teachers do not embrace this type of approach in their everyday teaching practices of science (Johnson, 2006; Luera, Moyer, & Everett, 2005; Smolleck, Zembal-Saul, & Yoder, 2006; Trumbull, Scarano, & Bonney, 2006). And the specific meanings attributed to inquiry by science teachers do not necessarily match with the original intentions of science education reform documents (Matson & Parsons, 2006; Wheeler, 2000; Windschitl, 2003). Unveiling the various meanings held by science teachers is important in developing better strategies for the future success of science education reform efforts (Jones & Eick, 2007; Keys & Bryan, 2001). Due to the potential influences of National Board Certified Science Teachers [NBCSTs] on inexperienced science teachers as their mentors, examining inquiry conceptions of NBCSTs is called for. How do these accomplished practitioners understand and enact inquiry? The purpose of this dissertation research study was twofold. First, it investigated the role of NBC performance assessment process on the professional development

  20. The independence of the Shari’a supervisory board in the Islamic financial institutions of the GCC countries

    Directory of Open Access Journals (Sweden)

    Samy Nathan Garas


    Full Text Available Islamic Financial Institutions (IFIs are governed by two boards: the Board of Directors (BoD and the Shari’a Supervisory Board (SSB. The SSB is a panel of Shari’a scholars who act independently from other governance organs. This paper discriminates between dependent SSBs and independent SSBs by using twenty one variables, which are classified into three groups: the implementation of governance best practices, the recruitment of SSB members, and the relationship between the SSB members and other governance organs. This study is one of the first studies that provide empirical results about the SSB independence. Nevertheless, the research focuses exclusively on the Gulf Cooperation Council (GCC countries and excludes the other countries where Shari’a supervision might have different forms. The study has developed a hypothesis, which was tested by a questionnaire. Data was collected from 76 Shari’a Supervisory Boards, 73 Boards of Directors, and 59 shareholders of IFIs in the GCC countries (Bahrain, Kuwait, Qatar, Saudi Arabia, and UAE during 2009. The discriminant analysis has been used in identifying both dependent and independent SSBs. The paper finds five variables relevant in discriminating the two groups. These variables are the incentives provided to the SSB; the average remuneration to the SSB members; the existence of the policy of penalties for violating the code of conduct; the relation between the SSB members and the BoD; and the role of executive management in recruiting SSB members.

  1. The essential role of the Deinococcus radiodurans ssb gene in cell survival and radiation tolerance.

    Directory of Open Access Journals (Sweden)

    J Scott Lockhart

    Full Text Available Recent evidence has implicated single-stranded DNA-binding protein (SSB expression level as an important factor in microbial radiation resistance. The genome of the extremely radiation resistant bacterium Deinococcus radiodurans contains genes for two SSB homologs: the homodimeric, canonical Ssb, encoded by the gene ssb, and a novel pentameric protein encoded by the gene ddrB. ddrB is highly induced upon exposure to radiation, and deletions result in decreased radiation-resistance, suggesting an integral role of the protein in the extreme resistance exhibited by this organism. Although expression of ssb is also induced after irradiation, Ssb is thought to be involved primarily in replication. In this study, we demonstrate that Ssb in D. radiodurans is essential for cell survival. The lethality of an ssb deletion cannot be complemented by providing ddrB in trans. In addition, the radiation-sensitive phenotype conferred by a ddrB deletion is not alleviated by providing ssb in trans. By altering expression of the ssb gene, we also show that lower levels of transcription are required for optimal growth than are necessary for high radiation resistance. When expression is reduced to that of E. coli, ionizing radiation resistance is similarly reduced. UV resistance is also decreased under low ssb transcript levels where growth is unimpaired. These results indicate that the expression of ssb is a key component of both normal cellular metabolism as well as pathways responsible for the high radiation tolerance of D. radiodurans.

  2. High-Speed On-Board Data Processing for Science Instruments (United States)

    Beyon, Jeffrey Y.; Ng, Tak-Kwong; Lin, Bing; Hu, Yongxiang; Harrison, Wallace


    A new development of on-board data processing platform has been in progress at NASA Langley Research Center since April, 2012, and the overall review of such work is presented in this paper. The project is called High-Speed On-Board Data Processing for Science Instruments (HOPS) and focuses on a high-speed scalable data processing platform for three particular National Research Council's Decadal Survey missions such as Active Sensing of CO2 Emissions over Nights, Days, and Seasons (ASCENDS), Aerosol-Cloud-Ecosystems (ACE), and Doppler Aerosol Wind Lidar (DAWN) 3-D Winds. HOPS utilizes advanced general purpose computing with Field Programmable Gate Array (FPGA) based algorithm implementation techniques. The significance of HOPS is to enable high speed on-board data processing for current and future science missions with its reconfigurable and scalable data processing platform. A single HOPS processing board is expected to provide approximately 66 times faster data processing speed for ASCENDS, more than 70% reduction in both power and weight, and about two orders of cost reduction compared to the state-of-the-art (SOA) on-board data processing system. Such benchmark predictions are based on the data when HOPS was originally proposed in August, 2011. The details of these improvement measures are also presented. The two facets of HOPS development are identifying the most computationally intensive algorithm segments of each mission and implementing them in a FPGA-based data processing board. A general introduction of such facets is also the purpose of this paper.

  3. Development and Evaluation of the Sugar-Sweetened Beverages Media Literacy (SSB-ML) Scale and Its Relationship With SSB Consumption


    Chen, Yvonnes; Porter, Kathleen J.; Estabrooks, Paul A.; Zoellner, Jamie


    Understanding how adults’ media literacy skill sets impact their sugar-sweetened beverage (SSB) intake provides insight into designing effective interventions to enhance their critical analysis of marketing messages and thus improve their healthy beverage choices. However, a media literacy scale focusing on SSBs is lacking. This cross-sectional study uses baseline data from a large randomized controlled trial to (a) describe the psychometric properties of an SSB Media Literacy Scale (SSB-ML) ...

  4. Spacecube: A Family of Reconfigurable Hybrid On-Board Science Data Processors (United States)

    Flatley, Thomas P.


    SpaceCube is a family of Field Programmable Gate Array (FPGA) based on-board science data processing systems developed at the NASA Goddard Space Flight Center (GSFC). The goal of the SpaceCube program is to provide 10x to 100x improvements in on-board computing power while lowering relative power consumption and cost. SpaceCube is based on the Xilinx Virtex family of FPGAs, which include processor, FPGA logic and digital signal processing (DSP) resources. These processing elements are leveraged to produce a hybrid science data processing platform that accelerates the execution of algorithms by distributing computational functions to the most suitable elements. This approach enables the implementation of complex on-board functions that were previously limited to ground based systems, such as on-board product generation, data reduction, calibration, classification, eventfeature detection, data mining and real-time autonomous operations. The system is fully reconfigurable in flight, including data parameters, software and FPGA logic, through either ground commanding or autonomously in response to detected eventsfeatures in the instrument data stream.

  5. A core hSSB1–INTS complex participates in the DNA damage response


    Zhang, Feng; Ma, Teng; Yu, Xiaochun


    Human single-stranded DNA-binding protein 1 (hSSB1) plays an important role in the DNA damage response and the maintenance of genomic stability. It has been shown that the core hSSB1 complex contains hSSB1, INTS3 and C9orf80. Using protein affinity purification, we have identified integrator complex subunit 6 (INTS6) as a major subunit of the core hSSB1 complex. INTS6 forms a stable complex with INTS3 and hSSB1 both in vitro and in vivo. In this complex, INTS6 directly interacts with INTS3. I...

  6. High-Speed On-Board Data Processing for Science Instruments: HOPS (United States)

    Beyon, Jeffrey


    The project called High-Speed On-Board Data Processing for Science Instruments (HOPS) has been funded by NASA Earth Science Technology Office (ESTO) Advanced Information Systems Technology (AIST) program during April, 2012 â€" April, 2015. HOPS is an enabler for science missions with extremely high data processing rates. In this three-year effort of HOPS, Active Sensing of CO2 Emissions over Nights, Days, and Seasons (ASCENDS) and 3-D Winds were of interest in particular. As for ASCENDS, HOPS replaces time domain data processing with frequency domain processing while making the real-time on-board data processing possible. As for 3-D Winds, HOPS offers real-time high-resolution wind profiling with 4,096-point fast Fourier transform (FFT). HOPS is adaptable with quick turn-around time. Since HOPS offers reusable user-friendly computational elements, its FPGA IP Core can be modified for a shorter development period if the algorithm changes. The FPGA and memory bandwidth of HOPS is 20 GB/sec while the typical maximum processor-to-SDRAM bandwidth of the commercial radiation tolerant high-end processors is about 130-150 MB/sec. The inter-board communication bandwidth of HOPS is 4 GB/sec while the effective processor-to-cPCI bandwidth of commercial radiation tolerant high-end boards is about 50-75 MB/sec. Also, HOPS offers VHDL cores for the easy and efficient implementation of ASCENDS and 3-D Winds, and other similar algorithms. A general overview of the 3-year development of HOPS is the goal of this presentation.

  7. Report of the Defense Science Board Task Force on Mission Impact of Foreign Influence on DoD Software

    National Research Council Canada - National Science Library


    The Defense Science Board (DSB) Task Force on Mission Impact of Foreign Influence on DoD Software examined areas in software security, security architecture, and risk mitigation and received briefings from industry, academia...

  8. Substitution of the burning PRIOR SSB 10 for SSB7 in the Furnace 10 of the Company Major Ernesto Che Guevara

    Directory of Open Access Journals (Sweden)

    Ivett María Ramírez-Pérez


    Full Text Available One of the fundamental causes of massive destruction of chambers and vaults in the Furnace of Reduction at the Ernesto Che Guevara Factory is due to operate the combustion chambers with excess of contribution of heat, causing that the flame of very high temperature penetrates into the homes, affecting the throats of the chambers, the vaults, teeth and arms. The burners current are Prior SSB10. In this paper is demonstrated that the burning Prior SSB 10 have double productivity that the SSB 7 with the same quantity of air to the burner. It is evaluated the substitution of the burning Prior SSB 10 by SSB 7 on the operation of the Furnace of Reduction No. 10 at the Ernesto Che Guevara (ECG Factory. Demonstrating that the change not produce variations in the operation.

  9. The Consensus Process at the Water Science and Technology Board, National Research Council (United States)

    Logan, W. S.


    Whereas the very birth of the U.S. Geological Survey arose from the recommendations of a National Academy of Sciences report, water science has not always had a prominent place at that institution. Prior to the 1980s, water issues were dealt with on an ad hoc basis by various boards related to science, engineering, and policy. With the birth of the Water Science and Technology Board (WSTB) in 1982, a diversity of water-related issues are now handled under one roof. The "business" of the WSTB is to produce consensus reports on a spectrum of topics in water science. Some of the projects that the WSTB works on are self-generated. The majority are generated either by Congress, or by government agencies. The WSTB takes on several different kinds of studies. Some of these are designed to advance the science of hydrology itself. This category would include the report Opportunities in the Hydrologic Sciences, which helped to establish hydrologic science as something separate from applied hydrology in Congress, the White House, and agencies such as NSF. However, the majority of the board's consensus studies involve hydrology in the interests of improving the natural and human environment. For example, Water for the Future: The West Bank and Gaza Strip, Israel, and Jordan outlined consensus principles backed by scientists from all of these entities for sustaining freshwater resources of the region. Closer to home, but no less controversial, a WSTB committee recently reached consensus on improving the process by which states determine which water bodies are polluted enough to require clean-up, and develop Total Maximum Daily Loads for these pollutants. Another committee recently sorted through the scientific bases for using natural attenuation for various contaminants in ground water and soil. And an ongoing committee is trying to help the South Florida scientific community to determine the best strategies for restoring the Everglades to some semblance of its former self

  10. Understanding bureaucracy in health science ethics: toward a better institutional review board. (United States)

    Bozeman, Barry; Slade, Catherine; Hirsch, Paul


    Research involving human participants continues to grow dramatically, fueled by advances in medical technology, globalization of research, and financial and professional incentives. This creates increasing opportunities for ethical errors with devastating effects. The typical professional and policy response to calamities involving human participants in research is to layer on more ethical guidelines or strictures. We used a recent case-the Johns Hopkins University/Kennedy Kreiger Institute Lead Paint Study-to examine lessons learned since the Tuskegee Syphilis Study about the role of institutionalized science ethics in the protection of human participants in research. We address the role of the institutional review board as the focal point for policy attention.

  11. Development and Evaluation of the Sugar-Sweetened Beverages Media Literacy (SSB-ML) Scale and Its Relationship With SSB Consumption (United States)

    Chen, Yvonnes; Porter, Kathleen J.; Estabrooks, Paul A.; Zoellner, Jamie


    Understanding how adults’ media literacy skill sets impact their sugar-sweetened beverage (SSB) intake provides insight into designing effective interventions to enhance their critical analysis of marketing messages and thus improve their healthy beverage choices. However, a media literacy scale focusing on SSBs is lacking. This cross-sectional study uses baseline data from a large randomized controlled trial to (a) describe the psychometric properties of an SSB Media Literacy Scale (SSB-ML) scale and its subdomains, (b) examine how the scale varies across demographic variables, and (c) explain the scale’s concurrent validity to predict SSB consumption. Results from 293 adults in rural southwestern Virginia (81.6% female, 94.0% White, 54.1% receiving SNAP and/or WIC benefits, average 410 SSB kcal daily) show that overall SSB-ML scale and its subdomains have strong internal consistencies (Cronbach’s alphas ranging from 0.65 to 0.83). The Representation & Reality domain significantly predicted SSB kilocalories, after controlling for demographic variables. This study has implications for the assessment and inclusion of context-specific media literacy skills in behavioral interventions. PMID:27690635

  12. Development and Evaluation of the Sugar-Sweetened Beverages Media Literacy (SSB-ML) Scale and Its Relationship With SSB Consumption. (United States)

    Chen, Yvonnes; Porter, Kathleen J; Estabrooks, Paul A; Zoellner, Jamie


    Understanding how adults' media literacy skill sets impact their sugar-sweetened beverage (SSB) intake provides insight into designing effective interventions to enhance their critical analysis of marketing messages and thus improve their healthy beverage choices. However, a media literacy scale focusing on SSBs is lacking. This cross-sectional study uses baseline data from a large randomized controlled trial to (a) describe the psychometric properties of an SSB Media Literacy Scale (SSB-ML) scale and its subdomains, (b) examine how the scale varies across demographic variables, and (c) explain the scale's concurrent validity to predict SSB consumption. Results from 293 adults in rural southwestern Virginia (81.6% female, 94.0% White, 54.1% receiving SNAP and/or WIC benefits, average 410 SSB kcal daily) show that overall SSB-ML scale and its subdomains have strong internal consistencies (Cronbach's alphas ranging from 0.65 to 0.83). The Representation & Reality domain significantly predicted SSB kilocalories, after controlling for demographic variables. This study has implications for the assessment and inclusion of context-specific media literacy skills in behavioral interventions.

  13. 77 FR 6795 - Notification of a Public Meeting of the Science Advisory Board (SAB) Animal Feeding Operations... (United States)


    ... ENVIRONMENTAL PROTECTION AGENCY [FRL-9629-4] Notification of a Public Meeting of the Science... Agency (EPA). ACTION: Notice. SUMMARY: The EPA Science Advisory Board (SAB) Staff Office announces a public meeting of the SAB Panel to conduct a peer review on the EPA documents, ``Draft--Development of...

  14. Effects of the ssb-1 and ssb-113 mutations on survival and DNA repair in UV-irradiated delta uvrB strains of Escherichia coli K-12.


    Wang, T C; Smith, K C


    The molecular defect in DNA repair caused by ssb mutations (single-strand binding protein) was studied by analyzing DNA synthesis and DNA double-strand break production in UV-irradiated Escherichia coli delta uvrB strains. The presence of the ssb-113 mutation produced a large inhibition of DNA synthesis and led to the formation of double-strand breaks, whereas the ssb-1 mutation produced much less inhibition of DNA synthesis and fewer double-strand breaks. We suggest that the single-strand bi...

  15. The Defense Science Board 2001 Summer Study on Defense Science and Technology (United States)


    HIT” The threat of biological weapons arises in part from a decades-old megatrend in the life sciences. New advances in molecular biology, genetics...99 The Technology Landscape Today.................................... 101 Biological Warfare Defense...planning and programming, today’s environment comprises a broader, more diffuse set of concerns: terrorism, biological warfare, regional tensions

  16. Real-Time On-Board Airborne Demonstration of High-Speed On-Board Data Processing for Science Instruments (HOPS) (United States)

    Beyon, Jeffrey Y.; Ng, Tak-Kwong; Davis, Mitchell J.; Adams, James K.; Bowen, Stephen C.; Fay, James J.; Hutchinson, Mark A.


    The project called High-Speed On-Board Data Processing for Science Instruments (HOPS) has been funded by NASA Earth Science Technology Office (ESTO) Advanced Information Systems Technology (AIST) program since April, 2012. The HOPS team recently completed two flight campaigns during the summer of 2014 on two different aircrafts with two different science instruments. The first flight campaign was in July, 2014 based at NASA Langley Research Center (LaRC) in Hampton, VA on the NASA's HU-25 aircraft. The science instrument that flew with HOPS was Active Sensing of CO2 Emissions over Nights, Days, and Seasons (ASCENDS) CarbonHawk Experiment Simulator (ACES) funded by NASA's Instrument Incubator Program (IIP). The second campaign was in August, 2014 based at NASA Armstrong Flight Research Center (AFRC) in Palmdale, CA on the NASA's DC-8 aircraft. HOPS flew with the Multifunctional Fiber Laser Lidar (MFLL) instrument developed by Excelis Inc. The goal of the campaigns was to perform an end-to-end demonstration of the capabilities of the HOPS prototype system (HOPS COTS) while running the most computationally intensive part of the ASCENDS algorithm real-time on-board. The comparison of the two flight campaigns and the results of the functionality tests of the HOPS COTS are presented in this paper.

  17. Ocean Science for Decision-Making: Current Activities of the National Research Council's Ocean Studies Board (United States)

    Roberts, S.; Glickson, D.; Mengelt, C.; Forrest, S.; Waddell, K.


    The National Research Council is a private, nonprofit organization chartered by Congress in 1916 as an expansion of the U.S. National Academy of Sciences. Its mission is to improve the use of science in government decision making and public policy, increase public understanding, and promote the acquisition and dissemination of knowledge in matters involving science, engineering, technology, and health. Within the National Research Council, the Ocean Studies Board (OSB) mission is to explore the science, policies, and infrastructure needed to understand, manage, and conserve coastal and marine environments and resources. OSB undertakes studies and workshops on emerging scientific and policy issues at the request of federal agencies, Congress, and others; provides program reviews and guidance; and facilitates communication on oceanographic issues among different sectors. OSB also serves as the U.S. National Committee to the international, nongovernmental Scientific Committee on Oceanic Research (SCOR). OSB has produced reports on a wide range of topics of interest to researchers and educators, the federal government, the non-profit sector, and industry. Recent reports have focused on ecosystem services in the Gulf of Mexico after the Deepwater Horizon oil spill, sea level rise on the U.S. west coast, scientific ocean drilling needs and accomplishments, requirements for sustained ocean color measurements, critical infrastructure for ocean research, tsunami warning and preparedness, ocean acidification, and marine and hydrokinetic power resource assessments. Studies that are currently underway include responding to oil spills in the Arctic, evaluating the effectiveness of fishery stock rebuilding plans, and reviewing the National Ocean Acidification Research Plan. OSB plays an important role in helping create policy decisions and disseminating important information regarding various aspects of ocean science.

  18. An Examination of Secondary School Students' Academic Achievement in Science Course and Achievement Scores in Performance Assignments with Regard to Different Variables: A Boarding School Example (United States)

    Bozdogan, Aykut Emre; Günaydin, Esra; Okur, Alperen


    The aim of the study is to explore the academic achievement and performance tasks of students studying in a regional primary boarding school in science course with regard to different variables. The study was carried out via survey method and total 96 students, 57 of them boarding students and 39 of them non-boarding students studying in the 5th,…

  19. Sailing for Science: on board experiences for transferring knowledge on Historical Oceanography for Future Innovation (United States)

    Garvani, Sara; Carmisciano, Cosmo; Locritani, Marina; Grossi, Luigi; Mori, Anna; Stroobant, Mascha; Schierano, Erika; De Strobel, Federico; Manzella, Giuseppe; Muzi, Enrico; Leccese, Dario; Sinapi, Luigi; Morellato, Claudio; La Tassa, Hebert; Talamoni, Roberta; Coelho, Emanuel; Nacini, Francesca


    culture witnesses, related to the naval history of seamanship from the origins up to nowadays), allowed the creation of a special educational format based on Historical Oceanography, for university and high school students as an integration for their curriculum. The Historical Oceanography Society has provided the major knowledges included in the ancient volumes of its archive, thanks to the availability of its members that also held theoretical and practical lessons during the course. The present paper will describe the one-week special course (about 60 hours of theory and practice with technical visits to Research centres and Museums) that has been planned to be carried out on board of the Italian Training Navy Ship (A. Vespucci) and has been organized in order to give the hints about on board life, as well as theoretical lessons on modern and historical oceanography, hands-on labs on oceanographic instruments from public and private collections, physiology of diving techniques and astronomy. The general aim of this course has been, hence, to give to excellent students all those technological but also creative and imaginative features of our past. References M. Locritani, I. Batzu, C. Carmisciano, F. Muccini, R. Talamoni, H.L. Tassa, M. Stroobant, G. Guccinelli, L. Benvenuti, M. Abbate, S. Furia, A. Benedetti, M.I. Bernardini, R. Centi, L. Casale, C. Vannucci, F. Giacomazzi, C. Marini, D. Tosi, S. Merlino, E. Mioni, F. Nacini, Feeling the pulse of public perception of science: Does research make our hearts beat faster?, in: MTS/IEEE OCEANS 2015 - Genova: Discovering Sustainable Ocean Energy for a New World, 2015. National Science Foundation, 50 Years of Ocean Discovery: National Science Foundation 1950-2000. Ocean Studies Board, National Research Council ISBN: 0-309-51744-3, 276 pages, 8.5 x 11, 2000. E.L. Mills, The Historian of Science and Oceanography After Twenty Years, Earth Sciences History. 12 (1993) 5-18. J.A. Bennett, History of Technology - McConnell Anita

  20. 77 FR 52025 - Notification of a Public Teleconference of the Science Advisory Board; Exposure and Human Health... (United States)


    ... Science Advisory Board; Exposure and Human Health Committee AGENCY: Environmental Protection Agency (EPA... Office announces a public teleconference of the SAB Exposure and Human Health Committee to discuss its... hereby given that the SAB Exposure and Human Health Committee (EHHC) will hold a public teleconference to...

  1. 75 FR 43944 - Defense Science Board; Task Force on Trends and Implications of Climate Change for National and... (United States)


    ... DEPARTMENT OF DEFENSE Office of the Secretary Defense Science Board; Task Force on Trends and Implications of Climate Change for National and International Security AGENCY: Department of Defense (DoD... and Implications of Climate Change for National and International Security will meet in closed session...

  2. 75 FR 34438 - Defense Science Board Task Force on Trends and Implications of Climate Change for National and... (United States)


    ... DEPARTMENT OF DEFENSE Office of the Secretary Defense Science Board Task Force on Trends and Implications of Climate Change for National and International Security AGENCY: Department of Defense (DoD... and Implications of Climate Change for National and International Security will meet in closed session...

  3. Preparing for Science at Sea - a Chief Scientists Training Cruise on Board the RV Sikuliaq (United States)

    Coakley, B.; Pockalny, R. A.


    As part of their education, marine geology and geophysics students spend time at sea, collecting, processing and interpreting data to earn their degrees. While this is a critical component of their preparation, it is an incomplete introduction to the process of doing science at sea. Most students are unfamiliar with the proposal process. Many students spend their time at sea performing assigned tasks without responsibility or participation in cruise planning and execution. In December 2016, we conducted a two-week-long, NSF-funded "Chief Scientist Training Cruise" aboard the R/V Sikuliaq designed to complete their introduction to seagoing science by giving the students the opportunity to plan and execute surveys based hypotheses they formulated. The educational process began with applicants responding to a request for proposals (RFP), which provided a framework for the scientific potential of the cruise. This process continued training through two days of workshops and presentations at the Hawai'i Institute of Geophysics. The students used existing data to define hypotheses, plan surveys, and collect/analyze data to test their hypothesis. The survey design was subject to the time constraints imposed by the ship schedule and the physical constraints imposed by the ship's equipment. The training and sea time made it possible to address all of steps of the scientific process, including proposal writing. Once underway, the combination of conducting the planned surveys and attending daily presentations helped familiarize the students with at-sea operations, the equipment on board the RV Sikuliaq, and the process of writing proposals to NSF for sea-going science. Questionnaires conducted prior to the cruise and in the final days before arriving in port document the success of this training program for developing the abilities and confidence in identifying significant scientific problems, preparing proposals to secure funding, and planning and directing ship surveys.

  4. The Reg1-interacting proteins, Bmh1, Bmh2, Ssb1, and Ssb2, have roles in maintaining glucose repression in Saccharomyces cerevisiae. (United States)

    Dombek, Kenneth M; Kacherovsky, Nataly; Young, Elton T


    In Saccharomyces cerevisiae, a type 1 protein phosphatase complex composed of the Glc7 catalytic subunit and the Reg1 regulatory subunit represses expression of many glucose-regulated genes. Here we show that the Reg1-interacting proteins Bmh1, Bmh2, Ssb1, and Ssb2 have roles in glucose repression. Deleting both BMH genes causes partially constitutive ADH2 expression without significantly increasing the level of Adr1 protein, the major activator of ADH2 expression. Adr1 and Bcy1, the regulatory subunit of cAMP-dependent protein kinase, are both required for this effect indicating that constitutive expression in Deltabmh1Deltabmh2 cells uses the same activation pathway that operates in Deltareg1 cells. Deletion of both BMH genes and REG1 causes a synergistic relief from repression, suggesting that Bmh proteins also act independently of Reg1 during glucose repression. A two-hybrid interaction with the Bmh proteins was mapped to amino acids 187-232, a region of Reg1 that is conserved in different classes of fungi. Deleting this region partially releases SUC2 from glucose repression. This indicates a role for the Reg1-Bmh interaction in glucose repression and also suggests a broad role for Bmh proteins in this process. An in vivo Reg1-Bmh interaction was confirmed by copurification of Bmh proteins with HA(3)-TAP-tagged Reg1. The nonconventional heat shock proteins Ssb1 and Ssb2 are also copurified with HA(3)-TAP-tagged Reg1. Deletion of both SSB genes modestly decreases repression of ADH2 expression in the presence of glucose, suggesting that Ssb proteins, perhaps through their interaction with Reg1, play a minor role in glucose repression.

  5. Modulation of intracellular protein degradation by SSB1-SIS1 chaperon system in yeast S. cerevisiae. (United States)

    Ohba, M


    In prokaryotes, DnaK-DnaJ chaperon is involved in the protein degradation catalyzed by proteases La and ClpA/B complex as shown in E. coli. To extend this into eukaryotic cells, we examined the effects of hsp70 genes, SSA1 and SSB1, and DnaJ genes, SIS1 and YDJ1, on the growth of proteasome subunit mutants of the yeast S. cerevisiae. The results identified SSB1 and SIS1 as a pair of chaperon genes specifically involved in efficient protein turnover in the yeast, whose overexpression suppressed the growth defects caused by the proteasome mutations. Moreover, a single amino acid substitution in the putative peptide-binding site of SSB1 protein profoundly enhanced the suppression activity, indicating that the activity is mediated by the peptide-binding activity of this chaperon. Thus SSB1, with its partner DnaJ, SIS1, modulates the efficiency of protein turnover through its chaperon activity.

  6. Support for the Core Research Activities and Studies of the Computer Science and Telecommunications Board (CSTB)

    Energy Technology Data Exchange (ETDEWEB)

    Jon Eisenberg, Director, CSTB


    The Computer Science and Telecommunications Board of the National Research Council considers technical and policy issues pertaining to computer science (CS), telecommunications, and information technology (IT). The functions of the board include: (1) monitoring and promoting the health of the CS, IT, and telecommunications fields, including attention as appropriate to issues of human resources and funding levels and program structures for research; (2) initiating studies involving CS, IT, and telecommunications as critical resources and sources of national economic strength; (3) responding to requests from the government, non-profit organizations, and private industry for expert advice on CS, IT, and telecommunications issues; and to requests from the government for expert advice on computer and telecommunications systems planning, utilization, and modernization; (4) fostering interaction among CS, IT, and telecommunications researchers and practitioners, and with other disciplines; and providing a base of expertise in the National Research Council in the areas of CS, IT, and telecommunications. This award has supported the overall operation of CSTB. Reports resulting from the Board's efforts have been widely disseminated in both electronic and print form, and all CSTB reports are available at its World Wide Web home page at The following reports, resulting from projects that were separately funded by a wide array of sponsors, were completed and released during the award period: 2007: * Summary of a Workshop on Software-Intensive Systems and Uncertainty at Scale * Social Security Administration Electronic Service Provision: A Strategic Assessment * Toward a Safer and More Secure Cyberspace * Software for Dependable Systems: Sufficient Evidence? * Engaging Privacy and Information Technology in a Digital Age * Improving Disaster Management: The Role of IT in Mitigation, Preparedness, Response, and Recovery 2006: * Renewing U.S. Telecommunications

  7. Influence of subject matter discipline and science content knowledge on National Board Certified science teachers' conceptions, enactment, and goals for inquiry (United States)

    Breslyn, Wayne Gene

    The present study investigated differences in the continuing development of National Board Certified Science Teachers' (NBCSTs) conceptions of inquiry across the disciplines of biology, chemistry, earth science, and physics. The central research question of the study was, "How does a NBCST's science discipline (biology, chemistry, earth science, or physics) influence their conceptions, enactment, and goals for inquiry-based teaching and learning?" A mixed methods approach was used that included an analysis of the National Board portfolio entry, Active Scientific Inquiry, for participants (n=48) achieving certification in the 2007 cohort. The portfolio entry provided detailed documentation of teachers' goals and enactment of an inquiry lesson taught in their classroom. Based on the results from portfolio analysis, participant interviews were conducted with science teachers (n=12) from the 2008 NBCST cohort who represented the science disciplines of biology, chemistry, earth science, and physics. The interviews provided a broader range of contexts to explore teachers' conceptions, enactment, and goals of inquiry. Other factors studied were disciplinary differences in NBCSTs' views of the nature of science, the relation between their science content knowledge and use of inquiry, and changes in their conceptions of inquiry as result of the NB certification process. Findings, based on a situated cognitive framework, suggested that differences exist between biology, chemistry, and earth science teachers' conceptions, enactment, and goals for inquiry. Further, individuals teaching in more than one discipline often held different conceptions of inquiry depending on the discipline in which they were teaching. Implications for the research community include being aware of disciplinary differences in studies on inquiry and exercising caution in generalizing findings across disciplines. In addition, teachers who teach in more than one discipline can highlight the contextual

  8. 77 FR 17475 - Notification of Public Teleconferences of the Science Advisory Board; Environmental Economics... (United States)


    ... Advisory Board; Environmental Economics Advisory Committee AGENCY: Environmental Protection Agency (EPA... Office announces public teleconferences of the SAB Environmental Economics Advisory Committee to conduct... Economics Advisory Committee (EEAC) will hold a public teleconferences to review the EPA draft report...

