2013-01-01
On Monday 14 October, the Service Status Board for GS and IT will change. The new Status Board will be integrated with the CERN Service Portal and with the CERN Service Catalogue. As of today, the SSB will display “Service Incidents”, “Planned Interventions” and “Service Changes”. References valid from 14 October: CERN SSB at https://cern.ch/ssb Computing SSB (previously IT SSB) at https://cern.ch/itssb Nicole Cremel, IT and GS Service Management Support
Shi, Wei; Vu, Therese; Boucher, Didier; Biernacka, Anna; Nde, Jules; Pandita, Raj K; Straube, Jasmin; Boyle, Glen M; Al-Ejeh, Fares; Nag, Purba; Jeffery, Jessie; Harris, Janelle L; Bain, Amanda L; Grzelak, Marta; Skrzypczak, Magdalena; Mitra, Abhishek; Dojer, Norbert; Crosetto, Nicola; Cloonan, Nicole; Becherel, Olivier J; Finnie, John; Skaar, Jeffrey R; Walkley, Carl R; Pandita, Tej K; Rowicka, Maga; Ginalski, Krzysztof; Lane, Steven W; Khanna, Kum Kum
2017-05-04
Hematopoietic stem and progenitor cells (HSPCs) are vulnerable to endogenous damage and defects in DNA repair can limit their function. The 2 single-stranded DNA (ssDNA) binding proteins SSB1 and SSB2 are crucial regulators of the DNA damage response; however, their overlapping roles during normal physiology are incompletely understood. We generated mice in which both Ssb1 and Ssb2 were constitutively or conditionally deleted. Constitutive Ssb1/Ssb2 double knockout (DKO) caused early embryonic lethality, whereas conditional Ssb1/Ssb2 double knockout (cDKO) in adult mice resulted in acute lethality due to bone marrow failure and intestinal atrophy featuring stem and progenitor cell depletion, a phenotype unexpected from the previously reported single knockout models of Ssb1 or Ssb2 Mechanistically, cDKO HSPCs showed altered replication fork dynamics, massive accumulation of DNA damage, genome-wide double-strand breaks enriched at Ssb-binding regions and CpG islands, together with the accumulation of R -loops and cytosolic ssDNA. Transcriptional profiling of cDKO HSPCs revealed the activation of p53 and interferon (IFN) pathways, which enforced cell cycling in quiescent HSPCs, resulting in their apoptotic death. The rapid cell death phenotype was reproducible in in vitro cultured cDKO-hematopoietic stem cells, which were significantly rescued by nucleotide supplementation or after depletion of p53. Collectively, Ssb1 and Ssb2 control crucial aspects of HSPC function, including proliferation and survival in vivo by resolving replicative stress to maintain genomic stability. © 2017 by The American Society of Hematology.
Lifescience Database Archive (English)
Full Text Available SS (Link to library) SSB721 (Link to dictyBase) ssb721 G20804 DDB0230090 Contig-U04...594-1 SSB721E (Link to Original site) - - - - - - SSB721E 549 Show SSB721 Library SS (Link to library) Clone ID SSB721 (Link to dict...yBase) Atlas ID ssb721 NBRP ID G20804 dictyBase ID DDB0230090 Link to Contig Contig-...U04594-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSB7-A/SSB72...quence update 1997.11.25 Translated Amino Acid sequence NDINSIVCKANSQCPTSHICTSSNKCIIKYSSKVGEKCTDSPLQCRVFNGEI
PEMBINAAN PRESTASI SEPAK BOLA DI SEKOLAH SEPAK BOLA (SSB TUGU MUDA KOTA SEMARANG TAHUN 2012/2013
Directory of Open Access Journals (Sweden)
Bagus Arif Wicaksono
2015-07-01
Full Text Available The purpose of this study to determine the purpose of the establishment of SSB , organization , training programs , facilities and infrastructure , human resources , the role of parents and the community , funding , distribution athlete in SSB Tugu Muda Semarang in 2013. The approach in this study uses a qualitative descriptive approach. Instruments and methods of data collection by observation, interviews , and documentation. The results showed that the SSB Tugu Muda Semarang existing board of management of systematic organization , in carrying out organizational activities carried out by organizations that exist. Based on the results penilitian , the suggestion that the author can say is keep the existing guidance systems , maintain the achievements that have been achieved so that it can attract more new athletes anymore.
Directory of Open Access Journals (Sweden)
Samy Nathan Garas
2010-07-01
Full Text Available Islamic Financial Institutions (IFIs are governed by two boards: the Board of Directors (BoD and the Shari’a Supervisory Board (SSB. The SSB is a panel of Shari’a scholars who act independently from other governance organs. This paper discriminates between dependent SSBs and independent SSBs by using twenty one variables, which are classified into three groups: the implementation of governance best practices, the recruitment of SSB members, and the relationship between the SSB members and other governance organs. This study is one of the first studies that provide empirical results about the SSB independence. Nevertheless, the research focuses exclusively on the Gulf Cooperation Council (GCC countries and excludes the other countries where Shari’a supervision might have different forms. The study has developed a hypothesis, which was tested by a questionnaire. Data was collected from 76 Shari’a Supervisory Boards, 73 Boards of Directors, and 59 shareholders of IFIs in the GCC countries (Bahrain, Kuwait, Qatar, Saudi Arabia, and UAE during 2009. The discriminant analysis has been used in identifying both dependent and independent SSBs. The paper finds five variables relevant in discriminating the two groups. These variables are the incentives provided to the SSB; the average remuneration to the SSB members; the existence of the policy of penalties for violating the code of conduct; the relation between the SSB members and the BoD; and the role of executive management in recruiting SSB members.
2012-01-12
... NATIONAL SCIENCE FOUNDATION National Science Board; Notice of Opportunity for Public Comment on the National Science Board Data Policies Report AGENCY: National Science Board (NSB), NSF. ACTION: Request for public comments. SUMMARY: The National Science Board seeks comments from the public on the...
Lifescience Database Archive (English)
Full Text Available SS (Link to library) SSB171 (Link to dictyBase) ssb171 - - Contig-U02783-1 SSB171F ...nk to dictyBase) Atlas ID ssb171 NBRP ID - dictyBase ID - Link to Contig Contig-U02783-1 Original site URL h
Chen, Yvonnes; Porter, Kathleen J.; Estabrooks, Paul A.; Zoellner, Jamie
2017-01-01
Understanding how adults’ media literacy skill sets impact their sugar-sweetened beverage (SSB) intake provides insight into designing effective interventions to enhance their critical analysis of marketing messages and thus improve their healthy beverage choices. However, a media literacy scale focusing on SSBs is lacking. This cross-sectional study uses baseline data from a large randomized controlled trial to (a) describe the psychometric properties of an SSB Media Literacy Scale (SSB-ML) scale and its subdomains, (b) examine how the scale varies across demographic variables, and (c) explain the scale’s concurrent validity to predict SSB consumption. Results from 293 adults in rural southwestern Virginia (81.6% female, 94.0% White, 54.1% receiving SNAP and/or WIC benefits, average 410 SSB kcal daily) show that overall SSB-ML scale and its subdomains have strong internal consistencies (Cronbach’s alphas ranging from 0.65 to 0.83). The Representation & Reality domain significantly predicted SSB kilocalories, after controlling for demographic variables. This study has implications for the assessment and inclusion of context-specific media literacy skills in behavioral interventions. PMID:27690635
Chen, Yvonnes; Porter, Kathleen J; Estabrooks, Paul A; Zoellner, Jamie
2017-10-01
Understanding how adults' media literacy skill sets impact their sugar-sweetened beverage (SSB) intake provides insight into designing effective interventions to enhance their critical analysis of marketing messages and thus improve their healthy beverage choices. However, a media literacy scale focusing on SSBs is lacking. This cross-sectional study uses baseline data from a large randomized controlled trial to (a) describe the psychometric properties of an SSB Media Literacy Scale (SSB-ML) scale and its subdomains, (b) examine how the scale varies across demographic variables, and (c) explain the scale's concurrent validity to predict SSB consumption. Results from 293 adults in rural southwestern Virginia (81.6% female, 94.0% White, 54.1% receiving SNAP and/or WIC benefits, average 410 SSB kcal daily) show that overall SSB-ML scale and its subdomains have strong internal consistencies (Cronbach's alphas ranging from 0.65 to 0.83). The Representation & Reality domain significantly predicted SSB kilocalories, after controlling for demographic variables. This study has implications for the assessment and inclusion of context-specific media literacy skills in behavioral interventions.
Lifescience Database Archive (English)
Full Text Available SS (Link to library) SSB322 (Link to dictyBase) - - - Contig-U03539-1 SSB322Z (Link... to Original site) - - SSB322Z 393 - - - - Show SSB322 Library SS (Link to library) Clone ID SSB322 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U03539-1 Original site URL http://dict...KGKXYILQDKQYKERGVGTIRVNKDLEEKXRIIMNAD GSKKNILNVNIFPKMKVTSPNEKTLTFIAFEDDKICTFVLIAKPEEIKNFSTVINKQISS LEVA*nfil...NAD GSKKNILNVNIFPKMKVTSPNEKTLTFIAFEDDKICTFVLIAKPEEIKNFSTVINKQISS LEVA*nfilkkkk Homology vs CSM-cDNA Score E
Chen, Yvonnes; Porter, Kathleen J.; Estabrooks, Paul A.; Zoellner, Jamie
2016-01-01
Understanding how adults’ media literacy skill sets impact their sugar-sweetened beverage (SSB) intake provides insight into designing effective interventions to enhance their critical analysis of marketing messages and thus improve their healthy beverage choices. However, a media literacy scale focusing on SSBs is lacking. This cross-sectional study uses baseline data from a large randomized controlled trial to (a) describe the psychometric properties of an SSB Media Literacy Scale (SSB-ML) ...
Directory of Open Access Journals (Sweden)
Ivett María Ramírez-Pérez
2017-01-01
Full Text Available One of the fundamental causes of massive destruction of chambers and vaults in the Furnace of Reduction at the Ernesto Che Guevara Factory is due to operate the combustion chambers with excess of contribution of heat, causing that the flame of very high temperature penetrates into the homes, affecting the throats of the chambers, the vaults, teeth and arms. The burners current are Prior SSB10. In this paper is demonstrated that the burning Prior SSB 10 have double productivity that the SSB 7 with the same quantity of air to the burner. It is evaluated the substitution of the burning Prior SSB 10 by SSB 7 on the operation of the Furnace of Reduction No. 10 at the Ernesto Che Guevara (ECG Factory. Demonstrating that the change not produce variations in the operation.
INTS3 controls the hSSB1-mediated DNA damage response
Skaar, Jeffrey R.; Richard, Derek J.; Saraf, Anita; Toschi, Alfredo; Bolderson, Emma; Florens, Laurence; Washburn, Michael P.; Khanna, Kum Kum; Pagano, Michele
2009-01-01
Human SSB1 (single-stranded binding protein 1 [hSSB1]) was recently identified as a part of the ataxia telangiectasia mutated (ATM) signaling pathway. To investigate hSSB1 function, we performed tandem affinity purifications of hSSB1 mutants mimicking the unphosphorylated and ATM-phosphorylated states. Both hSSB1 mutants copurified a subset of Integrator complex subunits and the uncharacterized protein LOC58493/c9orf80 (henceforth minute INTS3/hSSB-associated element [MISE]). The INTS3?MISE?h...
Automating ATLAS Computing Operations using the Site Status Board
Andreeva, J; The ATLAS collaboration; Campana, S; Di Girolamo, A; Espinal Curull, X; Gayazov, S; Magradze, E; Nowotka, MM; Rinaldi, L; Saiz, P; Schovancova, J; Stewart, GA; Wright, M
2012-01-01
The automation of operations is essential to reduce manpower costs and improve the reliability of the system. The Site Status Board (SSB) is a framework which allows Virtual Organizations to monitor their computing activities at distributed sites and to evaluate site performance. The ATLAS experiment intensively uses SSB for the distributed computing shifts, for estimating data processing and data transfer efficiencies at a particular site, and for implementing automatic exclusion of sites from computing activities, in case of potential problems. ATLAS SSB provides a real-time aggregated monitoring view and keeps the history of the monitoring metrics. Based on this history, usability of a site from the perspective of ATLAS is calculated. The presentation will describe how SSB is integrated in the ATLAS operations and computing infrastructure and will cover implementation details of the ATLAS SSB sensors and alarm system, based on the information in SSB. It will demonstrate the positive impact of the use of SS...
Board on chemical sciences and technology
International Nuclear Information System (INIS)
1991-01-01
The Board on Chemical Sciences and Technology organizes and provides direction for standing and ad-hoc committees charged with addressing specific issues relevant to the continued health of the chemical sciences and technology community. Studies currently under the oversight of the BCST include a major survey of the chemical sciences, a complementary survey of chemical engineering, an examination of the problems of biohazards in the laboratory, and an analysis of the roots and magnitude of the problem of obsolescent facilities for research and teaching in departments in the chemical sciences and engineering. The Board continues to respond to specific agency requests for program assessments and advice. BCST members are designated to serve as liaison with major federal agencies or departments that support research in order to help identify ways for the Board to assist these organizations. The BCST maintains close contact with professional societies and non-governmental organizations that share the Board's concern for the health of chemical sciences and technology. Individual Board members are assigned responsibility for liaison with the American Chemical Society, the American Institute of Chemical Engineers, the American Society of Biological Chemists, the Council for Chemical Research, the NAS Chemistry and Biochemistry Sections, and the National Academy of Engineering. In the past few years, the Board has served as a focus and a forum for a variety of issues that relate specifically to the health of chemistry
Board on chemical sciences and technology
International Nuclear Information System (INIS)
1991-01-01
The Board on Chemical Sciences and Technology organizes and provides direction for standing and ad hoc committees charged with addressing specific issues relevant to the continued health of the chemical sciences and technology community. Studies currently under the oversight of the BCST include a major survey of chemical engineering, an examination of the problems of biohazards in the laboratory, and an analysis of the roots and magnitude of the problem of obsolescent facilities for research and teaching in departments in the chemical sciences and engineering. The Board continues to respond to specific agency requests for program assessments and advice. BCST members are designated to serve as liaison with major federal agencies or departments that support research in order to help identify ways for the board to assist the these organizations. The BCST also maintains close contact with professional societies and nongovernmental organizations that share the Board's concern for the health of chemical sciences and technology. Individual Board members are assigned responsibility for liaison with the American Chemical Society, the American Institute of Chemical Engineers, the American Society of Biological Chemists, the Council for Chemical Research, the Chemistry and Biochemistry Sections of the National Academy of Sciences (NAS), and the National Academy of Engineering (NAE). In the past few years, the Board has served as a focus and a forum for a variety of issues that relate specifically to the health of chemistry. A sampling of these concerns include: industry-university cooperation; basic research funding in DOD, DOE, NIH, and NSF; basic research in the chemistry of life processes; basic research in biochemical engineering; basic research in the science and technology of new materials; and undergraduate education in chemistry and chemical engineering
75 FR 13265 - National Board for Education Sciences
2010-03-19
... DEPARTMENT OF EDUCATION National Board for Education Sciences AGENCY: Institute of Education Sciences, Department of Education. ACTION: Notice of an open meeting. SUMMARY: This notice sets forth the schedule and proposed agenda of an upcoming meeting of the National Board for Education Sciences. The...
75 FR 53280 - National Board for Education Sciences
2010-08-31
... DEPARTMENT OF EDUCATION National Board for Education Sciences AGENCY: Department of Education, Institute of Education Sciences. ACTION: Notice of an open meeting. SUMMARY: This notice sets forth the schedule and proposed agenda of an upcoming meeting of the National Board for Education Sciences. The...
77 FR 49462 - National Science Board; Sunshine Act Meetings
2012-08-16
... NATIONAL SCIENCE FOUNDATION National Science Board; Sunshine Act Meetings The National Science Board, pursuant to NSF regulations (45 CFR Part 614), the National Science Foundation Act, as amended... regard to the scheduling of a teleconference meeting of the Audit and Oversight Committee for the...
2011-08-16
... Public Teleconferences of the Science Advisory Board Radiation Advisory Committee AGENCY: Environmental Protection Agency (EPA). ACTION: Notice. SUMMARY: The EPA Science Advisory Board (SAB) Staff Office announces... the EPA Science Advisory Board can be found at the EPA SAB Web site at http// www.epa.gov/sab...
Fermilab Friends for Science Education | Board Tools
Fermilab Friends for Science Education FFSE Home About Us Join Us Support Us Contact Us Board Tools Testimonials Our Donors Board of Directors Board Tools Calendar Join Us Donate Now Get FermiGear! Education FFSE Scholarship Tools Google Drive Join Us/Renew Membership Forms: Online - Print Support Us Donation
In order to produce butanol biofuel at a competitive price, agricultural residues such as SSB should be used. This feedstock was studied as a substitute to corn to lower feedstock costs and broaden beyond a food crop. In addition, cutting edge science & technology was applied. In these studies we us...
The essential role of the Deinococcus radiodurans ssb gene in cell survival and radiation tolerance.
Directory of Open Access Journals (Sweden)
J Scott Lockhart
Full Text Available Recent evidence has implicated single-stranded DNA-binding protein (SSB expression level as an important factor in microbial radiation resistance. The genome of the extremely radiation resistant bacterium Deinococcus radiodurans contains genes for two SSB homologs: the homodimeric, canonical Ssb, encoded by the gene ssb, and a novel pentameric protein encoded by the gene ddrB. ddrB is highly induced upon exposure to radiation, and deletions result in decreased radiation-resistance, suggesting an integral role of the protein in the extreme resistance exhibited by this organism. Although expression of ssb is also induced after irradiation, Ssb is thought to be involved primarily in replication. In this study, we demonstrate that Ssb in D. radiodurans is essential for cell survival. The lethality of an ssb deletion cannot be complemented by providing ddrB in trans. In addition, the radiation-sensitive phenotype conferred by a ddrB deletion is not alleviated by providing ssb in trans. By altering expression of the ssb gene, we also show that lower levels of transcription are required for optimal growth than are necessary for high radiation resistance. When expression is reduced to that of E. coli, ionizing radiation resistance is similarly reduced. UV resistance is also decreased under low ssb transcript levels where growth is unimpaired. These results indicate that the expression of ssb is a key component of both normal cellular metabolism as well as pathways responsible for the high radiation tolerance of D. radiodurans.