  9. Evaluation of Board Performance in Iran’s Universities of Medical Sciences

    Directory of Open Access Journals (Sweden)

    Haniye Sajadi


    Full Text Available Background The critical role that the board plays in governance of universities clarifies the necessity of evaluating its performance. This study was aimed to evaluate the performance of the boards of medical universities and provide solutions to enhance its performance. Methods The first phase of present study was a qualitative research in which data were collected through face-to-face semi-structured interviews. Data were analyzed by thematic approach. The second phase was a mixed qualitative and quantitative study, with quantitative part in cross-sectional format and qualitative part in content analysis format. In the quantitative part, data were collected through Ministry of Health and Medical Education (MoHME. In the qualitative part, the content of 2,148 resolutions that were selected by using stratified sampling method were analyzed. Results Participants believed that the boards had no acceptable performance for a long time. Results also indicated the increasing number of meetings and resolutions of the boards in these 21 years. The boards’ resolutions were mostly operational in domain and administrative in nature. The share of specific resolutions was more than the general ones. Conclusion Given the current pace of change and development and the need to timely respond them, it is recommended to accelerate the slow pace of improvement process of the boards. It appears that more delegation and strengthening the position of the boards are the effective strategies to speed up this process.

  10. Saccharomyces cerevisiae SSB1 protein and its relationship to nucleolar RNA-binding proteins. (United States)

    Jong, A Y; Clark, M W; Gilbert, M; Oehm, A; Campbell, J L


    To better define the function of Saccharomyces cerevisiae SSB1, an abundant single-stranded nucleic acid-binding protein, we determined the nucleotide sequence of the SSB1 gene and compared it with those of other proteins of known function. The amino acid sequence contains 293 amino acid residues and has an Mr of 32,853. There are several stretches of sequence characteristic of other eucaryotic single-stranded nucleic acid-binding proteins. At the amino terminus, residues 39 to 54 are highly homologous to a peptide in calf thymus UP1 and UP2 and a human heterogeneous nuclear ribonucleoprotein. Residues 125 to 162 constitute a fivefold tandem repeat of the sequence RGGFRG, the composition of which suggests a nucleic acid-binding site. Near the C terminus, residues 233 to 245 are homologous to several RNA-binding proteins. Of 18 C-terminal residues, 10 are acidic, a characteristic of the procaryotic single-stranded DNA-binding proteins and eucaryotic DNA- and RNA-binding proteins. In addition, examination of the subcellular distribution of SSB1 by immunofluorescence microscopy indicated that SSB1 is a nuclear protein, predominantly located in the nucleolus. Sequence homologies and the nucleolar localization make it likely that SSB1 functions in RNA metabolism in vivo, although an additional role in DNA metabolism cannot be excluded.

  11. Improvement of lactic acid production in Saccharomyces cerevisiae by a deletion of ssb1. (United States)

    Lee, Jinsuk J; Crook, Nathan; Sun, Jie; Alper, Hal S


    Polylactic acid (PLA) is an important renewable polymer, but current processes for producing its precursor, lactic acid, suffer from process inefficiencies related to the use of bacterial hosts. Therefore, improving the capacity of Saccharomyces cerevisiae to produce lactic acid is a promising approach to improve industrial production of lactic acid. As one such improvement required, the lactic acid tolerance of yeast must be significantly increased. To enable improved tolerance, we employed an RNAi-mediated genome-wide expression knockdown approach as a means to rapidly identify potential genetic targets. In this approach, several gene knockdown targets were identified which confer increased acid tolerance to S. cerevisiae BY4741, of which knockdown of the ribosome-associated chaperone SSB1 conferred the highest increase (52%). This target was then transferred into a lactic acid-overproducing strain of S. cerevisiae CEN.PK in the form of a knockout and the resulting strain demonstrated up to 33% increased cell growth, 58% increased glucose consumption, and 60% increased L-lactic acid production. As SSB1 contains a close functional homolog SSB2 in yeast, this result was counterintuitive and may point to as-yet-undefined functional differences between SSB1 and SSB2 related to lactic acid production. The final strain produced over 50 g/L of lactic acid in under 60 h of fermentation.

  12. Molecular cloning of a Candida albicans gene (SSB1) coding for a protein related to the Hsp70 family. (United States)

    Maneu, V; Cervera, A M; Martinez, J P; Gozalbo, D


    We have cloned and sequenced a Candida albicans gene (SSB1) encoding a potential member of the heat-shock protein seventy (hsp70) family. The protein encoded by this gene contains 613 amino acids and shows a high degree (85%) of sequence identity to the ssb subfamily (ssb1 and ssb2) of the Saccharomyces cerevisiae hsp70 family. The transcribed mRNA (2.1 kb) is present in similar amounts both in yeast and germ tube cells of C. albicans.

  13. Application of the SSB biosensor to study in vitro transcription. (United States)

    Cook, Alexander; Hari-Gupta, Yukti; Toseland, Christopher P


    Gene expression, catalysed by RNA polymerases (RNAP), is one of the most fundamental processes in living cells. The majority of methods to quantify mRNA are based upon purification of the nucleic acid which leads to experimental inaccuracies and loss of product, or use of high cost dyes and sensitive spectrophotometers. Here, we describe the use of a fluorescent biosensor based upon the single stranded binding (SSB) protein. In this study, the SSB biosensor showed similar binding properties to mRNA, to that of its native substrate, single-stranded DNA (ssDNA). We found the biosensor to be reproducible with no associated loss of product through purification, or the requirement for expensive dyes. Therefore, we propose that the SSB biosensor is a useful tool for comparative measurement of mRNA yield following in vitro transcription. Copyright © 2018 The Authors. Published by Elsevier Inc. All rights reserved.

  14. Saccharomyces cerevisiae SSB1 protein and its relationship to nucleolar RNA-binding proteins.


    Jong, A Y; Clark, M W; Gilbert, M; Oehm, A; Campbell, J L


    To better define the function of Saccharomyces cerevisiae SSB1, an abundant single-stranded nucleic acid-binding protein, we determined the nucleotide sequence of the SSB1 gene and compared it with those of other proteins of known function. The amino acid sequence contains 293 amino acid residues and has an Mr of 32,853. There are several stretches of sequence characteristic of other eucaryotic single-stranded nucleic acid-binding proteins. At the amino terminus, residues 39 to 54 are highly ...

  15. hSSB1 regulates both the stability and the transcriptional activity of p53


    Xu, Shuangbing; Wu, Yuanzhong; Chen, Qiong; Cao, Jingying; Hu, Kaishun; Tang, Jianjun; Sang, Yi; Lai, Fenju; Wang, Li; Zhang, Ruhua; Li, Sheng-Ping; Zeng, Yi-Xin; Yin, Yuxin; Kang, Tiebang


    The tumor suppressor p53 is essential for several cellular processes that are involved in the response to diverse genotoxic stress, including cell cycle arrest, DNA repair, apoptosis and senescence. Studies of the regulation of p53 have mostly focused on its stability and transactivation; however, new regulatory molecules for p53 have also been frequently identified. Here, we report that human ssDNA binding protein SSB1 (hSSB1), a novel DNA damage-associated protein, can interact with p53 and...

  16. Suppression of the Escherichia coli ssb-1 mutation by an allele of groEL.


    Ruben, S M; VanDenBrink-Webb, S E; Rein, D C; Meyer, R R


    A series of spontaneous suppressors to the temperature-sensitive phenotype of the single-stranded DNA-binding protein mutation ssb-1 were isolated. A genomic library of EcoRI fragments from one of these suppressor strains was prepared by using pBR325 as the cloning vector. A 10.0-kilobase class of inserts was identified as carrying the ssb-1 gene itself. A second class of 8.3-kilobase inserts was shown to contain the groE region by (i) restriction analysis, (ii) Southern hybridization of the ...

  17. hSSB1 (NABP2/OBFC2B) is regulated by oxidative stress


    Nicolas Paquet; Mark N. Adams; Nicholas W. Ashton; Christine Touma; Roland Gamsjaeger; Liza Cubeddu; Vincent Leong; Sam Beard; Emma Bolderson; Catherine H. Botting; Kenneth J. O’Byrne; Derek J. Richard


    The maintenance of genome stability is an essential cellular process to prevent the development of diseases including cancer. hSSB1 (NABP2/ OBFC2A) is a critical component of the DNA damage response where it participates in the repair of double-strand DNA breaks and in base excision repair of oxidized guanine residues (8-oxoguanine) by aiding the localization of the human 8-oxoguanine glycosylase (hOGG1) to damaged DNA. Here we demonstrate that following oxidative stress, hSSB1 is stabilized ...

  18. A polarization-division multiplexing SSB-OFDM system with beat interference cancellation receivers (United States)

    Yang, Peiling; Ma, Jianxin; Zhang, Junyi


    In this paper, we have proposed a polarization-division multiplexing (PDM) single-sideband optical orthogonal frequency division multiplexing (SSB-OOFDM) scheme with signal-signal beat interference cancellation receivers with balanced detection (ICRBD). This system can double channel capacity and improve spectrum efficiency (SE) with the reduced guard band (GB) due to the PDM. Multiple input multiple output (MIMO) technique is used to solve polarization mode dispersion (PMD) associated with channel estimation and equalization. By simulation, we demonstrate the efficacy of the proposed technique for a 2 ×40 Gbit/s 16-QAM SSB-PDM-OOFDM system according to the error vector magnitude (EVM) and the constellation diagrams.

  19. 75 FR 71694 - Science Advisory Board Staff Office; Notification of Two Public Quality Review Teleconferences of... (United States)


    ... teleconference, to give EPA as much time as possible to process your request. Dated: November 16, 2010. Anthony... Board can be found on the SAB Web site at . SUPPLEMENTARY INFORMATION: Pursuant... advisory activity can be found on the SAB Web site at:

  20. 76 FR 80368 - Notification of Teleconferences of the Science Advisory Board Biogenic Carbon Emissions Panel (United States)


    ... Advisory Board Biogenic Carbon Emissions Panel AGENCY: Environmental Protection Agency (EPA). ACTION... Office announces two teleconferences of the SAB Biogenic Carbon Emissions Panel to review EPA's draft... policy, notice is hereby given that the SAB Biogenic Carbon Emissions Panel will hold two public...

  1. 77 FR 38802 - Notification of Closed Meeting of the Science Advisory Board's Scientific and Technological... (United States)


    ... ENVIRONMENTAL PROTECTION AGENCY [FRL-9695-3] Notification of Closed Meeting of the Science... Agency (EPA). ACTION: Notice. SUMMARY: The U.S. Environmental Protection Agency's (EPA), Science Advisory...) 564-2134 or email at [email protected] . The SAB Mailing address is: U.S. EPA Science Advisory...

  2. 78 FR 59018 - Notification of a Closed Meeting of the Science Advisory Board's Scientific and Technological... (United States)


    ... ENVIRONMENTAL PROTECTION AGENCY [FRL-9901-32-OA] Notification of a Closed Meeting of the Science... Agency (EPA). ACTION: Notice. SUMMARY: The U.S. Environmental Protection Agency's (EPA), Science Advisory... contributions in the advancement of science and technology through their research and development activities, as...

  3. Roles of Bacillus subtilis DprA and SsbA in RecA-mediated genetic recombination. (United States)

    Yadav, Tribhuwan; Carrasco, Begoña; Serrano, Ester; Alonso, Juan C


    Bacillus subtilis competence-induced RecA, SsbA, SsbB, and DprA are required to internalize and to recombine single-stranded (ss) DNA with homologous resident duplex. RecA, in the ATP · Mg(2+)-bound form (RecA · ATP), can nucleate and form filament onto ssDNA but is inactive to catalyze DNA recombination. We report that SsbA or SsbB bound to ssDNA blocks the RecA filament formation and fails to activate recombination. DprA facilitates RecA filamentation; however, the filaments cannot engage in DNA recombination. When ssDNA was preincubated with SsbA, but not SsbB, DprA was able to activate DNA strand exchange dependent on RecA · ATP. This work demonstrates that RecA · ATP, in concert with SsbA and DprA, catalyzes DNA strand exchange, and SsbB is an accessory factor in the reaction. In contrast, RecA · dATP efficiently catalyzes strand exchange even in the absence of single-stranded binding proteins or DprA, and addition of the accessory factors marginally improved it. We proposed that the RecA-bound nucleotide (ATP and to a lesser extent dATP) might dictate the requirement for accessory factors. © 2014 by The American Society for Biochemistry and Molecular Biology, Inc.

  4. Society Influencing Science: The role of the Transdisciplinary Advisory Board (TAB) of the European Joint Programming Initiative on Climate. (United States)

    Noone, K. J.; Manderscheid, P.; Monfray, P.


    It is becoming increasingly apparent that the separation between science and the rest of society is not helping us find solutions to "wicked" problems like climate change or achieving the Sustainable Development Goals. It is clear that a broader approach to research is necessary - one that includes stakeholders in the research process itself. What is unclear is how best to do this. The Transdisciplinary Advisory Board (TAB) of the European Joint Programming Initiative on Climate (JPI Climate) is an example of scientists and stakeholders working together to frame climate research and move the results of scientific research into decision support. JPI Climate is a consortium of 12 European countries (with partners from nine more countries) and is a major funding channel and forum for climate research in Europe. The TAB has an equal number of stakeholders and researchers from 10 different European countries, has an even gender balance, and its members have widely differing backgrounds. The TAB provides input and advice to the governing board of JPI Climate, and influences both the strategic planning for this funding initiative as well as specific calls for proposals issued through the consortium. In addition to its advisory role, the TAB explores the transdisciplinary process itself, expanding the boundaries of how stakeholders and science can interact positively. The TAB is a two-way mechanism through which stakeholders can help improve research and science can help improve society. We will give examples of the spectrum of how the TAB provides mutual influence between stakeholders and science - from helping to draft 10-year research strategies to helping advance the uptake of climate research into the private and policy sectors.

  5. Smart sustainable bottle (SSB) system for E. coli based recombinant protein production. (United States)

    Li, Zhaopeng; Carstensen, Bettina; Rinas, Ursula


    Recombinant proteins are usually required in laboratories interested in the protein but not in the production process itself. Thus, technical equipment which is easy to handle and straight forward protein production procedures are of great benefit to those laboratories. Companies selling single use cultivation bags and bioreactors are trying to satisfy at least part of these needs. However, single-use systems can contribute to major costs which might be acceptable when "good manufacturing practices" are required but not acceptable for most laboratories facing tight funding. The assembly and application of a simple self-made "smart sustainable bottle" (SSB) system for E. coli based protein production is presented. The core of the SSB system is a 2-L glass bottle which is operated at constant temperature, air flow, and stirrer speed without measurement and control of pH and dissolved oxygen. Oxygen transfer capacities are in the range as in conventional bioreactors operated at intermediate aeration rates and by far exceed those found in conventional shaking flasks and disposable bioreactors. The SSB system was applied for the production of various recombinant proteins using T7-based expression systems and a defined autoinduction medium. The production performance regarding amount and solubility of proteins with robust and delicate properties was as good as in state-of-the-art stirred tank commercial bioreactors. The SSB system represents a low cost protein production device applicable for easy, effective, and reproducible recombinant protein production.

  6. 76 FR 59388 - Board of Regents of the Uniformed Services University of the Health Sciences (United States)


    ... University of the Health Sciences AGENCY: Department of Defense, Uniformed Services University of the Health... Uniformed Services University of the Health Sciences. DATES: Tuesday, October 25, 2011, from 8:30 a.m. to 11... FURTHER INFORMATION CONTACT: Janet S. Taylor, Designated Federal Officer, 4301 Jones Bridge Road, Bethesda...

  7. 77 FR 32999 - Meeting of the Office of Justice Programs' Science Advisory Board (United States)


    ...); Bureau of Justice Statistics (BJS); Office of Juvenile Justice and Delinquency Prevention (OJJDP); Bureau... Department of Justice, with valuable advice in the areas of science and statistics for the purpose of...

  8. 78 FR 77168 - Meeting of the Office of Justice Programs' Science Advisory Board (United States)


    ...); Bureau of Justice Statistics (BJS); Office of Juvenile Justice and Delinquency Prevention (OJJDP); Bureau... Department of Justice, with valuable advice in the areas of science and statistics for the purpose of...

  9. 77 FR 73497 - Meeting of the Office of Justice Programs' Science Advisory Board (United States)


    ...); Bureau of Justice Statistics (BJS); Office of Juvenile Justice and Delinquency Prevention (OJJDP); Bureau... Department of Justice, with valuable advice in the areas of science and statistics for the purpose of...

  10. 76 FR 79220 - Meeting of the Office of Justice Programs' Science Advisory Board; Meeting (United States)


    ... Justice (NIJ); Bureau of Justice Statistics (BJS); Office of Juvenile Justice and Delinquency Prevention... component of the Department of Justice, with valuable advice in the areas of science and statistics for the...

  11. 76 FR 31991 - Meeting of the Office of Justice Programs' Science Advisory Board (United States)


    ...); Bureau of Justice Statistics (BJS); Office of Juvenile Justice and Delinquency Prevention (OJJDP... Department of Justice, with valuable advice in the areas of science and statistics for the purpose of...

  12. 75 FR 22790 - Science Advisory Board Staff Office; Request for Nominations of Candidates for EPA's Advisory... (United States)


    ... modeling; atmospheric science and engineering; ecology and ecological risk assessment; epidemiology... assessment; environmental modeling; industrial ecology; environmental engineering; environmental medicine... ``Ethics Requirements for Advisors'' link on the blue navigational bar on the SAB Web site at http://www...

  13. 78 FR 9689 - Notification of a Public Meeting of the Chartered Science Advisory Board (United States)


    ... advances in molecular biology, chemistry and innovative computer science to more effectively and... help identify reasons for any systematic differences between ex ante and ex post cost estimates. The...

  14. 78 FR 77687 - Science Advisory Board to the National Center for Toxicological Research; Notice of Meeting (United States)


    ... year. The SAB will be presented with an overview of the Division of Microbiology Subcommittee and the... National Toxicology Program of the National Institutes of Environmental Health Sciences on current and...

  15. 75 FR 22756 - Federal Advisory Committee; United States Army Science Board; Charter Renewal (United States)


    ... relating to the Army's scientific, technical, manufacturing, acquisition, logistics, and business... the following disciplines: Science, technology, manufacturing, acquisition, logistics, business...; the Assistant Secretary of the Army for Acquisition, Logistics and Technology; and as requested, other...

  16. Partial Support of Meeting of the Board on Mathematical Sciences and Their Applications

    Energy Technology Data Exchange (ETDEWEB)

    Weidman, Scott [National Academy of Sciences, Washington DC (United States)


    During the performance period, BMSA released the following major reports: Transforming Combustion Research through Cyberinfrastructure (2011); Assessing the Reliability of Complex Models: Mathematical and Statistical Foundations of Verification, Validation, and Uncertainty Quantification (2012); Fueling Innovation and Discovery: The Mathematical Sciences in the 21st Century (2012); Aging and the Macroeconomy: Long-Term Implications of an Older Population (2012); The Mathematical Sciences in 2025 (2013); Frontiers in Massive Data Analysis (2013); and Developing a 21st Century Global Library for Mathematics Research (2014).

  17. Oceans and Human Health (OHH): a European perspective from the Marine Board of the European Science Foundation (Marine Board-ESF). (United States)

    Moore, Michael N; Depledge, Michael H; Fleming, Lora; Hess, Philipp; Lees, David; Leonard, Paul; Madsen, Lise; Owen, Richard; Pirlet, Hans; Seys, Jan; Vasconcelos, Vitor; Viarengo, Aldo


    will impact adversely on efforts to alleviate poverty, sustain the availability of environmental goods and services and improve health and social and economic stability; and thus, will impinge on many policy decisions, both nationally and internationally. Knowledge exchange (KE) will be a key element of any ensuing research. KE will facilitate the integration of biological, medical, epidemiological, social and economic disciplines, as well as the emergence of synergies between seemingly unconnected areas of science and socio-economic issues, and will help to leverage knowledge transfer across the European Union (EU) and beyond. An integrated interdisciplinary systems approach is an effective way to bring together the appropriate groups of scientists, social scientists, economists, industry and other stakeholders with the policy formulators in order to address the complexities of interfacial problems in the area of environment and human health. The Marine Board of the European Science Foundation Working Group on "Oceans and Human Health" has been charged with developing a position paper on this topic with a view to identifying the scientific, social and economic challenges and making recommendations to the EU on policy-relevant research and development activities in this arena. This paper includes the background to health-related issues linked to the coastal environment and highlights the main arguments for an ecosystem-based whole systems approach.

  18. High school science teacher perceptions of the science proficiency testing as mandated by the State of Ohio Board of Education (United States)

    Jeffery, Samuel Shird

    There is a correlation between the socioeconomic status of secondary schools and scores on the State of Ohio's mandated secondary science proficiency tests. In low scoring schools many reasons effectively explain the low test scores as a result of the low socioeconomics. For example, one reason may be that many students are working late hours after school to help with family finances; parents may simply be too busy providing family income to realize the consequences of the testing program. There are many other personal issues students face that may cause them to score poorly an the test. The perceptions of their teachers regarding the science proficiency test program may be one significant factor. These teacher perceptions are the topic of this study. Two sample groups ware established for this study. One group was science teachers from secondary schools scoring 85% or higher on the 12th grade proficiency test in the academic year 1998--1999. The other group consisted of science teachers from secondary schools scoring 35% or less in the same academic year. Each group of teachers responded to a survey instrument that listed several items used to determine teachers' perceptions of the secondary science proficiency test. A significant difference in the teacher' perceptions existed between the two groups. Some of the ranked items on the form include teachers' opinions of: (1) Teaching to the tests; (2) School administrators' priority placed on improving average test scores; (3) Teacher incentive for improving average test scores; (4) Teacher teaching style change as a result of the testing mandate; (5) Teacher knowledge of State curriculum model; (6) Student stress as a result of the high-stakes test; (7) Test cultural bias; (8) The tests in general.

  19. In regard to the change of the editorial board and the advisory board of the Bosnian Journal of Basic Medical Sciences

    Directory of Open Access Journals (Sweden)

    Bakir Mehić


    Full Text Available The most vital part of a scientific journal is the Editorial board and Advisory board. So, it is never good that the composition of these boards lasts longer than 2-3 years.With the first number of BJBMS in 2014, a new composition of the Editorial board and Advisory Board of this journal was published. They consist of eminent scientists with adequate qualifications from nine countries and who can actively contribute to the good management of the journal and its further development. Their tasks will be: -Supporting and promotion of the journal (being true ambassadors of the journal,-Writing editorials, reviews and commentaries on works from the field of their expertise,-Giving opinions and suggestions on the management and policy of the journal, with the timely identification of the upcoming challenges. Commitment to upholding the ethics of publishing with impartiality and confidentiality, the fight against plagiarism and multiple or simultaneous publication of articles will remain a priority in the work of the Editorial Board and Advisory Board of BJBMS. Also, the newly appointed boards will continue to work in the way of protection of copyright for authors who were victims of plagiarism. In this sense, the editor in chief, together with the Editorial Board will take measures in accordance with the guidelines of the Committee for Ethics in publishing [1].Quality assurance in publishing and also in BJBMS is focused on the detection of forged data, images, and plagiarized articles. In its future work Editorial Board of BJBMS is obliged to pay attention to supporting academic integrity, ensuring the integrity of academic records and intellectual property. This latter implies: -Request for evidence of ethics for the approved research, that is, authors will be asked to prove that they obtained the consent of the patient for the study or in the case of experiments on animals, which methods were used so the animals would not suffer?-Ensuring that

  20. 78 FR 55064 - Solicitation for Members of the NOAA Science Advisory Board (SAB) Gulf Coast Ecosystem... (United States)


    .../index.html . Dated: September 3, 2013. Jason Donaldson, Chief Financial Officer/Chief Administrative Officer, Office of Oceanic and Atmospheric Research, National Oceanic and Atmospheric Administration... Act Science Program's roles within the context of NOAA's ocean missions and policies. They should be...

  1. 78 FR 57177 - Meeting of the Office of Justice Programs' Science Advisory Board (United States)


    ... advice in the areas of science and statistics for the purpose of enhancing the overall impact and... designated six (6) subcommittees: National Institute of Justice (NIJ); Bureau of Justice Statistics (BJS); Office of Juvenile Justice and Delinquency Prevention (OJJDP); Bureau of Justice Assistance; Quality and...

  2. 77 FR 12579 - Notification of a Public Meeting of the Chartered Science Advisory Board (United States)


    ... budget for EPA research and a draft report on science integration at EPA; to plan for a joint meeting of...). ADDRESSES: The meeting will be held at The Washington Plaza Hotel, 10 Thomas Circle NW., Washington, DC. FOR... Requested FY 2013 Research Budget for EPA The chartered SAB will conduct a quality review of an SAB draft...

  3. 75 FR 65528 - Membership of National Science Foundation's Senior Executive Service Performance Review Board (United States)


    ... Director, Division of Human Resource Management and Chief Human Capital Officer, National Science..., Division of Human Resource Management and Chief Human Capital Officer; Mark L. Weiss, Director, Division of... Human Resource Management and Chief Human Capital Officer. [FR Doc. 2010-26763 Filed 10-22-10; 8:45 am...

  4. 77 FR 12331 - Membership of National Science Foundation's Senior Executive Service Performance Review Board (United States)


    ... Director, Division of Human Resource Management, National Science Foundation, Room 315, 4201 Wilson... Resource Management and Chief Human Capital Officer. Deborah F. Lockhart, Deputy Director, Division of.... Sunley, Director, Division of Human Resource Management and PRB Executive Secretary. Dated: February 21...

  5. hSSB1 associates with and promotes stability of the BLM helicase




    Background Maintenance of genome stability is critical in human cells. Mutations in or loss of genome stability pathways can lead to a number of pathologies including cancer. hSSB1 is a critical DNA repair protein functioning in the repair and signalling of stalled DNA replication forks, double strand DNA breaks and oxidised DNA lesions. The BLM helicase is central to the repair of both collapsed DNA replication forks and double strand DNA breaks by homologous recombination. Results In this s...

  6. Report of the First Meeting of the Governing Board, SEAMEO Regional Centre for Education in Science and Mathematics (Penang, Malaysia, October 8-12, 1970). Final Report. (United States)

    Southeast Asian Ministers of Education Organization (Singapore). Regional Center for Education in Science and Mathematics.

    This report details the proceedings of the first meeting of the Governing Board of the SEAMEO Regional Centre for Education in Science and Mathematics held in Penang, Malaysia from October 8-12, 1970. Procedural matters detailed in the report include: (1) the election of officers; (2) the acceptance of the annual report of the events and…

  7. COMPASS, the COMmunity Petascale project for Accelerator Science and Simulation, a board computational accelerator physics initiative

    International Nuclear Information System (INIS)

    Cary, J.R.; Spentzouris, P.; Amundson, J.; McInnes, L.; Borland, M.; Mustapha, B.; Ostroumov, P.; Wang, Y.; Fischer, W.; Fedotov, A.; Ben-Zvi, I.; Ryne, R.; Esarey, E.; Geddes, C.; Qiang, J.; Ng, E.; Li, S.; Ng, C.; Lee, R.; Merminga, L.; Wang, H.; Bruhwiler, D.L.; Dechow, D.; Mullowney, P.; Messmer, P.; Nieter, C.; Ovtchinnikov, S.; Paul, K.; Stoltz, P.; Wade-Stein, D.; Mori, W.B.; Decyk, V.; Huang, C.K.; Lu, W.; Tzoufras, M.; Tsung, F.; Zhou, M.; Werner, G.R.; Antonsen, T.; Katsouleas, T.; Morris, B.


    Accelerators are the largest and most costly scientific instruments of the Department of Energy, with uses across a broad range of science, including colliders for particle physics and nuclear science and light sources and neutron sources for materials studies. COMPASS, the Community Petascale Project for Accelerator Science and Simulation, is a broad, four-office (HEP, NP, BES, ASCR) effort to develop computational tools for the prediction and performance enhancement of accelerators. The tools being developed can be used to predict the dynamics of beams in the presence of optical elements and space charge forces, the calculation of electromagnetic modes and wake fields of cavities, the cooling induced by comoving beams, and the acceleration of beams by intense fields in plasmas generated by beams or lasers. In SciDAC-1, the computational tools had multiple successes in predicting the dynamics of beams and beam generation. In SciDAC-2 these tools will be petascale enabled to allow the inclusion of an unprecedented level of physics for detailed prediction

  8. Biotransformation of Domestic Wastewater Treatment Plant Sludge by Two-Stage Integrated Processes -Lsb & Ssb

    Directory of Open Access Journals (Sweden)

    Md. Zahangir Alam, A. H. Molla and A. Fakhru’l-Razi


    Full Text Available The study of biotransformation of domestic wastewater treatment plant (DWTP sludge was conducted in laboratory-scale by two-stage integrated process i.e. liquid state bioconversion (LSB and solid state bioconversion (SSB processes. The liquid wastewater sludge [4% w/w of total suspended solids (TSS] was treated by mixed filamentous fungi Penicillium corylophilum and Aspergillus niger, isolated, screened and mixed cultured in terms of their higher biodegradation potential to wastewater sludge. The biosolids was increased to about 10% w/w. Conversely, the soluble [i.e. Total dissolve solid (TDS] and insoluble substances (TSS in treated supernatant were decreased effectively in the LSB process. In the developed LSB process, 93.8 g kg-1of biosolids were enriched with fungal biomass protein and nutrients (NPK, and 98.8% of TSS, 98.2% of TDS, 97.3% of turbidity, 80.2% of soluble protein, 98.8% of reducing sugar and 92.7% of chemical oxygen demand (COD in treated sludge supernatant were removed after 8 days of treatment. Specific resistance to filtration (1.39x1012 m/kg was decreased tremendously by the microbial treatment of DWTP sludge after 6 days of fermentation. The treated biosolids in DWTP sludge was considered as pretreated resource materials for composting and converted into compost by SSB process. The SSB process was evaluated for composting by monitoring the microbial growth and its subsequent roles in biodegradation in composting bin (CB. The process was conducted using two mixed fungal cultures, Trichoderma harzianum with Phanerochaete chrysosporium 2094 and (T/P and T. harzianum and Mucor hiemalis (T/M; and two bulking materials, sawdust (SD and rice straw (RS. The most encouraging results of microbial growth and subsequent solid state bioconversion were exhibited in the RS than the SD. Significant decrease of the C/N ratio and germination index (GI were attained as well as the higher value of glucosamine was exhibited in compost; which

  9. Single-strand DNA-binding protein SSB1 facilitates TERT recruitment to telomeres and maintains telomere G-overhangs. (United States)

    Pandita, Raj K; Chow, Tracy T; Udayakumar, Durga; Bain, Amanda L; Cubeddu, Liza; Hunt, Clayton R; Shi, Wei; Horikoshi, Nobuo; Zhao, Yong; Wright, Woodring E; Khanna, Kum Kum; Shay, Jerry W; Pandita, Tej K


    Proliferating mammalian stem and cancer cells express telomerase [telomerase reverse transcriptase (TERT)] in an effort to extend chromosomal G-overhangs and maintain telomere ends. Telomerase-expressing cells also have higher levels of the single-stranded DNA-binding protein SSB1, which has a critical role in DNA double-strand break (DSB) repair. Here, we report that SSB1 binds specifically to G-strand telomeric DNA in vitro and associates with telomeres in vivo. SSB1 interacts with the TERT catalytic subunit and regulates its interaction with telomeres. Deletion of SSB1 reduces TERT interaction with telomeres and leads to G-overhang loss. Although SSB1 is recruited to DSB sites, we found no corresponding change in TERT levels at these sites, implying that SSB1-TERT interaction relies upon a specific chromatin structure or context. Our findings offer an explanation for how telomerase is recruited to telomeres to facilitate G-strand DNA extension, a critical step in maintaining telomere ends and cell viability in all cancer cells. Cancer Res; 75(5); 858-69. ©2015 AACR. ©2015 American Association for Cancer Research.

  10. Single-strand DNA binding protein SSB1 facilitates TERT recruitment to telomeres and maintains telomere G-overhangs (United States)

    Pandita, Raj K.; Chow, Tracy T.; Udayakumar, Durga; Bain, Amanda L.; Cubeddu, Liza; Hunt, Clayton R.; Shi, Wei; Horikoshi, Nobuo; Zhao, Yong; Wright, Woodring E.; Khanna, Kum Kum; Shay, Jerry W.; Pandita, Tej K.


    Proliferating mammalian stem and cancer cells express telomerase (TERT) in an effort to extend chromosomal G-overhangs and maintain telomere ends. Telomerase-expressing cells also have higher levels of the single-stranded DNA binding protein SSB1, which has a critical role in DNA double-strand break repair. Here we report that SSB1 binds specifically to G-strand telomeric DNA in vitro and associates with telomeres in vivo. SSB1 interacted with the TERT catalytic subunit and regulates its interaction with telomeres. Deletion of SSB1 reduced TERT interaction with telomeres and lead to G-overhang loss. While SSB1 was recruited to DSB sites, we found no corresponding change in TERT levels at these sites, implying that SSB1-TERT interaction relied upon a specific chromatin structure or context. Our findings offer an explanation for how telomerase is recruited to telomeres to facilitate G-strand DNA extension, a critical step in maintaining telomere ends and cell viability in all cancer cells. PMID:25589350

  11. Science and defense 2003: the future on-board energies; Science et defense 2003: les futures energies embarquees

    Energy Technology Data Exchange (ETDEWEB)



    Since 1983, the DGA (delegation of armament) organizes the colloquium ''Science and defense'' in the domains of the scientific research and the defense. The 2003 colloquium took place in Paris on December 2 and 3 and concerns the future portable energies. This paper is a summary presentation of the presented topics: the needs and the developments for the portable energies, the state of the art of the mini and micro energy sources and their limitations, the energy materials which strongly provide energy by chemical transformation, the new energy sources of medium power, the environmental impacts. The budget devoted to these researches in 2002 by the DGA, are also presented. (A.L.B.)

  12. The SSB-positive/SSA-negative antibody profile is not associated with key phenotypic features of Sjögren's syndrome

    DEFF Research Database (Denmark)

    Baer, Alan N; McAdams DeMarco, Mara; Shiboski, Stephen C


    phenotypic features. Among SICCA participants classified with SS on the basis of the American-European Consensus Group or American College of Rheumatology criteria, only 2% required the anti-SSB-alone test result to meet these criteria. CONCLUSIONS: The presence of anti-SSB, without anti-SSA antibodies, had...... participants, 2061 (63%) had negative anti-SSA/anti-SSB, 1162 (35%) had anti-SSA with or without anti-SSB, and 74 (2%) anti-SSB alone. Key SS phenotypic features were more prevalent and had measures indicative of greater disease activity in those participants with anti-SSA, either alone or with anti-SSB, than...... in those with anti-SSB alone or negative SSA/SSB serology. These between-group differences were highly significant and not explained by confounding by age, race/ethnicity or gender. Participants with anti-SSB alone were comparable to those with negative SSA/SSB serology in their association with these key...

  13. Animal board invited review: advances in proteomics for animal and food sciences. (United States)

    Almeida, A M; Bassols, A; Bendixen, E; Bhide, M; Ceciliani, F; Cristobal, S; Eckersall, P D; Hollung, K; Lisacek, F; Mazzucchelli, G; McLaughlin, M; Miller, I; Nally, J E; Plowman, J; Renaut, J; Rodrigues, P; Roncada, P; Staric, J; Turk, R


    Animal production and health (APH) is an important sector in the world economy, representing a large proportion of the budget of all member states in the European Union and in other continents. APH is a highly competitive sector with a strong emphasis on innovation and, albeit with country to country variations, on scientific research. Proteomics (the study of all proteins present in a given tissue or fluid - i.e. the proteome) has an enormous potential when applied to APH. Nevertheless, for a variety of reasons and in contrast to disciplines such as plant sciences or human biomedicine, such potential is only now being tapped. To counter such limited usage, 6 years ago we created a consortium dedicated to the applications of Proteomics to APH, specifically in the form of a Cooperation in Science and Technology (COST) Action, termed FA1002--Proteomics in Farm Animals: In 4 years, the consortium quickly enlarged to a total of 31 countries in Europe, as well as Israel, Argentina, Australia and New Zealand. This article has a triple purpose. First, we aim to provide clear examples on the applications and benefits of the use of proteomics in all aspects related to APH. Second, we provide insights and possibilities on the new trends and objectives for APH proteomics applications and technologies for the years to come. Finally, we provide an overview and balance of the major activities and accomplishments of the COST Action on Farm Animal Proteomics. These include activities such as the organization of seminars, workshops and major scientific conferences, organization of summer schools, financing Short-Term Scientific Missions (STSMs) and the generation of scientific literature. Overall, the Action has attained all of the proposed objectives and has made considerable difference by putting proteomics on the global map for animal and veterinary researchers in general and by contributing significantly to reduce the East-West and North-South gaps

  14. The case for establishing a board of review for resolving environmental issues: The science court in Canada. (United States)

    Giesy, John P; Solomon, Keith R; Kacew, Sam; Mackay, Donald; Stobo, Gerald; Kennedy, Steven


    Technology and scientific advancements are accelerating changes in society at a pace that is challenging the abilities of government regulatory agencies and legal courts to understand the benefits and costs of these changes to humans, wildlife, and their environments. The social, economic, and political facets of concern, such as the potential effects of chemicals, complicate the preparation of regulatory standards and practices intended to safeguard the public. Court judges and attorneys and, in some cases, lay juries are tasked with interpreting the data and implications underlying these new advancements, often without the technical background necessary to understand complex subjects and subsequently make informed decisions. Here, we describe the scientific-quasi-judicial process adopted in Canada under the Canadian Environmental Protection Act, 1999, which could serve as a model for resolving conflicts between regulatory agencies and the regulated community. An example and process and lessons learned from the first Board of Review, which was for decamethylcyclopentasiloxane (D5; CAS# 541-02-06), are provided. Notable among these lessons are: 1) the need to apply state-of-the-science insights into the regulatory process, 2) to encourage agencies to continuously review and update their assessment processes, criteria, and models, and 3) provide these processes in guidance documents that are transparent and available to all stakeholders and generally foster closer cooperation between regulators, the academic community, industry, and nongovernment organizations (NGOs). Integr Environ Assess Manag 2016;12:572-579. © 2015 SETAC. © 2015 SETAC.

  15. Community Advisory Boards Guiding Engaged Research Efforts within a Clinical Translational Sciences Award: Key Contextual Factors Explored. (United States)

    Halladay, Jacqueline R; Donahue, Katrina E; Sleath, Betsy; Reuland, Dan; Black, Adina; Mitchell, C Madeline; Breland, Carol E; Coyne-Beasley, Tamera; Mottus, Kathleen; Watson, Sable Noelle; Lewis, Virginia; Wynn, Mysha; Corbie-Smith, Giselle


    Engaging stakeholders in research carries the promise of enhancing the research relevance, transparency, and speed of getting findings into practice. By describing the context and functional aspects of stakeholder groups, like those working as community advisory boards (CABs), others can learn from these experiences and operationalize their own CABs. Our objective is to describe our experiences with diverse CABs affiliated with our community engagement group within our institution's Clinical Translational Sciences Award (CTSA). We identify key contextual elements that are important to administering CABs. A group of investigators, staff, and community members engaged in a 6-month collaboration to describe their experiences of working with six research CABs. We identified the key contextual domains that illustrate how CABS are developed and sustained. Two lead authors, with experience with CABs and identifying contextual domains in other work, led a team of 13 through the process. Additionally, we devised a list of key tips to consider when devising CABs. The final domains include (1) aligned missions among stakeholders (2) resources/support, (3) defined operational processes/shared power, (4) well-described member roles, and (5) understanding and mitigating challenges. The tips are a set of actions that support the domains. Identifying key contextual domains was relatively easy, despite differences in the respective CAB's condition of focus, overall mission, or patient demographics represented. By contextualizing these five domains, other research and community partners can take an informed approach to move forward with CAB planning and engaged research.

  16. Testing of a Peroxidation Systems, Inc. perox-pure SSB-30

    International Nuclear Information System (INIS)

    Hodgson, K.M.; Lunsford, T.R.


    A facility is being designed and built at the US Department of Energy (DOE) Hanford Site to treat water containing a variety of organic and inorganic compounds. An ultraviolet light/hydrogen peroxide system, manufactured by Peroxidation Systems, Inc. (PSI), has been chosen to destroy the organic compounds in the feed stream. The PSI perox-pure trademark model SSB-30 has been tested by the Westinghouse Hanford Company (WHC) to provide data for permit documentation and to determine appropriate operating conditions. The destruction of the organic compounds was demonstrated with several feed compositions at different ultraviolet light exposures and hydrogen peroxide concentrations

  17. The ribosome-bound chaperones RAC and Ssb1/2p are required for accurate translation in Saccharomyces cerevisiae. (United States)

    Rakwalska, Magdalena; Rospert, Sabine


    The chaperone homologs RAC (ribosome-associated complex) and Ssb1/2p are anchored to ribosomes; Ssb1/2p directly interacts with nascent polypeptides. The absence of RAC or Ssb1/2p results in a similar set of phenotypes, including hypersensitivity against the aminoglycoside paromomycin, which binds to the small ribosomal subunit and compromises the fidelity of translation. In order to understand this phenomenon we measured the frequency of translation termination and misincorporation in vivo and in vitro with a novel reporter system. Translational fidelity was impaired in the absence of functional RAC or Ssb1/2p, and the effect was further enhanced by paromomycin. The mutant strains suffered primarily from a defect in translation termination, while misincorporation was compromised to a lesser extent. Consistently, a low level of soluble translation termination factor Sup35p enhanced growth defects in the mutant strains. Based on the combined data we conclude that RAC and Ssb1/2p are crucial in maintaining translational fidelity beyond their postulated role as chaperones for nascent polypeptides.

  18. Receiver sensitivity improvement in spectrally-efficient guard-band twin-SSB-OFDM using an optical IQ modulator (United States)

    Chen, Ming; Peng, Miao; Zhou, Hui; Zheng, Zhiwei; Tang, Xionggui; Maivan, Lap


    To further improve receiver sensitivity of spectrally-efficient guard-band direct-detection optical orthogonal frequency-division multiplexing (OFDM) with twin single-side-band (SSB) modulation technique, an optical IQ modulator (IQM) is employed to optimize optical carrier-to-signal power ratio (CSPR). The CSPRs for the guard-band twin-SSB-OFDM signal generated by using dual-drive Mach-Zehnder modulator (DD-MZM) and optical IQM are theoretically analyzed and supported by simulations. The optimal CSPR for the two types of guard-band twin-SSB-OFDM are identified. The simulations exhibit that the error vector magnitude (EVM) performance of the IQM-enabled guard-band twin-SSB-OFDM is improved by more than 4-dB compared to that of the twin-SSB-OFDM enabled by DD-MZM after 80-km single-mode fiber (SMF) transmission. In addition, more than 3-dB and 10 dB receiver sensitivity improvements in terms of received optical power (ROP) and optical signal-to-noise ratio (OSNR) are also achieved, respectively.

  19. SSB taxes and diet quality in US preschoolers: estimated changes in the 2010 Healthy Eating Index. (United States)

    Ford, C N; Poti, J M; Ng, S W; Popkin, B M


    Taxing sugar-sweetened beverages (SSBs) has been proposed as a strategy to combat child obesity. Yet it is unclear how a tax on SSBs might influence the overall quality of diet in preschool children. Thus, we use simulated price increases and the 2010 Healthy Eating Index (HEI-2010) to explore the relationship between SSB taxes and diet quality in preschool children. Price and purchase data from the 2009-2012 Nielsen Homescan Panel and a two-part marginal effects model were used to estimate relative changes in purchases with a 20% increase in the price of SSBs. Demand elasticities were applied to dietary intake data for children ages 2-5 years from the National Health and Nutrition Examination Survey (2009-2010 and 2011-2012) to estimate the impact of a 20% SSB tax on dietary intake and quality (HEI-2010). A 20% increase in the price of SSBs was associated with lower total caloric intake (-28 kcal d -1 , p diet quality as an isolated intervention among US preschool children. © 2016 World Obesity Federation.

  20. A new model of Social Support in Bereavement (SSB): An empirical investigation with a Chinese sample. (United States)

    Li, Jie; Chen, Sheying


    Bereavement can be an extremely stressful experience while the protective effect of social support is expected to facilitate the adjustment after loss. The ingredients or elements of social support as illustrated by a new model of Social Support in Bereavement (SSB), however, requires empirical evidence. Who might be the most effective providers of social support in bereavement has also been understudied, particularly within specific cultural contexts. The present study uses both qualitative and quantitative analyses to explore these two important issues among bereaved Chinese families and individuals. The results show that three major types of social support described by the SSB model were frequently acknowledged by the participants in this study. Aside from relevant books, family and friends were the primary sources of social support who in turn received support from their workplaces. Helping professionals turned out to be the least significant source of social support in the Chinese cultural context. Differences by gender, age, and bereavement time were also found. The findings render empirical evidence to the conceptual model of Social Support in Bereavement and also offer culturally relevant guidance for providing effective support to the bereaved.

  1. Test and assessment method of Automotive Safety Systems (SSB) particularly to monitor traffic incidents (United States)

    Pijanowski, B.; Łukjanow, S.; Burliński, R.


    The rapid development of telematics, particularly mobile telephony (GSM), wireless data transmission (GPRS) and satellite positioning (GPS) noticeable in the last decade, resulted in an almost unlimited growth of the possibilities for monitoring of mobile objects. These solutions are already widely used in the so-called “Intelligent Transport Systems” - ITS and affect a significant increase for road safety. The article describes a method of testing and evaluation of Car Safety Systems (Polish abbreviation - SSB) especially for monitoring traffic incidents, such as collisions and accidents. The algorithm of SSB testing process is also presented. Tests are performed on the dynamic test bench, part of which is movable platform with car security system mounted on it. Crash tests with a rigid obstacle are carried out instead of destructive attempts to crash test of the entire vehicle which is expensive. The tested system, depending on the simulated traffic conditions, is mounted in such a position and with the use of components, indicated by the manufacturer for the automotive safety system installation in a vehicle, for which it is intended. Then, the tests and assessments are carried out.

  2. Use of the National Board of Medical Examiners® Comprehensive Basic Science Exam: survey results of US medical schools. (United States)

    Wright, William S; Baston, Kirk


    The National Board of Medical Examiners ® (NBME) Comprehensive Basic Science Exam (CBSE) is a subject exam offered to US medical schools, where it has been used for external validation of student preparedness for the United States Medical Licensing Examination ® (USMLE) Step 1 in new schools and schools undergoing curricular reform. Information regarding the actual use of the NBME CBSE is limited. Therefore, the aim of the survey was to determine the scope and utilization of the NBME CBSE by US medical schools. A survey was sent in May 2016 to curriculum leadership of the 139 US medical schools listed on the Liaison Committee on Medical Education (LCME ® ) website with provisional or full accreditation as of February 29, 2016. Responses were received from 53 schools (38% response rate). A series of different follow-up questions were asked if respondents stated "yes" or "no" to the initial question "Does your institution administer the NBME CBSE prior to the USMLE Step 1?". A total of 37 schools (70%) administered the NBME CBSE. In all, 36 of the 37 schools responded to follow-up questions. Of 36 schools, 13 schools (36%) used the NBME CBSE for curriculum modification. Six schools (17%) used the NBME CBSE for formative assessment for a course, and five schools (14%) used the NBME CBSE for summative assessment for a course. A total of 28 schools (78%) used the NBME CBSE for identifying students performing below expectations and providing targeted intervention strategies. In all, 24 schools (67%) of the 36 responding schools administering the NBME CBSE administered the test once prior to the administration of the USMLE Step 1, whereas 10 (28%) schools administered the NBME CBSE two or more times prior to the administration of the USMLE Step 1. Our data suggest that the NBME CBSE is administered by many US medical schools. However, the objective, timing, and number of exams administered vary greatly among schools.

  3. Development of the science instrument CLUPI: the close-up imager on board the ExoMars rover (United States)

    Josset, J.-L.; Beauvivre, S.; Cessa, V.; Martin, P.


    First mission of the Aurora Exploration Programme of ESA, ExoMars will demonstrate key flight and in situ enabling technologies, and will pursue fundamental scientific investigations. Planned for launch in 2013, ExoMars will send a robotic rover to the surface of Mars. The Close-UP Imager (CLUPI) instrument is part of the Pasteur Payload of the rover fixed on the robotic arm. It is a robotic replacement of one of the most useful instruments of the field geologist: the hand lens. Imaging of surfaces of rocks, soils and wind drift deposits at high resolution is crucial for the understanding of the geological context of any site where the Pasteur rover may be active on Mars. At the resolution provided by CLUPI (approx. 15 micrometer/pixel), rocks show a plethora of surface and internal structures, to name just a few: crystals in igneous rocks, sedimentary structures such as bedding, fracture mineralization, secondary minerals, details of the surface morphology, sedimentary bedding, sediment components, surface marks in sediments, soil particles. It is conceivable that even textures resulting from ancient biological activity can be visualized, such as fine lamination due to microbial mats (stromatolites) and textures resulting from colonies of filamentous microbes, potentially present in sediments and in palaeocavitites in any rock type. CLUPI is a complete imaging system, consisting of an APS (Active Pixel Sensor) camera with 27° FOV optics. The sensor is sensitive to light between 400 and 900 nm with 12 bits digitization. The fixed focus optics provides well focused images of 4 cm x 2.4 cm rock area at a distance of about 10 cm. This challenging camera system, less than 200g, is an independent scientific instrument linked to the rover on board computer via a SpaceWire interface. After the science goals and specifications presentation, the development of this complex high performance miniaturized imaging system will be described.

  4. Use of the National Board of Medical Examiners® Comprehensive Basic Science Exam: survey results of US medical schools

    Directory of Open Access Journals (Sweden)

    Wright WS


    Full Text Available William S Wright,1 Kirk Baston2 1Department of Biomedical Sciences, 2Department of Pathology, University of South Carolina School of Medicine Greenville, Greenville, SC, USA Purpose: The National Board of Medical Examiners® (NBME Comprehensive Basic Science Exam (CBSE is a subject exam offered to US medical schools, where it has been used for external validation of student preparedness for the United States Medical Licensing Examination® (USMLE Step 1 in new schools and schools undergoing curricular reform. Information regarding the actual use of the NBME CBSE is limited. Therefore, the aim of the survey was to determine the scope and utilization of the NBME CBSE by US medical schools.Methods: A survey was sent in May 2016 to curriculum leadership of the 139 US medical schools listed on the Liaison Committee on Medical Education (LCME® website with provisional or full accreditation as of February 29, 2016. Responses were received from 53 schools (38% response rate. A series of different follow-up questions were asked if respondents stated “yes” or “no” to the initial question “Does your institution administer the NBME CBSE prior to the USMLE Step 1?”.Results: A total of 37 schools (70% administered the NBME CBSE. In all, 36 of the 37 schools responded to follow-up questions. Of 36 schools, 13 schools (36% used the NBME CBSE for curriculum modification. Six schools (17% used the NBME CBSE for formative assessment for a course, and five schools (14% used the NBME CBSE for summative assessment for a course. A total of 28 schools (78% used the NBME CBSE for identifying students performing below expectations and providing targeted intervention strategies. In all, 24 schools (67% of the 36 responding schools administering the NBME CBSE administered the test once prior to the administration of the USMLE Step 1, whereas 10 (28% schools administered the NBME CBSE two or more times prior to the administration of the USMLE Step 1.Conclusion

  5. Effect of antioxidants on x-ray induced DNA SSB and DSB in different cell systems

    International Nuclear Information System (INIS)

    Ramadu, Kadem


    The effect of x-ray radiation or antioxidants such as actinomycin D, cycloheximide and mitomycin C is studied on CHO, BHK and HeLa cells. X-ray radiation caused DNA single strand breaks (SSB) and double strand breaks (DSB) are prevented by cycloheximide and actinomycin-D. The DSB and SSB are significant in the case of x-ray radiation in combination with MMC, but different with actinomycin-D and cycloheximide in combination with x-ray radiation which causes less number of SSB and DSB. The ISC is observed more with x-ray radiation in combination with antioxidants mitomycin C (MMC) than that of cycloheximide and actinomycin-D, which individually causes inhibition of ISC induced by x-ray radiation. This observation proves that the MMC has an additive effect on x-ray induced ISC during cell proliferation. During cell proliferation, cell viability is observed with x-ray radiation and antioxidants which are dependent on the cell cycle phase. However, in the control cells, the initial Go-phase has shown negligible difference in percent cell viability thereby during S-phase gradual increase in the cell viability, and cell proliferation have been found to be stopped at G2+M-phase. On the contrary, cell viability and the extent of cell proliferation with x-ray radiation in combination with MMC have shown more damage (OH-damage) than is caused by x-ray radiation and MMC, separately. But, the fact is that actinomycin-D and cycloheximide act as antioxidants preventing thereby free radical formation and cell death, caused by x-ray radiation. During cell proliferation, cells observed from S and (G2+M) phase exhibit difference in cell viability in all the treatments alone and in combination. HeLa cells have been found insensitive to x-ray radiation and could be ascribed to the presence of glutathione transferase, which is less in CHO/BHK cell line. (author)

  6. 76 FR 72954 - Request for Nominations for Voting Members on Public Advisory Committee, Science Board to the... (United States)


    ... for critical review of Agency strategic science plan and its implementation as well as of related..., nanotechnology, food sciences, medical devices and combination products. III. Nomination Procedures Any...

  7. SSB of Scale Symmetry, Fermion Families and Quintessence without the Long-Range Force Problem (United States)

    Guendelman, E. I.; Kaganovich, A. B.

    We study a scale-invariant two measures theory where a dilaton field φ has no explicit potentials. The scale transformations include the translation of a dilaton φ-->φ+ const. The theory demonstrates a new mechanism for generation of the exponential potential: in the conformal Einstein frame (CEF), after SSB of scale invariance, the theory develops the exponential potential and, in general, the nonlinear kinetic term is generated as well. The scale symmetry does not allow the appearance of terms breaking the exponential shape of the potential that solves the problem of the flatness of the scalar field potential in the context of quintessential scenarios. As examples, two different possibilities for the choice of the dimensionless parameters are presented where the theory permits to get interesting cosmological results. For the first choice, the theory has standard scaling solutions for φ usually used in the context of the quintessential scenario. For the second choice, the theory allows three different solutions, one of which is a scaling solution with equation of state pφ=wρφ where w is predicted to be restricted by -1SSB of scale invariance.

  8. Persistent fetal sinus bradycardia associated with maternal anti-SSA/Ro and anti-SSB/La antibodies

    NARCIS (Netherlands)

    Chockalingam, Priya; Jaeggi, Edgar T.; Rammeloo, Lukas A.; Haak, Monique C.; Adama van Scheltema, Phebe N.; Breur, Johannes M. P. J.; Bartelings, Margot M.; Clur, Sally-Ann B.; Blom, Nico A.


    To study the clinical course and outcome of fetal sinus bradycardia (SB) due to maternal antibody-induced sinus node dysfunction. We reviewed the maternal, prenatal, and postnatal findings of fetuses with SB associated with elevated maternal anti-SSA/Ro and anti-SSB/La antibodies. Of the 6 cases

  9. Effectiveness of National Board Certified (NBC) Teachers in Terms of Classroom Environment, Attitudes and Achievement among Secondary Science Students (United States)

    Helding, Karen A.; Fraser, Barry J.


    No previous research has employed learning environments criteria in evaluating the effectiveness of the system of teacher certification sponsored by the National Board for Professional Teaching Standards. Because the litmus test of any professional development effort is the extent of the changes in teaching behaviours in participating teachers'…

  10. The Hsp70 homolog Ssb and the 14-3-3 protein Bmh1 jointly regulate transcription of glucose repressed genes in Saccharomyces cerevisiae. (United States)

    Hübscher, Volker; Mudholkar, Kaivalya; Chiabudini, Marco; Fitzke, Edith; Wölfle, Tina; Pfeifer, Dietmar; Drepper, Friedel; Warscheid, Bettina; Rospert, Sabine


    Chaperones of the Hsp70 family interact with a multitude of newly synthesized polypeptides and prevent their aggregation. Saccharomyces cerevisiae cells lacking the Hsp70 homolog Ssb suffer from pleiotropic defects, among others a defect in glucose-repression. The highly conserved heterotrimeric kinase SNF1/AMPK (AMP-activated protein kinase) is required for the release from glucose-repression in yeast and is a key regulator of energy balance also in mammalian cells. When glucose is available the phosphatase Glc7 keeps SNF1 in its inactive, dephosphorylated state. Dephosphorylation depends on Reg1, which mediates targeting of Glc7 to its substrate SNF1. Here we show that the defect in glucose-repression in the absence of Ssb is due to the ability of the chaperone to bridge between the SNF1 and Glc7 complexes. Ssb performs this post-translational function in concert with the 14-3-3 protein Bmh, to which Ssb binds via its very C-terminus. Raising the intracellular concentration of Ssb or Bmh enabled Glc7 to dephosphorylate SNF1 even in the absence of Reg1. By that Ssb and Bmh efficiently suppressed transcriptional deregulation of Δreg1 cells. The findings reveal that Ssb and Bmh comprise a new chaperone module, which is involved in the fine tuning of a phosphorylation-dependent switch between respiration and fermentation. © The Author(s) 2016. Published by Oxford University Press on behalf of Nucleic Acids Research.

  11. Autodisplay of the La/SSB protein on LPS-free E. coli for the diagnosis of Sjögren's syndrome. (United States)

    Yoo, Gu; Dilkaute, Carina; Bong, Ji-Hong; Song, Hyun-Woo; Lee, Misu; Kang, Min-Jung; Jose, Joachim; Pyun, Jae-Chul


    The objective of this study was to present an immunoassay for the diagnosis of Sjögren's syndrome based on the autodisplayed La/SSB protein on the outer membrane of intact E. coli (strain UT-5600) and LPS-free E. coli (ClearColi™). As the first step, an autodisplay vector (pCK002) was transfected into intact E. coli and LPS-free E. coli for comparison of efficiency of autdisplay of La/SSB. The maximal level of La/SSB expression was estimated to be similar for LPS-free E. coli and intact E. coli at different optimal induction periods. Intact E. coli was found to grow twofold faster than LPS-free E. coli, and the maximal level of expression for LPS-free E. coli was obtained with a longer induction period. When the zeta potential was measured, both intact E. coli and LPS-free E. coli showed negative values, and the autodisplay of negatively charged La/SSB protein (pIE. coli and LPS-free E. coli resulted in a slight change in zeta potential values. E. coli with autodisplayed La/SSB protein was used for an immunoassay of anti-La/SSB antibodies for the diagnosis of Sjögren's syndrome. The surface of E. coli with the autodisplayed antigen was modified with rabbit serum and papain to prevent false positive signals because of nonspecific binding of unrelated antibodies from human serum. LPS-free E. coli with autodisplayed La/SSB protein yielded sensitivity and selectivity of 81.6% and 78.6%, respectively. The Bland-Altman test showed that the immunoassays based on LPS-free E. coli and intact E. coli with autodisplayed La/SSB protein were statistically equivalent to a clinical immunoassay for detection of anti-La/SSB antibodies (confidence coefficient 95%). Copyright © 2017 Elsevier Inc. All rights reserved.

  12. 75 FR 71701 - Science Advisory Board Staff Office; Request for Nominations of Experts for the Review of a Draft... (United States)


    ... fluctuation in microbial populations. The EPA Office of the Science Advisor's Risk Assessment Forum has.... Kathryn Gallagher, Executive Director, Risk Assessment Forum, Office of the Science Advisor US EPA, Mail... person or organization may nominate qualified individuals in the areas of expertise described above for...

  13. Board game

    International Nuclear Information System (INIS)

    Brennan, N.S.


    A board game comprises a board, a number of counters and two dice. The board is marked to provide a central area, representing the nucleus of an atom, and six or more annular rings extending concentrically around the central area, the rings being divided into 2,8,18,32,48 and 72 squares. Each ring represents an electron shell, and some of the squares are numbered, the number representing the atomic number of different elements. (author)

  14. Alkyladenine DNA glycosylase (AAG) localizes to mitochondria and interacts with mitochondrial single-stranded binding protein (mtSSB). (United States)

    van Loon, Barbara; Samson, Leona D


    Due to a harsh environment mitochondrial genomes accumulate high levels of DNA damage, in particular oxidation, hydrolytic deamination, and alkylation adducts. While repair of alkylated bases in nuclear DNA has been explored in detail, much less is known about the repair of DNA alkylation damage in mitochondria. Alkyladenine DNA glycosylase (AAG) recognizes and removes numerous alkylated bases, but to date AAG has only been detected in the nucleus, even though mammalian mitochondria are known to repair DNA lesions that are specific substrates of AAG. Here we use immunofluorescence to show that AAG localizes to mitochondria, and we find that native AAG is present in purified human mitochondrial extracts, as well as that exposure to alkylating agent promotes AAG accumulation in the mitochondria. We identify mitochondrial single-stranded binding protein (mtSSB) as a novel interacting partner of AAG; interaction between mtSSB and AAG is direct and increases upon methyl methanesulfonate (MMS) treatment. The consequence of this interaction is specific inhibition of AAG glycosylase activity in the context of a single-stranded DNA (ssDNA), but not a double-stranded DNA (dsDNA) substrate. By inhibiting AAG-initiated processing of damaged bases, mtSSB potentially prevents formation of DNA breaks in ssDNA, ensuring that base removal primarily occurs in dsDNA. In summary, our findings suggest the existence of AAG-initiated BER in mitochondria and further support a role for mtSSB in DNA repair. Copyright © 2012. Published by Elsevier B.V.