Dombek, Kenneth M; Kacherovsky, Nataly; Young, Elton T
2004-09-10
In Saccharomyces cerevisiae, a type 1 protein phosphatase complex composed of the Glc7 catalytic subunit and the Reg1 regulatory subunit represses expression of many glucose-regulated genes. Here we show that the Reg1-interacting proteins Bmh1, Bmh2, Ssb1, and Ssb2 have roles in glucose repression. Deleting both BMH genes causes partially constitutive ADH2 expression without significantly increasing the level of Adr1 protein, the major activator of ADH2 expression. Adr1 and Bcy1, the regulatory subunit of cAMP-dependent protein kinase, are both required for this effect indicating that constitutive expression in Deltabmh1Deltabmh2 cells uses the same activation pathway that operates in Deltareg1 cells. Deletion of both BMH genes and REG1 causes a synergistic relief from repression, suggesting that Bmh proteins also act independently of Reg1 during glucose repression. A two-hybrid interaction with the Bmh proteins was mapped to amino acids 187-232, a region of Reg1 that is conserved in different classes of fungi. Deleting this region partially releases SUC2 from glucose repression. This indicates a role for the Reg1-Bmh interaction in glucose repression and also suggests a broad role for Bmh proteins in this process. An in vivo Reg1-Bmh interaction was confirmed by copurification of Bmh proteins with HA(3)-TAP-tagged Reg1. The nonconventional heat shock proteins Ssb1 and Ssb2 are also copurified with HA(3)-TAP-tagged Reg1. Deletion of both SSB genes modestly decreases repression of ADH2 expression in the presence of glucose, suggesting that Ssb proteins, perhaps through their interaction with Reg1, play a minor role in glucose repression.
Wang, T C; Smith, K C
1982-01-01
The molecular defect in DNA repair caused by ssb mutations (single-strand binding protein) was studied by analyzing DNA synthesis and DNA double-strand break production in UV-irradiated Escherichia coli delta uvrB strains. The presence of the ssb-113 mutation produced a large inhibition of DNA synthesis and led to the formation of double-strand breaks, whereas the ssb-1 mutation produced much less inhibition of DNA synthesis and fewer double-strand breaks. We suggest that the single-strand bi...
78 FR 33074 - Army Science Board Summer Study Session
2013-06-03
...--This study evaluates what science and technology competencies the Army must maintain and/or develop as... DEPARTMENT OF DEFENSE Department of the Army Army Science Board Summer Study Session AGENCY... the Army announces the following committee meeting: 1. Name of Committee: Army Science Board (ASB). 2...
2010-06-14
... Closed Meetings of the Science Advisory Board's Scientific and Technological Achievement Awards Committee... Agency's (EPA), Science Advisory Board (SAB) Staff Office announces a meeting and teleconference of the....gov . The SAB Mailing address is: U.S. EPA Science Advisory Board (1400F), U.S. Environmental...
Water Science and Technology Board annual report, 1990
Energy Technology Data Exchange (ETDEWEB)
1990-01-01
This report summarizes the activities of the Water Science and Technology Board (WSTB) during 1990, its eighth year of existence. It describes current and recently completed projects, new activities scheduled to begin in 1991, and plans for the future. The WSTB is intended to be a dynamic forum, a mechanism by which the board community of water science, technology, and policy professionals can help assure high-quality national water programs. As such, the Board considers out-reach and communications of much importance.
Water Science and Technology Board annual report, 1990
Energy Technology Data Exchange (ETDEWEB)
1990-12-31
This report summarizes the activities of the Water Science and Technology Board (WSTB) during 1990, its eighth year of existence. It describes current and recently completed projects, new activities scheduled to begin in 1991, and plans for the future. The WSTB is intended to be a dynamic forum, a mechanism by which the board community of water science, technology, and policy professionals can help assure high-quality national water programs. As such, the Board considers out-reach and communications of much importance.
A core hSSB1–INTS complex participates in the DNA damage response
Zhang, Feng; Ma, Teng; Yu, Xiaochun
2013-01-01
Human single-stranded DNA-binding protein 1 (hSSB1) plays an important role in the DNA damage response and the maintenance of genomic stability. It has been shown that the core hSSB1 complex contains hSSB1, INTS3 and C9orf80. Using protein affinity purification, we have identified integrator complex subunit 6 (INTS6) as a major subunit of the core hSSB1 complex. INTS6 forms a stable complex with INTS3 and hSSB1 both in vitro and in vivo. In this complex, INTS6 directly interacts with INTS3. I...
2010-09-08
... a Public Teleconference of the Science Advisory Board; Polycyclic Aromatic Hydrocarbon (PAH... Science Advisory Board (SAB) Staff Office announces a public teleconference of the SAB Polycyclic Aromatic... EPA Science Advisory Board can be found on the EPA Web site at http://www.epa.gov/sab . SUPPLEMENTARY...
2011-04-21
... ENVIRONMENTAL PROTECTION AGENCY [FRL-9298-6] Science Advisory Board Staff Office; Notification of a Public Teleconferences of the Science Advisory Board Panel for Review of Hydraulic Fracturing... EPA Science Advisory Board can be found at the EPA SAB Web site at http://www.epa.gov/sab . Any...
2011-07-27
... Closed Meetings of the Science Advisory Board's Scientific and Technological Achievement Awards Committee... Agency's (EPA), Science Advisory Board (SAB) Staff Office announces a meeting and teleconference of the[email protected] . The SAB Mailing address is: U.S. EPA Science Advisory Board (1400R), U.S. Environmental...
Core Support of the Board on Mathematical Sciences
Energy Technology Data Exchange (ETDEWEB)
None
1995-04-04
This proposal summarizes activities conducted by the Board on Mathematical Sciences (BMS) during the period August 1, 1994 to July 31, 1995 and describes future plans of the Board for the period August 1, 1995 to July 31, 1998. We are requesting core support in the amount of $105,000 ($35,000 each year) from the Department of Energy for the additional three-year period. The BMS activities supported exclusively by core funding are the annual Department Chairs Colloquia, the National Science and Technology Symposia, specific reports, the initiation of all projects, continuous oversight of all activities, and partial core support of the Committee on Applied and Theoretical Statistics (CATS). Other activities of the Board include giving recommendations on research directions to federal agencies, and reports on education in the mathematical sciences, interaction of mathematical sciences with other areas, health of the mathematical sciences, and emerging research directions.
76 FR 51064 - National Science Board; Sunshine Act Meetings; Notice
2011-08-17
... NATIONAL SCIENCE FOUNDATION National Science Board; Sunshine Act Meetings; Notice The National Science Board (NSB) Committee on Audit and Oversight and the NSB Committee on Strategy and Budget, pursuant to NSF regulations (45 CFR part 614), the National Science Foundation Act, as amended (42 U.S.C...
2011-02-08
... Two Public Teleconferences of the Science Advisory Board Dioxin Review Panel AGENCY: Environmental Protection Agency (EPA). ACTION: Notice. SUMMARY: The EPA Science Advisory Board (SAB) Staff Office announces... concerning the EPA Science Advisory Board can be found on the EPA Web site at http://www.epa.gov/sab...
2011-01-26
... a Public Teleconference of the Science Advisory Board Lead Review Panel AGENCY: Environmental Protection Agency (EPA). ACTION: Notice. SUMMARY: The EPA Science Advisory Board (SAB) Staff Office announces... information concerning the EPA Science Advisory Board can be found on the EPA Web site at http://www.epa.gov...
75 FR 48996 - National Science Board; Sunshine Act Meetings; Notice
2010-08-12
... NATIONAL SCIENCE FOUNDATION National Science Board; Sunshine Act Meetings; Notice The National Science Board's Committee on Audit & Oversight, pursuant to NSF regulations (45 CFR part 614), the National Science Foundation Act, as amended (42 U.S.C. 1862n-5), and the Government in the Sunshine Act (5...
76 FR 3180 - National Science Board; Sunshine Act Meetings; Notice
2011-01-19
... NATIONAL SCIENCE FOUNDATION National Science Board; Sunshine Act Meetings; Notice The National Science Board's Committee on Programs and Plans and the Committee on Audit & Oversight, pursuant to NSF regulations (45 CFR part 614), the National Science Foundation Act, as amended (42 U.S.C. 1862n-5), and the...
2010-03-12
... ENVIRONMENTAL PROTECTION AGENCY [FRL-9126-2] Science Advisory Board Staff Office; Notification of a Public Meeting of the Science Advisory Board (SAB) AGENCY: Environmental Protection Agency (EPA). ACTION: Notice. SUMMARY: The Environmental Protection Agency (EPA) Science Advisory Board (SAB) Staff...
2010-06-14
... a Public Meeting of the Science Advisory Board Exposure and Human Health Committee (EHHC) AGENCY: Environmental Protection Agency (EPA). ACTION: Notice. SUMMARY: The EPA Science Advisory Board (SAB) Staff... Science Advisory Board can be found on the SAB Web site at http://www.epa.gov/sab . SUPPLEMENTARY...
75 FR 61779 - National Science Board: Sunshine Act Meetings; Notice
2010-10-06
... Science Board's Committee on Programs and Plans, pursuant to NSF regulations (45 CFR Part 614), the... National Science Board business and other matters specified, as follows: DATE AND TIME: October 13, 2010, 1... Performance Computing Award. STATUS: Closed. LOCATION: This meeting will be held at National Science...
2011-07-08
... ENVIRONMENTAL PROTECTION AGENCY [FRL-9431-7] Science Advisory Board Staff Office; Notification of a Public Meeting of the Science Advisory Board Panel for the Review of Great Lakes Restoration... information concerning the EPA Science Advisory Board can be found at the EPA SAB Web site at http://www.epa...
77 FR 49463 - National Science Board; Sunshine Act Meetings
2012-08-16
... transaction of National Science Board business. AGENCY HOLDING MEETING: National Science Board. DATE AND TIME: Tuesday, August 21, 2012 from 5:00-6:00 p.m. SUBJECT MATTER: Chairman's remarks, consideration and... Meszaros, [email protected] , (703) 292-7000. Ann Bushmiller, NSB Senior Legal Counsel. [FR Doc. 2012-20197...
Lifescience Database Archive (English)
Full Text Available SS (Link to library) SSB373 (Link to dictyBase) - G00609 DDB0216216 Contig-U04543-1...nk to library) Clone ID SSB373 (Link to dictyBase) Atlas ID - NBRP ID G00609 dictyBase ID DDB0216216 Link to... Contig Contig-U04543-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...Value N AB016728 |AB016728.1 Dictyostelium discoideum sapA mRNA for saposin A, co... 44 7e-04 12 AC116330 |AC116330.2 Dictyostelium discoideum chromosome 2 map 3191214-3323468 strain AX4, comp
Roles of Bacillus subtilis DprA and SsbA in RecA-mediated genetic recombination.
Yadav, Tribhuwan; Carrasco, Begoña; Serrano, Ester; Alonso, Juan C
2014-10-03
Bacillus subtilis competence-induced RecA, SsbA, SsbB, and DprA are required to internalize and to recombine single-stranded (ss) DNA with homologous resident duplex. RecA, in the ATP · Mg(2+)-bound form (RecA · ATP), can nucleate and form filament onto ssDNA but is inactive to catalyze DNA recombination. We report that SsbA or SsbB bound to ssDNA blocks the RecA filament formation and fails to activate recombination. DprA facilitates RecA filamentation; however, the filaments cannot engage in DNA recombination. When ssDNA was preincubated with SsbA, but not SsbB, DprA was able to activate DNA strand exchange dependent on RecA · ATP. This work demonstrates that RecA · ATP, in concert with SsbA and DprA, catalyzes DNA strand exchange, and SsbB is an accessory factor in the reaction. In contrast, RecA · dATP efficiently catalyzes strand exchange even in the absence of single-stranded binding proteins or DprA, and addition of the accessory factors marginally improved it. We proposed that the RecA-bound nucleotide (ATP and to a lesser extent dATP) might dictate the requirement for accessory factors. © 2014 by The American Society for Biochemistry and Molecular Biology, Inc.
76 FR 67715 - Science Advisory Board
2011-11-02
... Administration (NOAA) science programs are of the highest quality and provide optimal support to resource... Advisory Board in Reviewing NOAA's Research and Development Portfolio-Presentation and Discussion; (6) NOAA...
75 FR 40754 - Government in the Sunshine Act Regulations of the National Science Board
2010-07-14
... NATIONAL SCIENCE FOUNDATION 45 CFR Part 614 RIN 3145-AA53 Government in the Sunshine Act Regulations of the National Science Board AGENCY: National Science Board (NSB), National Science Foundation (NSF). ACTION: Direct final rule. SUMMARY: The National Science Board (NSB) National Science Foundation...
DEFF Research Database (Denmark)
Baer, Alan N; McAdams DeMarco, Mara; Shiboski, Stephen C
2015-01-01
phenotypic features. Among SICCA participants classified with SS on the basis of the American-European Consensus Group or American College of Rheumatology criteria, only 2% required the anti-SSB-alone test result to meet these criteria. CONCLUSIONS: The presence of anti-SSB, without anti-SSA antibodies, had...... participants, 2061 (63%) had negative anti-SSA/anti-SSB, 1162 (35%) had anti-SSA with or without anti-SSB, and 74 (2%) anti-SSB alone. Key SS phenotypic features were more prevalent and had measures indicative of greater disease activity in those participants with anti-SSA, either alone or with anti-SSB, than...... in those with anti-SSB alone or negative SSA/SSB serology. These between-group differences were highly significant and not explained by confounding by age, race/ethnicity or gender. Participants with anti-SSB alone were comparable to those with negative SSA/SSB serology in their association with these key...
2011-03-10
... a Public Meeting of the Science Advisory Board Committee on Science Integration for Decision Making... Agency (EPA or Agency) Science Advisory Board (SAB) Staff Office announces a public meeting of the SAB Committee on Science Integration for Decision Making. DATES: The meeting dates are March 29, 2011 from 9 a.m...
2011-02-09
... ENVIRONMENTAL PROTECTION AGENCY [FRL-9264-5] Science Advisory Board Staff Office; Notification of a Public Meeting of the Science Advisory Board Panel for the Review of EPA's Hydraulic Fracturing...-2098 or via e-mail at [email protected] . General information concerning the EPA Science Advisory...
Ssb1 chaperone is a [PSI+] prion-curing factor.
Chacinska, A; Szczesniak, B; Kochneva-Pervukhova, N V; Kushnirov, V V; Ter-Avanesyan, M D; Boguta, M
2001-04-01
Yeast SUP7' or SUP11 nonsense suppressors have no phenotypic expression in strains deficient in the isopentenylation of A37 in tRNA. Here we show that such strains spontaneously produce cells with a nonsense suppressor phenotype which is related to the cytoplasmically inherited determinant and manifests all the key features of the [PSI+] prion. A screen of a multicopy yeast genomic library for genes that inactivate the [PSI+]-related suppressor phenotype resulted in the isolation of the SSB1 gene. Moreover, we demonstrate that multicopy plasmid encoding the Ssb1 chaperone cures cells of the [PSI+] prion.
Fermilab Friends for Science Education | Board of Directors
Fermilab Friends for Science Education FFSE Home About Us Join Us Support Us Contact Us Board of Directors Board Tools Calendar Join Us Donate Now Get FermiGear! Education Office Search Programs Calendar , Chicago, IL Join Us/Renew Membership Forms: Online - Print Support Us Donation Forms: Online - Print Tree
2011-01-26
... ENVIRONMENTAL PROTECTION AGENCY [FRL-9254-5] Science Advisory Board Staff Office; Notification of a Public Teleconference of the Science Advisory Board Nutrient Criteria Review Panel Correction In notice document 2011-1014 beginning on page 3133 in the issue of Wednesday, January 19, 2011, make the...
5 CFR 5301.105 - Restrictions applicable to Members of the National Science Board.
2010-01-01
... National Science Board. 5301.105 Section 5301.105 Administrative Personnel NATIONAL SCIENCE FOUNDATION SUPPLEMENTAL STANDARDS OF ETHICAL CONDUCT FOR EMPLOYEES OF THE NATIONAL SCIENCE FOUNDATION § 5301.105...) by the Chairman of the National Science Board or by the Designated Agency Ethics Official. (3) A...
Pandita, Raj K.; Chow, Tracy T.; Udayakumar, Durga; Bain, Amanda L.; Cubeddu, Liza; Hunt, Clayton R.; Shi, Wei; Horikoshi, Nobuo; Zhao, Yong; Wright, Woodring E.; Khanna, Kum Kum; Shay, Jerry W.; Pandita, Tej K.
2015-01-01
Proliferating mammalian stem and cancer cells express telomerase (TERT) in an effort to extend chromosomal G-overhangs and maintain telomere ends. Telomerase-expressing cells also have higher levels of the single-stranded DNA binding protein SSB1, which has a critical role in DNA double-strand break repair. Here we report that SSB1 binds specifically to G-strand telomeric DNA in vitro and associates with telomeres in vivo. SSB1 interacted with the TERT catalytic subunit and regulates its interaction with telomeres. Deletion of SSB1 reduced TERT interaction with telomeres and lead to G-overhang loss. While SSB1 was recruited to DSB sites, we found no corresponding change in TERT levels at these sites, implying that SSB1-TERT interaction relied upon a specific chromatin structure or context. Our findings offer an explanation for how telomerase is recruited to telomeres to facilitate G-strand DNA extension, a critical step in maintaining telomere ends and cell viability in all cancer cells. PMID:25589350
Application of the SSB biosensor to study in vitro transcription.