  15. 75 FR 20992 - Science Advisory Board Staff Office; Request for Nominations of Experts To Augment the SAB... (United States)


    ... experts in ecology, environmental economics, social and behavioral science, geographic information systems... services; (2) ecosystem services monitoring design; (3) landscape ecology principles, especially as related... activities, or the appearance of a lack of impartiality, as defined by Federal regulation. Ethics information...

  16. 75 FR 64726 - Science Advisory Board Staff Office; Request for Nominations of Experts To Serve on the Clean Air... (United States)


    ..., atmospheric chemistry, ecosystem modeling, aquatic chemistry, environmental science and engineering, risk...): Network Re-engineering--Advice on potential revisions to the technical and regulatory aspects of the PAMS... the most recently revised ozone NAAQS and changes to atmospheric chemistry that have occurred over the...

  17. Report of the Defense Science Board Task Force on Department of Defense Biological Safety and Security Program (United States)


    Three (NAMRU-3) - Lima, Peru : Naval Medical Research Center Detachment (NMRCD) *These labs are co-located. To provide some measure of the scope and...Aceh, Indonesia and the more recent earthquakes in central Java and Peru . Edgewood Chemical Biological Center (ECBC) ECBC’s science and technology... diabetes , obesity, cancer, psychiatric disorders, problems of pregnancy, AIDS, hepatitis, malaria, parasitic infections, and a host of other

  18. Complementation of Saccharomyces cerevisiae mutations in genes involved in translation and protein folding (EFB1 and SSB1) with Candida albicans cloned genes. (United States)

    Maneu, V; Roig, P; Gozalbo, D


    We have demonstrated that the expression of Candida albicans genes involved in translation and protein folding (EFB1 and SSB1) complements the phenotype of Saccharomyces cerevisiae mutants. The elongation factor 1beta (EF-1beta) is essential for growth and efb1 S. cerevisiae null mutant cells are not viable; however, viable haploid cells, carrying the disrupted chromosomal allele of the S. cerevisiae EFB1 gene and pEFB1, were isolated upon sporulation of a diploid strain which was heterozygous at the EFB1 locus and transformed with pEFB1 (a pEMBLYe23 derivative plasmid containing an 8-kb DNA fragment from the C. albicans genome which contains the EFB1 gene). This indicates that the C. albicans EFB1 gene encodes a functional EF-1beta. Expression of the SSB1 gene from C. albicans, which codes for a member of the 70-kDa heat shock protein family, in S. cerevisiae ssb1 ssb2 double mutant complements the mutant phenotype (poor growth particularly at low temperature, and sensitivity to certain protein synthesis inhibitors, such as paromomycin). This complementation indicates that C. albicans Ssbl may function as a molecular chaperone on the translating ribosomes, as described in S. cerevisiae. Northern blot analysis showed that SSB mRNA levels increased after mild cold shift (28 degrees C to 23 degrees C) and rapidly decreased after mild heat shift (from 28 degrees C to 37 degrees C, and particularly to 42 degrees C), indicating that SSB1 expression is regulated by temperature. Therefore, Ssb1 may be considered as a molecular chaperone whose pattern of expression is similar to that found in ribosomal proteins, according to its common role in translation.

  19. The Effect of Price and Socio-Economic Level on the Consumption of Sugar-Sweetened Beverages (SSB): The Case of Ecuador. (United States)

    Paraje, Guillermo


    The objective of this article is to estimate the own-price, cross-price and income elasticities of demand for SSB in Ecuador, as an indispensable step for predicting a reduction in the consumption of said beverages caused by the potential implementation of taxes in Ecuador. In addition, the own-price, cross-price and income elasticities of sugar-free substitutes like mineral water and diet soft drinks and juices are also estimated. The data from the 2011-2012 ENIGHUR, which contains detailed information on household consumption and socioeconomic variables, was used. The estimates are done using Deaton's Almost Ideal Demand System (AIDS) which accounts for differences in the quality of goods purchased. This demand system is estimated for different socio-economic groups, according to total household expenditure. The results reveal own-price elasticities for SSB between -1.17 and -1.33 depending on the socio-economic group, in line with the existing evidence for developed countries. Own-price elasticity for non-SSB is between -1 and -1.24. Income elasticities reveal that both SSB and non-SSB are normal goods with elasticities decreasing for higher socio-economic groups. These results show that the consumption of SSB is sensitive to price changes, meaning that the implementation of taxes on said beverages could be effective in reducing their consumption. The fact that non-SSB are also sensitive to price changes would indicate that subsidies could be implemented for the production of some of them.

  20. RPA70 depletion induces hSSB1/2-INTS3 complex to initiate ATR signaling


    Kar, Ananya; Kaur, Manpreet; Ghosh, Tanushree; Khan, Md. Muntaz; Sharma, Aparna; Shekhar, Ritu; Varshney, Akhil; Saxena, Sandeep


    The primary eukaryotic single-stranded DNA-binding protein, Replication protein A (RPA), binds to single-stranded DNA at the sites of DNA damage and recruits the apical checkpoint kinase, ATR via its partner protein, ATRIP. It has been demonstrated that absence of RPA incapacitates the ATR-mediated checkpoint response. We report that in the absence of RPA, human single-stranded DNA-binding protein 1 (hSSB1) and its partner protein INTS3 form sub-nuclear foci, associate with the ATR-ATRIP comp...

  1. A data-driven structural model of hSSB1 (NABP2/OBFC2B) self-oligomerization


    Touma, Christine; Adams, Mark N.; Ashton, Nicholas W.; Mizzi, Michael; El-Kamand, Serene; Richard, Derek J.; Cubeddu, Liza; Gamsjaeger, Roland


    Abstract The maintenance of genome stability depends on the ability of the cell to repair DNA efficiently. Single-stranded DNA binding proteins (SSBs) play an important role in DNA processing events such as replication, recombination and repair. While the role of human single-stranded DNA binding protein 1 (hSSB1/NABP2/OBFC2B) in the repair of double-stranded breaks has been well established, we have recently shown that it is also essential for the base excision repair (BER) pathway following...

  2. Cleft Palate-Craniofacial Journal 50th anniversary editorial board commentary: anatomy, basic sciences, and genetics--then and now. (United States)

    Mooney, Mark P; Cooper, Gregory M; Marazita, Mary L


    To celebrate the 50th year of the Cleft Palate-Craniofacial Journal we look back to where we started in 1964 and where we are now, and we speculate about directions for the future in a "Then and Now" editorial series. This editorial examines changing trends and perspectives in anatomical, basic science, and genetic studies published in this 50-year interval. In volume 1 there were 45 total papers, seven (16%) of which were peer-reviewed basic science and genetic articles published: four in anatomy, three in craniofacial biology, and none in genetics. In contrast, in volume 50, of 113 articles there were 47 (42%) peer-reviewed basic science and genetic articles published: 30 in anatomy, five in craniofacial biology, and 12 in genetics. Topical analysis of published manuscripts then and now reveal that similar topics in anatomy and craniofacial biology are still being researched today (e.g., phenotypic variability, optimal timing of surgery, presurgical orthopedics, bone grafting); whereas, most of the more recent papers use advanced technology to address old questions. In contrast, genetic publications have clearly increased in frequency during the last 50 years, which parallels advances in the field during this time. However, all of us have noticed that the more "cutting-edge" papers in these areas are not being submitted for publication to the journal, but instead to discipline-specific journals. Concerted efforts are therefore indicated to attract and publish these cutting-edge papers in order to keep the Cleft Palate-Craniofacial Journal in the forefront of orofacial cleft and craniofacial anomaly research and to provide a valuable service to American Cleft Palate-Craniofacial Association members.

  3. Bacillus subtilis single-stranded DNA-binding protein SsbA is phosphorylated at threonine 38 by the serine/threonine kinase YabT

    DEFF Research Database (Denmark)

    Derouiche, Abderahmane; Petranovic, Dina; Macek, Boris


    Background and purpose: Single-stranded DNA-binding proteins participate in all stages of DNA metabolism that involve single-stranded DNA, from replication, recombination, repair of DNA damage, to natural competence in species such as Bacillus subtilis. B. subtilis single-stranded DNA......-binding proteins have previously been found to be phosphorylated on tyrosine and arginine residues. While tyrosine phosphorylation was shown to enhance the DNA-binding properties of SsbA, arginine phosphorylation was not functionally characterized.Materials and methods: We used mass spectrometry analysis to detect...... phosphorylation of SsbA purified from B. subtilis cells. The detected phosphorylation site was assessed for its influence on DNA-binding in vitro, using electrophoretic mobility shift assays. The ability of B. subtilis serine/threonine kinases to phosphorylate SsbA was assessed using in vitro phosphorylation...

  4. 100-Gb/s 80-km transmission of PIM-SSB-OFDM at C-band using a single-end photodetector (United States)

    Huo, Jiahao; Zhou, Xian; Zhong, Kangping; Gui, Tao; Tan, Fengze; Tu, Jiajing; Yuan, Jinhui; Zhang, Hongyu; Long, Keping; Yu, Changyuan; Lau, Alan Pak Tao; Lu, Chao


    Polarization-interleave-multiplexed (PIM) with single-sideband orthogonal frequency-division multiplexing (SSB-OFDM) based on direct detection is proposed for short-reach applications transmitted up to 80 km in which the guard band can be shared for the two SSB signals with interleave electrical center frequencies. Based on two dual-drive Mach-Zehnder modulators with one single-end photodetector (PD), 100-Gb/s PIM-SSB-OFDM transmission over a 80-km standard single-mode fiber is successfully demonstrated. After 80-km transmission, the optical signal-to-noise ratio requirement is 29.1 dB with respect to the bit error rate threshold of 7% hard decision-forward error correction overhead.

  5. Purification of ribonucleoproteins by a novel approach: isolation of the SSB1 ribonucleoprotein from yeast and demonstration that it has no role in mRNA splicing. (United States)

    Cusick, M E


    A novel approach is described to purify potential ribonucleoproteins (RNP) of yeast. The method assays a yeast RNP complex, assembled in vitro on actin pre-mRNA, by low-ionic strength acrylamide gel electrophoresis. The minimal protein components of this RNP complex were three proteins, one of 30 kDa and two at 42-44 kDa, defined by formation of the complex on biotinylated-RNA, binding of this complex to avidin-agarose, and salt elution of the protein in the biotinylated-RNP complex. Using the assay for RNP complex formation, an RNP protein was purified to homogeneity on the basis of its affinity towards single-stranded DNA and RNA. This RNP protein turned out to be identical to a known RNP protein, the single-stranded binding protein 1 (ssb1) of yeast, on the basis of identical gel electrophoretic migration, antibody cross-reactivity, and identical properties on the gel complex formation assay. In vitro mRNA splicing was normal in extracts made from a yeast strain missing ssb1 (ssb1- strain). Addition of anti-ssb1 antibody to splicing extracts made from a wild type strain did not inhibit or diminish splicing. Instead, mRNA splicing was reproducibly stimulated several fold, indicating competition between ssb1 and splicing factors for binding to single-stranded RNA in the extracts. RNP complexes still formed in the ssb1- strain, demonstrating that it would be possible to purify other RNP proteins from this strain using the gel complex formation assay.

  6. The C-terminal domain of the bacterial SSB protein acts as a DNA maintenance hub at active chromosome replication forks.

    Directory of Open Access Journals (Sweden)

    Audrey Costes


    Full Text Available We have investigated in vivo the role of the carboxy-terminal domain of the Bacillus subtilis Single-Stranded DNA Binding protein (SSB(Cter as a recruitment platform at active chromosomal forks for many proteins of the genome maintenance machineries. We probed this SSB(Cter interactome using GFP fusions and by Tap-tag and biochemical analysis. It includes at least 12 proteins. The interactome was previously shown to include PriA, RecG, and RecQ and extended in this study by addition of DnaE, SbcC, RarA, RecJ, RecO, XseA, Ung, YpbB, and YrrC. Targeting of YpbB to active forks appears to depend on RecS, a RecQ paralogue, with which it forms a stable complex. Most of these SSB partners are conserved in bacteria, while others, such as the essential DNA polymerase DnaE, YrrC, and the YpbB/RecS complex, appear to be specific to B. subtilis. SSB(Cter deletion has a moderate impact on B. subtilis cell growth. However, it markedly affects the efficiency of repair of damaged genomic DNA and arrested replication forks. ssbΔCter mutant cells appear deficient in RecA loading on ssDNA, explaining their inefficiency in triggering the SOS response upon exposure to genotoxic agents. Together, our findings show that the bacterial SSB(Cter acts as a DNA maintenance hub at active chromosomal forks that secures their propagation along the genome.

  7. Buddy Board

    DEFF Research Database (Denmark)

    Enggaard, Helle; Moselund, Lene


    Projekt ’BuddyBoard’ er kommet i stand via et samarbejde mellem Frederikshavn kommune, Bunker43 og Lab. X. Afdeling en ’Havly’ på Sæby Ældrecenter fungerer som living lab, hvilket betyder, at det udgør et levende laboratorium for udvikling og afprøvning af teknologi (Schultz, 2013). Projektet er....... Bunker43 har udviklet en teknologi (BuddyBoard) til hurtig formidling af billeder fra pårørende og personale til beboere på institutioner. Pårørende og personale uploader billeder via en APP eller en hjemmeside og har mulighed for at tilføje en kort forklarende tekst til hvert billede. Beboeren ser...... billederne via en tablet. Systemet bygger på et simpelt og brugervenligt design, så ældre med kognitive og/eller fysiske funktionsnedsættelser kan anvende teknologien. BuddyBoard fungerer via internettet, og billederne gemmes på en sikret server hos udbyderen, som er Bunker43. Intentionerne med BuddyBoard er...

  8. Butanol production from sweet sorghum bagasse (SSB) with high solids content: part I – comparison of liquid hot water pretreatment with dilute sulfuric acid (United States)

    In these studies we pretreated sweet sorghum bagasse (SSB) using liquid hot water (LHW) or dilute H2SO4 (2 g·L-1) at 190 deg C for zero min (as soon as temperature reached 190 deg C, cooling was started) to reduce generation of sugar degradation fermentation inhibiting products such as furfural and ...

  9. International application of sugar-sweetened beverage (SSB) taxation in obesity reduction: factors that may influence policy effectiveness in country-specific contexts. (United States)

    Jou, Judy; Techakehakij, Win


    Sugar-sweetened beverage (SSB) taxation is becoming of increasing interest as a policy aimed at addressing the rising prevalence of obesity in many countries. Preliminary evidence indicates its potential to not only reduce obesity prevalence, but also generate public revenue. However, differences in country-specific contexts create uncertainties in its possible outcomes. This paper urges careful consideration of country-specific characteristics by suggesting three points in particular that may influence the effectiveness of a volume-based soft drink excise tax: population obesity prevalence, soft drink consumption levels, and existing baseline tax rates. Data from 19 countries are compared with regard to each point. The authors suggest that SSB or soft drink taxation policy may be more effective in reducing obesity prevalence where existing obesity prevalence and soft drink consumption levels are high. Conversely, in countries where the baseline tax rate is already considered high, SSB taxation may not have a noticeable impact on consumption patterns or obesity prevalence, and may incur negative feedback from the beverage industry or the general public. Thorough evaluation of these points is recommended prior to adopting SSB or soft drink taxation as an obesity reduction measure in any given country. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.

  10. Board Task Performance

    DEFF Research Database (Denmark)

    Minichilli, Alessandro; Zattoni, Alessandro; Nielsen, Sabina


    identify three board processes as micro-level determinants of board effectiveness. Specifically, we focus on effort norms, cognitive conflicts and the use of knowledge and skills as determinants of board control and advisory task performance. Further, we consider how two different institutional settings....... The findings show that: (i) Board processes have a larger potential than demographic variables to explain board task performance; (ii) board task performance differs significantly between boards operating in different contexts; and (iii) national context moderates the relationships between board processes...... and board task performance....

  11. Defense Business Board (United States)

    Skip to main content (Press Enter). Toggle navigation Defense Business Board Search Search Defense Business Board: Search Search Defense Business Board: Search Defense Business Board Business Excellence in Defense of the Nation Defense Business Board Home Charter Members Meetings Studies Contact Us The Defense

  12. Information and Announcements National Board for Higher ...

    Indian Academy of Sciences (India)

    National Board for Higher Mathematics ... the mathematics Olympiad cell of the Homi Bhabha Centre for Science Education (TIFR). ... cians and teachers interested in contributing to the mathematics Olympiad activity at the national level.

  13. Identification and characterization of the SSB1 locus involved in symptom development by Spring beauty latent virus infection in Arabidopsis thaliana. (United States)

    Fujisaki, Koki; Hagihara, Fumi; Azukawa, Yoshihiro; Kaido, Masanori; Okuno, Tetsuro; Mise, Kazuyuki


    The natural variation of Arabidopsis thaliana in response to a bromovirus, Spring beauty latent virus (SBLV), was examined. Of 63 Arabidopsis accessions tested, all were susceptible when inoculated with SBLV, although there was a large degree of variation in symptom development. Most accessions, including Columbia (Col-0), were symptomless or developed only mild symptoms, but four accessions, including S96, showed severe symptoms of SBLV infection. Genetic analysis suggested that the difference in the responses of Col-0 and S96 to SBLV was controlled by a single semidominant locus. We have designated this locus SSB1 (symptom development by SBLV infection). By using genetic markers, SSB1 was mapped to chromosome IV. The patterns of distribution and accumulation of SBLV in sensitive accessions were similar to those in the insensitive accessions. In addition, symptom development in S96 by SBLV infection was critically interrupted by the presence of the NahG gene, which encodes salicylic acid (SA) hydroxylase. These data suggest that symptom development in A. thaliana controlled by SSB1 is independent of the efficiency of SBLV multiplication and is dependent on SA signaling.

  14. Type A Accident Investigation Board report on the January 17, 1996, electrical accident with injury in Technical Area 21 Tritium Science and Fabrication Facility Los Alamos National Laboratory. Final report

    International Nuclear Information System (INIS)


    An electrical accident was investigated in which a crafts person received serious injuries as a result of coming into contact with a 13.2 kilovolt (kV) electrical cable in the basement of Building 209 in Technical Area 21 (TA-21-209) in the Tritium Science and Fabrication Facility (TSFF) at Los Alamos National Laboratory (LANL). In conducting its investigation, the Accident Investigation Board used various analytical techniques, including events and causal factor analysis, barrier analysis, change analysis, fault tree analysis, materials analysis, and root cause analysis. The board inspected the accident site, reviewed events surrounding the accident, conducted extensive interviews and document reviews, and performed causation analyses to determine the factors that contributed to the accident, including any management system deficiencies. Relevant management systems and factors that could have contributed to the accident were evaluated in accordance with the guiding principles of safety management identified by the Secretary of Energy in an October 1994 letter to the Defense Nuclear Facilities Safety Board and subsequently to Congress

  15. Type A Accident Investigation Board report on the January 17, 1996, electrical accident with injury in Technical Area 21 Tritium Science and Fabrication Facility Los Alamos National Laboratory. Final report

    Energy Technology Data Exchange (ETDEWEB)



    An electrical accident was investigated in which a crafts person received serious injuries as a result of coming into contact with a 13.2 kilovolt (kV) electrical cable in the basement of Building 209 in Technical Area 21 (TA-21-209) in the Tritium Science and Fabrication Facility (TSFF) at Los Alamos National Laboratory (LANL). In conducting its investigation, the Accident Investigation Board used various analytical techniques, including events and causal factor analysis, barrier analysis, change analysis, fault tree analysis, materials analysis, and root cause analysis. The board inspected the accident site, reviewed events surrounding the accident, conducted extensive interviews and document reviews, and performed causation analyses to determine the factors that contributed to the accident, including any management system deficiencies. Relevant management systems and factors that could have contributed to the accident were evaluated in accordance with the guiding principles of safety management identified by the Secretary of Energy in an October 1994 letter to the Defense Nuclear Facilities Safety Board and subsequently to Congress.

  16. Strategic transformation of population studies: recommendations of the working group on epidemiology and population sciences from the National Heart, Lung, and Blood Advisory Council and Board of External Experts. (United States)

    Roger, Véronique L; Boerwinkle, Eric; Crapo, James D; Douglas, Pamela S; Epstein, Jonathan A; Granger, Christopher B; Greenland, Philip; Kohane, Isaac; Psaty, Bruce M


    In 2013, the National Heart, Lung, and Blood Institute assembled a working group on epidemiology and population sciences from its Advisory Council and Board of External Experts. The working group was charged with making recommendations to the National Heart, Lung, and Blood Advisory Council about how the National Heart, Lung, and Blood Institute could take advantage of new scientific opportunities and delineate future directions for the epidemiology of heart, lung, blood, and sleep diseases. Seven actionable recommendations were proposed for consideration. The themes included 1) defining the compelling scientific questions and challenges in population sciences and epidemiology of heart, lung, blood, and sleep diseases; 2) developing methods and training mechanisms to integrate "big data" science into the practice of epidemiology; 3) creating a cohort consortium and inventory of major studies to optimize the efficient use of data and specimens; and 4) fostering a more open, competitive approach to evaluating large-scale longitudinal epidemiology and population studies. By building on the track record of success of the heart, lung, blood, and sleep cohorts to leverage new data science opportunities and encourage broad research and training partnerships, these recommendations lay a strong foundation for the transformation of heart, lung, blood, and sleep epidemiology. © The Author 2015. Published by Oxford University Press on behalf of the Johns Hopkins Bloomberg School of Public Health. All rights reserved. For permissions, please e-mail:

  17. Space Synthetic Biology (SSB) (United States)

    National Aeronautics and Space Administration — This project focused on employing advanced biological engineering and bioelectrochemical reactor systems to increase life support loop closure and in situ resource...

  18. Identification of the divergent calmodulin binding motif in yeast Ssb1/Hsp75 protein and in other HSP70 family members. (United States)

    Heinen, R C; Diniz-Mendes, L; Silva, J T; Paschoalin, V M F


    Yeast soluble proteins were fractionated by calmodulin-agarose affinity chromatography and the Ca2+/calmodulin-binding proteins were analyzed by SDS-PAGE. One prominent protein of 66 kDa was excised from the gel, digested with trypsin and the masses of the resultant fragments were determined by MALDI/MS. Twenty-one of 38 monoisotopic peptide masses obtained after tryptic digestion were matched to the heat shock protein Ssb1/Hsp75, covering 37% of its sequence. Computational analysis of the primary structure of Ssb1/Hsp75 identified a unique potential amphipathic alpha-helix in its N-terminal ATPase domain with features of target regions for Ca2+/calmodulin binding. This region, which shares 89% similarity to the experimentally determined calmodulin-binding domain from mouse, Hsc70, is conserved in near half of the 113 members of the HSP70 family investigated, from yeast to plant and animals. Based on the sequence of this region, phylogenetic analysis grouped the HSP70s in three distinct branches. Two of them comprise the non-calmodulin binding Hsp70s BIP/GR78, a subfamily of eukaryotic HSP70 localized in the endoplasmic reticulum, and DnaK, a subfamily of prokaryotic HSP70. A third heterogeneous group is formed by eukaryotic cytosolic HSP70s containing the new calmodulin-binding motif and other cytosolic HSP70s whose sequences do not conform to those conserved motif, indicating that not all eukaryotic cytosolic Hsp70s are target for calmodulin regulation. Furthermore, the calmodulin-binding domain found in eukaryotic HSP70s is also the target for binding of Bag-1 - an enhancer of ADP/ATP exchange activity of Hsp70s. A model in which calmodulin displaces Bag-1 and modulates Ssb1/Hsp75 chaperone activity is discussed.

  19. Identification of the divergent calmodulin binding motif in yeast Ssb1/Hsp75 protein and in other HSP70 family members

    Directory of Open Access Journals (Sweden)

    R.C. Heinen


    Full Text Available Yeast soluble proteins were fractionated by calmodulin-agarose affinity chromatography and the Ca2+/calmodulin-binding proteins were analyzed by SDS-PAGE. One prominent protein of 66 kDa was excised from the gel, digested with trypsin and the masses of the resultant fragments were determined by MALDI/MS. Twenty-one of 38 monoisotopic peptide masses obtained after tryptic digestion were matched to the heat shock protein Ssb1/Hsp75, covering 37% of its sequence. Computational analysis of the primary structure of Ssb1/Hsp75 identified a unique potential amphipathic alpha-helix in its N-terminal ATPase domain with features of target regions for Ca2+/calmodulin binding. This region, which shares 89% similarity to the experimentally determined calmodulin-binding domain from mouse, Hsc70, is conserved in near half of the 113 members of the HSP70 family investigated, from yeast to plant and animals. Based on the sequence of this region, phylogenetic analysis grouped the HSP70s in three distinct branches. Two of them comprise the non-calmodulin binding Hsp70s BIP/GR78, a subfamily of eukaryotic HSP70 localized in the endoplasmic reticulum, and DnaK, a subfamily of prokaryotic HSP70. A third heterogeneous group is formed by eukaryotic cytosolic HSP70s containing the new calmodulin-binding motif and other cytosolic HSP70s whose sequences do not conform to those conserved motif, indicating that not all eukaryotic cytosolic Hsp70s are target for calmodulin regulation. Furthermore, the calmodulin-binding domain found in eukaryotic HSP70s is also the target for binding of Bag-1 - an enhancer of ADP/ATP exchange activity of Hsp70s. A model in which calmodulin displaces Bag-1 and modulates Ssb1/Hsp75 chaperone activity is discussed.

  20. Mass spectrometric analysis of a UV-cross-linked protein-DNA complex: tryptophans 54 and 88 of E. coli SSB cross-link to DNA

    DEFF Research Database (Denmark)

    Steen, Hanno; Petersen, Jørgen; Mann, Matthias


    acid and peptide entities present in such heteroconjugates. Sample preparation of the peptide-nucleic acid heteroconjugates is, therefore, a crucial step in any mass spectrometry-based analytical procedure. This study demonstrates the performance of four different MS-based strategies to characterize E....... coli single-stranded DNA binding protein (SSB) that was UV-cross-linked to a 5-iodouracil containing DNA oligomer. Two methods were optimized to circumvent the need for standard liquid chromatography and gel electrophoresis, thereby dramatically increasing the overall sensitivity of the analysis...

  1. Departmental Appeals Board Decisions (United States)

    U.S. Department of Health & Human Services — Decisions issued by the Chair and Board Members of the Departmental Appeals Board concerning determinations in discretionary, project grant programs, including...

  2. Pilot Boarding Areas (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Pilot boarding areas are locations at sea where pilots familiar with local waters board incoming vessels to navigate their passage to a destination port. Pilotage is...

  3. In Defense of Boards

    NARCIS (Netherlands)

    B. Visser (Bauke); S. Dominguez Martinez (Silvia); O.H. Swank (Otto)


    textabstractIt is often assumed that bad corporate performance means a bad CEO. The task of a board of directors is then simple: dismiss the executive. If it fails to do so, the board is said to be indolent. We take a kinder approach to observed board behaviour and point to the problems even

  4. Board of Directors or Supervisory Board

    DEFF Research Database (Denmark)

    Werlauff, Erik


    The article analyses the legal consequences of the choice now available to Danish public limited companies, which can now opt for a two-tier management structure, in which the management board undertakes both the day-to-day and the overall management, while a supervisory board exercises control...... over the management board, including its appointment and dismissal. The article considers which companies a two-tier structure may be relevant for, and reviews the consequences for the composition, election and functioning of the company organs....

  5. Establishing Proficiency Levels for the Delaware Student Testing Program in Science and Social Studies, Grades 4 & 6. Report and Recommendations to the Delaware State Board of Education. (United States)

    Delaware State Dept. of Education, Dover. Assessment and Accountability Branch.

    This document contains the results of a standard setting conducted in January 2002 on the Delaware Student Testing Program (DSTP) Science and Social Studies tests at grades 4 and 6. Each standard setting process entailed convening four groups, one for each grade level and content area, and each group met for 2 days. At the standard setting judges…

  6. Global-scale Observations of the Limb and Disk (GOLD) Mission: Science from Geostationary Orbit on-board a Commercial Communications Satellite (United States)

    Eastes, R.; Deaver, T.; Krywonos, A.; Lankton, M. R.; McClintock, W. E.; Pang, R.


    Geostationary orbits are ideal for many science investigations of the Earth system on global scales. These orbits allow continuous observations of the same geographic region, enabling spatial and temporal changes to be distinguished and eliminating the ambiguity inherent to observations from low Earth orbit (LEO). Just as observations from geostationary orbit have revolutionized our understanding of changes in the troposphere, they will dramatically improve our understanding of the space environment at higher altitudes. However, geostationary orbits are infrequently used for science missions because of high costs. Geostationary satellites are large, typically weighing tons. Consequently, devoting an entire satellite to a science mission requires a large financial commitment, both for the spacecraft itself and for sufficient science instrumentation to justify a dedicated spacecraft. Furthermore, the small number of geostationary satellites produced for scientific missions increases the costs of each satellite. For these reasons, it is attractive to consider flying scientific instruments on satellites operated by commercial companies, some of whom have fleets of ~40 satellites. However, scientists' lack of understanding of the capabilities of commercial spacecraft as well as commercial companies' concerns about risks to their primary mission have impeded the cooperation necessary for the shared use of a spacecraft. Working with a commercial partner, the GOLD mission has successfully overcome these issues. Our experience indicates that there are numerous benefits to flying on commercial communications satellites (e.g., it is possible to downlink large amounts of data) and the costs are low if the experimental requirements adequately match the capabilities and available resources of the host spacecraft. Consequently, affordable access to geostationary orbit aboard a communications satellite now appears possible for science payloads.

  7. 31st August 2011 - Government of Japan R. Chubachi, Executive Member of the Council for Science and Technology Policy, Cabinet Office, Vice Chairman, Representative Corporate Executive Officer and Member of the Board, Sony Corporation, visiting the ATLAS experimental area with Former Collaboration Spokesperson P. Jenni and Senior physicist T. Kondo.

    CERN Multimedia

    Raphaël Piguet


    31st August 2011 - Government of Japan R. Chubachi, Executive Member of the Council for Science and Technology Policy, Cabinet Office, Vice Chairman, Representative Corporate Executive Officer and Member of the Board, Sony Corporation, visiting the ATLAS experimental area with Former Collaboration Spokesperson P. Jenni and Senior physicist T. Kondo.

  8. Spaceborne synthetic aperture radar: Current status and future directions. A report to the Committee on Earth Sciences, Space Studies Board, National Research Council (United States)

    Evans, D. L. (Editor); Apel, J.; Arvidson, R.; Bindschadler, R.; Carsey, F.; Dozier, J.; Jezek, K.; Kasischke, E.; Li, F.; Melack, J.


    This report provides a context in which questions put forth by NASA's Office of Mission to Planet Earth (OMPTE) regarding the next steps in spaceborne synthetic aperture radar (SAR) science and technology can be addressed. It summarizes the state-of-the-art in theory, experimental design, technology, data analysis, and utilization of SAR data for studies of the Earth, and describes potential new applications. The report is divided into five science chapters and a technology assessment. The chapters summarize the value of existing SAR data and currently planned SAR systems, and identify gaps in observational capabilities needing to be filled to address the scientific questions. Cases where SAR provides complementary data to other (non-SAR) measurement techniques are also described. The chapter on technology assessment outlines SAR technology development which is critical not only to NASA's providing societally relevant geophysical parameters but to maintaining competitiveness in SAR technology, and promoting economic development.

  9. Marine Science

    African Journals Online (AJOL)

    Science. The journal has a new and more modern layout, published online only, and the editorial. Board was increased to include more disciplines pertaining to marine sciences. While important chal- lenges still lie ahead, we are steadily advancing our standard to increase visibility and dissemination throughout the global ...

  10. 6.4 Tb/s (32 × 200 Gb/s) WDM direct-detection transmission with twin-SSB modulation and Kramers-Kronig receiver (United States)

    Zhu, Yixiao; Jiang, Mingxuan; Ruan, Xiaoke; Chen, Zeyu; Li, Chenjia; Zhang, Fan


    We experimentally demonstrate 6.4 Tb/s wavelength division multiplexed (WDM) direct-detection transmission based on Nyquist twin-SSB modulation over 25 km SSMF with bit error rates (BERs) below the 20% hard-decision forward error correction (HD-FEC) threshold of 1.5 × 10-2. The two sidebands of each channel are separately detected using Kramers-Kronig receiver without MIMO equalization. We also carry out numerical simulations to evaluate the system robustness against I/Q amplitude imbalance, I/Q phase deviation and the extinction ratio of modulator, respectively. Furthermore, we show in simulation that the requirement of steep edge optical filter can be relaxed if multi-input-multi-output (MIMO) equalization between the two sidebands is used.

  11. Atomic Energy Control Board

    International Nuclear Information System (INIS)

    Blackman, N.S.; Gummer, W.K.


    This paper has been prepared to provide an overview of the responsibilities and activities of the Atomic Energy Control Board. It is designed to address questions that are often asked concerning the establishment of the Atomic Energy Control Board, its enabling legislation, licensing and compliance activities, federal-provincial relationships, international obligations, and communications with the public

  12. SMART Boards Rock (United States)

    Giles, Rebecca M.; Shaw, Edward L.


    SMART Board is a technology that combines the functionality of a whiteboard, computer, and projector into a single system. The interactive nature of the SMART Board offers many practical uses for providing an introduction to or review of material, while the large work area invites collaboration through social interaction and communication. As a…

  13. 78 FR 10607 - National Sea Grant Advisory Board (United States)


    ... extension, science and technology programs, and other matters as described in the agenda found on the National Sea Grant College Program Web site at . Dated: February 6, 2013. Jason Donaldson, Chief...

  14. Boards on the Move: Surfboards, Skateboards, Snowboards, and Kiteboards (United States)

    Moye, Johnny J.; Ritz, John M.


    Technological advances through mathematics and science have made possible the modification of boarding sports. This article discusses the development of sport technologies that use boards and also touches on the social and cultural effects of the new technologies. It identifies many new forms of sports equipment that were spawned from modifying…

  15. 77 FR 2541 - Board Meeting (United States)


    ... FARM CREDIT SYSTEM INSURANCE CORPORATION Board Meeting AGENCY: Farm Credit System Insurance Corporation Board; Regular Meeting. SUMMARY: Notice is hereby given of the regular meeting of the Farm Credit System Insurance Corporation Board (Board). DATE AND TIME: The meeting of the Board will be held at the...

  16. Status of research methods used in the dissertations of graduates from Tabriz University of Medical Sciences (Assistantship, MD, Board and MSc for the years 1996-2006

    Directory of Open Access Journals (Sweden)

    Abbas Doulani


    Full Text Available   The present study seeks to examine the status of research methods employed in dissertations submitted by graduates of Tabriz University of Medical Sciences. The study also examined the impact factors. Using content analysis, the research methods were divided into four groups: historical, descriptive, empirical and literature review. The distributions for each method were calculated on the basis of gender, graduate level, citations, time frame and fields of study. Samples were chosen randomly from among the dissertations available at faculty libraries at TUMS. 390 dissertations were selected. Findings demonstrated that gender did not influence the choice of research method. With exception of Nursing faculty, graduate level proved to be an prominent factor when choosing research method. All types of citations (books, journals, online and non-printed sources were identified as another significant factor impacting pushing towards any given research method. With exception of Hygiene and Food Faculty, the time factor affected the research method selection process as well. Finally, given their different research characteristics, the field of studies investigated also contributed to both the scope and direction of research methods chosen.

  17. Decamp Clock Board Firmware

    International Nuclear Information System (INIS)

    Vicente, J. de; Castilla, J.; Martinez, G.


    Decamp (Dark Energy Survey Camera) is a new instrument designed to explore the universe aiming to reveal the nature of Dark Energy. The camera consists of 72 CCDs and 520 Mpixels. The readout electronics of DECam is based on the Monsoon system. Monsoon is a new image acquisition system developed by the NOAO (National Optical Astronomical Observatory) for the new generation of astronomical cameras. The Monsoon system uses three types of boards inserted in a Eurocard format based crate: master control board, acquisition board and clock board. The direct use of the Monsoon system for DECam readout electronics requires nine crates mainly due to the high number of clock boards needed. Unfortunately, the available space for DECam electronics is constrained to four crates at maximum. The major drawback to achieve such desired compaction degree resides in the clock board signal density. This document describes the changes performed at CIEMAT on the programmable logic of the Monsoon clock board aiming to meet such restricted space constraints. (Author) 5 refs

  18. Decamp Clock Board Firmware

    Energy Technology Data Exchange (ETDEWEB)

    Vicente, J. de; Castilla, J.; Martinez, G.


    Decamp (Dark Energy Survey Camera) is a new instrument designed to explore the universe aiming to reveal the nature of Dark Energy. The camera consists of 72 CCDs and 520 Mpixels. The readout electronics of DECam is based on the Monsoon system. Monsoon is a new image acquisition system developed by the NOAO (National Optical Astronomical Observatory) for the new generation of astronomical cameras. The Monsoon system uses three types of boards inserted in a Eurocard format based crate: master control board, acquisition board and clock board. The direct use of the Monsoon system for DECam readout electronics requires nine crates mainly due to the high number of clock boards needed. Unfortunately, the available space for DECam electronics is constrained to four crates at maximum. The major drawback to achieve such desired compaction degree resides in the clock board signal density. This document describes the changes performed at CIEMAT on the programmable logic of the Monsoon clock board aiming to meet such restricted space constraints. (Author) 5 refs.


    CERN Multimedia

    Human Resources Division


    The Joint Advisory Appeals Board was convened to examine the appeal lodged by Mr Luc Vos with regard to advancement. As the appellant has not objected, the report of the Board and the final decision of the Director-General are brought to the notice of the personnel in accordance with Article R VI 1.20 of the Staff Regulations. The relevant documents will therefore be posted on the notice boards of the Administration Building (N° 60) from 14 to 28 June 2002. Human Resources Division Tel. 74128

  20. Joint Advisory Appeals Board

    CERN Multimedia

    HR Department


    The Joint Advisory Appeals Board has examined the internal appeal lodged by a member of the personnel against the decision to grant him only a periodic one-step advancement for the 2006 reference year. The person concerned has not objected to the report of the Board and the final decision of the Director-General being brought to the attention of the members of the personnel. In application of Article R VI 1.18 of the Staff Regulations, these documents will therefore be posted on the notice board of the Main building (bldg. 500) from 1 September to 14 September 2008. Human Resources Department (73911)

  1. Joint Advisory Appeals Board

    CERN Multimedia


    The Joint Advisory Appeals Board was convened to examine the appeal lodged by Mr Poul Frandsen concerning his assimilation into the new career structure. As the appellant has not objected, the report of the Board and the final decision of the Director-General are brought to the notice of the personnel in accordance with Article R VI 1.20 of the Staff Regulations. The relevant documents will therefore be posted on the notice boards of the Administration Building (N° 60) from 13 to 24 January 2003. Human Resources Division Tel. 74128


    CERN Multimedia

    Personnel Division


    The Joint Advisory Appeals Board was convened to examine the appeal lodged by Mr Joào Bento with regard to residential category. As the appellant has not objected, the recommendations of the Board and the final decision of the Director-General are brought to the notice of the personnel in accordance with Article RÊVIÊ1.20 of the Staff Regulations.The relevant documents will therefore be posted on the notice boards of the Administration Building (N¡ 60) from 29 October to 12 November 1999.Personnel DivisionTel. 74128

  3. Joint Advisory Appeals Board

    CERN Multimedia

    HR Department


    The Joint Advisory Appeals Board was convened to examine an appeal lodged by a member of the personnel with regard to advancement. The person concerned has requested that the report of the Board and the final decision of the Director-General be brought to the notice of the personnel in accordance with Article R VI 1.20 of the Staff Regulations. The relevant documents will therefore be posted on the notice boards of the Administration Building (No. 60) from 24 March to 10 April 2006. Human Resources Department Tel. 74128

  4. Joint Advisory Appeals Board

    CERN Multimedia

    HR Department


    The Joint Advisory Appeals Board was convened to examine an internal appeal lodged by a member of the personnel with regard to the decision not to grant him an indefinite contract. The person concerned has requested that the report of the Board and the final decision of the Director-General be brought to the notice of the members of the personnel, in accordance with Article R VI 1.18 of the Staff Regulations. The relevant documents will therefore be posted on the notice board of the Main building (Bldg. 60) from 24 September to 7 October 2007. Human Resources Department


    CERN Multimedia

    Human Resources Division


    The Joint Advisory Appeals Board was convened to examine the appeal lodged by Mr Olivier Francis Martin with regard to indefinite contract. As the appellant has not objected, the report of the Board and the final decision of the Director-General are brought to the notice of the personnel in accordance with Article R VI 1.20 of the Staff Regulations. The relevant documents will therefore be posted on the notice boards of the Administration Building (N° 60) from 8 to 25 June 2001.


    CERN Multimedia

    Human Resources Division


    The Joint Advisory Appeals Board was convened to examine the appeal lodged by Mr Jack Blanchard with regard to 'non recognition of specific functions'. As the appellant has not objected, the report of the Board and the final decision of the Director-General are brought to the notice of the personnel in accordance with Article R VI 1.20 of the Staff Regulations. The relevant documents will therefore be posted on the notice boards of the Administration Building (N° 60) from 12th to 26th April 2002. Human Resources Division Tel. 74128

  7. Joint Advisory Appeals Board

    CERN Multimedia


    The Joint Advisory Appeals Board was convened to examine the appeal lodged by Mrs Judith Igo-Kemenes concerning the application of procedures foreseen by Administrative Circular N§ 26 (Rev. 3). As the appellant has not objected, the report of the Board and the final decision of the Director-General are brought to the notice of the personnel in accordance with Article R VI 1.20 of the Staff Regulations. The relevant documents will therefore be posted on the notice boards of the Administration Building (N° 60) from 6 to 20 June 2003. Human Resources Division Tel. 74128

  8. Joint Advisory Appeals Board

    CERN Multimedia


    The Joint Advisory Appeals Board was convened to examine the appeal lodged by Mrs Maria DIMOU with regard to a periodic one-step increase. As the appellant has not objected, the report of the Board and the final decision of the Director-General are brought to the notice of the personnel in accordance with Article R VI 1.20 of the Staff Regulations. The relevant documents will therefore be posted on the notice boards of the Administration Building (N° 60) from 30 April to 14 May 2004. Human Resources Department Tel. 74128


    CERN Multimedia

    Human Resources Division


    The Joint Advisory Appeals Board was convened to examine the appeal lodged by Mr Joël Lahaye with regard to non-resident allowance. As the appellant has not objected, the report of the Board and the final decision of the Director-General are brought to the notice of the personnel in accordance with Article R VI 1.20 of the Staff Regulations. The relevant documents will therefore be posted on the notice boards of the Administration Building (N° 60) from 18 May to 1st June 2001.

  10. Joint Advisory Appeals Board

    CERN Multimedia

    HR Department


    The Joint Advisory Appeals Board has examined the internal appeal lodged by a member of the personnel with regard to the decision not to award him a periodic one-step advancement for the 2006 reference year. The person concerned has not objected to the report of the Board and the final decision of the Director-General being brought to the notice of the members of the personnel. In application of Article R VI 1.18 of the Staff Regulations, these documents will therefore be posted on the notice board of the Main building (Bldg. 500) from 17 March to 30 March 2008. Human Resources Department Tel. 73911


    CERN Multimedia

    Human Resources Division


    The Joint Advisory Appeals Board was convened to examine the appeal lodged by Mr Bertrand Nicquevert with regard to the non-resident allowance. As the appellant has not objected, the report of the Board and the final decision of the Director-General are brought to the notice of the personnel in accordance with Article R VI 1.20 of the Staff Regulations. The relevant documents will therefore be posted on the notice boards of the Administration Building (N° 60) from 29 November to 13 December 2002. Human Resources Division Tel. 74128


    CERN Multimedia

    Human Resources Division


    The Joint Advisory Appeals Board was convened to examine the appeal lodged by Mr Antonio Millich with regard to advancement. As the appellant has not objected, the report of the Board and the final decision of the Director-General are brought to the notice of the personnel in accordance with Article R VI 1.20 of the Staff Regulations. The relevant documents will therefore be posted on the notice boards of the Administration Building (N° 60) from 27 September to 11 October 2002. Human Resources Division Tel. 74128

  13. Joint Advisory Appeals Board

    CERN Multimedia

    Human Resources Department


    The Joint Advisory Appeals Board was convened to examine an appeal lodged by a member of the personnel with regard to a periodic one-step increase. As the appellant has not objected, the report of the Board and the final decision of the Director-General are brought to the notice of the personnel in accordance with Article R VI 1.20 of the Staff Regulations. The relevant documents will therefore be posted on the notice boards of the Administration Building (N° 60) from 1 to 15 April 2005. Human Resources Department Tel. 74128

  14. Joint Advisory Appeals Board

    CERN Multimedia

    HR Department


    The Joint Advisory Appeals Board has examined the internal appeal lodged by a member of the personnel against the decision to grant him only a periodic one-step advancement for the 2006 reference year. The person concerned has not objected to the report of the Board and the final decision of the Director-General being brought to the attention of the members of the personnel. In application of Article R VI 1.18 of the Staff Regulations, these documents will therefore be posted on the notice board of the Main Building (Bldg. 500) from 1 September to 14 September 2008. Human Resources Department (73911)


    CERN Multimedia

    Human Resources Division


    The Joint Advisory Appeals Board was convened to examine the appeal lodged by Mr Gert Jan Bossen with regard to dependent child allowance. As the appellant has not objected, the report of the Board and the final decision of the Director-General are brought to the notice of the personnel in accordance with Article R VI 1.20 of the Staff Regulations. The relevant documents will therefore be posted on the notice boards of the Administration Building (N° 60) from 1st to 15 March 2002. Human Resources Division Tel. 74128

  16. Joint Advisory Appeals Board

    CERN Multimedia

    HR Department


    The Joint Advisory Appeals Board has examined the internal appeal lodged by a member of the personnel with regard to the decision not to grant him an indefinite contract. The person concerned has not objected to the report of the Board and the final decision of the Director-General being brought to the notice of the members of the personnel. In application of Article R VI 1.18 of the Staff Regulations, these documents will therefore be posted on the notice board of the Main Building (Bldg. 500) from 26 May to 6 June 2008. Human Resources Department (73911)


    CERN Multimedia

    Human Resources Division


    The Joint Advisory Appeals Board was convened to examine the appeal lodged by Mr Serge Peraire with regard to exceptional advancement. As the appellant has not objected, the report of the Board and the final decision of the Director-General are brought to the notice of the personnel in accordance with Article R VI 1.20 of the Staff Regulations. The relevant documents will therefore be posted on the notice boards of the Administration Building (N° 60) from 17 to 31 May 2002. Human Resources Division Tel. 74128

  18. Joint Advisory Appeals Board

    CERN Multimedia

    HR Department


    The Joint Advisory Appeals Board was convened to examine an internal appeal lodged by a member of the personnel with regard to the decision not to grant him an indefinite contract. The person concerned has not objected to the report of the Board and the final decision of the Director-General being brought to the notice of the members of the personnel, in accordance with Article R VI 1.18 of the Staff Regulations. These documents will therefore be posted on the notice board of the Main Building (Bldg. 60) from 21 January to 3 February 2008. Human Resources Department (73911)

  19. Primer printed circuit boards

    CERN Document Server

    Argyle, Andrew


    Step-by-step instructions for making your own PCBs at home. Making your own printed circuit board (PCB) might seem a daunting task, but once you master the steps, it's easy to attain professional-looking results. Printed circuit boards, which connect chips and other components, are what make almost all modern electronic devices possible. PCBs are made from sheets of fiberglass clad with copper, usually in multiplelayers. Cut a computer motherboard in two, for instance, and you'll often see five or more differently patterned layers. Making boards at home is relatively easy

  20. Joint Advisory Appeals Board

    CERN Multimedia


    The Joint Advisory Appeals Board was convened to examine the appeal lodged by Mr Aloïs Girardoz with regard to classification and advancement. As the appellant has not objected, the Board's report and the Director-General's decision will be brought to the notice of the personnel in accordance with Article R VI 1.20 of the Staff Regulations. The relevant documents will therefore be posted on the notice boards of the Administration Building (N° 60) from 15 to 29 August 2003. Human Resources Division Tel. 74128

  1. science

    International Development Research Centre (IDRC) Digital Library (Canada)

    David Spurgeon

    Give us the tools: science and technology for development. Ottawa, ...... altered technical rela- tionships among the factors used in the process of production, and the en- .... to ourselves only the rights of audit and periodic substantive review." If a ...... and destroying scarce water reserves, recreational areas and a generally.

  2. Boat boarding ladder placement (United States)


    Presented in three volumes; 'Boat Boarding Ladder Placement,' which explores safety considerations including potential for human contact with a rotating propeller; 'Boat Handhold Placement,' which explores essential principles and methods of fall con...

  3. Checking a printed board

    CERN Multimedia


    An 'Interactive Printed Circuit Board Design System' has been developed by a company in a Member-State. Printed circuits are now produced at the SB's surface treatment workshop using a digitized photo-plotter.

  4. Boarding school rules. (United States)

    Griffiths, Matt


    Ofsted inspects and regulates services that care for children and young people, including boarding facilities. Medication management is an integral part of caring for children in boarding schools, and robust systems must be in place to pass inspection. These systems must cover how medicines are dispensed, administered and stored at the facility, risk assessments, identifying which pupils can manage their own medicines and the individual health needs of boarders, so that care plans can be put in place for children with specific needs.


    CERN Multimedia

    B. Cousins

    Open Access Publication Policy ATLAS had recently issued a short statement in support of open access publishing. The mood of the discussions in the December CMS Collaboration Board had appeared to be in favour and so it was being proposed that CMS issue the same statement as that made by ATLAS (the statement is attached to the agenda of this meeting). The Collaboration Board agreed. Election of the Chair of the Collaboration Board Following the agreement to shorten the terms of both the Spokesperson and the Collaboration Board Chair, and to introduce a longer overlap period between the election and the start of the term, the election for the next Collaboration Board Chair was due in December 2007. If the old standard schedule specified in the Constitution were adapted to this date, then the Board should be informed at the present meeting that the election was being prepared. However, it was felt that the experience of the previous year's election of the Spokesperson had shown that it would be desirable to...

  6. A Circuit Board Using a Sheet of Thick Paper and Aluminium Tape (United States)

    Kamata, Masahiro; Honda, Motoshi


    We have developed a circuit board using materials that are inexpensive and familiar to elementary school students. Most of the responses from students who made this board were relatively positive and we observed them enjoy making the boards at a Science Festival in Japan and in elementary school. As an application, we also developed a tiny torch…

  7. Preoptometry and optometry school grade point average and optometry admissions test scores as predictors of performance on the national board of examiners in optometry part I (basic science) examination. (United States)

    Bailey, J E; Yackle, K A; Yuen, M T; Voorhees, L I


    To evaluate preoptometry and optometry school grade point averages and Optometry Admission Test (OAT) scores as predictors of performance on the National Board of Examiners in Optometry NBEO Part I (Basic Science) (NBEOPI) examination. Simple and multiple correlation coefficients were computed from data obtained from a sample of three consecutive classes of optometry students (1995-1997; n = 278) at Southern California College of Optometry. The GPA after year two of optometry school was the highest correlation (r = 0.75) among all predictor variables; the average of all scores on the OAT was the highest correlation among preoptometry predictor variables (r = 0.46). Stepwise regression analysis indicated a combination of the optometry GPA, the OAT Academic Average, and the GPA in certain optometry curricular tracks resulted in an improved correlation (multiple r = 0.81). Predicted NBEOPI scores were computed from the regression equation and then analyzed by receiver operating characteristic (roc) and statistic of agreement (kappa) methods. From this analysis, we identified the predicted score that maximized identification of true and false NBEOPI failures (71% and 10%, respectively). Cross validation of this result on a separate class of optometry students resulted in a slightly lower correlation between actual and predicted NBEOPI scores (r = 0.77) but showed the criterion-predicted score to be somewhat lax. The optometry school GPA after 2 years is a reasonably good predictor of performance on the full NBEOPI examination, but the prediction is enhanced by adding the Academic Average OAT score. However, predicting performance in certain subject areas of the NBEOPI examination, for example Psychology and Ocular/Visual Biology, was rather insubstantial. Nevertheless, predicting NBEOPI performance from the best combination of year two optometry GPAs and preoptometry variables is better than has been shown in previous studies predicting optometry GPA from the best

  8. Board Certification in Counseling Psychology (United States)

    Crowley, Susan L.; Lichtenberg, James W.; Pollard, Jeffrey W.


    Although specialty board certification by the American Board of Professional Psychology (ABPP) has been a valued standard for decades, the vast majority of counseling psychologists do not pursue board certification in the specialty. The present article provides a brief history of board certification in general and some historical information about…

  9. 78 FR 4847 - Board Meeting (United States)


    ... FARM CREDIT SYSTEM INSURANCE CORPORATION Board Meeting AGENCY: Farm Credit System Insurance Corporation. SUMMARY: Notice is hereby given of the regular meeting of the Farm Credit System Insurance Corporation Board (Board). DATE AND TIME: The meeting of the Board will be held at the offices of the Farm...

  10. 77 FR 55837 - Board Meeting (United States)


    ... FARM CREDIT SYSTEM INSURANCE CORPORATION Board Meeting AGENCY: Farm Credit System Insurance Corporation. ACTION: Regular meeting. SUMMARY: Notice is hereby given of the regular meeting of the Farm Credit System Insurance Corporation Board (Board). Date and Time: The meeting of the Board will be held...

  11. Defense Science Board Summer Study on Autonomy (United States)


    classification societies to explore the economic, social, legal , regulatory and technological factors which need to be addressed to make autonomous ships a...used for both training and dealing with vulnerabilities, to provide additional opportunities for red teaming. Cultural, policy, and legal issues The...inappropriate targeting, self-destruction, system abort and return to base, and so on. The vulnerabilities that an adversary might exploit could result from

  12. Defense Science Board Report on Advanced Computing (United States)


    computers  will  require extensive  research and development  to have a chance of  reaching  the  exascale   level.  Even  if  exascale   level machines  can...generations of petascale and then  exascale   level  computing  capability.  This  includes  both  the  hardware  and  the  complex  software  that  may  be...required  for  the  architectures  needed  for  exacscale  capability.  The  challenges  are  extremely  daunting,  especially  at  the  exascale

  13. Defense Science Board Task Force on Mobility

    National Research Council Canada - National Science Library

    Tuttle, Jr, William G


    .... national security objectives as it is today. Both the 2001 and 2005 National Defense Strategy objectives place greater emphasis than in the past on the nation's worldwide commitments, increasing the demand for responsive forces capable...

  14. 77 FR 476 - Science Advisory Board (United States)


    ... provide optimal support to resource management. Matters To Be Considered: The meeting will include the... Group and (3) Update from the Research and Development Portfolio Review Task Force and discussion of...

  15. 78 FR 68480 - National Science Board (United States)


    ... business, as follows: Date and Time: Monday, November 18, 2013 at 11:00 a.m. EST. Subject Matter: Consideration of nominations for honorary awards. Status: Closed. This meeting will be held by teleconference... 22230. Telephone: (703) 292-7000. Ann Bushmiller, NSB Senior Legal Counsel. [FR Doc. 2013-27199 Filed 11...

  16. 7 CFR 1160.105 - Board. (United States)


    ... and Orders; Milk), DEPARTMENT OF AGRICULTURE FLUID MILK PROMOTION PROGRAM Fluid Milk Promotion Order Definitions § 1160.105 Board. Board means the National Processor Advertising and Promotion Board established... Promotion Board or Board). ...

  17. Quantitative proteomics and network analysis of SSA1 and SSB1 deletion mutants reveals robustness of chaperone HSP70 network in Saccharomyces cerevisiae. (United States)

    Jarnuczak, Andrew F; Eyers, Claire E; Schwartz, Jean-Marc; Grant, Christopher M; Hubbard, Simon J


    Molecular chaperones play an important role in protein homeostasis and the cellular response to stress. In particular, the HSP70 chaperones in yeast mediate a large volume of protein folding through transient associations with their substrates. This chaperone interaction network can be disturbed by various perturbations, such as environmental stress or a gene deletion. Here, we consider deletions of two major chaperone proteins, SSA1 and SSB1, from the chaperone network in Sacchromyces cerevisiae. We employ a SILAC-based approach to examine changes in global and local protein abundance and rationalise our results via network analysis and graph theoretical approaches. Although the deletions result in an overall increase in intracellular protein content, correlated with an increase in cell size, this is not matched by substantial changes in individual protein concentrations. Despite the phenotypic robustness to deletion of these major hub proteins, it cannot be simply explained by the presence of paralogues. Instead, network analysis and a theoretical consideration of folding workload suggest that the robustness to perturbation is a product of the overall network structure. This highlights how quantitative proteomics and systems modelling can be used to rationalise emergent network properties, and how the HSP70 system can accommodate the loss of major hubs. © 2015 The Authors. PROTEOMICS published by Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  18. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Editorial Board. Editorial Board. Resonance – Journal of Science Education. Chief Editor. N Sathyamurthy, Jawaharlal Nehru Centre for Advanced Scientific Research, Bangalore ... Guruswamy Kumaraswamy, CSIR-National Chemical Laboratory, Pune


    CERN Multimedia

    Human Resources Division


    The Joint Advisory Appeals Board was convened to examine the appeal lodged by Mr Neil Calder, Mrs Sudeshna Datta Cockerill, Mrs Andrée Fontbonne, Mrs Moniek Laurent and Mr Ulrich Liptow with regard to membership in the Pension Fund under the period with a Paid Associate contract, appeals dealt with on a collective basis. As the appellants have not objected, the report of the Board and the final decision of the Director-General are brought to the notice of the personnel in accordance with Article R VI 1.20 of the Staff Regulations. The relevant documents will therefore be posted on the notice boards of the Administration Building (N° 60) from 10 to 31 August 2001.

  20. Pension Fund Governing Board

    CERN Multimedia

    HR Department


    Note The CERN pension scheme is based on the principle of defined benefits, so beneficiaries continue to receive the benefits to which they are entitled in accordance with the Rules of the Pension Fund. This means that pension entitlements under the Rules are not directly affected by the financial crisis and the current economic situation. However, the adjustment of pensions to the cost of living is not automatic and, under the method applied since 2006, must take into account the Fund’s financial position. Meeting of the Pension Fund Governing Board The Pension Fund Governing Board held its eighth meeting at ESO in Garching, Germany (near Munich) on 24 October 2008. Before starting its work, the Governing Board had the privilege of hearing an opening address by Professor Tim de Zeeuw, the Director General of ESO. Professor de Zeeuw described the mission of ESO and the ambitious projects of his organisation, which performs astronomy observations using telescopes located in...

  1. WeaselBoard :

    Energy Technology Data Exchange (ETDEWEB)

    Mulder, John C.; Schwartz, Moses Daniel; Berg, Michael J.; Van Houten, Jonathan Roger; Urrea, Jorge Mario; King, Michael Aaron; Clements, Abraham Anthony; Jacob, Joshua A.


    Critical infrastructures, such as electrical power plants and oil refineries, rely on programmable logic controllers (PLCs) to control essential processes. State of the art security cannot detect attacks on PLCs at the hardware or firmware level. This renders critical infrastructure control systems vulnerable to costly and dangerous attacks. WeaselBoard is a PLC backplane analysis system that connects directly to the PLC backplane to capture backplane communications between modules. WeaselBoard forwards inter-module traffic to an external analysis system that detects changes to process control settings, sensor values, module configuration information, firmware updates, and process control program (logic) updates. WeaselBoard provides zero-day exploit detection for PLCs by detecting changes in the PLC and the process. This approach to PLC monitoring is protected under U.S. Patent Application 13/947,887.

  2. Joint Advisory Appeals Board

    CERN Multimedia


    The Joint Advisory Appeals Board has examined the internal appeal lodged by a former member of the personnel, a beneficiary of the CERN Pension Fund, against the calculation of his pension in the framework of the Progressive Retirement Programme.   The person concerned has not objected to the report of the Board and the final decision of the Director-General being brought to the attention of the members of the personnel. In application of Article R VI 1.18 of the Staff Regulations, these documents will therefore be available from 26 July to 11 August 2013 at the following link. HR Department Head Office

  3. 76 FR 70970 - Technology Innovation Program Advisory Board (United States)


    ... Technology, Education, and Science (COMPETES) Act, Public Law 110-69 (August 9, 2007), 15 U.S.C. 278n, the... eminent in such fields as business, research, science and technology, engineering, education, and... Program Advisory Board AGENCY: National Institute of Standards and Technology, Department of Commerce...

  4. Does Board Diversity Really Matter?

    DEFF Research Database (Denmark)

    Rose, Caspar; Munch-Madsen, Peter; Funch, Maja


    We study the impact of female board representation as well as citizenship on corporate performance based on a sample of the largest listed firms in the Nordic countries as well as Germany. We also seek to determine the variation of board structures using factor analysis. We find no support for any...... performance impact relating to female board representation. However, we find an impact of board citizenship on performance showing that board members with a background from common law have a significant positive influence on corporate performance measured as ROA, ROE and ROCE. Consistent with other studies we...... also document that large boards impact corporate performance negatively. Moreover we also show that data set on boards can be explained by four underlying factors. This article adds insight to board determinants of corporate performance as well as the classification of board variation. Specifically...

  5. Magnetic field on board

    International Nuclear Information System (INIS)

    Estevez Radio, H.; Fernandez Arenal, C.A.


    Here, the calculation of the magnetic field on board ships is performed, using matrix calculus, in a similar way as when the magnetic field in matter is studied. Thus the final formulas are written in a more compact form and they are obtained through a simpler way, more suitable for the university education. (Author)

  6. Board affiliation and pay gap

    Directory of Open Access Journals (Sweden)

    Shenglan Chen


    Full Text Available This paper examines the effects of board affiliation on the corporate pay gap. Using a sample of Chinese listed firms from 2005 to 2011, we find that boards with a greater presence of directors appointed by block shareholders have lower pay gaps. Furthermore, the governance effects of board affiliation with and without pay are distinguished. The empirical results show that board affiliation without pay is negatively related to the pay gap, while board affiliation with pay is positively related to the pay gap. Overall, the results shed light on how block shareholders affect their companies’ pay gaps through board affiliation.