Cook, Alexander; Hari-Gupta, Yukti; Toseland, Christopher P
2018-02-12
Gene expression, catalysed by RNA polymerases (RNAP), is one of the most fundamental processes in living cells. The majority of methods to quantify mRNA are based upon purification of the nucleic acid which leads to experimental inaccuracies and loss of product, or use of high cost dyes and sensitive spectrophotometers. Here, we describe the use of a fluorescent biosensor based upon the single stranded binding (SSB) protein. In this study, the SSB biosensor showed similar binding properties to mRNA, to that of its native substrate, single-stranded DNA (ssDNA). We found the biosensor to be reproducible with no associated loss of product through purification, or the requirement for expensive dyes. Therefore, we propose that the SSB biosensor is a useful tool for comparative measurement of mRNA yield following in vitro transcription. Copyright © 2018 The Authors. Published by Elsevier Inc. All rights reserved.
Saccharomyces cerevisiae SSB1 protein and its relationship to nucleolar RNA-binding proteins.
Jong, A Y; Clark, M W; Gilbert, M; Oehm, A; Campbell, J L
1987-08-01
To better define the function of Saccharomyces cerevisiae SSB1, an abundant single-stranded nucleic acid-binding protein, we determined the nucleotide sequence of the SSB1 gene and compared it with those of other proteins of known function. The amino acid sequence contains 293 amino acid residues and has an Mr of 32,853. There are several stretches of sequence characteristic of other eucaryotic single-stranded nucleic acid-binding proteins. At the amino terminus, residues 39 to 54 are highly homologous to a peptide in calf thymus UP1 and UP2 and a human heterogeneous nuclear ribonucleoprotein. Residues 125 to 162 constitute a fivefold tandem repeat of the sequence RGGFRG, the composition of which suggests a nucleic acid-binding site. Near the C terminus, residues 233 to 245 are homologous to several RNA-binding proteins. Of 18 C-terminal residues, 10 are acidic, a characteristic of the procaryotic single-stranded DNA-binding proteins and eucaryotic DNA- and RNA-binding proteins. In addition, examination of the subcellular distribution of SSB1 by immunofluorescence microscopy indicated that SSB1 is a nuclear protein, predominantly located in the nucleolus. Sequence homologies and the nucleolar localization make it likely that SSB1 functions in RNA metabolism in vivo, although an additional role in DNA metabolism cannot be excluded.
[National Academies' Board on Mathematical Sciences and their Application] Final technical report
Energy Technology Data Exchange (ETDEWEB)
Scott T. Weidman
2005-01-11
The National Academies' Board on Mathematical Sciences and their Applications (BMSA) is a primary interface between the research enterprise and federal agencies that rely on the mathematical sciences. The Board provides objective and authoritative advice on how best to apply the tools of mathematics, statistics, operations research, financial engineering, computational modeling, computational science, information analysis, and decision analysis to practical problems of national importance. In so doing, the Board strengthens the policy-making process and increases the visibility of, and appreciation for, the mathematical sciences while also identifying growth areas for the discipline. The Board consists of 18 pro bono experts from a broad range of quantitative fields, with experience in academia, industry, and national laboratories.
Water Science and Technology Board annual report 1988
Energy Technology Data Exchange (ETDEWEB)
1989-01-01
This annual report of the Water Science and Technology Board (WSTB) summarizes the activities of the Board and its subgroups during 1988, its sixth year of existence. Included are descriptions of current and recently completed projects, new activities scheduled to begin in 1989, and plans for the future. The report also includes information on Board and committee memberships, program operational features, and reports produced during the past several years. This annual report is intended to provide an introduction to the WSTB and summary of its program for the year.
Pandita, Raj K; Chow, Tracy T; Udayakumar, Durga; Bain, Amanda L; Cubeddu, Liza; Hunt, Clayton R; Shi, Wei; Horikoshi, Nobuo; Zhao, Yong; Wright, Woodring E; Khanna, Kum Kum; Shay, Jerry W; Pandita, Tej K
2015-03-01
Proliferating mammalian stem and cancer cells express telomerase [telomerase reverse transcriptase (TERT)] in an effort to extend chromosomal G-overhangs and maintain telomere ends. Telomerase-expressing cells also have higher levels of the single-stranded DNA-binding protein SSB1, which has a critical role in DNA double-strand break (DSB) repair. Here, we report that SSB1 binds specifically to G-strand telomeric DNA in vitro and associates with telomeres in vivo. SSB1 interacts with the TERT catalytic subunit and regulates its interaction with telomeres. Deletion of SSB1 reduces TERT interaction with telomeres and leads to G-overhang loss. Although SSB1 is recruited to DSB sites, we found no corresponding change in TERT levels at these sites, implying that SSB1-TERT interaction relies upon a specific chromatin structure or context. Our findings offer an explanation for how telomerase is recruited to telomeres to facilitate G-strand DNA extension, a critical step in maintaining telomere ends and cell viability in all cancer cells. Cancer Res; 75(5); 858-69. ©2015 AACR. ©2015 American Association for Cancer Research.
Chen, Ming; Peng, Miao; Zhou, Hui; Zheng, Zhiwei; Tang, Xionggui; Maivan, Lap
2017-12-01
To further improve receiver sensitivity of spectrally-efficient guard-band direct-detection optical orthogonal frequency-division multiplexing (OFDM) with twin single-side-band (SSB) modulation technique, an optical IQ modulator (IQM) is employed to optimize optical carrier-to-signal power ratio (CSPR). The CSPRs for the guard-band twin-SSB-OFDM signal generated by using dual-drive Mach-Zehnder modulator (DD-MZM) and optical IQM are theoretically analyzed and supported by simulations. The optimal CSPR for the two types of guard-band twin-SSB-OFDM are identified. The simulations exhibit that the error vector magnitude (EVM) performance of the IQM-enabled guard-band twin-SSB-OFDM is improved by more than 4-dB compared to that of the twin-SSB-OFDM enabled by DD-MZM after 80-km single-mode fiber (SMF) transmission. In addition, more than 3-dB and 10 dB receiver sensitivity improvements in terms of received optical power (ROP) and optical signal-to-noise ratio (OSNR) are also achieved, respectively.
Improvement of lactic acid production in Saccharomyces cerevisiae by a deletion of ssb1.
Lee, Jinsuk J; Crook, Nathan; Sun, Jie; Alper, Hal S
2016-01-01
Polylactic acid (PLA) is an important renewable polymer, but current processes for producing its precursor, lactic acid, suffer from process inefficiencies related to the use of bacterial hosts. Therefore, improving the capacity of Saccharomyces cerevisiae to produce lactic acid is a promising approach to improve industrial production of lactic acid. As one such improvement required, the lactic acid tolerance of yeast must be significantly increased. To enable improved tolerance, we employed an RNAi-mediated genome-wide expression knockdown approach as a means to rapidly identify potential genetic targets. In this approach, several gene knockdown targets were identified which confer increased acid tolerance to S. cerevisiae BY4741, of which knockdown of the ribosome-associated chaperone SSB1 conferred the highest increase (52%). This target was then transferred into a lactic acid-overproducing strain of S. cerevisiae CEN.PK in the form of a knockout and the resulting strain demonstrated up to 33% increased cell growth, 58% increased glucose consumption, and 60% increased L-lactic acid production. As SSB1 contains a close functional homolog SSB2 in yeast, this result was counterintuitive and may point to as-yet-undefined functional differences between SSB1 and SSB2 related to lactic acid production. The final strain produced over 50 g/L of lactic acid in under 60 h of fermentation.
Maneu, V; Cervera, A M; Martinez, J P; Gozalbo, D
1997-06-15
We have cloned and sequenced a Candida albicans gene (SSB1) encoding a potential member of the heat-shock protein seventy (hsp70) family. The protein encoded by this gene contains 613 amino acids and shows a high degree (85%) of sequence identity to the ssb subfamily (ssb1 and ssb2) of the Saccharomyces cerevisiae hsp70 family. The transcribed mRNA (2.1 kb) is present in similar amounts both in yeast and germ tube cells of C. albicans.
2011-04-20
... Science Advisory Board; Drinking Water Committee Augmented for the Review of the Effectiveness of Partial...: The EPA Science Advisory Board (SAB) Staff Office announces a public teleconference of the SAB... EPA Science Advisory Board can be found on the EPA Web site at http://www.epa.gov/sab . SUPPLEMENTARY...
2011-07-11
... ENVIRONMENTAL PROTECTION AGENCY [FRL-9435-3] Notification of Public Teleconferences of the Science... Protection Agency (EPA), Science Advisory Board Staff Office. ACTION: Notice. SUMMARY: The EPA Science... information concerning the EPA Science Advisory Board can be found at the EPA SAB Web site at http// www.epa...
Water Science and Technology Board annual report 1989
Energy Technology Data Exchange (ETDEWEB)
1990-01-01
This report summarizes the activities of the Water Science and Technology Board (WSTB) and its subgroups during 1989, it seventh year of existence. It describes current and recently completed projects, new activities scheduled to begin in 1990, and plans for the future. The report also includes information on Board and committee memberships, program operational features, and reports produced during the past several years. This annual report is an introduction to the WSTB and its program for the year. 4 figs.
Smart sustainable bottle (SSB) system for E. coli based recombinant protein production.
Li, Zhaopeng; Carstensen, Bettina; Rinas, Ursula
2014-11-05
Recombinant proteins are usually required in laboratories interested in the protein but not in the production process itself. Thus, technical equipment which is easy to handle and straight forward protein production procedures are of great benefit to those laboratories. Companies selling single use cultivation bags and bioreactors are trying to satisfy at least part of these needs. However, single-use systems can contribute to major costs which might be acceptable when "good manufacturing practices" are required but not acceptable for most laboratories facing tight funding. The assembly and application of a simple self-made "smart sustainable bottle" (SSB) system for E. coli based protein production is presented. The core of the SSB system is a 2-L glass bottle which is operated at constant temperature, air flow, and stirrer speed without measurement and control of pH and dissolved oxygen. Oxygen transfer capacities are in the range as in conventional bioreactors operated at intermediate aeration rates and by far exceed those found in conventional shaking flasks and disposable bioreactors. The SSB system was applied for the production of various recombinant proteins using T7-based expression systems and a defined autoinduction medium. The production performance regarding amount and solubility of proteins with robust and delicate properties was as good as in state-of-the-art stirred tank commercial bioreactors. The SSB system represents a low cost protein production device applicable for easy, effective, and reproducible recombinant protein production.
Autodisplay of the La/SSB protein on LPS-free E. coli for the diagnosis of Sjögren's syndrome.
Yoo, Gu; Dilkaute, Carina; Bong, Ji-Hong; Song, Hyun-Woo; Lee, Misu; Kang, Min-Jung; Jose, Joachim; Pyun, Jae-Chul
2017-05-01
The objective of this study was to present an immunoassay for the diagnosis of Sjögren's syndrome based on the autodisplayed La/SSB protein on the outer membrane of intact E. coli (strain UT-5600) and LPS-free E. coli (ClearColi™). As the first step, an autodisplay vector (pCK002) was transfected into intact E. coli and LPS-free E. coli for comparison of efficiency of autdisplay of La/SSB. The maximal level of La/SSB expression was estimated to be similar for LPS-free E. coli and intact E. coli at different optimal induction periods. Intact E. coli was found to grow twofold faster than LPS-free E. coli, and the maximal level of expression for LPS-free E. coli was obtained with a longer induction period. When the zeta potential was measured, both intact E. coli and LPS-free E. coli showed negative values, and the autodisplay of negatively charged La/SSB protein (pIE. coli and LPS-free E. coli resulted in a slight change in zeta potential values. E. coli with autodisplayed La/SSB protein was used for an immunoassay of anti-La/SSB antibodies for the diagnosis of Sjögren's syndrome. The surface of E. coli with the autodisplayed antigen was modified with rabbit serum and papain to prevent false positive signals because of nonspecific binding of unrelated antibodies from human serum. LPS-free E. coli with autodisplayed La/SSB protein yielded sensitivity and selectivity of 81.6% and 78.6%, respectively. The Bland-Altman test showed that the immunoassays based on LPS-free E. coli and intact E. coli with autodisplayed La/SSB protein were statistically equivalent to a clinical immunoassay for detection of anti-La/SSB antibodies (confidence coefficient 95%). Copyright © 2017 Elsevier Inc. All rights reserved.
High-Speed On-Board Data Processing for Science Instruments
Beyon, Jeffrey Y.; Ng, Tak-Kwong; Lin, Bing; Hu, Yongxiang; Harrison, Wallace
2014-01-01
A new development of on-board data processing platform has been in progress at NASA Langley Research Center since April, 2012, and the overall review of such work is presented in this paper. The project is called High-Speed On-Board Data Processing for Science Instruments (HOPS) and focuses on a high-speed scalable data processing platform for three particular National Research Council's Decadal Survey missions such as Active Sensing of CO2 Emissions over Nights, Days, and Seasons (ASCENDS), Aerosol-Cloud-Ecosystems (ACE), and Doppler Aerosol Wind Lidar (DAWN) 3-D Winds. HOPS utilizes advanced general purpose computing with Field Programmable Gate Array (FPGA) based algorithm implementation techniques. The significance of HOPS is to enable high speed on-board data processing for current and future science missions with its reconfigurable and scalable data processing platform. A single HOPS processing board is expected to provide approximately 66 times faster data processing speed for ASCENDS, more than 70% reduction in both power and weight, and about two orders of cost reduction compared to the state-of-the-art (SOA) on-board data processing system. Such benchmark predictions are based on the data when HOPS was originally proposed in August, 2011. The details of these improvement measures are also presented. The two facets of HOPS development are identifying the most computationally intensive algorithm segments of each mission and implementing them in a FPGA-based data processing board. A general introduction of such facets is also the purpose of this paper.
76 FR 2672 - Science Advisory Board Meeting
2011-01-14
... statements. In general, each individual or group making a verbal presentation will be limited to a total time... scheduled for: Monday, January 31 from 10-11 a.m. Eastern Time. ADDRESSES: Conference call. Public access [email protected] ) SUPPLEMENTARY INFORMATION: The Science Advisory Board (SAB) was established by a Decision...
Flight Hardware Virtualization for On-Board Science Data Processing
National Aeronautics and Space Administration — Utilize Hardware Virtualization technology to benefit on-board science data processing by investigating new real time embedded Hardware Virtualization solutions and...
2010-07-27
... and what emerging science and technology would have the greatest intelligence potential in this type... DEPARTMENT OF DEFENSE Office of the Secretary Defense Science Board; Task Force on Counter... Defense (DoD). ACTION: Notice of advisory committee meetings. SUMMARY: The Defense Science Board Task...
Modulation of intracellular protein degradation by SSB1-SIS1 chaperon system in yeast S. cerevisiae.
Ohba, M
1997-06-09
In prokaryotes, DnaK-DnaJ chaperon is involved in the protein degradation catalyzed by proteases La and ClpA/B complex as shown in E. coli. To extend this into eukaryotic cells, we examined the effects of hsp70 genes, SSA1 and SSB1, and DnaJ genes, SIS1 and YDJ1, on the growth of proteasome subunit mutants of the yeast S. cerevisiae. The results identified SSB1 and SIS1 as a pair of chaperon genes specifically involved in efficient protein turnover in the yeast, whose overexpression suppressed the growth defects caused by the proteasome mutations. Moreover, a single amino acid substitution in the putative peptide-binding site of SSB1 protein profoundly enhanced the suppression activity, indicating that the activity is mediated by the peptide-binding activity of this chaperon. Thus SSB1, with its partner DnaJ, SIS1, modulates the efficiency of protein turnover through its chaperon activity.
Saccharomyces cerevisiae SSB1 protein and its relationship to nucleolar RNA-binding proteins.
Jong, A Y; Clark, M W; Gilbert, M; Oehm, A; Campbell, J L
1987-01-01
To better define the function of Saccharomyces cerevisiae SSB1, an abundant single-stranded nucleic acid-binding protein, we determined the nucleotide sequence of the SSB1 gene and compared it with those of other proteins of known function. The amino acid sequence contains 293 amino acid residues and has an Mr of 32,853. There are several stretches of sequence characteristic of other eucaryotic single-stranded nucleic acid-binding proteins. At the amino terminus, residues 39 to 54 are highly ...
Gender Representation on Journal Editorial Boards in the Mathematical Sciences
2016-01-01
We study gender representation on the editorial boards of 435 journals in the mathematical sciences. Women are known to comprise approximately 15% of tenure-stream faculty positions in doctoral-granting mathematical sciences departments in the United States. Compared to this group, we find that 8.9% of the 13067 editorships in our study are held by women. We describe group variations within the editorships by identifying specific journals, subfields, publishers, and countries that significantly exceed or fall short of this average. To enable our study, we develop a semi-automated method for inferring gender that has an estimated accuracy of 97.5%. Our findings provide the first measure of gender distribution on editorial boards in the mathematical sciences, offer insights that suggest future studies in the mathematical sciences, and introduce new methods that enable large-scale studies of gender distribution in other fields. PMID:27536970
The EGSE science software of the IBIS instrument on-board INTEGRAL satellite
International Nuclear Information System (INIS)
La Rosa, Giovanni; Fazio, Giacomo; Segreto, Alberto; Gianotti, Fulvio; Stephen, John; Trifoglio, Massimo
2000-01-01
IBIS (Imager on Board INTEGRAL Satellite) is one of the key instrument on-board the INTEGRAL satellite, the follow up mission of the high energy missions CGRO and Granat. The EGSE of IBIS is composed by a Satellite Interface Simulator, a Control Station and a Science Station. Here are described the solutions adopted for the architectural design of the software running on the Science Station. Some preliminary results are used to show the science functionality, that allowed to understand the instrument behavior, all along the test and calibration campaigns of the Engineering Model of IBIS
2012-07-12
... ENVIRONMENTAL PROTECTION AGENCY [FRL-9699-7] Notification of Public Teleconferences of the Science...). ACTION: Notice. SUMMARY: The Environmental Protection Agency (EPA or Agency) Science Advisory Board (SAB... concerning the EPA Science Advisory Board can be found at the EPA SAB Web site at http://www.epa.gov/sab...