  7. Board and Deans of Amsterdam University, Netherlands

    CERN Document Server

    Patrice Loïez


    L. to r.: Dr Thomas Taylor, CERN IT Deputy Division Leader; Prof. Dymph C. van den Boom, Dean Faculty of Social and Behavioural Sciences, Professor in Empirical Thoretical Pedagogy; Prof. Jos Engelen, NIKHEF/University of Amsterdam, Dutch Delegate to the Scientific Policy Committee and Chairman of the LHC Committee; Prof. Jacob van der Gaag, Dean Faculty of Economic Science and Econometry, Professor in Developmenteconomy;Mr Jan van der Boon, CERN Director of Admnistration; Prof. Jan Robert Bausch, Dean Faculty of Dental Medicine, Professor in general Dentistry; Dr Sijbolt J. Noorda, President of the Board of the University of Amsterdam.

  8. SVX Sequencer Board

    International Nuclear Information System (INIS)

    Utes, M.


    The SVX Sequencer boards are 9U by 280mm circuit boards that reside in slots 2 through 21 of each of eight Eurocard crates in the D0 Detector Platform. The basic purpose is to control the SVX chips for data acquisition and when a trigger occurs, to gather the SVX data and relay the data to the VRB boards in the Movable Counting House. Functions and features are as follows: (1) Initialization of eight SVX chip strings using the MIL-STD-1553 data bus; (2) Real time manipulation of the SVX control lines to effect data acquisition, digitization, and readout based on the NRZ/Clock signals from the Controller; (3) Conversion of 8-bit electrical SVX readout data to an optical signal operating at 1.062 Gbit/sec, sent to the VRB. Eight HDIs will be serviced per board; (4) Built-in logic analyzer which can record the most important control and data lines during a data acquisition cycle and put this recorded information onto the 1553 bus; (5) Identification header and end of data trailer tacked onto data stream; (6) 1553 register which can read the current values of the control and data lines; (7) 1553 register which can test the optical link; (8) 1553 registers for crossing pulse width, calibration pulse voltage, and calibration pipeline select; (9) 1553 register for reading the optical drivers status link; (10) 1553 register for power control of SVX chips and ignoring bad SVX strings; (11) Front panel displays and LEDs show the board status at a glance; (12) In-system programmable EPLDs are programmed via 1553 or Altera's 'Bitblaster'; (13) Automatic readout abort after 45us; (14) Supplies BUSY signal back to Trigger Framework; (15) Supports a heartbeat system to prevent excessive SVX current draw; and (16) Supports a SVX power trip feature if heartbeat failure occurs.

  9. Proceedings – Mathematical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Editorial Board. Proceedings – Mathematical Sciences. Chief Editor. B V Rajarama Bhat, Indian Statistical Institute, Bengaluru ( Associate Editor. Parameswaran Sankaran, The Institute of Mathematical Sciences, Chennai ( Advisory Board. M S Raghunathan, Indian Institute of ...

  10. Board diversity in family firms


    Menozzi, Anna; Fraquelli, Giovanni; Novara, Jolanda de


    The paper deals with diversity as a key factor to improve the board of directors’ decision process in family firms. The empirical literature about board diversity points at the positive impact of diversity on board functioning and firm performance. The paper uses a statistical diversity index to capture the heterogeneity of board of directors and put it in relation with firm performance, as measured by firm profitability. The empirical analysis is based on a newly collected panel of 327 famil...

  11. Why Not Charter School Boards? (United States)

    Schlechty, Phillip C.; Cole, Robert W.


    Claiming that individual school board members act in selfish ways, proposes electing entire school board as a slate. Board would collectively be held responsible for performance of the school system and all of its employees. State legislation would be required to specify how interested groups would select a slate and create a charter, which is the…

  12. Board effectiveness: Investigating payment asymmetry between board members and shareholders

    Directory of Open Access Journals (Sweden)

    Wuchun Chi


    Full Text Available Board members may well be responsible for dissension between themselves and shareholders since they are simultaneously the setters and receivers of both board remuneration and dividends. They may act out of their own personal interests at the expense of external shareholders. We investigate the impact of ownership structure, board structure and control deviation on payment asymmetry, where excessively high remuneration is paid to board members but considerably lower dividends are distributed to shareholders. We find strong evidence confirming that the smaller the shareholdings of board members and outside blockholders are, the more asymmetric the payments are. With controlling family members on the board and a higher percentage of seats held by independent board members, there is a slight reduction in the likelihood and severity of payment asymmetry. In addition, it is abundantly clear that the larger the board seat-control deviation is, the greater is the likelihood and severity of payment asymmetry. While prior research has primarily focused on board-manager agency issues, the board-shareholder perspective could be even more important in that it is the board that is the most directly delegated agent of shareholders, not the managers

  13. Interpersonal Communication Processes Between Students, Caregivers of Boarding School, and Boarding School Environments in Building the Self Concept


    Maulia, Putri; Budi Lestari, SU, Dr. Dra. Sri


    In a family, interpersonal communication processes take place in nurturing and controlling against the behavior of their children. Now, many parents who choose to educate his children in boarding schools and they hopes their children can have a religious knowledge as well as a good general science, have a good character, and have a positive self-concept if educated in the boarding school. This research using a qualitative approach, aims to describing interpersonal communication processes betw...

  14. Pension Fund Governing Board

    CERN Multimedia

    HR Department


    Note The CERN pension scheme is based on the principle of defined benefits, so beneficiaries continue to receive the benefits to which they are entitled in accordance with the Rules of the Pension Fund. This means that pension entitlements under the Rules are not directly affected by the financial crisis and the current economic situation. However, the adjustment of pensions to the cost of living is not automatic and, under the method applied since 2006, must take into account the Fund’s financial position. Meeting of the Pension Fund Governing Board The Pension Fund Governing Board held its eighth meeting at ESO in Garching (near Munich), Germany on 24 October 2008. Before starting its work, the Governing Board had the privilege of hearing an opening address by Professor Tim de Zeeuw, the Director General of ESO. Professor de Zeeuw described the mission of ESO and the ambitious projects of his organisation, which performs astronomy observations using telescopes located in Chile. The Director-General receiv...

  15. Fermilab Friends for Science Education | Support Us (United States)

    Fermilab Friends for Science Education FFSE Home About Us Join Us Support Us Contact Us Support Us improving science (science, technology, engineering and mathematics) education. Your donation allows us to Testimonials Our Donors Board of Directors Board Tools Calendar Join Us Donate Now Get FermiGear! Education

  16. Patients overwhelmingly prefer inpatient boarding to emergency department boarding. (United States)

    Viccellio, Peter; Zito, Joseph A; Sayage, Valerie; Chohan, Jasmine; Garra, Gregory; Santora, Carolyn; Singer, Adam J


    Boarding of admitted patients in the emergency department (ED) is a major cause of crowding. One alternative to boarding in the ED, a full-capacity protocol where boarded patients are redeployed to inpatient units, can reduce crowding and improve overall flow. Our aim was to compare patient satisfaction with boarding in the ED vs. inpatient hallways. We performed a structured telephone survey regarding patient experiences and preferences for boarding among admitted ED patients who experienced boarding in the ED hallway and then were subsequently transferred to inpatient hallways. Demographic and clinical characteristics, as well as patient preferences, including items related to patient comfort and safety using a 5-point scale, were recorded and descriptive statistics were used to summarize the data. Of 110 patients contacted, 105 consented to participate. Mean age was 57 ± 16 years and 52% were female. All patients were initially boarded in the ED in a hallway before their transfer to an inpatient hallway bed. The overall preferred location after admission was the inpatient hallway in 85% (95% confidence interval 75-90) of respondents. In comparing ED vs. inpatient hallway boarding, the following percentages of respondents preferred inpatient boarding with regard to the following 8 items: rest, 85%; safety, 83%; confidentiality, 82%; treatment, 78%; comfort, 79%; quiet, 84%; staff availability, 84%; and privacy, 84%. For no item was there a preference for boarding in the ED. Patients overwhelmingly preferred the inpatient hallway rather than the ED hallway when admitted to the hospital. Copyright © 2013 Elsevier Inc. All rights reserved.

  17. The Activity Summary Board (United States)

    Touitou, Israel; Barry, Stephen; Bielik, Tom; Schneider, Barbara; Krajcik, Joseph


    Project-based learning (PBL) is an instructional approach to science teaching that supports the "Next Generation Science Standards" (Krajcik 2015; NGSS Lead States 2013). In a PBL lesson, students design and solve real-world problems or explain scientific phenomena. Students using a PBL model learn and retain more than those not using…

  18. AMIE Camera System on board SMART-1 (United States)

    Josset, J. L.; Beauvivre, S.; Amie Team

    The Advanced Moon micro-Imager Experiment AMIE on board ESA SMART-1 the first European mission to the Moon launched on 27th September 2003 is an imaging system with scientific technical and public outreach oriented objectives The science objectives are to image the Lunar Poles permanent shadow areas ice deposit eternal light crater rims ancient Lunar Non-mare volcanism local spectro-photometry and physical state of the lunar sur-face and to map high latitudes regions south mainly at far side South Pole Aitken basin The technical objectives are to perform a laserlink experiment detec-tion of laser beam emitted by ESA Tenerife ground station flight demonstration of new technologies and on-board autonomy navigation The public outreach and educational objectives are to promote planetary exploration We present the AMIE instrument and perfomances with respect to the first results

  19. 49 CFR 1011.2 - The Board. (United States)


    ... TRANSPORTATION GENERAL RULES AND REGULATIONS BOARD ORGANIZATION; DELEGATIONS OF AUTHORITY § 1011.2 The Board. (a... submitted for decision except those assigned to an individual Board Member or employee or an employee board...) The Board may bring before it any matter assigned to an individual Board Member or employee or...

  20. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Editorial Board. Sadhana. Editor. N Viswanadham, Indian Institute of Science, Bengaluru. Senior Associate Editors. Arakeri J H, Indian Institute of Science, Bengaluru Hari K V S, Indian Institute of Science, Bengaluru Mujumdar P P, Indian Institute of Science, Bengaluru Manoj Kumar Tiwari, Indian Institute of Technology, ...

  1. Refinement of boards' role required. (United States)

    Umbdenstock, R J


    The governing board's role in health care is not changing, but new competitive forces necessitate a refinement of the board's approach to fulfilling its role. In a free-standing, community, not-for-profit hospital, the board functions as though it were the "owner." Although it does not truly own the facility in the legal sense, the board does have legal, fiduciary, and financial responsibilities conferred on it by the state. In a religious-sponsored facility, the board fulfills these same obligations on behalf of the sponsoring institute, subject to the institute's reserved powers. In multi-institutional systems, the hospital board's power and authority depend on the role granted it by the system. Boards in all types of facilities are currently faced with the following challenges: Fulfilling their basic responsibilities, such as legal requirements, financial duties, and obligations for the quality of care. Encouraging management and the board itself to "think strategically" in attacking new competitive market forces while protecting the organization's traditional mission and values. Assessing recommended strategies in light of consequences if constituencies think the organization is abandoning its commitments. Boards can take several steps to match their mode of operation with the challenges of the new environment. Boards must rededicate themselves to the hospital's mission. Trustees must expand their understanding of health care trends and issues and their effect on the organization. Boards must evaluate and help strengthen management's performance, rather than acting as a "watchdog" in an adversarial position. Boards must think strategically, rather than focusing solely on operational details. Boards must evaluate the methods they use for conducting business.

  2. What makes great boards great. (United States)

    Sonnenfeld, Jeffrey A


    In the wake of meltdowns at WorldCom, Tyco, and Enron, enormous attention has been focused on the companies' boards. It seems inconceivable that business disasters of such magnitude could happen without gross or even criminal negligence on the part of board members. And yet a close examination of those boards reveals no broad pattern of incompetence or corruption. In fact, they followed most of the accepted standards for board operations: Members showed up for meetings; they had money invested in the company; audit committees, compensation committees, and codes of ethics were in place; the boards weren't too small or too big, nor were they dominated by insiders. In other words, they passed the tests that would normally be applied to determine whether a board of directors was likely to do a good job. And that's precisely what's so scary, according to corporate governance expert Jeffrey Sonnenfeld, who suggests that it's time for some new thinking about how corporate boards operate and are evaluated. He proposes thinking not only about how to structure the board's work but also about how to manage it as a social system. Good boards are, very simply, high-functioning work groups. They're distinguished by a climate of respect, trust, and candor among board members and between the board and management. Information is shared openly and on time; emergent political factions are quickly eliminated. Members feel free to challenge one another's assumptions and conclusions, and management encourages lively discussion of strategic issues. Directors feel a responsibility to contribute meaningfully to the board's performance. In addition, good boards assess their own performance, both collectively and individually.

  3. Annual report of the Science and Engineering Research Council 1992-1993

    International Nuclear Information System (INIS)


    Details of expenditure and reports of the activities of the four Boards which operate as the Science and Engineering Research Council are given. These are the Astronomical and Planetry Science Board, the Engineering Board, the Nuclear Physics Board and the Science Board. There is also a report on the optical physics and optoelectronic research supported by the Council. Committee membership, studentship, fellowships research grants and administration details are reported. (UK)

  4. Currency Boards; The Ultimate Fix?


    Atish R. Ghosh


    The growing integration of world capital markets has made it fashionable to argue that only extreme exchange rate regimes are sustainable. Short of adopting a common currency, currency board arrangements represent the most extreme form of exchange rate peg. This paper compares the macroeconomic performance of countries with currency boards to those with other forms of pegged exchange rate regime. Currency boards are indeed associated with better inflation performance, even allowing for potent...

  5. Pharmacology national board examinations: factors that may influence performance. (United States)

    Neidle, E A; Kahn, N


    Data from a survey of pharmacology courses in 60 dental schools were used to determine whether certain teaching variables affect performance in pharmacology National Board examinations. In addition, three-year class-averaged pharmacology scores and, rarely, one-year averaged scores were correlated with several admissions variables. While correlations between some admissions variables and pharmacology scores were quite good, the averaged pharmacology scores were not powerfully affected by course length, placement of the course in the curriculum, length of the curriculum, or the presence of a dentally trained pharmacologist in the department. It is suggested that other factors, related to the student and his capabilities, influence performance on National Boards. Dental pharmacology courses should be designed to given students the best possible exposure to an important basic science, not to make them perform well on National Boards, because student performance on National Boards may be independent of the nature of the didactic courses.

  6. Pension Fund governing board

    CERN Multimedia

    HR Department


    On 16 March and 7 May, the Pension Fund Governing Board (PFGB) held its fourth and fifth meetings The first of these meetings was primarily dedicated to the examination of the strategic asset allocation. The PFGB reaffirmed the main goal of the new strategic asset allocation: to improve the Pension Fund’s position with regard to risk by lowering overall portfolio volatility through suitable investments in less volatile asset classes such as real estate and absolute return strategies, where the return does not depend on market trends and negative growth is extremely unlikely. The finalised document will be presented to the Finance Committee and the Council at their June meetings for approval, in accordance with the provisions of the Levaux report. The PFGB also took note of the Internal Audit’s report on Pension Fund operations and decided to refer it to Working Group I as a working document for establishing a control and internal monitoring system for Pension Fund oper...

  7. 77 FR 26069 - Joint Biomedical Laboratory Research and Development and Clinical Science Research and... (United States)


    ... DEPARTMENT OF VETERANS AFFAIRS Joint Biomedical Laboratory Research and Development and Clinical Science Research and Development Services Scientific Merit Review Board, Notice of Meeting Amendment The... Development and Clinical Science Research and Development Services Scientific Merit Review Board have changed...

  8. 76 FR 4299 - National Sea Grant Advisory Board; Meeting (United States)


    ..., education and extension, science and technology programs, and other matters as described in the agenda found on the National Sea Grant College Program Web site at can be found at . Dated: January 19, 2011...

  9. 75 FR 59697 - National Sea Grant Advisory Board (United States)


    ..., science and technology programs, and other matters as described in the agenda found on the National Sea Grant College Program Web site at . DATES... advice. The agenda for this meeting can be found at

  10. 76 FR 57023 - National Sea Grant Advisory Board (United States)


    ..., science and technology programs, and other matters as described in the agenda found on the National Sea Grant College Program Web site at . DATES... advice. The agenda for this meeting can be found at

  11. 77 FR 52695 - National Sea Grant Advisory Board (United States)


    ..., education and extension, science and technology programs, and other matters as described in the agenda found on the National Sea Grant College Program Web site at . Dated: August 24, 2012. Andrew Baldus, Acting Chief...

  12. Spotlight on Ethics: Institutional Review Boards as Systemic Bullies (United States)

    Carr, Caleb T.


    Bullying, often considered an interpersonal or intergroup behaviour, has not been explored as an unintended artefact of organisational structure. Institutional review boards (IRBs), the 'human research ethics committees' at US universities, help oversee the protection of human research subjects, particularly in the social sciences within…

  13. An Olive Branch for Boards. (United States)

    Harrington-Lueker, Donna


    Peacekeeping strategies for school-board meetings include developing a code of conduct that spells out guidelines for behavior and then enforcing it; bringing in a neutral observer to help board members work through what is really worrying them; and concentrating on policy. (MLF)

  14. General purpose programmable accelerator board (United States)

    Robertson, Perry J.; Witzke, Edward L.


    A general purpose accelerator board and acceleration method comprising use of: one or more programmable logic devices; a plurality of memory blocks; bus interface for communicating data between the memory blocks and devices external to the board; and dynamic programming capabilities for providing logic to the programmable logic device to be executed on data in the memory blocks.

  15. 77 FR 60116 - Human Studies Review Board; Notification of a Public Meeting (United States)


    ... ENVIRONMENTAL PROTECTION AGENCY [EPA-HQ-ORD-2012-0718; FRL-9736-4] Human Studies Review Board; Notification of a Public Meeting AGENCY: Environmental Protection Agency (EPA). ACTION: Notice. SUMMARY: The EPA Office of the Science Advisor announces a public meeting of the Human Studies Review Board to...

  16. 78 FR 57383 - Human Studies Review Board; Notification of a Public Meeting (United States)


    ... ENVIRONMENTAL PROTECTION AGENCY [EPA-HQ-ORD-2013-0626; FRL-9900-98-ORD] Human Studies Review Board; Notification of a Public Meeting AGENCY: U.S. Environmental Protection Agency (EPA). ACTION: Notice. SUMMARY: The EPA Office of the Science Advisor announces a public meeting of the Human Studies Review Board to...

  17. 77 FR 74004 - Human Studies Review Board; Notification of a Public Meeting (United States)


    ... ENVIRONMENTAL PROTECTION AGENCY [EPA-HQ-ORD-2012-0892; FRL-9761-4] Human Studies Review Board; Notification of a Public Meeting AGENCY: Environmental Protection Agency (EPA). ACTION: Notice. SUMMARY: The EPA Office of the Science Advisor announces a public meeting of the Human Studies Review Board to...

  18. 76 FR 80938 - Human Studies Review Board; Notification of a Public Meeting (United States)


    ... ENVIRONMENTAL PROTECTION AGENCY [EPA-HQ-ORD-2011-0954; FRL-9611-6] Human Studies Review Board; Notification of a Public Meeting AGENCY: U.S. Environmental Protection Agency. ACTION: Notice. SUMMARY: The EPA Office of the Science Advisor announces a public meeting of the Human Studies Review Board to advise the...

  19. Study of microRNAs (miRNAs) that are predicted to target the autoantigens Ro/SSA and La/SSB in primary Sjögren’s Syndrome (United States)

    Gourzi, V C; Kapsogeorgou, E K; Kyriakidis, N C; Tzioufas, A G


    The elevated tissue expression of Ro/SSA and La/SSB autoantigens appears to be crucial for the generation and perpetuation of autoimmune humoral responses against these autoantigens in Sjögren’s syndrome (SS). The mechanisms that govern their expression are not known. miRNAs, the post-transcriptional regulators of gene expression, might be implicated. We have identified previously the miRNAs let7b, miR16, miR181a, miR200b-3p, miR200b-5p, miR223 and miR483-5p that are predicted to target Ro/SSA [Ro52/tripartite motif-containing protein 21 (TRIM21), Ro60/TROVE domain family, member 2 (TROVE2)] and La/SSB mRNAs. To study possible associations with autoantigen mRNA expression and disease features, their expression was investigated in minor salivary gland (MSG) tissues, peripheral blood mononuclear cells (PBMC) and long-term cultured non-neoplastic salivary gland epithelial cells (SGEC) from 29 SS patients (20 of 29 positive for autoantibodies to Ro/SSA and La/SSB) and 24 sicca-complaining controls. The levels of miR16 were up-regulated in MSGs, miR200b-3p in SGECs and miR223 and miR483-5p in PBMCs of SS patients compared to sicca-complaining controls. The MSG levels of let7b, miR16, miR181a, miR223 and miR483-5p were correlated positively with Ro52/TRIM21-mRNA. miR181a and miR200b-3p were correlated negatively with Ro52/TRIM21 and Ro60/TROVE2 mRNAs in SGECs, respectively, whereas let7b, miR200b-5p and miR223 associated with La/SSB-mRNA. In PBMCs, let7b, miR16, miR181a and miR483-5p were correlated with Ro52/TRIM21, whereas let7b, miR16 and miR181a were also associated with La/SSB-mRNA expression. Significantly lower miR200b-5p levels were expressed in SS patients with mucosa-associated lymphoid tissue (MALT) lymphoma compared to those without. Our findings indicate that miR16, miR200b-3p, miR223 and miR483-5p are deregulated in SS, but the exact role of this deregulation in disease pathogenesis and autoantigen expression needs to be elucidated. PMID:26201309

  20. German versus Nordic Board Models

    DEFF Research Database (Denmark)

    Ringe, Georg


    Board structure is an important component of the individual governance of firms, and the appropriateness of the various models is one of the most debated issues in corporate governance today. A comparison of the Nordic and German approaches to the structure of corporate boards reveals stark...... conceptual differences, as emphasized by the 2014 Lekvall Report on the Nordic Corporate Governance Model. This article provides a conceptual comparison between the two approaches to board structure and confirms the fundamental divergence between both models. However, relying on a number of recent legal...... changes and developments in business practice, the article argues that board practices in the two systems effectively blur the structural distinction, and that board organization is converging in practice. It thereby contributes to the broader debates on functionality and comparative corporate law...

  1. 49 CFR 1011.5 - Employee boards. (United States)


    ... 49 Transportation 8 2010-10-01 2010-10-01 false Employee boards. 1011.5 Section 1011.5... OF TRANSPORTATION GENERAL RULES AND REGULATIONS BOARD ORGANIZATION; DELEGATIONS OF AUTHORITY § 1011.5 Employee boards. This section covers matters assigned to the Accounting Board, a board of employees of the...

  2. Association of Regulatory Boards of Optometry (United States)

    ... website of the Association of Regulatory Boards of Optometry (ARBO). ARBO's web site is designed to provide resources to regulatory boards of optometry throughout the world. State/Provincial/Territorial Boards of ...

  3. 76 FR 21877 - Environmental Management Advisory Board (United States)


    ... DEPARTMENT OF ENERGY Environmental Management Advisory Board AGENCY: Department of Energy. ACTION: Notice of call for nominations for appointment to the Environmental Management Advisory Board. SUMMARY... Environmental Management Advisory Board. DATES: Nominations will be accepted through May 13, 2011. ADDRESSES...

  4. 78 FR 66384 - Membership of the Merit Systems Protection Board's Performance Review Board (United States)


    ... MERIT SYSTEMS PROTECTION BOARD Membership of the Merit Systems Protection Board's Performance Review Board AGENCY: Merit Systems Protection Board. ACTION: Notice. SUMMARY: Notice is hereby given of the members of the Merit Systems Protection Board's Performance Review Board. DATES: November 5, 2013...

  5. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Editorial Board. Bulletin of Materials Science. Editor. Giridhar U. Kulkarni, Centre for Nano and Soft Matter Science, Bengaluru. Associate Editors. Ayan Datta, Indian Association for the Cultivation of Science, Kolkata M. Eswaramoorthy, Jawaharlal Nehru Centre for Advanced Scientific Research, Bengaluru A.K. Ganguli ...

  6. Fermilab Friends for Science Education | Programs (United States)

    Fermilab Friends for Science Education FFSE Home About Us Join Us Support Us Contact Us Programs Donors Board of Directors Board Tools Calendar Join Us Donate Now Get FermiGear! Education Office Search photo Fermilab Friends for Science Education, in partnership with Fermilab and area educators, designs

  7. An agenda for board research

    Directory of Open Access Journals (Sweden)

    Sandra Guerra


    Full Text Available Scholarly investigations on the board of directors, although intense from the mid-1990s onward, did not lead to entirely convincing results. This study proposes discussion on building a multidisciplinary and integrated theoretical framework able to capture the complexity and distinctive dimensions of the board as a group decision-making process. This is achieved through an essay developed from analytical and descriptive review of the literature. A synthesis on board research is presented, aiming to understand theoretical models lenses used to study corporate governance issues. The strengths and weaknesses of these models are pointed out, and their influence on board investigation is observed. This essay concludes by proposing a research agenda that considers the addition of psychological and sociological approaches to economic models of the analysis of group decision-making

  8. Specialty Board on Fluency Disorders (United States)

    ... or large groups of speech-language pathologists. Speech-language pathologists who are Board Certified Specialists in Fluency may be found on this website by searching name, city(location) or zip code. ...

  9. Investor Perceptions of Board Performance

    DEFF Research Database (Denmark)

    Fischer, Paul E.; Gramlich, Jeffrey D.; Miller, Brian P.


    This paper provides evidence that uncontested director elections provide informative polls of investor perceptions regarding board performance. We find that higher (lower) vote approval is associated with lower (higher) stock price reactions to subsequent announcements of management turnovers. In...

  10. Employee on Boarding Process Automation


    Khushboo Nalband; Priyanka Jadhav; Geetanjali Salunke


    On boarding, also known as organizational socialization, plays a vital role in building the initial relationship between an organization and an employee. It also contributes to an employees’ satisfaction, better performance and greater organizational commitment thus increasing an employees’ effectiveness and productivity in his/her role. Therefore, it is essential that on boarding process of an organization is efficient and effective to improve new employees’ retention. Generally this on boar...

  11. NASA Space Life Sciences (United States)

    Hayes, Judith


    This slide presentation reviews the requirements that NASA has for the medical service of a crew returning to earth after long duration space flight. The scenarios predicate a water landing. Two scenarios are reviewed that outline the ship-board medical operations team and the ship board science reseach team. A schedule for the each crew upon landing is posited for each of scenarios. The requirement for a heliport on board the ship is reviewed and is on the requirement for a helicopter to return the Astronauts to the Baseline Data Collection Facility (BDCF). The ideal is to integrate the medical and science requirements, to minimize the risks and Inconveniences to the returning astronauts. The medical support that is required for all astronauts returning from long duration space flight (30 days or more) is reviewed. The personnel required to support the team is outlined. The recommendations for medical operations and science research for crew support are stated.

  12. Analysis of second order harmonic distortion due to transmitter non-linearity and chromatic and modal dispersion of optical OFDM SSB modulated signals in SMF-MMF fiber links (United States)

    Patel, Dhananjay; Singh, Vinay Kumar; Dalal, U. D.


    Single mode fibers (SMF) are typically used in Wide Area Networks (WAN), Metropolitan Area Networks (MAN) and also find applications in Radio over Fiber (RoF) architectures supporting data transmission in Fiber to the Home (FTTH), Remote Antenna Units (RAUs), in-building networks etc. Multi-mode fibers (MMFs) with low cost, ease of installation and low maintenance are predominantly (85-90%) deployed in-building networks providing data access in local area networks (LANs). The transmission of millimeter wave signals through the SMF in WAN and MAN, along with the reuse of MMF in-building networks will not levy fiber reinstallation cost. The transmission of the millimeter waves experiences signal impairments due to the transmitter non-linearity and modal dispersion of the MMF. The MMF exhibiting large modal dispersion limits the bandwidth-length product of the fiber. The second and higher-order harmonics present in the optical signal fall within the system bandwidth. This causes degradation in the received signal and an unwanted radiation of power at the RAU. The power of these harmonics is proportional to the non-linearity of the transmitter and the modal dispersion of the MMF and should be maintained below the standard values as per the international norms. In this paper, a mathematical model is developed for Second-order Harmonic Distortion (HD2) generated due to non-linearity of the transmitter and chromatic-modal dispersion of the SMF-MMF optic link. This is also verified using a software simulation. The model consists of a Mach Zehnder Modulator (MZM) that generates two m-QAM OFDM Single Sideband (SSB) signals based on phase shift of the hybrid coupler (90° and 120°). Our results show that the SSB signal with 120° hybrid coupler has suppresses the higher-order harmonics and makes the system more robust against the HD2 in the SMF-MMF optic link.

  13. Fermilab Friends for Science Education | Tree of Knowledge (United States)

    Fermilab Friends for Science Education FFSE Home About Us Join Us Support Us Contact Us Tree of Testimonials Our Donors Board of Directors Board Tools Calendar Join Us Donate Now Get FermiGear! Education precollege science education programs. Prominently displayed at the Lederman Science Center is the lovely

  14. Presidential Search: An Overview for Board Members (United States)

    Association of Governing Boards of Universities and Colleges, 2012


    The selection of a president is a governing board's most important responsibility, and the search process is the board's best opportunity to help guide its institution into a successful new era. This guide outlines the leadership roles during a search (those of the board, the board chair, the search committee, and others), briefs board…

  15. Bringing out the Best Board Behavior (United States)

    Caruso, Nicholas


    The author's advice for for a school board superintendent is to assume incompetence instead of malevolence. Board members who behave inappropriately are a minority, and those with malicious intent are extremely rare. Most misbehaving board members act out of frustration. They may not understand the appropriate role of a board member.…

  16. 22 CFR 902.3 - Board staff. (United States)


    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Board staff. 902.3 Section 902.3 Foreign Relations FOREIGN SERVICE GRIEVANCE BOARD ORGANIZATION § 902.3 Board staff. The chairperson shall select the Board's executive secretary and other staff provided for in the Act. The executive secretary and staff...

  17. Advisory Boards: Gateway to Business Engagement (United States)

    Meeder, Hans; Pawlowski, Brett


    Interest has been growing in how to build or manage an effective business advisory board. Developing an advisory board is crucial to keeping CTE programs relevant and viable by engaging the support of business and industry. This article delves into how to build and manage a board, and how to re-energize boards that already exist but may be lacking.

  18. Sexual harassment within the marine sciences and the ethical dilemmas of collaboration: a case study in the education and reportino methods available to scientists, students, and staff on board a federal research vessel (United States)

    Ohern, J.


    Within the Science, technology, engineering, and math (STEM) disciplines, a disparity between male and female involvement persists on the order of about 3:1. While roughly 40% of men with STEM degrees go on to pursue STEM jobs, just 26% of women with STEM degrees hold jobs within the STEM field. There are a number of contributing factors to these disparities, but one pernicious factor is the issue of sexual harassment and discrimination. For the marine sciences this is an especially concerning issue because our field research frequently takes place hundreds of miles offshore. Despite education and policy initiatives, sexual harassment pervades many research vessels and is often never addressed, discouraging female involvement and limiting the opportunities available to women. Ethical dilemmas develop when administrators do not want to risk limited field schedules and funding while investigations are conducted and harassment issues resolved. Additionally, scientists and staff often collaborate between institutions, benefitting science but blurring the lines of responsibility. In one such case, administrators within a federal research office declined to report sexual harassment taking place between contracted crew members on their research vessel. The lengthy review process and lack of culpability discourages reporting of sexual harassment and allows problematic situations to occur. This case study reviews the reporting mechanisms currently in place, the barriers to reporting, and the proposed methods for more effectively resolving discriminatory workplaces. Collaboration within marine science is an absolute necessity, and our research benefits from diverse working groups. As marine scientists we have an ethical responsibility to ensure safe working environments for both the scientists and the staff who make our research possible.

  19. The new Board of Governors

    International Nuclear Information System (INIS)


    Full text: Miss Blanche Margaret Meagher was elected chairman of the IAEA Board of Governors for 1964-65, after the new Board had been constituted at the Eighth Session of the General Conference in September. Since 1962 Miss Meagher has been Canadian Ambassador to Austria, and Canadian Governor of the Agency. Miss Meagher joined the Canadian Department of External Affairs in 1942, and has held a number of foreign diplomatic appointments; she has also served on Canadian delegations to the UN Educational, Scientific and Cultural Organization, the International Telecommunication Union, the Economic and Social Council of UN and the UN Disarmament Sub-Committee. The Vice-Chairmen of the Board are Mr. Wilhelm Billig (Poland) and Mr. Hassan M. Tohamy (UAR). Mr. Billig is Chairman of the State Council for Atomic Energy, and High Commissioner for Peaceful Uses of Atomic Energy. Mr. Tohamy is Ambassador to Austria, and Resident Representative to the Agency. Of the twelve elected members of the Board, five were chosen by the General Conference in 1964 for two years, viz. Argentina, Chile, Netherlands, Thailand and the United Arab Republic. Seven were elected in 1963: Afghanistan, China, Congo (Leopoldville), Morocco, Romania, Switzerland and Uruguay. The remaining thirteen members have been designated by the Board: Australia, Belgium, Brazil, Canada, Finland, France, India, Japan, Poland, South Africa, USSR, United Kingdom and United States. (author)

  20. Controlling electronics boards with PVSS

    CERN Document Server

    Jacobsson, Richard


    This paper addresses several aspects of implementing a control system for electronics boards in order to perform remote Field Programmable Gate Array (FPGA) programming, hardware configuration, register control, and monitoring, as well as interfacing it to an expert system. The paper presents an implementation, using the Distributed Information Management (DIM) package and the industrial SCADA system PVSS II from ETM, in which the access mechanisms to the board resources are completely generic and in which the device prescription and the handling of mapping between functional parameters and physical registers follow a common structure independent of the board type. The control system also incorporates mechanisms by which it may be controlled from a finite state machine based expert system. Finally the paper suggests an improvement in which the mapping between logical parameters and physical registers is represented by descriptors in the device description such that the translation can be handled by a common m...

  1. Segregation in a Galton Board

    International Nuclear Information System (INIS)

    Benito, J G; Vidales, A M; Ippolito, I


    This work deals with a numerical study of the problem of separation of particles with different elastic properties. The separation procedure uses a Galton Board which consist in a bidimensional system of obstacles arranged in a triangular lattice. Disks of equal diameters but different elastic properties are launched from the top of the device. The Galton Board is commonly used for mixing particles, but here, we intend to find special conditions under which one can use it as a segregating device. We introduce a mixture of particles and generate, through simulations, different conditions to favor the segregation process based on the different elastic coefficients of the particles. We inspect which is the best configuration of size, density of obstacles and wall separation to favor the separations of particles. Our results prove that the Galton Board can be used as a segregation device under certain conditions.

  2. Institutional Evolution and Corporate Boards

    DEFF Research Database (Denmark)

    Chen, Victor Zitian; Hobdari, Bersant; Sun, Pei


    We argue that corporate boards are a dynamic repository of human- and social capital in response to external institutional evolution. Theoretically, integrating institutional economics, agency theory and resource dependence theory, we explain that evolution of market-, legal- and political......, since the board changes are typically proposed by the block shareholders, whose motivation for doing so is closely associated with a corporation’s financial performance, we further argue that financial performance is a key moderator of the relationships between institutional evolution and changes...... institutions restructures the particular context in which board members play their two primary roles: monitoring the CEO on behalf of the shareholders, suggested by the agency theory, and supporting the CEO by providing resources, knowledge and information, suggested by the resource dependence theory...

  3. Board's system of publications. [National Radiological Protection Board

    Energy Technology Data Exchange (ETDEWEB)

    Gaines, M J [National Radiological Protection Board, Harwell (UK)


    The purpose of each of the several classes of publication issued by the National Radiological Protection Board is stated. The classes are: advice on standards for protection, emergency reference levels, technical reports, instrument evaluation reports, annual research and development reports, three-yearly reports on the work of the NRPB, miscellaneous specialist booklets, publications for the layman, radiological protection bulletin, information sheets, and brochures.

  4. The Board's Role in Financial Oversight. AGB Board Essentials Series (United States)

    Krawitz, Natalie


    An often-volatile economy, changing demographics, and technological innovations in educational delivery are among the dramatic changes across higher education that have forced boards and institutions to question the viability of the existing business model. Flat or declining state support in real terms, lower investment returns in some years,…

  5. The importance of board independence

    NARCIS (Netherlands)

    Zijl, N.J.M.


    Although the attributed importance of board independence is high, a clear definition of independence does not exist. Furthermore, the aim and consequences of independence are the subject of discussion and empirical evidence about the impact of independence is weak and disputable. Despite this lack

  6. Joint Advisory Appeals Board report

    CERN Document Server

    Lalande, Amanda


    With regard to the internal appeal procedure, Article R VI 1.18 of the Staff Rules and Regulations states that unless the member of the personnel objects, (the) decision and report of the JAAB (Joint Advisory Appeals Board) shall be brought to the attention of the members of the personnel.

  7. Faculty Communication with Governing Boards (United States)

    Tiede, Hans-Joerg


    College and university governance works best when every constituency within the institution has a clear understanding of its role with respect to the other constituencies. It works best when communication among the governing board, the administration, and the faculty (not to mention the staff and students) is regular, open, and honest. Too often…

  8. The Atomic Energy Control Board

    International Nuclear Information System (INIS)

    Shultz, R.J.


    Certain aspects of the Atomic Energy Control Board's relationships with Cabinet, the Minister, Government officials, The licensees and the public are analyzed. The way some of the relationships would have been modified by the Nuclear Control and Administration Act proposed in 1977 is examined. (L.L.)

  9. Assessing Your Board's Risk Tolerance (United States)

    Griswold, John S.; Jarvis, William F.


    In the wake of the financial crisis, trustees of many endowed nonprofit institutions realized that their portfolio was riskier than they thought and their own ability to tolerate loss wasn't as strong as they imagined. What can board and investment committee members do to improve their ability to assess their--and their institution's--capacity for…

  10. Internationalilzation of the Firm and its Board

    DEFF Research Database (Denmark)

    Oxelheim, Lars; Gregoric, Aleksandra; Randøy, Trond

    competencies required by firm internationalization positively affect board internationalization, whereas the impact of the internationalization of a firm’s commercial operations is positive but not significant across all model specifications. We find that the higher the number of national board members......, the amount of foreigners on the nomination committee also positively relates to the number of foreigners on the board. Rather than age, the median board tenure negatively impacts the prevalence of foreigners on the supervisory board. This barrier to board internationalization may reflect conservatism, fear...

  11. Report of the Science and Engineering Research Council for the year 1987-88

    International Nuclear Information System (INIS)


    The paper presents the Annual Report of the Science and Engineering Research Council (SERC), United Kingdom 1987/8. The contents contains the reports of the four Boards of the Council - the Astronomy and Planetary Science Board, the Engineering Board, the Nuclear Physics Board and the Science Board. The SERC report also contains eleven review articles on major advances in Science in recent years, including high temperature superconductivity and the supernova in the Large Magellanic Cloud, as well as details of fourteen ''highlights'' of 1987/8 including the dating of the Turin Shroud. (U.K.)

  12. Why monetary board: Monetary board and endogenic price flexibility

    Directory of Open Access Journals (Sweden)

    Bašić Tamara


    Full Text Available The paper presents a model which proves that a unilateral exchange rate fixing, i.e. monetary board, as opposed to certain opinions, is an optimal policy since it increases flexibility of nominal prices, which is the ultimate goal of a flexible exchange rate policy. A suitable calibration of the model shows that the higher the initial price flexibility, the lower the difference needed for "utility increase" in getting the producers to switch from fixed to flexible prices. The results obtained in all cases indicate that exchange rate fixing increases price flexibility, which proves that a unilateral exchange rate fixing, i.e. monetary board, could be an optimal monetary policy.

  13. Board members’ contribution to strategy: The mediating role of board internal processes

    Directory of Open Access Journals (Sweden)

    Carmen Barroso-Castro


    Full Text Available This study aims to explore what directors do on the board, to what extent the processes occurring in the board allow the sharing and integrating of the existing knowledge, thus facilitating the board members’ contributions to strategy. We adopt the view that the internal board processes increase the impact of the cognitive resources on board performance. Using survey data from 200 large Spanish companies we demonstrate that directors’ level of knowledge of the firm and board job-related diversity positively influence the degree of the board's strategic involvement. Additionally, the internal processes that take place within the board – particularly Cognitive Conflict, the Critical and Independent Approach and the Comprehensive Discussion Process – influence the board's strategic involvement and play a partial mediating role on the aforementioned relationships. However, our results show no evidence for a positive relationship between Board Meeting Dynamics and the board's strategic involvement.

  14. Boys' boarding school management: understanding the choice ...

    African Journals Online (AJOL)

    Maggard,. 1976). Kotler ... positioning strategy for a secondary boys' boarding school should seek to match its .... (in this case, the attributes parents consider important in boarding school selection), ..... Marketing for Hospitality and Tourism (3rd ed).

  15. 76 FR 57712 - Performance Review Board Membership (United States)


    ... DEPARTMENT OF COMMERCE Performance Review Board Membership AGENCY: Economics and Statistics... the Performance Review Board (PRB) in accordance with the Economics and Statistics Administration's.... Bostic, Jr., Arnold A. Jackson, Theodore A. Johnson, Steven J. Jost, J. Steven Landefeld, Jennifer Madans...

  16. 7 CFR 1230.4 - Board. (United States)


    ... of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE PORK PROMOTION, RESEARCH, AND CONSUMER INFORMATION Pork Promotion, Research, and Consumer Information Order Definitions § 1230.4 Board. Board means...

  17. 7 CFR 1215.2 - Board. (United States)


    ... of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE POPCORN PROMOTION, RESEARCH, AND CONSUMER INFORMATION Popcorn Promotion, Research, and Consumer Information Order Definitions § 1215.2 Board. Board...

  18. American Board of Obesity Medicine (ABOM) (United States)

    ... not trained in how to manage it. The American Board of Obesity Medicine certifies physicians looking to bridge this gap. ... an ABOM diplomate. APPLY NOW OUR MISSION The American Board of Obesity Medicine (ABOM) serves the public and the field ...

  19. Sustainability issues in circuit board recycling

    DEFF Research Database (Denmark)

    Legarth, Jens Brøbech; Alting, Leo; Baldo, Gian Luca


    The resource recovery and environmental impact issues of printed circuit board recycling by secondary copper smelters are discussed. Guidelines concerning material selection for circuit board manufacture and concerning the recycling processes are given to enhance recovery efficiency and to lower...

  20. ChalkBoard: Mapping Functions to Polygons (United States)

    Matlage, Kevin; Gill, Andy

    ChalkBoard is a domain specific language for describing images. The ChalkBoard language is uncompromisingly functional and encourages the use of modern functional idioms. ChalkBoard uses off-the-shelf graphics cards to speed up rendering of functional descriptions. In this paper, we describe the design of the core ChalkBoard language, and the architecture of our static image generation accelerator.

  1. Corporate boards and bank loan contracting


    Francis, Bill; Hasan, Iftekhar; Koetter, Michael; Wu, Qiang


    We investigate the role of corporate boards in bank loan contracting. We find that when corporate boards are more independent, both price and nonprice loan terms (e.g., interest rates, collateral, covenants, and performance-pricing provisions) are more favorable, and syndicated loans comprise more lenders. In addition, board size, audit committee structure, and other board characteristics influence bank loan prices. However, they do not consistently affect all nonprice loan terms except for a...

  2. Cultural differences and board gender diversity


    Carrasco , Amélia; Francoeur , Claude; Réal , Isabelle; Laffarga , Joaquina; Ruiz-Barbadillo , Emiliano


    International audience; As evidence of the continuing interest raised by "board gender diversity", major studies (Catalyst, 2008; World Economic Forum, 2010; European Board Diversity Analysis, 2010) were recently carried out and have all led to reports confirming the imbalance of women on boards and the need to address this issue. Moreover, our analysis of these reports indicates that the low proportion of women observed on corporate boards varies across countries, which raises the question a...

  3. The May 26, 1999 Resolution of the Joint Meeting of the Board of the Radiation Diagnosis and Radiation Therapy Section, Academic Council, Ministry of Health of Russia, the X-ray Diagnosis Ad Hoc Commission, Interdepartmental Scientific Council for Medical Radiology and Radiation Medicine, Russian Academy of Medical Sciences, and the Executive Committee, Russian Association of Radiologists

    International Nuclear Information System (INIS)

    Kharchenko, V.P.; Rozhkova, N.I.; Vlasov, P.V.


    The text of the May 26, 1999 Resolution of the joint meeting of the Board of the Radiation Diagnosis and Radiation Therapy Section of the Ministry of Health of Russia with the X-ray Diagnostics Ad Hoc Problem Commission of the Intergovernmental Scientific Council for Medical Radiology and Radiation Medicine of the Russian Academy of Medical Sciences and the Executive Committee of Russian Association of Radiologists is presented. It is noted that in spite of the fact that the intervention radiology as an independent branch has not yet been formed, separate developments, aimed at application of invasive interventions under the control of radiodiagnostic methods are carried out in the area of bronco pulmonology, gastroenterology, mammology, gynecology, urology, oncology above 30 years and steps in legalization of this trend are also undertaken. Absence of statistical documentation on technical and staff provision of therapeutical-prophylactic establishments as well as unified terminology is noted. The tasks aimed at broader introduction of intervention radiology in Russia are set up [ru

  4. From Global Firms to Global Boards?

    DEFF Research Database (Denmark)

    Thomsen, Steen; Gregoric, Aleksandra; Randøy, Trond


    . This indicates some support for the view that different kinds of firm internationalization – commercial versus financial - might lead to different types of board internationalization. We find no evidence that the internationalization of boards is limited by the conservatism of existing national board members...

  5. 42 CFR 426.489 - Board remands. (United States)


    ... decision; and (2) Explains why the case is being remanded and the specific actions ordered by the Board. (b) Action by an ALJ on remand. An ALJ takes any action that is ordered by the Board and may take any additional action that is not inconsistent with the Board's remand order. ...

  6. Advisory Board on Alcoholism and Drug Abuse (United States)

    State Employees Advisory Board on Alcoholism and Drug Abuse DHSS State of Alaska Home Divisions and ; Advisory Board on Alcoholism and Drug Abuse Page Content Alison Kulas Executive Director If you, a family Kulas Begins Tenure as Executive Director The Advisory Board on Alcoholism and Drug Abuse, The Alaska

  7. 75 FR 11870 - Inland Waterways Users Board (United States)


    ... DEPARTMENT OF DEFENSE Department of the Army; Corps of Engineers Inland Waterways Users Board AGENCY: Department of the Army, U.S. Army Corps of Engineers, DoD. ACTION: Notice of open meeting... is made of the forthcoming meeting. Name of Committee: Inland Waterways Users Board (Board). Date...

  8. 78 FR 44934 - Inland Waterways Users Board (United States)


    ... DEPARTMENT OF DEFENSE Department of the Army; Corps of Engineers Inland Waterways Users Board AGENCY: Department of the Army, U.S. Army Corps of Engineers, DoD. ACTION: Notice of open meeting... is made of the forthcoming meeting. Name of Committee: Inland Waterways Users Board (Board). Date...

  9. 75 FR 57264 - Inland Waterways Users Board (United States)


    ... DEPARTMENT OF DEFENSE Department of the Army; Corps of Engineers Inland Waterways Users Board AGENCY: Department of the Army, U.S. Army Corps of Engineers, DoD. ACTION: Notice of open meeting... is made of the forthcoming meeting. Name of Committee: Inland Waterways Users Board (Board). Date...

  10. 76 FR 11216 - Inland Waterways Users Board (United States)


    ... DEPARTMENT OF DEFENSE Department of the Army; Corps of Engineers Inland Waterways Users Board AGENCY: Department of the Army, U.S. Army Corps of Engineers, DoD. ACTION: Notice of open meeting... is made of the forthcoming meeting. Name of Committee: Inland Waterways Users Board (Board). Date...

  11. 78 FR 72070 - Inland Waterways Users Board (United States)


    ... DEPARTMENT OF DEFENSE Department of the Army; Corps of Engineers Inland Waterways Users Board AGENCY: Department of the Army, U.S. Army Corps of Engineers, DoD. ACTION: Notice of open meeting... is made of the forthcoming meeting. Name of Committee: Inland Waterways Users Board (Board). Date...

  12. 77 FR 69447 - Inland Waterways Users Board (United States)


    ... DEPARTMENT OF DEFENSE Department of the Army; Corps of Engineers Inland Waterways Users Board AGENCY: Department of the Army, U.S. Army Corps of Engineers, DoD. ACTION: Notice of open meeting... is made of the forthcoming meeting. Name of Committee: Inland Waterways Users Board (Board). Date...

  13. VISUALISERINGSTAVLA : Visualisering av Kanban boards


    Y. F. Sam, Adam


    Hos många företag används whiteboards för att visualisera arbetsprocessen. En vanlig metodik för detta är så kallade Kanban boards, ett system av tabeller och lappar för att indikera olika avvikelser eller moment i projekt med datum och annan relevant information. Företag kan även välja att använda en mjukvara som simulerar samma metodik, ett exempel på detta är så kallade Elektroniska kanban boards. I detta arbete har båda dessa metoder (whiteboard samt en digital lösning) observerats hos tr...

  14. Issues in Canadian board transparency

    Directory of Open Access Journals (Sweden)

    Chris Bart


    Full Text Available Transparency is considered one of the principles of good corporate governance. But what does it mean – in practice – especially when it comes to Board transparency – i.e. the ability of shareholders to gain knowledge about an organization’s corporate governance practices in order to make an informed assessment of Directors’ individual and collective roles and performance. In a preliminary investigation of Board transparency practices in Canadian listed firms (using data from 2003-2004, it was found that there were wide variations in the nature and quantity of corporate governance practices disclosed. The reasons for these variations are discussed and a number of recommendations for improved disclosure are presented.

  15. The Atomic Energy Control Board

    International Nuclear Information System (INIS)

    Doern, G.B.


    This study describes and assesses the regulatory and administrative processes and procedures of the Atomic Energy Control Board, the AECB. The Atomic Energy Control Act authorized the AECB to control atomic energy materials and equipment in the national interest and to participate in measures for the international control of atomic energy. The AECB is authorized to make regulations to control atomic energy materials and equipment and to make grants in support of atomic energy research. (author)

  16. Who's who on the Board

    International Nuclear Information System (INIS)



    Brief summaries of the curriculum vitae and present positions held by each member of the National Radiological Protection Board are given. The members are Sir Richard Southwood, Mr. A.M. Allen, Professor A. Barret, Professor J.H. Edwards, Professor H.J. Evans, Professor K.J. Evans, Professor P. Haggett, Professor J.R. Lee, Professor J.S. Orr, Dr. R. Owen, Professor J. Peto, Dr. D.H. Roberts and Mr. M.E. Trowbridge. (U.K.)

  17. 14 CFR 250.5 - Amount of denied boarding compensation for passengers denied boarding involuntarily. (United States)


    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Amount of denied boarding compensation for passengers denied boarding involuntarily. 250.5 Section 250.5 Aeronautics and Space OFFICE OF THE SECRETARY... boarding compensation for passengers denied boarding involuntarily. (a) Subject to the exceptions provided...

  18. Motives and Power of School Board Members: Implications for School Board-Superintendent Relationships (United States)

    Mountford, Meredith


    The qualitative study presented in this article explores motivations for school board membership and conceptions of power held by school board members. The findings of the study suggest a relationship exists between the way board members define power and the type of motivation board members have for service. The implications of these findings for…

  19. 75 FR 9196 - Letter From Secretary of Energy Accepting Defense Nuclear Facilities Safety Board (Board... (United States)


    ... DEPARTMENT OF ENERGY Letter From Secretary of Energy Accepting Defense Nuclear Facilities Safety Board (Board) Recommendation 2009-2 AGENCY: Department of Energy. ACTION: Notice. SUMMARY: The...: The Department of Energy (DOE) acknowledges receipt of Defense Nuclear Facilities Safety Board (Board...

  20. 76 FR 52997 - Public Company Accounting Oversight Board; Order Approving Proposed Board Funding Final Rules for... (United States)


    ... Accounting Oversight Board; Order Approving Proposed Board Funding Final Rules for Allocation of the Board's... August 18, 2011. I. Introduction On June 21, 2011, the Public Company Accounting Oversight Board (the... public accounting firm, in amounts that are sufficient to cover the costs of processing and reviewing...

  1. The Perceptions of Georgia School Board Members' Need for Training on School Board Governance (United States)

    Nutt, Pamela Studdard


    This study explored the perceptions of training needs of school board members in Georgia. The study examined perceptions of school board chairs, board members with 1 to 5 years experience, members with 6 to 10 years experience, members with 11 to 15 years experience and board members with 16 plus years experience in the areas of school board…

  2. Space science in the twenty-first century: imperatives for the decades 1995 to 2015 : life sciences

    National Research Council Canada - National Science Library


    Early in 1984, NASA asked the Space Science Board to undertake a study to determine the principal scientific issues that the disciplines of space science would face during the period from about 1995 to 2015...

  3. Integrated reporting and board features

    Directory of Open Access Journals (Sweden)

    Rares HURGHIS


    Full Text Available In the last two decades the concept of sustainability reporting gained more importance in the companies’ annual reports, a trend which is embedded also in integrated reporting. Issuing an integrated report became a necessity, because the report explains to the investors how the organization creates value over time. The governance structure, more exactly the board of directors, decides whether or not the company will issue an integrated report. Thus, are there certain features of the board that might influence the issue of an integrated report? Do the companies which issue an integrated report have certain features of the governance structure? Looking for an answer to these questions, we seek for any possible correlations between a disclosure index and the corporate governance structure characteristics, on a sample from the companies participating at the International Integrated Reporting Council Examples Database. The results highlight that only the size of the board influences the extent to which the issued integrated report is in accordance with the International Framework.

  4. Primary Sjögren syndrome: report of a 10 years old girl with local edema and positivity of anti SS-A and anti SS-B autoantibodies

    Directory of Open Access Journals (Sweden)

    V. Gerloni


    Full Text Available Sjögren-Larsson syndrome (SLS is an autoimmune disease, uncommon in childhood. We report a case of SLS in a 10-year-old girl with a history of tumor, calor and rubor in the back of her toes almost every month, which resolved in 4-5 days without therapy. She did not complain of dry mouth or dry eyes. The laboratory fi ndings showed high infl ammation markers, rheumatoid factor 128 IU, Waaler-Rose 256 IU, anti nuclear antibody (ANA 1/640, SSA (anti Sjögren antigen A and SSB (anti Sjögren antigen B positive and hypergammaglobulinemia. The Schirmer’s test resulted to be pathologic, the ultrasonography images and biopsy of minor salivary glands revealed focal periductal lymphocytic infi ltrate and sialoduct ectasia class IV of juvenile Sjögren syndrome. The juvenile Sjögren syndrome is frequently under-diagnosed. Clinical manifestations in children might be different from the adult form, although laboratory fi ndings may be similar to those found in adults.

  5. Hospital board effectiveness: relationships between board training and hospital financial viability. (United States)

    Molinari, C; Morlock, L; Alexander, J; Lyles, C A


    This study examined whether hospital governing boards that invest in board education and training are more informed and effective decision-making bodies. Measures of hospital financial viability (i.e., selected financial ratios and outcomes) are used as indicators of hospital board effectiveness. Board participation in educational programs was significantly associated with improved profitability, liquidity, and occupancy levels, suggesting that investment in the education of directors is likely to enhance hospital viability and thus increase board effectiveness.

  6. Gender Quotas for Corporate Boards


    Elomäki, Anna


    Gender quotas for corporate boards can be seen as a way of drawing attention to gendered power within the economy as well as a way to democratize the economy, yet the debate about them has focused on the economic and business benefits of gender equality rather than on gender justice or democracy. This article examines how women’s under-representation in economic decision-making was constituted as an economic problem in the European Union’s gender-equality policies and how the economization of...

  7. The fourth Board of Governors

    International Nuclear Information System (INIS)


    The General Conference of the International Atomic Energy Agency at its fourth regular session, which was held in Vienna from 20 September to 1 October 1960, elected five Member States to serve a two-year term on the Agency's Board of Governors. The five were Argentina, El Salvador, the Federal Republic of Germany, Iraq and Thailand. The new members succeed Indonesia, the Netherlands, Peru, the United Arab Republic and Venezuela, which were elected for a two-year term by the second session of the General Conference in 1958

  8. Preserving the Legitimacy of Board Certification. (United States)

    Hanemann, Michael S; Wall, Holly C; Dean, John A


    The aims of this discussion were to inform the medical community about the American Board of Cosmetic Surgery's ongoing attempts in Louisiana to achieve equivalency to American Board of Medical Specialties (ABMS) member boards so that its diplomates may use the term "board certified" in advertising and to ensure public safety by upholding the standards for medical board certification. In 2011, Louisiana passed a truth in medical advertising law, which was intended to protect the public by prohibiting the use of the term "board certified" by improperly credentialed physicians. An American Board of Cosmetic Surgery diplomate petitioned the Louisiana State Board of Medical Examiners to approve a rule that would establish a pathway to equivalency for non-ABMS member boards, whose diplomates have not completed training approved by the Accreditation Council for Graduate Medical Education (ACGME) in the specialty they are certifying. Physicians and physician organizations representing multiple specialties (facial plastic and reconstructive surgery, otolaryngology [head and neck surgery], orthopedic spine surgery, pediatric neurosurgery, dermatology, and plastic surgery) urged the Louisiana State Board of Medical Examiners to clarify its advertising policy, limiting the use of the term "board certified" to physicians who have completed ACGME-approved training in the specialty or subspecialty named in the certificate. The public equates the term "board certified" with the highest level of expertise in a medical specialty. When a certifying board does not require completion of ACGME or American Osteopathic Association (AOA)-accredited training in the specialty it certifies, the result is an unacceptable degree of variability in the education and training standards applied to its diplomates. Independent, third-party oversight of certifying boards and training programs is necessary to ensure quality standards are upheld. Any system that assesses a non-ABMS member or non

  9. Report of the Defense Science Board/Defense Policy Board Task Force On Theater Missile Defense

    National Research Council Canada - National Science Library


    ... also tackled the controversial subject of the ABM Treaty and its effect on theater missile defenses Subsequent to its interim report, which expressed strong concerns about the demarcation path the US...

  10. 75 FR 65528 - Membership of the National Science Board's Senior Executive Service Performance Review Board (United States)


    ...: Comments should be addressed to Interim Director, Division of Human Resource Management and Chief Human.... Judith S. Sunley, Interim Director, Division of Human Resource Management and Chief Human Capital Officer..., Interim Director, Division of Human Resource Management and Chief Human Capital Officer. [FR Doc. 2010...

  11. Science Programs (United States)

    Laboratory Delivering science and technology to protect our nation and promote world stability Science & ; Innovation Collaboration Careers Community Environment Science & Innovation Facilities Science Pillars Research Library Science Briefs Science News Science Highlights Lab Organizations Science Programs Applied

  12. 76 FR 24974 - Joint Biomedical Laboratory Research and Development and Clinical Science Research and... (United States)


    ... Science Research and Development Services Scientific Merit Review Board; Notice of Meeting Amendment The... and Clinical Science Research and Development Services Scientific Merit Review Board have been..., behavioral and clinical science research. The panel meetings will be open to the public for approximately one...

  13. 76 FR 79273 - Joint Biomedical Laboratory Research and Development and Clinical Science Research and... (United States)


    ... Science Research and Development Services Scientific Merit Review Board Panel for Eligibility, Notice of... and Clinical Science Research and Development Services Scientific Merit Review Board will meet on... medical specialties within the general areas of biomedical, behavioral, and clinical science research. The...

  14. Key Science and Engineering Indicators: 2010 Digest. NSB 10-02 (United States)

    Roesel, Cheryl, Ed.


    The National Science Board (Board) is required under the National Science Foundation (NSF) Act, 42 U.S.C. (United States Code) Section 1863 (j) (1) to prepare and transmit the biennial "Science and Engineering Indicators" ("SEI") report to the President and to the Congress by January 15 of every even-numbered year. The report…


    CERN Multimedia


    For informationIn closed session the Management Board discussed the1999 advancement exercise. In open session the Director-General reported on the following highlights of the June meetings of the Scientific Policy Committee, Finance Committee, Committee of Council and Council:Member and Non-Member State MattersFollowing Bulgaria's accession to CERN as its twentieth Member State on 11 June 1999, a Bulgarian delegation headed by the deputy Prime Minister and Minister of Education and Science, Mr Vesselin Metodiev, had attended the Council for the first time. Welcoming the new members, the President of Council had expressed the hope that the new co-operation between CERN and Bulgaria would constitute a firmer basis for the Organisation's long-standing scientific collaboration with Bulgarian physicists and play a valuable role in widening its European network of partners.The Council had also approved a resolution providing for a redefinition of Greece's annual contributions to the CERN Budget for the period 1998-...

  16. Board on Research Data and Information

    Energy Technology Data Exchange (ETDEWEB)

    Sztein, A. Ester [National Academy of Sciences, Washington, DC (United States); Boright, John [National Academy of Sciences, Washington, DC (United States)


    The Board on Research Data and Information (BRDI) has planned and undertaken numerous activities regarding data citation, attribution, management, policy, publishing, centers, access, curation, sharing, and infrastructure; and international collaboration and cooperation. Some of these activities resulted in National Research Council reports (For Attribution: Developing Data Attribution and Citation Practices and Standards (2012), The Case for International Scientific Data Sharing: A Focus on Developing Countries (2012), and The Future of Scientific Knowledge Discovery in Open Networked Environments (2012); and a peer-reviewed paper (Out of Cite, Out of Mind: The Current State of Practice, Policy, and Technology for the Citation of Data, 2013). BRDI held symposia, workshops and sessions in the U.S. and abroad on diverse topics such as global scientific data infrastructures, discovery of data online, privacy in a big data world, and data citation principles, among other timely data-related subjects. In addition, BRDI effects the representation of the United States before the International Council for Science’s International Committee on Data for Science and Technology (CODATA).