Rakwalska, Magdalena; Rospert, Sabine
2004-10-01
The chaperone homologs RAC (ribosome-associated complex) and Ssb1/2p are anchored to ribosomes; Ssb1/2p directly interacts with nascent polypeptides. The absence of RAC or Ssb1/2p results in a similar set of phenotypes, including hypersensitivity against the aminoglycoside paromomycin, which binds to the small ribosomal subunit and compromises the fidelity of translation. In order to understand this phenomenon we measured the frequency of translation termination and misincorporation in vivo and in vitro with a novel reporter system. Translational fidelity was impaired in the absence of functional RAC or Ssb1/2p, and the effect was further enhanced by paromomycin. The mutant strains suffered primarily from a defect in translation termination, while misincorporation was compromised to a lesser extent. Consistently, a low level of soluble translation termination factor Sup35p enhanced growth defects in the mutant strains. Based on the combined data we conclude that RAC and Ssb1/2p are crucial in maintaining translational fidelity beyond their postulated role as chaperones for nascent polypeptides.
hSSB1 (NABP2/OBFC2B) is regulated by oxidative stress
Nicolas Paquet; Mark N. Adams; Nicholas W. Ashton; Christine Touma; Roland Gamsjaeger; Liza Cubeddu; Vincent Leong; Sam Beard; Emma Bolderson; Catherine H. Botting; Kenneth J. O’Byrne; Derek J. Richard
2016-01-01
The maintenance of genome stability is an essential cellular process to prevent the development of diseases including cancer. hSSB1 (NABP2/ OBFC2A) is a critical component of the DNA damage response where it participates in the repair of double-strand DNA breaks and in base excision repair of oxidized guanine residues (8-oxoguanine) by aiding the localization of the human 8-oxoguanine glycosylase (hOGG1) to damaged DNA. Here we demonstrate that following oxidative stress, hSSB1 is stabilized ...
77 FR 4584 - Sunshine Act Meetings; National Science Board
2012-01-30
... regard to the scheduling of meetings for the transaction of National Science Board business and other... Presentation: Research in Mathematics Education Committee on Strategy and Budget (CSB) Open Session: 9-10 a.m...
75 FR 55617 - National Science Board; Sunshine Act Meetings Notice
2010-09-13
... Dakota Science and Engineering Research. Introduction: Dr. Jack Warner, Executive Director, SD Board of... Member. Plenary Open Open Session: 8 a.m.-11:45 a.m. Jacket Legacy Room. 8 a.m. Chairman's Introduction... of Deep Underground Science and Engineering Laboratory (DUSEL) on South Dakota Graduate Education in...
A polarization-division multiplexing SSB-OFDM system with beat interference cancellation receivers
Yang, Peiling; Ma, Jianxin; Zhang, Junyi
2018-06-01
In this paper, we have proposed a polarization-division multiplexing (PDM) single-sideband optical orthogonal frequency division multiplexing (SSB-OOFDM) scheme with signal-signal beat interference cancellation receivers with balanced detection (ICRBD). This system can double channel capacity and improve spectrum efficiency (SE) with the reduced guard band (GB) due to the PDM. Multiple input multiple output (MIMO) technique is used to solve polarization mode dispersion (PMD) associated with channel estimation and equalization. By simulation, we demonstrate the efficacy of the proposed technique for a 2 ×40 Gbit/s 16-QAM SSB-PDM-OOFDM system according to the error vector magnitude (EVM) and the constellation diagrams.
75 FR 72843 - National Science Board; Sunshine Act Meetings; Notice
2010-11-26
... in regard to the scheduling of meetings for the transaction of National Science Board business and... your name and place of business to request your badge, which will be ready for pick-up at the visitor's... Education in Science, Technology, Engineering, and Math (STEM) for America's Future. [cir] Speaker: Dr...
2011-02-16
... NATIONAL SCIENCE FOUNDATION National Science Board; Sunshine Act Meetings; Impromptu Notice of Change (Addition of Agenda Item) The National Science Board's (NSB) Audit & Oversight (A&O) Committee..., National Science Foundation, 4201 Wilson Blvd., Arlington, VA 22230. Telephone: (703) 292-7000. Daniel A...
77 FR 43064 - Defense Science Board; Notice of Advisory Committee Meetings
2012-07-23
... Science Board 2012 Summer Study on Technology and Innovation Enablers for Superiority in 2030 will meet in closed session August 20-24, 2012, from 8:00 a.m. to 5:00 p.m. at the Charles Stark Draper Laboratory... meeting, the Board will discuss interim finding and recommendations resulting from ongoing Task Force...
hSSB1 regulates both the stability and the transcriptional activity of p53
Xu, Shuangbing; Wu, Yuanzhong; Chen, Qiong; Cao, Jingying; Hu, Kaishun; Tang, Jianjun; Sang, Yi; Lai, Fenju; Wang, Li; Zhang, Ruhua; Li, Sheng-Ping; Zeng, Yi-Xin; Yin, Yuxin; Kang, Tiebang
2012-01-01
The tumor suppressor p53 is essential for several cellular processes that are involved in the response to diverse genotoxic stress, including cell cycle arrest, DNA repair, apoptosis and senescence. Studies of the regulation of p53 have mostly focused on its stability and transactivation; however, new regulatory molecules for p53 have also been frequently identified. Here, we report that human ssDNA binding protein SSB1 (hSSB1), a novel DNA damage-associated protein, can interact with p53 and...
Paraje, Guillermo
2016-01-01
The objective of this article is to estimate the own-price, cross-price and income elasticities of demand for SSB in Ecuador, as an indispensable step for predicting a reduction in the consumption of said beverages caused by the potential implementation of taxes in Ecuador. In addition, the own-price, cross-price and income elasticities of sugar-free substitutes like mineral water and diet soft drinks and juices are also estimated. The data from the 2011-2012 ENIGHUR, which contains detailed information on household consumption and socioeconomic variables, was used. The estimates are done using Deaton's Almost Ideal Demand System (AIDS) which accounts for differences in the quality of goods purchased. This demand system is estimated for different socio-economic groups, according to total household expenditure. The results reveal own-price elasticities for SSB between -1.17 and -1.33 depending on the socio-economic group, in line with the existing evidence for developed countries. Own-price elasticity for non-SSB is between -1 and -1.24. Income elasticities reveal that both SSB and non-SSB are normal goods with elasticities decreasing for higher socio-economic groups. These results show that the consumption of SSB is sensitive to price changes, meaning that the implementation of taxes on said beverages could be effective in reducing their consumption. The fact that non-SSB are also sensitive to price changes would indicate that subsidies could be implemented for the production of some of them.
2012-04-11
...). ACTION: Notice. SUMMARY: The Environmental Protection Agency (EPA or Agency) Science Advisory Board ([email protected] . General information concerning the EPA Science Advisory Board can be found at the EPA... ENVIRONMENTAL PROTECTION AGENCY [FRL-9658-7] Notification of Two Public Teleconferences of the...
Spacecube: A Family of Reconfigurable Hybrid On-Board Science Data Processors
Flatley, Thomas P.
2015-01-01
SpaceCube is a family of Field Programmable Gate Array (FPGA) based on-board science data processing systems developed at the NASA Goddard Space Flight Center (GSFC). The goal of the SpaceCube program is to provide 10x to 100x improvements in on-board computing power while lowering relative power consumption and cost. SpaceCube is based on the Xilinx Virtex family of FPGAs, which include processor, FPGA logic and digital signal processing (DSP) resources. These processing elements are leveraged to produce a hybrid science data processing platform that accelerates the execution of algorithms by distributing computational functions to the most suitable elements. This approach enables the implementation of complex on-board functions that were previously limited to ground based systems, such as on-board product generation, data reduction, calibration, classification, eventfeature detection, data mining and real-time autonomous operations. The system is fully reconfigurable in flight, including data parameters, software and FPGA logic, through either ground commanding or autonomously in response to detected eventsfeatures in the instrument data stream.
Flight Hardware Virtualization for On-Board Science Data Processing Project
National Aeronautics and Space Administration — Utilize Hardware Virtualization technology to benefit on-board science data processing by investigating new real time embedded Hardware Virtualization solutions and...
76 FR 44333 - National Biodefense Science Board; Call for Nominees
2011-07-25
... to support the functions of the Board, (b) four individuals from the pharmaceutical, biotechnology..., and opportunities presented by advances in biological and life sciences, biotechnology, and genetic...
High-Speed On-Board Data Processing for Science Instruments: HOPS
Beyon, Jeffrey
2015-01-01
The project called High-Speed On-Board Data Processing for Science Instruments (HOPS) has been funded by NASA Earth Science Technology Office (ESTO) Advanced Information Systems Technology (AIST) program during April, 2012 â€" April, 2015. HOPS is an enabler for science missions with extremely high data processing rates. In this three-year effort of HOPS, Active Sensing of CO2 Emissions over Nights, Days, and Seasons (ASCENDS) and 3-D Winds were of interest in particular. As for ASCENDS, HOPS replaces time domain data processing with frequency domain processing while making the real-time on-board data processing possible. As for 3-D Winds, HOPS offers real-time high-resolution wind profiling with 4,096-point fast Fourier transform (FFT). HOPS is adaptable with quick turn-around time. Since HOPS offers reusable user-friendly computational elements, its FPGA IP Core can be modified for a shorter development period if the algorithm changes. The FPGA and memory bandwidth of HOPS is 20 GB/sec while the typical maximum processor-to-SDRAM bandwidth of the commercial radiation tolerant high-end processors is about 130-150 MB/sec. The inter-board communication bandwidth of HOPS is 4 GB/sec while the effective processor-to-cPCI bandwidth of commercial radiation tolerant high-end boards is about 50-75 MB/sec. Also, HOPS offers VHDL cores for the easy and efficient implementation of ASCENDS and 3-D Winds, and other similar algorithms. A general overview of the 3-year development of HOPS is the goal of this presentation.
Water Science and Technology Board annual report 1987
Energy Technology Data Exchange (ETDEWEB)
1988-01-01
In 1982, the National Research Council chose to recognize the importance of water resource issues by establishing the Water Science and Technology Board (WSTB). During the five years since its first meeting in November 1982, the WSTB has grown and matured. The WSTB has met 14 times to provide guidance and plan activities. Under the WSTB's direction, committees of experts have conducted approximately 30 studies on a broad array of topics, from dam safety to irrigation-induced water quality problems to ground water protection strategies. Studies have ranged in scope from the oversight of specific agency projects and programs to broader scientific reviews, such as a disciplinary assessment of the hydrologic sciences initiated in 1987. In all cases, studies have the general theme of ultimately improving the scientific and technological bases of programs of water management and environmental quality. This fifth annual report of the WSTB summarizes the Board's accomplishments during 1987, its current activities, and its plans for the future. The report also includes information on Board and committee memberships, program organizations, and the reports produced. The report should provide the reader with a basic understanding of the WSTB's interests, achievements, and capabilities. The WSTB welcomes inquiries and suggestions concerning its activities and will provide more detailed information on any aspects of its work to those interested.
Enhancing Science Kits with the Driving Question Board
Nordine, Jeff; Torres, Ruben
2013-01-01
This article describes the driving question board (DQB), a visual organizer that supports inquiry-based instruction through the use of guiding questions. The DQB is a teaching aid designed to increase student engagement alongside science kits. Information is provided on its application to a lesson on buoyancy, highlighting how it improved…
Water Science and Technology Board. Annual report 1991
Energy Technology Data Exchange (ETDEWEB)
1995-01-01
This report summarizes the activities of the Water Science and Technology Board during 1991. The WSTB is intended to be a dynamic forum, a mechanism by which the broad community of water science, technology, and policy professionals can help assure high-quality national water programs. The principal products of WSTB studies are written reports which cover a wide range of water resources issues of current national concern. A few recent examples are: Restoration of aquatic ecosystems - science, technologies and public policy; Water transfers in the West - efficiency, equity and the environment; Opportunities in the hydrologic sciences; and Ground water models - scientific and regulatory applications. Projects completed, ongoing studies and published reports are described in detail in their respective sections of this report.
Suppression of the Escherichia coli ssb-1 mutation by an allele of groEL.
Ruben, S M; VanDenBrink-Webb, S E; Rein, D C; Meyer, R R
1988-01-01
A series of spontaneous suppressors to the temperature-sensitive phenotype of the single-stranded DNA-binding protein mutation ssb-1 were isolated. A genomic library of EcoRI fragments from one of these suppressor strains was prepared by using pBR325 as the cloning vector. A 10.0-kilobase class of inserts was identified as carrying the ssb-1 gene itself. A second class of 8.3-kilobase inserts was shown to contain the groE region by (i) restriction analysis, (ii) Southern hybridization of the ...
2012-03-28
...). ACTION: Notice. SUMMARY: The Environmental Protection Agency (EPA or Agency) Science Advisory Board (SAB... Science Advisory Board can be found at the EPA SAB Web site at http://www.epa.gov/sab . SUPPLEMENTARY... ENVIRONMENTAL PROTECTION AGENCY [FRL-9653-1] Notification of Two Public Teleconferences of the...
2012-10-19
... ENVIRONMENTAL PROTECTION AGENCY [FRL--9743-2] Notification of a Public Teleconference of the Science Advisory Board; Perchlorate Advisory Panel AGENCY: Environmental Protection Agency (EPA). ACTION: Notice. SUMMARY: The Environmental Protection Agency (EPA) Science Advisory Board (SAB) Staff Office...
76 FR 76769 - National Science Board; Sunshine Act Meetings
2011-12-08
... matters specified, as follows: AGENCY HOLDING MEETING: National Science Board DATE AND TIME: Monday.../notices/ . AGENCY CONTACT: Jennie L. Moehlmann, [email protected] , (703) 292-7000. PUBLIC AFFAIRS CONTACT... STEM education plan. Discussion of the NSF STEM education research portfolio: getting from theory to...
2011-08-18
... Science Advisory Board Panel for the Review of the Great Lakes Restoration Initiative Action Plan AGENCY... Agency) Science Advisory Board (SAB) Staff Office announces a public teleconference of the SAB Panel to... information concerning the EPA Science Advisory Board can be found at the EPA SAB Web site at http://www.epa...
100-Gb/s 80-km transmission of PIM-SSB-OFDM at C-band using a single-end photodetector
Huo, Jiahao; Zhou, Xian; Zhong, Kangping; Gui, Tao; Tan, Fengze; Tu, Jiajing; Yuan, Jinhui; Zhang, Hongyu; Long, Keping; Yu, Changyuan; Lau, Alan Pak Tao; Lu, Chao
2017-10-01
Polarization-interleave-multiplexed (PIM) with single-sideband orthogonal frequency-division multiplexing (SSB-OFDM) based on direct detection is proposed for short-reach applications transmitted up to 80 km in which the guard band can be shared for the two SSB signals with interleave electrical center frequencies. Based on two dual-drive Mach-Zehnder modulators with one single-end photodetector (PD), 100-Gb/s PIM-SSB-OFDM transmission over a 80-km standard single-mode fiber is successfully demonstrated. After 80-km transmission, the optical signal-to-noise ratio requirement is 29.1 dB with respect to the bit error rate threshold of 7% hard decision-forward error correction overhead.
2010-09-23
...] Science Advisory Board to the National Center for Toxicological Research Notice of Meeting AGENCY: Food... closed to the public. Name of Committee: Science Advisory Board (SAB) to the National Center for Toxicological Research (NCTR). General Function of the Committee: To provide advice and recommendations to the...
2012-09-18
...] Science Advisory Board to the National Center for Toxicological Research; Notice of Meeting AGENCY: Food... closed to the public. Name of Committee: Science Advisory Board (SAB) to the National Center for Toxicological Research (NCTR). General Function of the Committee: To provide advice and recommendations to the...
2012-05-23
...). ACTION: Notice. SUMMARY: The Environmental Protection Agency (EPA or Agency) Science Advisory Board (SAB... information concerning the EPA Science Advisory Board can be found at the EPA SAB Web site at http://www.epa... ENVIRONMENTAL PROTECTION AGENCY [FRL-9675-4] Notification of a Public Teleconference of the...
Directory of Open Access Journals (Sweden)
Audrey Costes
2010-12-01
Full Text Available We have investigated in vivo the role of the carboxy-terminal domain of the Bacillus subtilis Single-Stranded DNA Binding protein (SSB(Cter as a recruitment platform at active chromosomal forks for many proteins of the genome maintenance machineries. We probed this SSB(Cter interactome using GFP fusions and by Tap-tag and biochemical analysis. It includes at least 12 proteins. The interactome was previously shown to include PriA, RecG, and RecQ and extended in this study by addition of DnaE, SbcC, RarA, RecJ, RecO, XseA, Ung, YpbB, and YrrC. Targeting of YpbB to active forks appears to depend on RecS, a RecQ paralogue, with which it forms a stable complex. Most of these SSB partners are conserved in bacteria, while others, such as the essential DNA polymerase DnaE, YrrC, and the YpbB/RecS complex, appear to be specific to B. subtilis. SSB(Cter deletion has a moderate impact on B. subtilis cell growth. However, it markedly affects the efficiency of repair of damaged genomic DNA and arrested replication forks. ssbΔCter mutant cells appear deficient in RecA loading on ssDNA, explaining their inefficiency in triggering the SOS response upon exposure to genotoxic agents. Together, our findings show that the bacterial SSB(Cter acts as a DNA maintenance hub at active chromosomal forks that secures their propagation along the genome.
Beyon, Jeffrey Y.; Ng, Tak-Kwong; Davis, Mitchell J.; Adams, James K.; Bowen, Stephen C.; Fay, James J.; Hutchinson, Mark A.
2015-01-01
The project called High-Speed On-Board Data Processing for Science Instruments (HOPS) has been funded by NASA Earth Science Technology Office (ESTO) Advanced Information Systems Technology (AIST) program since April, 2012. The HOPS team recently completed two flight campaigns during the summer of 2014 on two different aircrafts with two different science instruments. The first flight campaign was in July, 2014 based at NASA Langley Research Center (LaRC) in Hampton, VA on the NASA's HU-25 aircraft. The science instrument that flew with HOPS was Active Sensing of CO2 Emissions over Nights, Days, and Seasons (ASCENDS) CarbonHawk Experiment Simulator (ACES) funded by NASA's Instrument Incubator Program (IIP). The second campaign was in August, 2014 based at NASA Armstrong Flight Research Center (AFRC) in Palmdale, CA on the NASA's DC-8 aircraft. HOPS flew with the Multifunctional Fiber Laser Lidar (MFLL) instrument developed by Excelis Inc. The goal of the campaigns was to perform an end-to-end demonstration of the capabilities of the HOPS prototype system (HOPS COTS) while running the most computationally intensive part of the ASCENDS algorithm real-time on-board. The comparison of the two flight campaigns and the results of the functionality tests of the HOPS COTS are presented in this paper.
76 FR 1641 - Meeting of the Office of Justice Programs' Science Advisory Board
2011-01-11
... and By-Laws, a review of ethics rules applicable to the Board's activities, and briefings from OJP... DEPARTMENT OF JUSTICE Office of Justice Programs [OJP (OJP) Docket No. 1543] Meeting of the Office of Justice Programs' Science Advisory Board AGENCY: Office of Justice Programs (OJP), Justice. ACTION...
2011-12-23
... ENVIRONMENTAL PROTECTION AGENCY [FRL-9610-8] Notification of a Public Meeting of the Science...: Notice. SUMMARY: The Environmental Protection Agency (EPA or Agency) Science Advisory Board (SAB) [email protected] . General information concerning the EPA Science Advisory Board can be found at the EPA SAB...
78 FR 26399 - National Science Board; Sunshine Act Meetings; Notice
2013-05-06
... business and other matters specified, as follows: AGENCY HOLDING MEETING: National Science Board. DATE AND... (LIGO) renewal proposal Information Item: Advanced Technology Solar Telescope (ATST) Committee on... Geosciences and EarthScope (GAGE) and Seismological Facilities for the Advancement of Geoscience and Earth...
Hübscher, Volker; Mudholkar, Kaivalya; Chiabudini, Marco; Fitzke, Edith; Wölfle, Tina; Pfeifer, Dietmar; Drepper, Friedel; Warscheid, Bettina; Rospert, Sabine
2016-07-08
Chaperones of the Hsp70 family interact with a multitude of newly synthesized polypeptides and prevent their aggregation. Saccharomyces cerevisiae cells lacking the Hsp70 homolog Ssb suffer from pleiotropic defects, among others a defect in glucose-repression. The highly conserved heterotrimeric kinase SNF1/AMPK (AMP-activated protein kinase) is required for the release from glucose-repression in yeast and is a key regulator of energy balance also in mammalian cells. When glucose is available the phosphatase Glc7 keeps SNF1 in its inactive, dephosphorylated state. Dephosphorylation depends on Reg1, which mediates targeting of Glc7 to its substrate SNF1. Here we show that the defect in glucose-repression in the absence of Ssb is due to the ability of the chaperone to bridge between the SNF1 and Glc7 complexes. Ssb performs this post-translational function in concert with the 14-3-3 protein Bmh, to which Ssb binds via its very C-terminus. Raising the intracellular concentration of Ssb or Bmh enabled Glc7 to dephosphorylate SNF1 even in the absence of Reg1. By that Ssb and Bmh efficiently suppressed transcriptional deregulation of Δreg1 cells. The findings reveal that Ssb and Bmh comprise a new chaperone module, which is involved in the fine tuning of a phosphorylation-dependent switch between respiration and fermentation. © The Author(s) 2016. Published by Oxford University Press on behalf of Nucleic Acids Research.
Water Science and Technology Board. Annual report 1992-1993
Energy Technology Data Exchange (ETDEWEB)
1995-01-01
This report summarizes the activities of the Water Science and Technology Board during 1992. The WSTB is intended to be a dynamic forum, a mechanism by which the broad community of water science, technology, and policy professionals can help assure high-quality national water programs. The principal products of WSTB studies are written reports which cover a wide range of water resources issues of current national concern. A few recent examples are: Managing wastewater in coastal urban areas; Ground water vulnerability assessment; Water transfers in the West - efficiency, equity and the environment; and Opportunities in the hydrologic sciences. Projects completed, ongoing studies and published reports are described in detail in their respective sections of this report.
76 FR 6766 - Meeting of the Defense Science Board
2011-02-08
... resulting from ongoing Task Force activities. The Board will also discuss plans for future consideration of... Committee Act, Public Law 92-463, as amended (5 U.S.C. App. 2) and 41 CFR 102- 3.155, the Department of.... 552b(c)(1). Interested persons may submit a written statement for consideration by the Defense Science...
78 FR 51752 - Sunshine Act Meetings; National Science Board
2013-08-21
... for the transaction of National Science Board business, as follows: DATE AND TIME: Monday, August 26, 2013 at 3:30 p.m. EST SUBJECT MATTER: Consideration of nominations for the NSB class of 2014- 2020... Bushmiller, NSB Senior Legal Counsel. [FR Doc. 2013-20485 Filed 8-19-13; 4:15 pm] BILLING CODE 7555-01-P ...
Report of the Defense Science Board Task Force on Strategic Communication
National Research Council Canada - National Science Library
2008-01-01
The 2007 Defense Science Board (DSB) Task Force on Strategic Communication has written this report within the context of a larger study, the DSB 2007 Summer Study on Challenges to Military Operations in Support of National Interests...
Directory of Open Access Journals (Sweden)
Md. Zahangir Alam, A. H. Molla and A. Fakhru’l-Razi
2012-10-01
Full Text Available The study of biotransformation of domestic wastewater treatment plant (DWTP sludge was conducted in laboratory-scale by two-stage integrated process i.e. liquid state bioconversion (LSB and solid state bioconversion (SSB processes. The liquid wastewater sludge [4% w/w of total suspended solids (TSS] was treated by mixed filamentous fungi Penicillium corylophilum and Aspergillus niger, isolated, screened and mixed cultured in terms of their higher biodegradation potential to wastewater sludge. The biosolids was increased to about 10% w/w. Conversely, the soluble [i.e. Total dissolve solid (TDS] and insoluble substances (TSS in treated supernatant were decreased effectively in the LSB process. In the developed LSB process, 93.8 g kg-1of biosolids were enriched with fungal biomass protein and nutrients (NPK, and 98.8% of TSS, 98.2% of TDS, 97.3% of turbidity, 80.2% of soluble protein, 98.8% of reducing sugar and 92.7% of chemical oxygen demand (COD in treated sludge supernatant were removed after 8 days of treatment. Specific resistance to filtration (1.39x1012 m/kg was decreased tremendously by the microbial treatment of DWTP sludge after 6 days of fermentation. The treated biosolids in DWTP sludge was considered as pretreated resource materials for composting and converted into compost by SSB process. The SSB process was evaluated for composting by monitoring the microbial growth and its subsequent roles in biodegradation in composting bin (CB. The process was conducted using two mixed fungal cultures, Trichoderma harzianum with Phanerochaete chrysosporium 2094 and (T/P and T. harzianum and Mucor hiemalis (T/M; and two bulking materials, sawdust (SD and rice straw (RS. The most encouraging results of microbial growth and subsequent solid state bioconversion were exhibited in the RS than the SD. Significant decrease of the C/N ratio and germination index (GI were attained as well as the higher value of glucosamine was exhibited in compost; which
75 FR 37452 - Science Board Advisory Committee; Notice of Meeting
2010-06-29
... DEPARTMENT OF HEALTH AND HUMAN SERVICES Food and Drug Administration [Docket No. FDA-2010-N-0001... Safety and Applied Nutrition (CFSAN). The Science Board will hear about an interim report from the... the committee. Written submissions may be made to the contact person on or before August 9, 2010. Oral...
75 FR 13141 - National Science Board; Sunshine Act Meetings; Notice
2010-03-18
... AND TIME: Wednesday, March 24, 2010, 11 a.m. SUBJECT MATTER: Discussion of Recent NSF Portfolio Review Materials, Issues for the Portfolio Assessment, and Next Steps. STATUS: Open. This meeting will be held by... National Science Board Web site ( http://www.nsf.gov/nsb ) for information or schedule updates, or contact...
2010-05-19
... nitrogen in the environment. At the global scale, reactive nitrogen from human activities now exceeds that... in the environment and that nitrogen cycling through biogeochemical pathways has a variety of... a Public Teleconference of the Science Advisory Board Integrated Nitrogen Committee AGENCY...
78 FR 55116 - National Science Board; Sunshine Act Meetings; Notice
2013-09-09
... for the transaction of National Science Board business, as follows: DATE AND TIME: Thursday, September 12, 2013 at 10:30 a.m. EDT. SUBJECT MATTER: Consideration of nominations for the NSB class of 2014.... Ann Bushmiller, NSB Senior Legal Counsel. [FR Doc. 2013-21968 Filed 9-5-13; 11:15 am] BILLING CODE...
van Loon, Barbara; Samson, Leona D
2013-03-01
Due to a harsh environment mitochondrial genomes accumulate high levels of DNA damage, in particular oxidation, hydrolytic deamination, and alkylation adducts. While repair of alkylated bases in nuclear DNA has been explored in detail, much less is known about the repair of DNA alkylation damage in mitochondria. Alkyladenine DNA glycosylase (AAG) recognizes and removes numerous alkylated bases, but to date AAG has only been detected in the nucleus, even though mammalian mitochondria are known to repair DNA lesions that are specific substrates of AAG. Here we use immunofluorescence to show that AAG localizes to mitochondria, and we find that native AAG is present in purified human mitochondrial extracts, as well as that exposure to alkylating agent promotes AAG accumulation in the mitochondria. We identify mitochondrial single-stranded binding protein (mtSSB) as a novel interacting partner of AAG; interaction between mtSSB and AAG is direct and increases upon methyl methanesulfonate (MMS) treatment. The consequence of this interaction is specific inhibition of AAG glycosylase activity in the context of a single-stranded DNA (ssDNA), but not a double-stranded DNA (dsDNA) substrate. By inhibiting AAG-initiated processing of damaged bases, mtSSB potentially prevents formation of DNA breaks in ssDNA, ensuring that base removal primarily occurs in dsDNA. In summary, our findings suggest the existence of AAG-initiated BER in mitochondria and further support a role for mtSSB in DNA repair. Copyright © 2012. Published by Elsevier B.V.
2012-03-22
... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health National Science Advisory Board for Biosecurity Meeting; Office of Biotechnology Activities, Office of Science Policy, Office of.... Contact Person: Ronna Hill, NSABB Program Assistant, NIH Office of Biotechnology Activities, 6705...
Maneu, V; Roig, P; Gozalbo, D
2000-11-01
We have demonstrated that the expression of Candida albicans genes involved in translation and protein folding (EFB1 and SSB1) complements the phenotype of Saccharomyces cerevisiae mutants. The elongation factor 1beta (EF-1beta) is essential for growth and efb1 S. cerevisiae null mutant cells are not viable; however, viable haploid cells, carrying the disrupted chromosomal allele of the S. cerevisiae EFB1 gene and pEFB1, were isolated upon sporulation of a diploid strain which was heterozygous at the EFB1 locus and transformed with pEFB1 (a pEMBLYe23 derivative plasmid containing an 8-kb DNA fragment from the C. albicans genome which contains the EFB1 gene). This indicates that the C. albicans EFB1 gene encodes a functional EF-1beta. Expression of the SSB1 gene from C. albicans, which codes for a member of the 70-kDa heat shock protein family, in S. cerevisiae ssb1 ssb2 double mutant complements the mutant phenotype (poor growth particularly at low temperature, and sensitivity to certain protein synthesis inhibitors, such as paromomycin). This complementation indicates that C. albicans Ssbl may function as a molecular chaperone on the translating ribosomes, as described in S. cerevisiae. Northern blot analysis showed that SSB mRNA levels increased after mild cold shift (28 degrees C to 23 degrees C) and rapidly decreased after mild heat shift (from 28 degrees C to 37 degrees C, and particularly to 42 degrees C), indicating that SSB1 expression is regulated by temperature. Therefore, Ssb1 may be considered as a molecular chaperone whose pattern of expression is similar to that found in ribosomal proteins, according to its common role in translation.
76 FR 21705 - Closed Meeting of the Defense Science Board
2011-04-18
... ongoing Task Force activities. The Board will also discuss plans for future consideration of scientific... Committee Act, Public Law 92-463, as amended (5 U.S.C. App. 2) and 41 CFR 102- 3.155, the Department of.... 552b(c)(1). Interested persons may submit a written statement for consideration by the Defense Science...
75 FR 9876 - Science Advisory Board; Notice of Open Meeting
2010-03-04
..., each individual or group making a verbal presentation will be limited to a total time of five (5... Science Advisory Board (SAB) was established by a Decision Memorandum dated September 25, 1997, and is the... resource management. Time and Date: The meeting will be held Tuesday March 23, 2010, from 8:30 a.m. to 5:30...
Water Science and Technology Board. Annual report 1993-1994
Energy Technology Data Exchange (ETDEWEB)
1995-01-01
This report summarizes the activities of the Water Science and Technology Board during 1993-1994. The WSTB is intended to be a dynamic forum, a mechanism by which the broad community of water science, technology, and policy professionals can help assure high-quality national water programs. The principal products of WSTB studies are written reports which cover a wide range of water resources issues of current national concern. A few recent examples are: Alternatives for ground water cleanup; Managing wastewater in coastal urban areas; and, Water transfers in the West - efficiency, equity and the environment. Projects completed, ongoing studies and published reports are described in detail in their respective sections of this report.
76 FR 10888 - Science Advisory Board (SAB); Notice of Open Meeting
2011-02-28
... general, each individual or group making a verbal presentation will be limited to a total time of five (5... meeting. SUMMARY: The Science Advisory Board (SAB) was established by a Decision Memorandum dated... quality and provide optimal support to resource management. TIME AND DATE: The meeting will be held...
2013-09-24
... ENVIRONMENTAL PROTECTION AGENCY [FRL--9901-26-OA] Notification of a Public Meeting of the Science Advisory Board Panel for the Review of the EPA Water Body Connectivity Report AGENCY: Environmental Protection Agency (EPA). ACTION: Notice. SUMMARY: The EPA Science Advisory Board (SAB) Staff Office announces...
76 FR 77268 - National Science Board; Sunshine Act Meetings; Notice Revised
2011-12-12
... business and other matters specified, as follows: AGENCY HOLDING MEETING: National Science Board. DATE AND... portfolio: getting from theory to scale Task Force on Merit Review (MR) Open Session: 2:30 p.m.-3:30 p.m... Report Human Capital Management Update OIG FY 2012 Audit Plan Update on Procedures re Personally...
DEFF Research Database (Denmark)
Derouiche, Abderahmane; Petranovic, Dina; Macek, Boris
2016-01-01
Background and purpose: Single-stranded DNA-binding proteins participate in all stages of DNA metabolism that involve single-stranded DNA, from replication, recombination, repair of DNA damage, to natural competence in species such as Bacillus subtilis. B. subtilis single-stranded DNA......-binding proteins have previously been found to be phosphorylated on tyrosine and arginine residues. While tyrosine phosphorylation was shown to enhance the DNA-binding properties of SsbA, arginine phosphorylation was not functionally characterized.Materials and methods: We used mass spectrometry analysis to detect...... phosphorylation of SsbA purified from B. subtilis cells. The detected phosphorylation site was assessed for its influence on DNA-binding in vitro, using electrophoretic mobility shift assays. The ability of B. subtilis serine/threonine kinases to phosphorylate SsbA was assessed using in vitro phosphorylation...
2012-04-13
... (EPA). ACTION: Notice. SUMMARY: The Environmental Protection Agency (EPA or Agency) Science Advisory... . General information concerning the EPA Science Advisory Board can be found at the EPA SAB Web site at http... appropriate SAB Staff Office procedural policies. EPA's Office of the Science Advisor has requested that the...
2012-01-27
... (EPA). ACTION: Notice. SUMMARY: The Environmental Protection Agency (EPA or Agency) Science Advisory... . General information concerning the EPA Science Advisory Board can be found at the EPA SAB Web site at http... to recommendations in a 2007 SAB Report, ``Advice to EPA on Advancing the Science and Application of...
77 FR 15996 - Science Advisory Board (SAB); Notice of Open Meeting
2012-03-19
... limited to a total time of five (5) minutes. Individuals or groups planning to make a verbal presentation... Science Advisory Board (SAB) was established by a Decision Memorandum dated September 25, 1997, and is the... resource management. Time and Date: The meeting will be held Thursday, April 5, 2012 from 9 a.m. to 5:15 p...
2011-02-14
... Time & Location Change The National Science Board's Committee on Program and Plans, pursuant to NSF... MATTER: No change. STATUS: No change. ORIGINAL LOCATION: Room 1295 or 1235, National Science Foundation, 4201Wilson Blvd., Arlington, VA 22230. NEW LOCATION: Room 1295. Public overflow room for the open session...