  17. Victor Frankenstein's Institutional Review Board Proposal, 1790. (United States)

    Harrison, Gary; Gannon, William L


    To show how the case of Mary Shelley's Victor Frankenstein brings light to the ethical and moral issues raised in Institutional Review Board (IRB) protocols, we nest an imaginary IRB proposal dated August 1790 by Victor Frankenstein within a discussion of the importance and function of the IRB. Considering the world of science as would have appeared in 1790 when Victor was a student at Ingolstadt, we offer a schematic overview of a fecund moment when advances in comparative anatomy, medical experimentation and theories of life involving animalcules and animal electricity sparked intensive debates about the basic principles of life and the relationship between body and soul. Constructing an IRB application based upon myriad speculations circulating up to 1790, we imagine how Victor would have drawn upon his contemporaries' scientific work to justify the feasibility of his project, as well as how he might have outlined the ethical implications of his plan to animate life from "dead" tissues. In Mary Shelley's Frankenstein, Victor failed to consider his creature's autonomy, vulnerability, and welfare. In this IRB proposal, we show Victor facing those issues of justice and emphasize how the novel can be an important component in courses or workshops on research ethics. Had Victor Frankenstein had to submit an IRB proposal tragedy may have been averted, for he would have been compelled to consider the consequences of his experiment and acknowledge, if not fulfill, his concomitant responsibilities to the creature that he abandoned and left to fend for itself.

  18. The Editorial Board is Changing

    Directory of Open Access Journals (Sweden)

    LE Nicolle


    Full Text Available The success of The Canadian Journal of Infectious Diseases & Medical Microbiology over the past 16 years is largely attributable to the continuing and substantial support from a dedicated and enthusiastic Editorial Board. The individuals who have participated are listed on the masthead in each issue of the Journal. Many of the current Editorial Board members have participated continually since the initiation of the Journal - a commitment of over 16 years. They have provided oversight as the Journal has evolved, and their critical insights in the discussion of issues as they have developed, as well as their suggestions for new directions, have significantly contributed to the maintenance of Journal quality. Our associate editors have been particularly active. They have coordinated and, frequently, developed much of the content for the special sections - adult and paediatric infectious disease notes, clinical vignettes and reviews. They have also facilitated the peer review of submitted manuscripts by identifying reviewers and making recommendations for revisions and publication. These contributions have been essential to the continuing operation and high, scientific quality of the Journal.

  19. Optimal back-to-front airplane boarding (United States)

    Bachmat, Eitan; Khachaturov, Vassilii; Kuperman, Ran


    The problem of finding an optimal back-to-front airplane boarding policy is explored, using a mathematical model that is related to the 1+1 polynuclear growth model with concave boundary conditions and to causal sets in gravity. We study all airplane configurations and boarding group sizes. Optimal boarding policies for various airplane configurations are presented. Detailed calculations are provided along with simulations that support the main conclusions of the theory. We show that the effectiveness of back-to-front policies undergoes a phase transition when passing from lightly congested airplanes to heavily congested airplanes. The phase transition also affects the nature of the optimal or near-optimal policies. Under what we consider to be realistic conditions, optimal back-to-front policies lead to a modest 8-12% improvement in boarding time over random (no policy) boarding, using two boarding groups. Having more than two groups is not effective.

  20. Optimal back-to-front airplane boarding. (United States)

    Bachmat, Eitan; Khachaturov, Vassilii; Kuperman, Ran


    The problem of finding an optimal back-to-front airplane boarding policy is explored, using a mathematical model that is related to the 1+1 polynuclear growth model with concave boundary conditions and to causal sets in gravity. We study all airplane configurations and boarding group sizes. Optimal boarding policies for various airplane configurations are presented. Detailed calculations are provided along with simulations that support the main conclusions of the theory. We show that the effectiveness of back-to-front policies undergoes a phase transition when passing from lightly congested airplanes to heavily congested airplanes. The phase transition also affects the nature of the optimal or near-optimal policies. Under what we consider to be realistic conditions, optimal back-to-front policies lead to a modest 8-12% improvement in boarding time over random (no policy) boarding, using two boarding groups. Having more than two groups is not effective.

  1. New Rationales for Women on Boards


    Choudhury, B.


    Should measures promoting women to corporate boards be solely justified in terms of economic arguments? Traditionally, such measures have tended to rely on utilitarian arguments, despite the fact that the most prominent of these arguments—the relationship between women’s presence on boards and firm financial performance—is equivocal. Conversely, this article argues that rationales for increasing women on boards should be based on both equality and economics grounds. An equality rationale is n...

  2. Board Directors and Corporate Social Responsibility

    Directory of Open Access Journals (Sweden)

    Mariana Nedelcu (Bunea


    Full Text Available The boards of directors and corporate social responsibility (CSR have been the subject of much study and debate in the corporate governance circles over the two last decades. With issues ranging from poor corporate reporting to excessive executive compensation often splashed in the headlines, the role of boards comes into the media limelight as never before. Boards of directors are also becoming increasingly aware of corporate social responsibility issues.

  3. Board Directors and Corporate Social Responsibility


    Mariana Nedelcu (Bunea)


    The boards of directors and corporate social responsibility (CSR) have been the subject of much study and debate in the corporate governance circles over the two last decades. With issues ranging from poor corporate reporting to excessive executive compensation often splashed in the headlines, the role of boards comes into the media limelight as never before. Boards of directors are also becoming increasingly aware of corporate social responsibility issues.

  4. Diversity of what? Multifaceted Boards and Directors


    A. Hillman; S. Nielsen; A. Zattoni


    Board diversity has long intrigued practitioners and scholars. Constituents encourage companies to vary of director characteristics, but companies often resist. Academics debate whether diversity is beneficial for board decision-making and the empirical evidence is mixed, partly because “diversity” is treated as a singular construct despite representing many different forms (e.g. demographic, human capital and social capital). We propose a theoretical model of board diversit...

  5. Does firm performance affect board independence?

    Directory of Open Access Journals (Sweden)

    Yi Wang


    Full Text Available This paper seeks to shed some light on the antecedents of board independence. Specifically, it attempts to test the conceptual frameworks which make different predictions about the effect of firm performance on the level of board independence. The results provide support for the perspective that appointing more independent members to the boards may merely represent firms’ attempts to comply with institutional pressures. It is found that higher blockholder shareholdings lead to lower independence on the board, and audit and remuneration committees. Moreover, larger firms have relatively more independent directors sitting on nomination and remuneration committees.

  6. The Ontario Energy Board's proposed new mandate

    International Nuclear Information System (INIS)

    Laughren, F.


    The Ontario Energy Board's proposed new mandate was reviewed. The role of the Board will be to regulate the monopoly delivery components of the electricity and natural gas industry and to smooth the transition to competition. The Board will monitor market performance and will encourage electricity and natural gas monopoly services to be compatible where possible. The Board will also assist local restructuring efforts when called upon do so and ensure that the marketplace operates efficiently and effectively. Gas marketers' licensing is scheduled to begin in early 1999. Licenses will also apply to the electric industry. The objectives of the proposed licensing, the regulatory requirements and the proposed regulatory approach are described

  7. 76 FR 67402 - Performance Review Board Appointments (United States)


    ... Executive Service (SES), Senior Level (SL), and Scientific or Professional (ST) Performance Review Boards...; White, Dave. Research, Education and Economics (REE) Bartuska, Ann; Jacobs-Young, Chavonda; Woteki...

  8. Corporate Social Responsibility in the Board Room

    DEFF Research Database (Denmark)

    Knudsen, Jette Steen; Geisler, Kathrine; Ege, Mette


    When do board directors pay attention to corporate social responsibility (CSR) issues? Board directors have traditionally focused on maximizing shareholder profit and viewed corporate governance narrowly as a way to meet this goal. They have paid little or no attention to CSR issues because...... they see CSR as a contrast to profit maximization. We argue in this article that companies can no longer ignore CSR. We propose that three conditions must be met in order for boards to pay attention toCSR. First, the board must have a mindset that considers CSR as contributing value to the firm. Second...

  9. Social Responsibility in the Board Room

    DEFF Research Database (Denmark)

    Ege, Mette; Geisler, Kathrine; Knudsen, Jette Steen

    When do board directors pay attention to corporate social responsibility (CSR) issues? Board directors have traditionally focused on maximizing shareholder profit and viewed corporate governance narrowly as a way to meet this goal. They have paid little or no attention to CSR issues because...... they see CSR as a contrast to profit maximization. We argue in this article that companies can no longer ignore CSR. We propose that three conditions must be met in order for boards to pay attention to CSR. First, the board must have a mind-set that considers CSR as contributing value to the firm. Second...

  10. 78 FR 36191 - Meeting of the National Biodefense Science Board (United States)


    ... rapidly restoring community functioning after emergency events. Recent research suggests that social... objectives for preparedness, the identification of the gaps between these goals and objectives and what can... received by close of business one week prior to each teleconference will be distributed to the NBSB in...

  11. Defense Science Board Task Force Report: Predicting Violent Behavior (United States)


    Boeing • Coca Cola • Disney • Intel Corporation D E F E N S E S C I E N C E B O A R D | D E P A R T M E N T O F D E F E N S E DSB TASK FORCE...University of North Carolina Corporations:  Microsoft  Coca Cola  Boeing  Disney D E F E N S E S C I E N C E B O A R D | D E P A R T M E

  12. Army Science Board 2001 AD HOC Study "Knowledge Management"

    National Research Council Canada - National Science Library

    Reese, John


    ...) Examine technology and operational concepts to mitigate asymmetric threats; (4) Provide a 2008-2012 roadmap to enable small, autonomous processing that facilitates knowledge production, sharing and decision making...

  13. Defense Science Board Summer Study on Strategic Surprise (United States)


    actions and hedges against changing priorities. The study focused on potential regrets in eight areas and provides recommendations to avoid ... avoid   potential  regrets  in 2024.  A Changing Context for Operations  The study explored current and future operational contexts. The study defined...hedge against these and similar surprises—and to  avoid   regretting  actions or lack  of action taken today—the study evaluated several key mission and

  14. 75 FR 65497 - Science Board Advisory Committee; Notice of Meeting (United States)


    ... DEPARTMENT OF HEALTH AND HUMAN SERVICES Food and Drug Administration [Docket No. FDA-2010-N-0001... for Food Safety and Applied Nutrition (CFSAN) will present its evaluation and review of the final... contact person on or before Monday, November 8, 2010. Oral presentations from the public will be scheduled...

  15. 75 FR 4589 - National Science Board; Sunshine Act Meetings; Notice (United States)


    ... DISCUSSED: Wednesday, February 3, 2010 Chairman's Introduction Open Session: 7:30 a.m.-7:35 a.m., Room 1235... Research. NSB Action Item: Award for NEON: Observatory Design and Prototyping. Committee on Strategy and.... Financial System Modernization--``iTRAK''. Inspector General's ARRA Update. Closed Investigative Matters...

  16. 75 FR 38504 - Army Science Board Plenary Meeting (United States)


    ... Soldier Resilience and Performance Sustainment. Purposed Agenda: Wednesday 21 July: 0800-0930 Study... Meeting: July 21, 2010. Time(s) of Meeting: 0800-1330. Location: Beckman Center, 100 Academy, Irvine, CA...

  17. Defense Science Board (DSB) Task Force on Cyber Deterrence (United States)


    Adversary-Specific Campaign Planning and Wargaming Findings: Because deterrence operates by affecting the calculations of specific decision -making...a strategic threat to U.S. critical infrastructure, or to be able to significantly affect the U.S. military’s ability to deploy and operate globally...bolster U.S. cyber deterrence and strengthen U.S. national security. The Task Force notes that the cyber threat to U.S. critical infrastructure is

  18. Natick Soldier Systems Center Science and Technology Board (9th) (United States)


    NSRDEC overarching CRADA’s with all five UMass campuses (in routing) • Patent License Agreement with Niche, Inc , New Bedford, MA (Ground impact...84.2 1 201 1 2014 GEAR4 UNITY REMOTE (Ben created.’deveil)j)ild~icensed) 2017 :>O?O SUM DEVICES QUANTIFIED SELF JAWBONE UP ATBIT ULTRA NIKE FUEL...Rudolph gained system development experience in multiple IT companies. In March 1994, he co-founded Paradigm Technologies, Inc ., an industry partner

  19. 77 FR 32641 - Meetings of the National Biodefense Science Board (United States)


    ... 26, 2012, public meeting will be held at the Washington Plaza Hotel, 10 Thomas Circle Northwest... meeting to facilitate attendance. Pre-registration is optional for in-person attendance, however online... year 2020. The NBSB continues to review and evaluate the 2012 Public Health Emergency Medical...

  20. 78 FR 64205 - Army Science Board Fall Plenary Meeting (United States)


    ... by 41 CFR 102-3.150(a). Therefore, the Advisory Committee Management Officer for the Department of..., (703) 545-8652,"> or Carolyn German, (703) 545-8654, carolyn.t.german[email protected] . SUPPLEMENTARY INFORMATION: None. Brenda S. Bowen, Army...

  1. 78 FR 69138 - Sunshine Act Meeting; National Science Board (United States)


    ... action and information items for NSB review Report on Antarctic site visit NSB Information Item: Next Generation National Nanotechnology Infrastructure Network (NG NNIN) Committee on Programs and Plans (CPP...

  2. 78 FR 35035 - National Biodefense Science Board; Call for Nominees (United States)


    ... from the pharmaceutical, biotechnology and device industries, (c) four academicians, and (d) five other..., biotechnology, and genetic engineering with respect to threats posed by naturally occurring infectious diseases...

  3. 78 FR 40480 - National Biodefense Science Board; Call for Nominees (United States)


    ... from the pharmaceutical, biotechnology and device industries, (c) four academicians, and (d) five other..., biotechnology, and genetic engineering with respect to threats posed by naturally occurring infectious diseases...

  4. Defense Science Board (DSB) Summer Study Report on Strategic Surprise (United States)


    modeling  and  simulation capabilities and test facilities.  Recommendation 15  Leveraging the Internet of Things  Department of Defense should create a...Manferdelli      Intel  Dr. Joseph  Markowitz       Private Consultant  Dr. Mark Maybury      MITRE  Hon. James Miller      Private Consultant  Hon. Judith

  5. 76 FR 62457 - National Science Board; Sunshine Act Meeting (United States)


    ... available for the public and NSF staff to listen-in on this teleconference meeting. All visitors must... the room number. Call 703-292- 7000 to request your badge, which will be ready for pick-up at the...

  6. 76 FR 69769 - National Science Board; Sunshine Act Meetings; Notice (United States)


    ...., Arlington, VA 22230. A room will be available for the public and NSF staff to listen-in on this... will be ready for pick-up at the visitor's desk on the day of the meeting. All visitors must report to...

  7. 76 FR 50759 - National Science Board; Sunshine Act Meeting (United States)


    ... the public and NSF staff to listen-in on this teleconference meeting. All visitors must contact the... number. Call 703-292- 7000 to request your badge, which will be ready for pick-up at the visitor's desk...

  8. 76 FR 35481 - National Science Board; Sunshine Act Meetings; Notice (United States)


    ... 22230. A room will be available for the public and NSF staff to listen-in on this teleconference meeting... for pick-up at the visitor's desk on the day of the meeting. All visitors must report to the NSF...

  9. 76 FR 72450 - National Science Board; Sunshine Act Meetings; Notice (United States)


    ... Foundation, 4201Wilson Blvd., Arlington, VA 22230. A room will be available for the public and NSF staff to... request your badge, which will be ready for pick-up at the visitor's desk on the day of the meeting. All...

  10. 76 FR 6828 - National Science Board; Sunshine Act Meetings; Notice (United States)


    ... place of business to request your badge, which will be ready for pick-up at the visitor's desk on the... with NSF Staff Summary of January 26, 2011 Task Force Teleconference Discussion of Task Force Future...

  11. 76 FR 36938 - National Science Board; Sunshine Act Meetings; Notice (United States)


    ... of the meeting, a room will be available for the public and NSF staff to listen-in on this... will be ready for pick-up at the visitor's desk on the day of the meeting. All visitors must report to...

  12. 76 FR 70168 - National Science Board; Sunshine Act Meetings (United States)


    ...., Arlington, VA 22230. A room will be available for the public and NSF staff to listen-in on this... will be ready for pick-up at the visitor's desk on the day of the meeting. All visitors must report to...

  13. 78 FR 8499 - National Board for Education Sciences; Meeting (United States)


    ... things, the establishments of activities to be supported by the Institute, on the funding for... Portable Document Format (PDF) on the Internet at the following site: document published in the Federal Register. Free Internet access to this official edition of the Federal...

  14. 76 FR 58789 - National Board for Education Sciences; Meeting (United States)


    ...) on, among other things, the establishment of activities to be supported by the Institute and the... (PDF) on the Internet at the following site: . To use... in the Federal Register. Free Internet access to the official edition of the Federal Register and the...

  15. 78 FR 28811 - National Board for Education Sciences; Meeting (United States)


    ... things, the establishments of activities to be supported by the Institute, on the funding for... Format (PDF) on the Internet at the following site: . To use PDF... in the Federal Register. Free Internet access to this official edition of the Federal Register and...

  16. 77 FR 33732 - National Board for Education Sciences; Meeting (United States)


    ...) on, among other things, the establishment of activities to be supported by the Institute, on the... Document Format (PDF) on the Internet at the following site: . To... document published in the Federal Register. Free Internet access to the official edition of the Federal...

  17. 77 FR 10575 - National Science Board; Sunshine Act Meetings; Notice (United States)


    ... 9th and N. Stuart Streets entrance on the day of the teleconference to receive a visitor's badge... additional information and schedule updates (time, place, subject matter or status of meeting) may be found...

  18. 78 FR 21631 - National Science Board; Sunshine Act Meetings; Notice (United States)


    ... visitor desk located in the lobby at the 9th and N. Stuart Streets entrance on the day of the [[Page 21632..., subject matter or status of meeting) may be found at . Point of contact...

  19. 78 FR 23312 - National Science Board; Sunshine Act Meetings; Notice (United States)


    ... must report to the NSF visitor desk located in the lobby at the 9th and N. Stuart Streets entrance on... information which may be found at . Point of contact for the meeting is John...

  20. 78 FR 42111 - National Science Board; Sunshine Act Meetings; Notice (United States)


    ...'s badge. All visitors must report to the NSF visitor desk located in the lobby at the 9th and N... information. Meeting information and updates (time, place, subject matter or status of meeting) may be found...

  1. 78 FR 14593 - National Science Board; Sunshine Act Meetings (United States)


    ... NSF visitor desk located in the lobby at the 9th and N. Stuart Streets entrance on the day of the... matter or status of meeting) may be found at . Point of contact for this...

  2. 78 FR 20359 - Sunshine Act Meetings; National Science Board (United States)


    ... for May 2013 meeting. STATUS: Open. LOCATION: This meeting will be held by teleconference at the... visitors must report to the NSF visitor desk located in the lobby at the 9th and N. Stuart Streets entrance... information and updates (time, place, subject matter or status of meeting) may be found at

  3. Defense Science Board Task Force Report on Cyber Defense Management (United States)


    techniques coupled with the use of the Markov decision processand stochastic math models enhance the results by accounting for the inherent randomness...Purpose/Goal Macro-economic input/output Santos and Haimes, 2004 Evaluate sensitivity of the U.S. economy to cyber attacks in particular sectors Macro

  4. Lunar Science from and for Planet Earth (United States)

    Pieters, M. C.; Hiesinger, H.; Head, J. W., III


    Our Moon Every person on Earth is familiar with the Moon. Every resident with nominal eyesight on each continent has seen this near-by planetary body with their own eyes countless times. Those fortunate enough to have binoculars or access to a telescope have explored the craters, valleys, domes, and plains across the lunar surface as changing lighting conditions highlight the mysteries of this marvellously foreign landscape. Schoolchildren learn that the daily rhythm and flow of tides along the coastlines of our oceans are due to the interaction of the Earth and the Moon. This continuous direct and personal link is but one of the many reasons lunar science is fundamental to humanity. The Earth-Moon System In the context of space exploration, our understanding of the Earth-Moon system has grown enormously. The Moon has become the cornerstone for most aspects of planetary science that relate to the terrestrial (rocky) planets. The scientific context for exploration of the Moon is presented in a recent report by a subcommittee of the Space Studies Board of the National Research Council [free from the website:]. Figure 1 captures the interwoven themes surrounding lunar science recognized and discussed in that report. In particular, it is now recognized that the Earth and the Moon have been intimately linked in their early history. Although they subsequently took very different evolutionary paths, the Moon provides a unique and valuable window both into processes that occurred during the first 600 Million years of solar system evolution (planetary differentiation and the heavy bombardment record) as well as the (ultimately dangerous) impact record of more recent times. This additional role of the Moon as keystone is because the Earth and the Moon share the same environment at 1 AU, but only the Moon retains a continuous record of cosmic events. An Initial Bloom of Exploration and Drought The space age celebrated its 50th

  5. NPS Transit System Passenger Boardings Study: Converting Ticket Sales to Passenger Boardings. (United States)


    This report examines the reporting of passenger boardings (unlinked passenger trips) by NPS transit systems that use a ticket sales conversion methodology. By studying and validating the park units' passenger boarding methodology from converting tick...

  6. National Board Certification as Professional Development: What Are Teachers Learning?

    Directory of Open Access Journals (Sweden)

    David Lustick


    Full Text Available This study investigated the National Board for Professional Teaching Standards’ (NBPTS assessment process in order to identify, quantify, and substantiate learning outcomes from the participants. One hundred and twenty candidates for the Adolescent and Young Adult Science (AYA Science Certificate were studied over a two-year period using the recurrent institutional cycle research design. This quasi-experimental methodology allowed for the collection of both cross-sectional and longitudinal data insuring a good measure of internal validity regarding observed changes between individual and across group means. Transcripts of structured interviews with each teacher were scored by multiple assessors according to the 13 standards of NBPTS’ framework for accomplished science teaching. These scores provided the quantitative evidence of teacher learning in this study. Significant pre-intervention to post-intervention changes to these individual and group means are reported as learning outcomes from the assessment process. Findings suggest that the intervention had significant impact upon candidates’ understanding of knowledge associated with science teaching with an overall effect size of 0.47. Standards associated with greatest gains include Scientific Inquiry and Assessment. The results support the claim that the certification process is an effective standards based professional learning opportunity comparable to other human improvement interventions from related domains. Drawing on qualitative data, we also explore three possible implications of teacher learning outcomes from certification upon classroom practice identified as Dynamic, Technical, and Deferred. These patterns suggest that more than one kind of learning may be taking place in relation to board certification. The discussion then considers the importance of this study for policy making and science teaching communities.

  7. National board certification as professional development: What are teachers learning? (United States)

    Lustick, David Scott

    This study investigated the National Board for Professional Teaching Standards' (NBPTS) assessment process in order to identify, quantify, and substantiate possible learning outcomes from the participants. One hundred and twenty candidates for the Adolescent and Young Adult Science (AYA Science) Certificate were studied over a 2-year period using the recurrent institutional cycle research design. This quasi-experimental methodology allowed for the collection of both cross-sectional and longitudinal data insuring a good measure of internal validity regarding observed changes both between and within group means. Multiple assessors scored transcripts of structured interviews with each teacher using the NBPTS' assessment framework according to the 13 standards accomplished science teaching. The scores (aggregated to the group level) provided the quantitative evidence of teacher learning in this study. Significant changes in mean scores from pre to post are reported at the overall, standard group, and individual standard levels. Findings suggest that the intervention had an overall effect size of .475 upon candidates' understanding of science teaching related knowledge. More specifically, most learning was associated with the standards of Scientific Inquiry and Assessment. The results support the hypothesis that the certification process is an effective standards based professional learning opportunity. The learning outcomes discussed in this report (including the identification of Dynamic, Technical, and Deferred Learning categories) should inform debate between educational stakeholders regarding the financial and ideological support of National Board certification as a means of improving teacher quality, provide suggestions for the improvement of the assessment process, and contribute insight into the current divisive state of science education in public education.

  8. Hospital boards and hospital strategic focus: the impact of board involvement in strategic decision making. (United States)

    Ford-Eickhoff, Karen; Plowman, Donde Ashmos; McDaniel, Reuben R


    Despite pressures to change the role of hospital boards, hospitals have made few changes in board composition or director selection criteria. Hospital boards have often continued to operate in their traditional roles as either "monitors" or "advisors." More attention to the direct involvement of hospital boards in the strategic decision-making process of the organizations they serve, the timing and circumstances under which board involvement occurs, and the board composition that enhances their abilities to participate fully is needed. We investigated the relationship between broader expertise among hospital board members, board involvement in the stages of strategic decision making, and the hospital's strategic focus. We surveyed top management team members of 72 nonacademic hospitals to explore the participation of critical stakeholder groups such as the board of directors in the strategic decision-making process. We used hierarchical regression analysis to explore our hypotheses that there is a relationship between both the nature and involvement of the board and the hospital's strategic orientation. Hospitals with broader expertise on their boards reported an external focus. For some of their externally-oriented goals, hospitals also reported that their boards were involved earlier in the stages of decision making. In light of the complex and dynamic environment of hospitals today, those charged with developing hospital boards should match the variety in the external issues that the hospital faces with more variety in board makeup. By developing a board with greater breadth of expertise, the hospital responds to its complex environment by absorbing that complexity, enabling a greater potential for sensemaking and learning. Rather than acting only as monitors and advisors, boards impact their hospitals' strategic focus through their participation in the strategic decision-making process.

  9. Historical Trends in Graduate Research and Training of Diplomates of the American Board of Forensic Anthropology. (United States)

    Bethard, Jonathan D


    The history of forensic anthropology has been documented by numerous scholars. These contributions have described the work of early pioneers in the field and have described important milestones, such as the founding of the Physical Anthropology Section of the American Academy of Forensic Sciences (AAFS) in 1972 and the American Board of Forensic Anthropology (ABFA) in 1977. This paper contributes to the growing literature on the history of forensic anthropology by documenting the academic training of all individuals who have been granted diplomate status by the ABFA (n = 115). Doctoral dissertation titles were queried to discern broad patterns of research foci. A total of 39 doctoral granting institutions have trained diplomates and 77.3% of board-certified forensic anthropologists wrote dissertations involving skeletal biology, bioarchaeology, or forensic anthropology. Board-certified forensic anthropologists are a broadly trained group of professionals with far-reaching anthropological interests and expertise. © 2016 American Academy of Forensic Sciences.

  10. Science and Science Fiction (United States)

    Oravetz, David


    This article is for teachers looking for new ways to motivate students, increase science comprehension, and understanding without using the old standard expository science textbook. This author suggests reading a science fiction novel in the science classroom as a way to engage students in learning. Using science fiction literature and language…

  11. 76 FR 57026 - Air Force Scientific Advisory Board Notice of Meeting (United States)


    ... open to the public. The meeting on Thursday, 14 October, will be from 8 a.m.-11:30 a.m. and closed to... Board; Air Force Global Strike Command overview highlighting high priority capability gaps and technology solution partnerships; Air Force Research Laboratory overview focusing on the Air Force Science...

  12. Model Debate for the Yellow Book Learning in Islamic Boarding School (United States)

    Apdoludin; Saidek, Abdul Rahim; Islami, Raisul


    This study aimed to determine the effect model of debate in the yellow book learning in schools to improve students' critical thinking skills so they can find a new science. This study was an experimental study with a control group. The study was conducted in classes XI Islamic Boarding School Al-Hidayah Jambi. This study uses two parallel…

  13. The Role of School Board Social Capital in District Governance: Effects on Financial and Academic Outcomes (United States)

    Saatcioglu, Argun; Moore, Suzanne; Sargut, Gokce; Bajaj, Aarti


    Social capital refers to the nature of ties within a social unit, as well as the unit's external relationships. We draw from organizational sociology and political science, and also build upon existing insights in school board research, to offer an approach that address the effects of "bonding" (internal ties) and "bridging"…

  14. Florida SpringBoard® Schools Efficacy Study. Statistical Report 2015-1 (United States)

    Niu, Sunny; Li, Jun; Merriman, Jennifer; Matos-Elefonte, Haifa


    In this study, we compare SpringBoard® (SB) schools that had continuously used the SB English Language Arts (ELA) curriculum for at least three years with comparable non-SB schools. For high schools, the outcomes examined were school-level AP® participation and performance for a) all AP subjects, b) ELA and social science AP subjects, and c) ELA…

  15. 78 FR 18978 - Human Studies Review Board; Notification of a Public Webinar/Teleconference (United States)


    ... ENVIRONMENTAL PROTECTION AGENCY [EPA-HQ-ORD-2013-0115; FRL 9794-8] Human Studies Review Board; Notification of a Public Webinar/ Teleconference AGENCY: U. S. Environmental Protection Agency (EPA). ACTION: Notice. SUMMARY: The EPA Office of the Science Advisor announces a public Webinar/teleconference of the...

  16. 76 FR 2107 - Human Studies Review Board; Notice of Public Meeting (United States)


    ... ENVIRONMENTAL PROTECTION AGENCY [EPA-HQ-ORD-2011-0970; FRL-9252-3] Human Studies Review Board; Notice of Public Meeting AGENCY: Environmental Protection Agency (EPA). ACTION: Notice. SUMMARY: The U.S. Environmental Protection Agency (EPA or Agency) Office of the Science Advisor (OSA) announces a public meeting...

  17. 75 FR 32461 - Human Studies Review Board; Notice of Public Meeting (United States)


    ... ENVIRONMENTAL PROTECTION AGENCY [EPA-HQ-ORD-2010-0381; FRL-9159-9] Human Studies Review Board; Notice of Public Meeting AGENCY: Environmental Protection Agency (EPA). ACTION: Notice. SUMMARY: The U.S. Environmental Protection Agency's (EPA or Agency) Office of the Science Advisor (OSA) announces a public meeting...

  18. 77 FR 15099 - Human Studies Review Board; Notification of a Public Webinar/Teleconference (United States)


    ... ENVIRONMENTAL PROTECTION AGENCY [EPA-HQ-ORD-2012-0175; FRL-9647-2] Human Studies Review Board; Notification of a Public Webinar/ Teleconference AGENCY: U. S. Environmental Protection Agency. ACTION: Notice. SUMMARY: The EPA Office of the Science Advisor announces a public Webinar/teleconference of the HSRB to...

  19. 76 FR 77825 - Human Studies Review Board; Notification of a Public Teleconference (United States)


    ... ENVIRONMENTAL PROTECTION AGENCY [EPA-HQ-ORD-2011-0953; FRL-9506-6] Human Studies Review Board; Notification of a Public Teleconference AGENCY: Environmental Protection Agency. ACTION: Notice. SUMMARY: The EPA Office of the Science Advisor announces a public teleconference of the HSRB to discuss its draft...

  20. 75 FR 61748 - Human Studies Review Board; Notice of Public Meeting (United States)


    ... ENVIRONMENTAL PROTECTION AGENCY [EPA-HQ-ORD-2010-0797' FRL-9211-1] Human Studies Review Board; Notice of Public Meeting AGENCY: Environmental Protection Agency (EPA). ACTION: Notice. SUMMARY: The U.S. Environmental Protection Agency (EPA or Agency) Office of the Science Advisor (OSA) announces a public meeting...