Jou, Judy; Techakehakij, Win
2012-09-01
Sugar-sweetened beverage (SSB) taxation is becoming of increasing interest as a policy aimed at addressing the rising prevalence of obesity in many countries. Preliminary evidence indicates its potential to not only reduce obesity prevalence, but also generate public revenue. However, differences in country-specific contexts create uncertainties in its possible outcomes. This paper urges careful consideration of country-specific characteristics by suggesting three points in particular that may influence the effectiveness of a volume-based soft drink excise tax: population obesity prevalence, soft drink consumption levels, and existing baseline tax rates. Data from 19 countries are compared with regard to each point. The authors suggest that SSB or soft drink taxation policy may be more effective in reducing obesity prevalence where existing obesity prevalence and soft drink consumption levels are high. Conversely, in countries where the baseline tax rate is already considered high, SSB taxation may not have a noticeable impact on consumption patterns or obesity prevalence, and may incur negative feedback from the beverage industry or the general public. Thorough evaluation of these points is recommended prior to adopting SSB or soft drink taxation as an obesity reduction measure in any given country. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.
The Consensus Process at the Water Science and Technology Board, National Research Council
Logan, W. S.
2001-12-01
Whereas the very birth of the U.S. Geological Survey arose from the recommendations of a National Academy of Sciences report, water science has not always had a prominent place at that institution. Prior to the 1980s, water issues were dealt with on an ad hoc basis by various boards related to science, engineering, and policy. With the birth of the Water Science and Technology Board (WSTB) in 1982, a diversity of water-related issues are now handled under one roof. The "business" of the WSTB is to produce consensus reports on a spectrum of topics in water science. Some of the projects that the WSTB works on are self-generated. The majority are generated either by Congress, or by government agencies. The WSTB takes on several different kinds of studies. Some of these are designed to advance the science of hydrology itself. This category would include the report Opportunities in the Hydrologic Sciences, which helped to establish hydrologic science as something separate from applied hydrology in Congress, the White House, and agencies such as NSF. However, the majority of the board's consensus studies involve hydrology in the interests of improving the natural and human environment. For example, Water for the Future: The West Bank and Gaza Strip, Israel, and Jordan outlined consensus principles backed by scientists from all of these entities for sustaining freshwater resources of the region. Closer to home, but no less controversial, a WSTB committee recently reached consensus on improving the process by which states determine which water bodies are polluted enough to require clean-up, and develop Total Maximum Daily Loads for these pollutants. Another committee recently sorted through the scientific bases for using natural attenuation for various contaminants in ground water and soil. And an ongoing committee is trying to help the South Florida scientific community to determine the best strategies for restoring the Everglades to some semblance of its former self
2013-06-04
... ENVIRONMENTAL PROTECTION AGENCY [FRL--9819-3] Notification of a Public Meeting of the Science... Agency (EPA). ACTION: Notice. SUMMARY: The EPA Science Advisory Board (SAB) Staff Office announces a public meeting of the SAB Environmental Justice Technical Guidance Review Panel to provide advice through...
2013-03-05
... ENVIRONMENTAL PROTECTION AGENCY [FRL-9786-6] Notification of a Public Meeting of the Science...: Notice. SUMMARY: The Environmental Protection Agency (EPA or agency) Science Advisory Board (SAB) Staff Office announces a public meeting of the SAB Chemical Assessment Advisory Committee (CAAC) to receive a...
Cusick, M E
1992-12-29
A novel approach is described to purify potential ribonucleoproteins (RNP) of yeast. The method assays a yeast RNP complex, assembled in vitro on actin pre-mRNA, by low-ionic strength acrylamide gel electrophoresis. The minimal protein components of this RNP complex were three proteins, one of 30 kDa and two at 42-44 kDa, defined by formation of the complex on biotinylated-RNA, binding of this complex to avidin-agarose, and salt elution of the protein in the biotinylated-RNP complex. Using the assay for RNP complex formation, an RNP protein was purified to homogeneity on the basis of its affinity towards single-stranded DNA and RNA. This RNP protein turned out to be identical to a known RNP protein, the single-stranded binding protein 1 (ssb1) of yeast, on the basis of identical gel electrophoretic migration, antibody cross-reactivity, and identical properties on the gel complex formation assay. In vitro mRNA splicing was normal in extracts made from a yeast strain missing ssb1 (ssb1- strain). Addition of anti-ssb1 antibody to splicing extracts made from a wild type strain did not inhibit or diminish splicing. Instead, mRNA splicing was reproducibly stimulated several fold, indicating competition between ssb1 and splicing factors for binding to single-stranded RNA in the extracts. RNP complexes still formed in the ssb1- strain, demonstrating that it would be possible to purify other RNP proteins from this strain using the gel complex formation assay.
Karaman, Ayhan
Inquiry has been one of the most prominent terms of the contemporary science education reform movement (Buck, Latta, & Leslie-Pelecky, 2007; Colburn, 2006; Settlage, 2007). Practicing classroom inquiry has maintained its central position in science education for several decades because science education reform documents promote classroom inquiry as the potential savior of science education from its current problems. Likewise, having the capabilities of teaching science through inquiry has been considered by National Board for Professional Teaching Standards [NBPTS] as one of the essential elements of being an accomplished science teacher. Successful completion of National Board Certification [NBC] assessment process involves presenting a clear evidence of enacting inquiry with students. Despite the high-profile of the word inquiry in the reform documents, the same is not true in schools (Crawford, 2007). Most of the science teachers do not embrace this type of approach in their everyday teaching practices of science (Johnson, 2006; Luera, Moyer, & Everett, 2005; Smolleck, Zembal-Saul, & Yoder, 2006; Trumbull, Scarano, & Bonney, 2006). And the specific meanings attributed to inquiry by science teachers do not necessarily match with the original intentions of science education reform documents (Matson & Parsons, 2006; Wheeler, 2000; Windschitl, 2003). Unveiling the various meanings held by science teachers is important in developing better strategies for the future success of science education reform efforts (Jones & Eick, 2007; Keys & Bryan, 2001). Due to the potential influences of National Board Certified Science Teachers [NBCSTs] on inexperienced science teachers as their mentors, examining inquiry conceptions of NBCSTs is called for. How do these accomplished practitioners understand and enact inquiry? The purpose of this dissertation research study was twofold. First, it investigated the role of NBC performance assessment process on the professional development
Testing of a Peroxidation Systems, Inc. perox-pure SSB-30
International Nuclear Information System (INIS)
Hodgson, K.M.; Lunsford, T.R.
1994-02-01
A facility is being designed and built at the US Department of Energy (DOE) Hanford Site to treat water containing a variety of organic and inorganic compounds. An ultraviolet light/hydrogen peroxide system, manufactured by Peroxidation Systems, Inc. (PSI), has been chosen to destroy the organic compounds in the feed stream. The PSI perox-pure trademark model SSB-30 has been tested by the Westinghouse Hanford Company (WHC) to provide data for permit documentation and to determine appropriate operating conditions. The destruction of the organic compounds was demonstrated with several feed compositions at different ultraviolet light exposures and hydrogen peroxide concentrations
Persistent fetal sinus bradycardia associated with maternal anti-SSA/Ro and anti-SSB/La antibodies
Chockalingam, Priya; Jaeggi, Edgar T.; Rammeloo, Lukas A.; Haak, Monique C.; Adama van Scheltema, Phebe N.; Breur, Johannes M. P. J.; Bartelings, Margot M.; Clur, Sally-Ann B.; Blom, Nico A.
2011-01-01
To study the clinical course and outcome of fetal sinus bradycardia (SB) due to maternal antibody-induced sinus node dysfunction. We reviewed the maternal, prenatal, and postnatal findings of fetuses with SB associated with elevated maternal anti-SSA/Ro and anti-SSB/La antibodies. Of the 6 cases
2012-02-09
... ENVIRONMENTAL PROTECTION AGENCY [FRL-9629-4] Notification of a Public Meeting of the Science... Agency (EPA). ACTION: Notice. SUMMARY: The EPA Science Advisory Board (SAB) Staff Office announces a public meeting of the SAB Panel to conduct a peer review on the EPA documents, ``Draft--Development of...
hSSB1 associates with and promotes stability of the BLM helicase
O'BYRNE, KEN
2017-01-01
Background Maintenance of genome stability is critical in human cells. Mutations in or loss of genome stability pathways can lead to a number of pathologies including cancer. hSSB1 is a critical DNA repair protein functioning in the repair and signalling of stalled DNA replication forks, double strand DNA breaks and oxidised DNA lesions. The BLM helicase is central to the repair of both collapsed DNA replication forks and double strand DNA breaks by homologous recombination. Results In this s...
Pijanowski, B.; Łukjanow, S.; Burliński, R.
2016-09-01
The rapid development of telematics, particularly mobile telephony (GSM), wireless data transmission (GPRS) and satellite positioning (GPS) noticeable in the last decade, resulted in an almost unlimited growth of the possibilities for monitoring of mobile objects. These solutions are already widely used in the so-called “Intelligent Transport Systems” - ITS and affect a significant increase for road safety. The article describes a method of testing and evaluation of Car Safety Systems (Polish abbreviation - SSB) especially for monitoring traffic incidents, such as collisions and accidents. The algorithm of SSB testing process is also presented. Tests are performed on the dynamic test bench, part of which is movable platform with car security system mounted on it. Crash tests with a rigid obstacle are carried out instead of destructive attempts to crash test of the entire vehicle which is expensive. The tested system, depending on the simulated traffic conditions, is mounted in such a position and with the use of components, indicated by the manufacturer for the automotive safety system installation in a vehicle, for which it is intended. Then, the tests and assessments are carried out.
2012-08-01
... Science Advisory Board; Environmental Economics Advisory Committee AGENCY: Environmental Protection Agency...) Staff Office announces two public teleconferences of the SAB Environmental Economics Advisory Committee...., notice is hereby given that the SAB Environmental Economics Advisory Committee (EEAC) will hold public...
75 FR 4407 - Science Board to the Food and Drug Administration; Notice of Meeting
2010-01-27
... DEPARTMENT OF HEALTH AND HUMAN SERVICES Food and Drug Administration [Docket No. FDA-2010-N-0001... subcommittee reviewing research at the Center for Food Safety and Applied Nutrition. The Science Board will... person on or before Monday, February 15, 2010. Oral presentations from the public will be scheduled...
Fujisaki, Koki; Hagihara, Fumi; Azukawa, Yoshihiro; Kaido, Masanori; Okuno, Tetsuro; Mise, Kazuyuki
2004-09-01
The natural variation of Arabidopsis thaliana in response to a bromovirus, Spring beauty latent virus (SBLV), was examined. Of 63 Arabidopsis accessions tested, all were susceptible when inoculated with SBLV, although there was a large degree of variation in symptom development. Most accessions, including Columbia (Col-0), were symptomless or developed only mild symptoms, but four accessions, including S96, showed severe symptoms of SBLV infection. Genetic analysis suggested that the difference in the responses of Col-0 and S96 to SBLV was controlled by a single semidominant locus. We have designated this locus SSB1 (symptom development by SBLV infection). By using genetic markers, SSB1 was mapped to chromosome IV. The patterns of distribution and accumulation of SBLV in sensitive accessions were similar to those in the insensitive accessions. In addition, symptom development in S96 by SBLV infection was critically interrupted by the presence of the NahG gene, which encodes salicylic acid (SA) hydroxylase. These data suggest that symptom development in A. thaliana controlled by SSB1 is independent of the efficiency of SBLV multiplication and is dependent on SA signaling.
Buchanan, Elizabeth; Aycock, John; Dexter, Scott; Dittrich, David; Hvizdak, Erin
2011-06-01
This paper explores the growing concerns with computer science research, and in particular, computer security research and its relationship with the committees that review human subjects research. It offers cases that review boards are likely to confront, and provides a context for appropriate consideration of such research, as issues of bots, clouds, and worms enter the discourse of human subjects review.
Breslyn, Wayne Gene
The present study investigated differences in the continuing development of National Board Certified Science Teachers' (NBCSTs) conceptions of inquiry across the disciplines of biology, chemistry, earth science, and physics. The central research question of the study was, "How does a NBCST's science discipline (biology, chemistry, earth science, or physics) influence their conceptions, enactment, and goals for inquiry-based teaching and learning?" A mixed methods approach was used that included an analysis of the National Board portfolio entry, Active Scientific Inquiry, for participants (n=48) achieving certification in the 2007 cohort. The portfolio entry provided detailed documentation of teachers' goals and enactment of an inquiry lesson taught in their classroom. Based on the results from portfolio analysis, participant interviews were conducted with science teachers (n=12) from the 2008 NBCST cohort who represented the science disciplines of biology, chemistry, earth science, and physics. The interviews provided a broader range of contexts to explore teachers' conceptions, enactment, and goals of inquiry. Other factors studied were disciplinary differences in NBCSTs' views of the nature of science, the relation between their science content knowledge and use of inquiry, and changes in their conceptions of inquiry as result of the NB certification process. Findings, based on a situated cognitive framework, suggested that differences exist between biology, chemistry, and earth science teachers' conceptions, enactment, and goals for inquiry. Further, individuals teaching in more than one discipline often held different conceptions of inquiry depending on the discipline in which they were teaching. Implications for the research community include being aware of disciplinary differences in studies on inquiry and exercising caution in generalizing findings across disciplines. In addition, teachers who teach in more than one discipline can highlight the contextual
SSB taxes and diet quality in US preschoolers: estimated changes in the 2010 Healthy Eating Index.
Ford, C N; Poti, J M; Ng, S W; Popkin, B M
2017-04-01
Taxing sugar-sweetened beverages (SSBs) has been proposed as a strategy to combat child obesity. Yet it is unclear how a tax on SSBs might influence the overall quality of diet in preschool children. Thus, we use simulated price increases and the 2010 Healthy Eating Index (HEI-2010) to explore the relationship between SSB taxes and diet quality in preschool children. Price and purchase data from the 2009-2012 Nielsen Homescan Panel and a two-part marginal effects model were used to estimate relative changes in purchases with a 20% increase in the price of SSBs. Demand elasticities were applied to dietary intake data for children ages 2-5 years from the National Health and Nutrition Examination Survey (2009-2010 and 2011-2012) to estimate the impact of a 20% SSB tax on dietary intake and quality (HEI-2010). A 20% increase in the price of SSBs was associated with lower total caloric intake (-28 kcal d -1 , p diet quality as an isolated intervention among US preschool children. © 2016 World Obesity Federation.
77 FR 52024 - Notification of a Public Teleconference of the Chartered Science Advisory Board
2012-08-28
... disability, please contact Dr. Nugent preferably at least 10 days prior to the teleconference, to give EPA as... the EPA Science Advisory Board can be found on the SAB Web site at http://www.epa.gov/sab... about this advisory activity can be found on the SAB Web site at http://yosemite.epa.gov/sab/sabproduct...
Effect of antioxidants on x-ray induced DNA SSB and DSB in different cell systems
International Nuclear Information System (INIS)
Ramadu, Kadem
1998-01-01
The effect of x-ray radiation or antioxidants such as actinomycin D, cycloheximide and mitomycin C is studied on CHO, BHK and HeLa cells. X-ray radiation caused DNA single strand breaks (SSB) and double strand breaks (DSB) are prevented by cycloheximide and actinomycin-D. The DSB and SSB are significant in the case of x-ray radiation in combination with MMC, but different with actinomycin-D and cycloheximide in combination with x-ray radiation which causes less number of SSB and DSB. The ISC is observed more with x-ray radiation in combination with antioxidants mitomycin C (MMC) than that of cycloheximide and actinomycin-D, which individually causes inhibition of ISC induced by x-ray radiation. This observation proves that the MMC has an additive effect on x-ray induced ISC during cell proliferation. During cell proliferation, cell viability is observed with x-ray radiation and antioxidants which are dependent on the cell cycle phase. However, in the control cells, the initial Go-phase has shown negligible difference in percent cell viability thereby during S-phase gradual increase in the cell viability, and cell proliferation have been found to be stopped at G2+M-phase. On the contrary, cell viability and the extent of cell proliferation with x-ray radiation in combination with MMC have shown more damage (OH-damage) than is caused by x-ray radiation and MMC, separately. But, the fact is that actinomycin-D and cycloheximide act as antioxidants preventing thereby free radical formation and cell death, caused by x-ray radiation. During cell proliferation, cells observed from S and (G2+M) phase exhibit difference in cell viability in all the treatments alone and in combination. HeLa cells have been found insensitive to x-ray radiation and could be ascribed to the presence of glutathione transferase, which is less in CHO/BHK cell line. (author)
Li, Jie; Chen, Sheying
2016-01-01
Bereavement can be an extremely stressful experience while the protective effect of social support is expected to facilitate the adjustment after loss. The ingredients or elements of social support as illustrated by a new model of Social Support in Bereavement (SSB), however, requires empirical evidence. Who might be the most effective providers of social support in bereavement has also been understudied, particularly within specific cultural contexts. The present study uses both qualitative and quantitative analyses to explore these two important issues among bereaved Chinese families and individuals. The results show that three major types of social support described by the SSB model were frequently acknowledged by the participants in this study. Aside from relevant books, family and friends were the primary sources of social support who in turn received support from their workplaces. Helping professionals turned out to be the least significant source of social support in the Chinese cultural context. Differences by gender, age, and bereavement time were also found. The findings render empirical evidence to the conceptual model of Social Support in Bereavement and also offer culturally relevant guidance for providing effective support to the bereaved.
National Research Council Canada - National Science Library
2007-01-01
The Defense Science Board (DSB) Task Force on Mission Impact of Foreign Influence on DoD Software examined areas in software security, security architecture, and risk mitigation and received briefings from industry, academia...
Board on chemical sciences and technology
International Nuclear Information System (INIS)
1991-01-01
The Board has completed five reports since June 1988. Biosafety in the Laboratory: Prudent Practices for Handling and Disposal of Infectious Materials is a comprehensive review of the principles and practices of biological safety in the laboratory. Currently in press, it promises to be a landmark publication in this field, comparable to the Board's two previous studies on handling and disposal of chemicals in laboratories. Chemical Processes and Products in Severe Nuclear Reactor Accidents: Report of a Workshop evaluates the quality and relevance of existing high-temperature thermodynamic and kinetic data to the analysis of light-water reactor accidents. A number of areas where important data was deemed to be lacking or inadequate were identified to provide a sound basis for predicting the behavior of fission products, fuel, and other materials in nuclear reactors during a severe accident leading to radioactivity release. Training Requirements for Chemists in Nuclear Medicine, Nuclear Industry, and Related Areas assesses the training requirements for chemists in nuclear medicine, nuclear industry, and related areas. Finally, the Board's Air Force Office of Scientific Research High Energy Density Materials Panel has completed two program evaluation reports on this Air Force program
2011-05-06
... the teleconference to give EPA as much time as possible to process your request. Dated: April 26, 2011.... General information concerning the EPA Science Advisory Board can be found on the EPA Web site at http... NAS Comments.'' Background information about this SAB advisory activity can be found on the SAB Web...
2012-08-28
... Science Advisory Board; Exposure and Human Health Committee AGENCY: Environmental Protection Agency (EPA... Office announces a public teleconference of the SAB Exposure and Human Health Committee to discuss its... hereby given that the SAB Exposure and Human Health Committee (EHHC) will hold a public teleconference to...
2011-06-16
... disability, please contact Dr. Nugent preferably at least ten days prior to the teleconference to give EPA as... concerning the EPA Science Advisory Board can be found on the EPA Web site at http://www.epa.gov/sab... advisory activity, including its meetings and teleconferences, can be found on the SAB Web site at http...
2011-07-05
... disability, please contact Dr. Nugent preferably at least ten days prior to the teleconference to give EPA as... concerning the EPA Science Advisory Board can be found on the EPA Web site at http://www.epa.gov/sab... advisory activity, including its meetings and teleconferences, can be found on the SAB Web site at http...
2010-12-27
... ``Reactive Nitrogen in the United States; an Analysis of Inputs, Flows, Consequences, and Management Options... information concerning the EPA Science Advisory Board can be found on the SAB Web site at http://www.epa.gov... information about this advisory activity can be found on the SAB Web site at http://yosemite.epa.gov/sab...
RPA70 depletion induces hSSB1/2-INTS3 complex to initiate ATR signaling
Kar, Ananya; Kaur, Manpreet; Ghosh, Tanushree; Khan, Md. Muntaz; Sharma, Aparna; Shekhar, Ritu; Varshney, Akhil; Saxena, Sandeep
2015-01-01
The primary eukaryotic single-stranded DNA-binding protein, Replication protein A (RPA), binds to single-stranded DNA at the sites of DNA damage and recruits the apical checkpoint kinase, ATR via its partner protein, ATRIP. It has been demonstrated that absence of RPA incapacitates the ATR-mediated checkpoint response. We report that in the absence of RPA, human single-stranded DNA-binding protein 1 (hSSB1) and its partner protein INTS3 form sub-nuclear foci, associate with the ATR-ATRIP comp...
Water Science and Technology Board Annual Report 2001-2002
Energy Technology Data Exchange (ETDEWEB)
None, None
2002-10-01
This annual report marks the twentieth anniversary of the Water Science and Technology Board (WSTB) (1982-2002). The WSTB oversees studies of water issues. The principal products of studies are written reports. These reports cover a wide range of water resources issues of national concern. The following three recently issued reports illustrate the scope of the WSTB's studies: Envisioning the Agenda for Water Resources Research in the Twenty-first Century. The Missouri River Ecosystem: Exploring the Prospects for Recovery, and Assessing the TMDL Approach to Water Quality Management. The WSTB generally meets three times each year where discussions are held on ongoing projects, strategic planning, and developing new initiatives. The meetings also foster communication within the water resources community. The annual report includes a discussion on current studies, completed studies 2001-2002, and future plans, as well as a listing of published reports (1983-2002).
2011-05-09
... contact Dr. Stallworth preferably at least ten days prior to the teleconference to give EPA as much time... information concerning the EPA Science Advisory Board can be found on the EPA Web site at http://www.epa.gov... report. Background information about this SAB advisory activity can be found on the SAB Web site at http...
2011-07-13
... Dr. Nugent preferably at least ten days prior to the teleconference to give EPA as much time as... concerning the EPA Science Advisory Board can be found on the EPA Web site at http://www.epa.gov/sab... found on the SAB Web site at http://yosemite.epa.gov/sab/sabproduct.nsf/fedrgstr_activites/Oil%20Spill...
2010-07-27
... DEPARTMENT OF DEFENSE Office of the Secretary Defense Science Board; Task Force on Trends and Implications of Climate Change for National and International Security AGENCY: Department of Defense (DoD... and Implications of Climate Change for National and International Security will meet in closed session...
2010-06-17
... DEPARTMENT OF DEFENSE Office of the Secretary Defense Science Board Task Force on Trends and Implications of Climate Change for National and International Security AGENCY: Department of Defense (DoD... and Implications of Climate Change for National and International Security will meet in closed session...
Understanding bureaucracy in health science ethics: toward a better institutional review board.
Bozeman, Barry; Slade, Catherine; Hirsch, Paul
2009-09-01
Research involving human participants continues to grow dramatically, fueled by advances in medical technology, globalization of research, and financial and professional incentives. This creates increasing opportunities for ethical errors with devastating effects. The typical professional and policy response to calamities involving human participants in research is to layer on more ethical guidelines or strictures. We used a recent case-the Johns Hopkins University/Kennedy Kreiger Institute Lead Paint Study-to examine lessons learned since the Tuskegee Syphilis Study about the role of institutionalized science ethics in the protection of human participants in research. We address the role of the institutional review board as the focal point for policy attention.
Bozdogan, Aykut Emre; Günaydin, Esra; Okur, Alperen
2014-01-01
The aim of the study is to explore the academic achievement and performance tasks of students studying in a regional primary boarding school in science course with regard to different variables. The study was carried out via survey method and total 96 students, 57 of them boarding students and 39 of them non-boarding students studying in the 5th,…
A data-driven structural model of hSSB1 (NABP2/OBFC2B) self-oligomerization
Touma, Christine; Adams, Mark N.; Ashton, Nicholas W.; Mizzi, Michael; El-Kamand, Serene; Richard, Derek J.; Cubeddu, Liza; Gamsjaeger, Roland
2017-01-01
Abstract The maintenance of genome stability depends on the ability of the cell to repair DNA efficiently. Single-stranded DNA binding proteins (SSBs) play an important role in DNA processing events such as replication, recombination and repair. While the role of human single-stranded DNA binding protein 1 (hSSB1/NABP2/OBFC2B) in the repair of double-stranded breaks has been well established, we have recently shown that it is also essential for the base excision repair (BER) pathway following...
Proceedings – Mathematical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Editorial Board. Proceedings – Mathematical Sciences. Chief Editor. B V Rajarama Bhat, Indian Statistical Institute, Bengaluru (bhat@isibang.ac.in). Associate Editor. Parameswaran Sankaran, The Institute of Mathematical Sciences, Chennai (sankaran@imsc.res.in). Advisory Board. M S Raghunathan, Indian Institute of ...
Science & Engineering Indicators 2016. National Science Board
National Science Foundation, 2016
2016-01-01
"Science and Engineering Indicators" (SEI) is first and foremost a volume of record comprising high-quality quantitative data on the U.S. and international science and engineering enterprise. SEI includes an overview and seven chapters that follow a generally consistent pattern. The chapter titles are as follows: (1) Elementary and…
78 FR 73852 - Army Science Board Winter Plenary Meeting
2013-12-09
... Board to review the results of the FY13 study titled, ``Creating an Innovation Culture in the Army'' in... the Fiscal Year 2013 ``Creating an Innovation Culture'' Study. The ASB board members will cast a vote....mil @mail.mil"> william.m.mclagan.mil @mail.mil or Ms. Carolyn German at (703) 545-8654 or email...
78 FR 57136 - National Board for Education Sciences; Meeting
2013-09-17
... discussion. From 11:00 a.m. to 12:30 p.m., the Board will consider the topic, ``Supporting English Language... roundtable discussion of the issues raised. The meeting will break for lunch from 12:30 to 1:30 p.m. The... What Works Clearinghouse--Postsecondary Topics, the Board will engage in roundtable discussion of the...
SSB of Scale Symmetry, Fermion Families and Quintessence without the Long-Range Force Problem
Guendelman, E. I.; Kaganovich, A. B.
We study a scale-invariant two measures theory where a dilaton field φ has no explicit potentials. The scale transformations include the translation of a dilaton φ-->φ+ const. The theory demonstrates a new mechanism for generation of the exponential potential: in the conformal Einstein frame (CEF), after SSB of scale invariance, the theory develops the exponential potential and, in general, the nonlinear kinetic term is generated as well. The scale symmetry does not allow the appearance of terms breaking the exponential shape of the potential that solves the problem of the flatness of the scalar field potential in the context of quintessential scenarios. As examples, two different possibilities for the choice of the dimensionless parameters are presented where the theory permits to get interesting cosmological results. For the first choice, the theory has standard scaling solutions for φ usually used in the context of the quintessential scenario. For the second choice, the theory allows three different solutions, one of which is a scaling solution with equation of state pφ=wρφ where w is predicted to be restricted by -1
Gourzi, V C; Kapsogeorgou, E K; Kyriakidis, N C; Tzioufas, A G
2015-01-01
The elevated tissue expression of Ro/SSA and La/SSB autoantigens appears to be crucial for the generation and perpetuation of autoimmune humoral responses against these autoantigens in Sjögren’s syndrome (SS). The mechanisms that govern their expression are not known. miRNAs, the post-transcriptional regulators of gene expression, might be implicated. We have identified previously the miRNAs let7b, miR16, miR181a, miR200b-3p, miR200b-5p, miR223 and miR483-5p that are predicted to target Ro/SSA [Ro52/tripartite motif-containing protein 21 (TRIM21), Ro60/TROVE domain family, member 2 (TROVE2)] and La/SSB mRNAs. To study possible associations with autoantigen mRNA expression and disease features, their expression was investigated in minor salivary gland (MSG) tissues, peripheral blood mononuclear cells (PBMC) and long-term cultured non-neoplastic salivary gland epithelial cells (SGEC) from 29 SS patients (20 of 29 positive for autoantibodies to Ro/SSA and La/SSB) and 24 sicca-complaining controls. The levels of miR16 were up-regulated in MSGs, miR200b-3p in SGECs and miR223 and miR483-5p in PBMCs of SS patients compared to sicca-complaining controls. The MSG levels of let7b, miR16, miR181a, miR223 and miR483-5p were correlated positively with Ro52/TRIM21-mRNA. miR181a and miR200b-3p were correlated negatively with Ro52/TRIM21 and Ro60/TROVE2 mRNAs in SGECs, respectively, whereas let7b, miR200b-5p and miR223 associated with La/SSB-mRNA. In PBMCs, let7b, miR16, miR181a and miR483-5p were correlated with Ro52/TRIM21, whereas let7b, miR16 and miR181a were also associated with La/SSB-mRNA expression. Significantly lower miR200b-5p levels were expressed in SS patients with mucosa-associated lymphoid tissue (MALT) lymphoma compared to those without. Our findings indicate that miR16, miR200b-3p, miR223 and miR483-5p are deregulated in SS, but the exact role of this deregulation in disease pathogenesis and autoantigen expression needs to be elucidated. PMID:26201309
Heinen, R C; Diniz-Mendes, L; Silva, J T; Paschoalin, V M F
2006-11-01
Yeast soluble proteins were fractionated by calmodulin-agarose affinity chromatography and the Ca2+/calmodulin-binding proteins were analyzed by SDS-PAGE. One prominent protein of 66 kDa was excised from the gel, digested with trypsin and the masses of the resultant fragments were determined by MALDI/MS. Twenty-one of 38 monoisotopic peptide masses obtained after tryptic digestion were matched to the heat shock protein Ssb1/Hsp75, covering 37% of its sequence. Computational analysis of the primary structure of Ssb1/Hsp75 identified a unique potential amphipathic alpha-helix in its N-terminal ATPase domain with features of target regions for Ca2+/calmodulin binding. This region, which shares 89% similarity to the experimentally determined calmodulin-binding domain from mouse, Hsc70, is conserved in near half of the 113 members of the HSP70 family investigated, from yeast to plant and animals. Based on the sequence of this region, phylogenetic analysis grouped the HSP70s in three distinct branches. Two of them comprise the non-calmodulin binding Hsp70s BIP/GR78, a subfamily of eukaryotic HSP70 localized in the endoplasmic reticulum, and DnaK, a subfamily of prokaryotic HSP70. A third heterogeneous group is formed by eukaryotic cytosolic HSP70s containing the new calmodulin-binding motif and other cytosolic HSP70s whose sequences do not conform to those conserved motif, indicating that not all eukaryotic cytosolic Hsp70s are target for calmodulin regulation. Furthermore, the calmodulin-binding domain found in eukaryotic HSP70s is also the target for binding of Bag-1 - an enhancer of ADP/ATP exchange activity of Hsp70s. A model in which calmodulin displaces Bag-1 and modulates Ssb1/Hsp75 chaperone activity is discussed.
Directory of Open Access Journals (Sweden)
R.C. Heinen
2006-11-01
Full Text Available Yeast soluble proteins were fractionated by calmodulin-agarose affinity chromatography and the Ca2+/calmodulin-binding proteins were analyzed by SDS-PAGE. One prominent protein of 66 kDa was excised from the gel, digested with trypsin and the masses of the resultant fragments were determined by MALDI/MS. Twenty-one of 38 monoisotopic peptide masses obtained after tryptic digestion were matched to the heat shock protein Ssb1/Hsp75, covering 37% of its sequence. Computational analysis of the primary structure of Ssb1/Hsp75 identified a unique potential amphipathic alpha-helix in its N-terminal ATPase domain with features of target regions for Ca2+/calmodulin binding. This region, which shares 89% similarity to the experimentally determined calmodulin-binding domain from mouse, Hsc70, is conserved in near half of the 113 members of the HSP70 family investigated, from yeast to plant and animals. Based on the sequence of this region, phylogenetic analysis grouped the HSP70s in three distinct branches. Two of them comprise the non-calmodulin binding Hsp70s BIP/GR78, a subfamily of eukaryotic HSP70 localized in the endoplasmic reticulum, and DnaK, a subfamily of prokaryotic HSP70. A third heterogeneous group is formed by eukaryotic cytosolic HSP70s containing the new calmodulin-binding motif and other cytosolic HSP70s whose sequences do not conform to those conserved motif, indicating that not all eukaryotic cytosolic Hsp70s are target for calmodulin regulation. Furthermore, the calmodulin-binding domain found in eukaryotic HSP70s is also the target for binding of Bag-1 - an enhancer of ADP/ATP exchange activity of Hsp70s. A model in which calmodulin displaces Bag-1 and modulates Ssb1/Hsp75 chaperone activity is discussed.
Garvani, Sara; Carmisciano, Cosmo; Locritani, Marina; Grossi, Luigi; Mori, Anna; Stroobant, Mascha; Schierano, Erika; De Strobel, Federico; Manzella, Giuseppe; Muzi, Enrico; Leccese, Dario; Sinapi, Luigi; Morellato, Claudio; La Tassa, Hebert; Talamoni, Roberta; Coelho, Emanuel; Nacini, Francesca
2017-04-01
culture witnesses, related to the naval history of seamanship from the origins up to nowadays), allowed the creation of a special educational format based on Historical Oceanography, for university and high school students as an integration for their curriculum. The Historical Oceanography Society has provided the major knowledges included in the ancient volumes of its archive, thanks to the availability of its members that also held theoretical and practical lessons during the course. The present paper will describe the one-week special course (about 60 hours of theory and practice with technical visits to Research centres and Museums) that has been planned to be carried out on board of the Italian Training Navy Ship (A. Vespucci) and has been organized in order to give the hints about on board life, as well as theoretical lessons on modern and historical oceanography, hands-on labs on oceanographic instruments from public and private collections, physiology of diving techniques and astronomy. The general aim of this course has been, hence, to give to excellent students all those technological but also creative and imaginative features of our past. References M. Locritani, I. Batzu, C. Carmisciano, F. Muccini, R. Talamoni, H.L. Tassa, M. Stroobant, G. Guccinelli, L. Benvenuti, M. Abbate, S. Furia, A. Benedetti, M.I. Bernardini, R. Centi, L. Casale, C. Vannucci, F. Giacomazzi, C. Marini, D. Tosi, S. Merlino, E. Mioni, F. Nacini, Feeling the pulse of public perception of science: Does research make our hearts beat faster?, in: MTS/IEEE OCEANS 2015 - Genova: Discovering Sustainable Ocean Energy for a New World, 2015. National Science Foundation, 50 Years of Ocean Discovery: National Science Foundation 1950-2000. Ocean Studies Board, National Research Council ISBN: 0-309-51744-3, 276 pages, 8.5 x 11, 2000. E.L. Mills, The Historian of Science and Oceanography After Twenty Years, Earth Sciences History. 12 (1993) 5-18. J.A. Bennett, History of Technology - McConnell Anita
Towards a centralized Grid Speedometer
International Nuclear Information System (INIS)
Dzhunov, I; Andreeva, J; Saiz, P; Fajardo, E; Gutsche, O; Luyckx, S
2014-01-01
Given the distributed nature of the Worldwide LHC Computing Grid and the way CPU resources are pledged and shared around the globe, Virtual Organizations (VOs) face the challenge of monitoring the use of these resources. For CMS and the operation of centralized workflows, the monitoring of how many production jobs are running and pending in the Glidein WMS production pools is very important. The Dashboard Site Status Board (SSB) provides a very flexible framework to collect, aggregate and visualize data. The CMS production monitoring team uses the SSB to define the metrics that have to be monitored and the alarms that have to be raised. During the integration of CMS production monitoring into the SSB, several enhancements to the core functionality of the SSB were required; They were implemented in a generic way, so that other VOs using the SSB can exploit them. Alongside these enhancements, there were a number of changes to the core of the SSB framework. This paper presents the details of the implementation and the advantages for current and future usage of the new features in SSB.
78 FR 10607 - National Sea Grant Advisory Board
2013-02-14
... extension, science and technology programs, and other matters as described in the agenda found on the National Sea Grant College Program Web site at http://www.seagrant.noaa.gov/leadership/advisory_board.html....seagrant.noaa.gov/leadership/advisory_board.html . Dated: February 6, 2013. Jason Donaldson, Chief...
2011-02-09
..., preferably at least 10 days prior to the meeting, to give EPA as much time as possible to process your... Board can be found on the SAB Web site at http://www.epa.gov/sab . SUPPLEMENTARY INFORMATION: The SAB... light of EPA's research needs. Previous SAB budget advisories are on the SAB Web site at http://www.epa...
Towards a centralized Grid Speedometer
Gutsche, Oliver
2013-01-01
Given the distributed nature of the grid and the way CPU resources are pledged and scared around the globe, VOs are facing the challenge to monitor the use of these resources. For CMS and the operation of centralized workflows the monitoring of how many production jobs are running and pending in the Glidein WMS production pools is very important. The Dashboard SSB (Site Status Board) provides a very flexible framework to collect, aggregate and visualize data. The CMS production monitoring team uses the SSB to define the metrics that have to be monitored and the alarms that have to be set. During the integration of the CMS production monitoring into the SSB, several enhancements to the core functionality of the SSB were implemented; all in a generic way, so that other VOs using the SSB can use them as well. Alongside these enhancements, there were a few changes to the core of the SSB framework from which the CMS production team was able to benefit. We will present the details of the implementation and the adva...
Noone, K. J.; Manderscheid, P.; Monfray, P.
2017-12-01
It is becoming increasingly apparent that the separation between science and the rest of society is not helping us find solutions to "wicked" problems like climate change or achieving the Sustainable Development Goals. It is clear that a broader approach to research is necessary - one that includes stakeholders in the research process itself. What is unclear is how best to do this. The Transdisciplinary Advisory Board (TAB) of the European Joint Programming Initiative on Climate (JPI Climate) is an example of scientists and stakeholders working together to frame climate research and move the results of scientific research into decision support. JPI Climate is a consortium of 12 European countries (with partners from nine more countries) and is a major funding channel and forum for climate research in Europe. The TAB has an equal number of stakeholders and researchers from 10 different European countries, has an even gender balance, and its members have widely differing backgrounds. The TAB provides input and advice to the governing board of JPI Climate, and influences both the strategic planning for this funding initiative as well as specific calls for proposals issued through the consortium. In addition to its advisory role, the TAB explores the transdisciplinary process itself, expanding the boundaries of how stakeholders and science can interact positively. The TAB is a two-way mechanism through which stakeholders can help improve research and science can help improve society. We will give examples of the spectrum of how the TAB provides mutual influence between stakeholders and science - from helping to draft 10-year research strategies to helping advance the uptake of climate research into the private and policy sectors.
78 FR 60851 - Science Advisory Board Meeting
2013-10-02
... written statements. In general, each individual or group making a verbal presentation will be limited to a... Advisory Board (SAB) was established by a Decision Memorandum dated September 25, 1997, and is the only... resource management. Time and Date: The meeting will be held Tuesday, November 19, 2013 from 10:00 a.m. to...
Contemporary management issues confronting fisheries science
Frank, Kenneth T.; Brickman, David
2001-06-01
Stock collapses have occurred worldwide. The most frequently cited cause is over-fishing, suggesting that fisheries management has been ineffective in controlling exploitation rates. The progression of a fishery from an over-exploited to a collapsed state involves impairment of the reproductive capacity of the target species, i.e. recruitment over-fishing. In many cases, this occurs by reduction of the spawning stock biomass (SSB) through the systematic elimination of spawning components within a stock complex. While operational definitions of minimum levels of SSB have been developed, they have seldom been applied and never adopted in a Canadian groundfish management context. The answer to the question of how much is enough to perpetuate a stock under exploitation has been illusive. Serebryakov [J. Cons. Int. Explor. Mer, 47 (1990) 267] has advocated definition of critical levels of SSB based on survival rates (R/SSB). We review his method and discuss the utility of the approach. An alternative approach to the problem of estimating minimum SSB is through a fundamental revision of the traditional stock and recruitment relationship. Explicit theoretical SSB thresholds below which reproduction/recruitment is severely impaired based upon density-dependent mating success (or Allee effects) is considered a superior approach to the question of how much is enough because of its ecological grounding. However, the successful application of this approach will require re-definition of the space/time scales of the management unit. Finally, support is growing for the establishment of closed areas or "no-take zones" as an alternative approach to managing the problems of fishing a stock complex by enabling sub-populations to escape fishing. While the expected benefits of areas protected from fishing are numerous, clear demonstrations of benefits of such areas in marine temperate ecosystems are lacking. In fact, unintended negative consequences may result from such actions.
Evaluation of Board Performance in Iran’s Universities of Medical Sciences
Directory of Open Access Journals (Sweden)
Haniye Sajadi
2014-10-01
Full Text Available Background The critical role that the board plays in governance of universities clarifies the necessity of evaluating its performance. This study was aimed to evaluate the performance of the boards of medical universities and provide solutions to enhance its performance. Methods The first phase of present study was a qualitative research in which data were collected through face-to-face semi-structured interviews. Data were analyzed by thematic approach. The second phase was a mixed qualitative and quantitative study, with quantitative part in cross-sectional format and qualitative part in content analysis format. In the quantitative part, data were collected through Ministry of Health and Medical Education (MoHME. In the qualitative part, the content of 2,148 resolutions that were selected by using stratified sampling method were analyzed. Results Participants believed that the boards had no acceptable performance for a long time. Results also indicated the increasing number of meetings and resolutions of the boards in these 21 years. The boards’ resolutions were mostly operational in domain and administrative in nature. The share of specific resolutions was more than the general ones. Conclusion Given the current pace of change and development and the need to timely respond them, it is recommended to accelerate the slow pace of improvement process of the boards. It appears that more delegation and strengthening the position of the boards are the effective strategies to speed up this process.
76 FR 35410 - Science Advisory Board; Meeting
2011-06-17
... statements. In general, each individual or group making a verbal presentation will be limited to a total time... Advisory Board (SAB) was established by a Decision Memorandum dated September 25, 1997, and is the only... management. Time and Date: The meeting will be held Wednesday, July 20, 2011, from 9:30 a.m. to 5:30 p.m. and...
77 FR 38273 - Science Advisory Board; Meeting
2012-06-27
... will be limited to a total time of five (5) minutes. Individuals or groups planning to make a verbal... Advisory Board (SAB) was established by a Decision Memorandum dated September 25, 1997, and is the only... management. Time and Date: The meeting will be held Monday, July 16, 2012 from 9 a.m. to 5:30 p.m. and...
Boards on the Move: Surfboards, Skateboards, Snowboards, and Kiteboards
Moye, Johnny J.; Ritz, John M.
2009-01-01
Technological advances through mathematics and science have made possible the modification of boarding sports. This article discusses the development of sport technologies that use boards and also touches on the social and cultural effects of the new technologies. It identifies many new forms of sports equipment that were spawned from modifying…
78 FR 38297 - Science Advisory Board (SAB)
2013-06-26
... presentation will be limited to a total time of two (2) minutes. Individuals or groups planning to make a... Board (SAB) was established by a Decision Memorandum dated September 25, 1997, and is the only Federal... management. Time and Date: The meeting will be held Tuesday, July 23, 2013 from 2:00 p.m. to 5:00 p.m. EDT...
76 FR 70970 - Technology Innovation Program Advisory Board
2011-11-16
... Technology, Education, and Science (COMPETES) Act, Public Law 110-69 (August 9, 2007), 15 U.S.C. 278n, the... eminent in such fields as business, research, science and technology, engineering, education, and... Program Advisory Board AGENCY: National Institute of Standards and Technology, Department of Commerce...
In these studies we pretreated sweet sorghum bagasse (SSB) using liquid hot water (LHW) or dilute H2SO4 (2 g·L-1) at 190 deg C for zero min (as soon as temperature reached 190 deg C, cooling was started) to reduce generation of sugar degradation fermentation inhibiting products such as furfural and ...
Maulia, Putri; Budi Lestari, SU, Dr. Dra. Sri
2017-01-01
In a family, interpersonal communication processes take place in nurturing and controlling against the behavior of their children. Now, many parents who choose to educate his children in boarding schools and they hopes their children can have a religious knowledge as well as a good general science, have a good character, and have a positive self-concept if educated in the boarding school. This research using a qualitative approach, aims to describing interpersonal communication processes betw...
Directory of Open Access Journals (Sweden)
Bakir Mehić
2014-02-01
Full Text Available The most vital part of a scientific journal is the Editorial board and Advisory board. So, it is never good that the composition of these boards lasts longer than 2-3 years.With the first number of BJBMS in 2014, a new composition of the Editorial board and Advisory Board of this journal was published. They consist of eminent scientists with adequate qualifications from nine countries and who can actively contribute to the good management of the journal and its further development. Their tasks will be: -Supporting and promotion of the journal (being true ambassadors of the journal,-Writing editorials, reviews and commentaries on works from the field of their expertise,-Giving opinions and suggestions on the management and policy of the journal, with the timely identification of the upcoming challenges. Commitment to upholding the ethics of publishing with impartiality and confidentiality, the fight against plagiarism and multiple or simultaneous publication of articles will remain a priority in the work of the Editorial Board and Advisory Board of BJBMS. Also, the newly appointed boards will continue to work in the way of protection of copyright for authors who were victims of plagiarism. In this sense, the editor in chief, together with the Editorial Board will take measures in accordance with the guidelines of the Committee for Ethics in publishing [1].Quality assurance in publishing and also in BJBMS is focused on the detection of forged data, images, and plagiarized articles. In its future work Editorial Board of BJBMS is obliged to pay attention to supporting academic integrity, ensuring the integrity of academic records and intellectual property. This latter implies: -Request for evidence of ethics for the approved research, that is, authors will be asked to prove that they obtained the consent of the patient for the study or in the case of experiments on animals, which methods were used so the animals would not suffer?-Ensuring that
Annual report of the Science and Engineering Research Council 1992-1993
International Nuclear Information System (INIS)
1993-01-01
Details of expenditure and reports of the activities of the four Boards which operate as the Science and Engineering Research Council are given. These are the Astronomical and Planetry Science Board, the Engineering Board, the Nuclear Physics Board and the Science Board. There is also a report on the optical physics and optoelectronic research supported by the Council. Committee membership, studentship, fellowships research grants and administration details are reported. (UK)
A Circuit Board Using a Sheet of Thick Paper and Aluminium Tape
Kamata, Masahiro; Honda, Motoshi
2003-01-01
We have developed a circuit board using materials that are inexpensive and familiar to elementary school students. Most of the responses from students who made this board were relatively positive and we observed them enjoy making the boards at a Science Festival in Japan and in elementary school. As an application, we also developed a tiny torch…
Information and Announcements National Board for Higher ...
Indian Academy of Sciences (India)
National Board for Higher Mathematics ... the mathematics Olympiad cell of the Homi Bhabha Centre for Science Education (TIFR). ... cians and teachers interested in contributing to the mathematics Olympiad activity at the national level.
Roberts, S.; Glickson, D.; Mengelt, C.; Forrest, S.; Waddell, K.
2012-12-01
The National Research Council is a private, nonprofit organization chartered by Congress in 1916 as an expansion of the U.S. National Academy of Sciences. Its mission is to improve the use of science in government decision making and public policy, increase public understanding, and promote the acquisition and dissemination of knowledge in matters involving science, engineering, technology, and health. Within the National Research Council, the Ocean Studies Board (OSB) mission is to explore the science, policies, and infrastructure needed to understand, manage, and conserve coastal and marine environments and resources. OSB undertakes studies and workshops on emerging scientific and policy issues at the request of federal agencies, Congress, and others; provides program reviews and guidance; and facilitates communication on oceanographic issues among different sectors. OSB also serves as the U.S. National Committee to the international, nongovernmental Scientific Committee on Oceanic Research (SCOR). OSB has produced reports on a wide range of topics of interest to researchers and educators, the federal government, the non-profit sector, and industry. Recent reports have focused on ecosystem services in the Gulf of Mexico after the Deepwater Horizon oil spill, sea level rise on the U.S. west coast, scientific ocean drilling needs and accomplishments, requirements for sustained ocean color measurements, critical infrastructure for ocean research, tsunami warning and preparedness, ocean acidification, and marine and hydrokinetic power resource assessments. Studies that are currently underway include responding to oil spills in the Arctic, evaluating the effectiveness of fishery stock rebuilding plans, and reviewing the National Ocean Acidification Research Plan. OSB plays an important role in helping create policy decisions and disseminating important information regarding various aspects of ocean science.
Bulletin of Materials Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Editorial Board. Bulletin of Materials Science. Editor. Giridhar U. Kulkarni, Centre for Nano and Soft Matter Science, Bengaluru. Associate Editors. Ayan Datta, Indian Association for the Cultivation of Science, Kolkata M. Eswaramoorthy, Jawaharlal Nehru Centre for Advanced Scientific Research, Bengaluru A.K. Ganguli ...
Fermilab Friends for Science Education | Support Us
Fermilab Friends for Science Education FFSE Home About Us Join Us Support Us Contact Us Support Us improving science (science, technology, engineering and mathematics) education. Your donation allows us to Testimonials Our Donors Board of Directors Board Tools Calendar Join Us Donate Now Get FermiGear! Education
76 FR 34069 - National Board for Education Sciences; Meeting
2011-06-10
.... Following lunch the Board will turn to the topic, ``Communications: What are effective ways to communicate... Stanford University and Dr. Robert Slavin of Johns Hopkins University and the Success for All Foundation...
Board on chemical sciences and technology
International Nuclear Information System (INIS)
1988-01-01
Current and Ongoing Projects include: Committee on Nuclear and Radiochemistry; Committee on Nuclear and Radiochemistry Workshop on Training Requirements for Chemists in Nuclear Medicine, Nuclear Industry, and Related Areas; Committee on Nuclear and Radiochemistry Workshop on High-Temperature and Nuclear Chemical Processes in Severe Reactor Accidents; Committee on Chemical Engineering Frontiers Research Needs and Opportunities; Committee on Separation Science on Technology; Panel on Future Directions for Fundamental Science in Fossil Energy Research; Committee for Handling and Disposal of Biohazards in the Laboratory (BIL); Advisory Panels to the AFSOR Chemical and Atmospheric Sciences Directorate; US National Committee for Pure and Applied Chemistry; US National Committee for Biochemistry; US National Committee for Crystallography
An international nanoscience advisory board to improve and harmonize nanotechnology oversight
International Nuclear Information System (INIS)
Marchant, Gary E.; White, Andrew
2011-01-01
As governments around the world begin to implement regulations aimed at controlling nanotechnology, those regulations should be based upon the best available science, applied as consistently as possible within jurisdictions and, to the extent feasible, across jurisdictions. These goals would be easier to achieve with the creation of an international nanoscience advisory board. Such a body could be modeled on similar international scientific advisory bodies for other issues, such as the Intergovernmental Panel on Climate Change (IPCC) and the Intergovernmental Science-Policy Platform on Biodiversity and Ecosystem Services. Such a body should also take into account lessons learned from these similar organizations. An international nanoscience advisory board could assist regulatory bodies by providing a central source of accurate scientific information about the risks and benefits of nanotechnology, including relevant uncertainties, rather than having each regulatory body make these determinations independently. An international nanoscience advisory board could facilitate harmonization within and between jurisdictions by involving the top experts in the field to produce a centralized knowledge base for regulatory decisions. While an international nanoscience advisory board presents many potential benefits, it also faces significant difficulties, which are best illustrated by examining the history and challenges of existing international science advisory bodies.
Fermilab Friends for Science Education | Programs
Fermilab Friends for Science Education FFSE Home About Us Join Us Support Us Contact Us Programs Donors Board of Directors Board Tools Calendar Join Us Donate Now Get FermiGear! Education Office Search photo Fermilab Friends for Science Education, in partnership with Fermilab and area educators, designs
Report of the Science and Engineering Research Council for the year 1987-88
International Nuclear Information System (INIS)
1988-12-01
The paper presents the Annual Report of the Science and Engineering Research Council (SERC), United Kingdom 1987/8. The contents contains the reports of the four Boards of the Council - the Astronomy and Planetary Science Board, the Engineering Board, the Nuclear Physics Board and the Science Board. The SERC report also contains eleven review articles on major advances in Science in recent years, including high temperature superconductivity and the supernova in the Large Magellanic Cloud, as well as details of fourteen ''highlights'' of 1987/8 including the dating of the Turin Shroud. (U.K.)
Fermilab Friends for Science Education | Tree of Knowledge
Fermilab Friends for Science Education FFSE Home About Us Join Us Support Us Contact Us Tree of Testimonials Our Donors Board of Directors Board Tools Calendar Join Us Donate Now Get FermiGear! Education precollege science education programs. Prominently displayed at the Lederman Science Center is the lovely
77 FR 60116 - Human Studies Review Board; Notification of a Public Meeting
2012-10-02
... ENVIRONMENTAL PROTECTION AGENCY [EPA-HQ-ORD-2012-0718; FRL-9736-4] Human Studies Review Board; Notification of a Public Meeting AGENCY: Environmental Protection Agency (EPA). ACTION: Notice. SUMMARY: The EPA Office of the Science Advisor announces a public meeting of the Human Studies Review Board to...
77 FR 74004 - Human Studies Review Board; Notification of a Public Meeting
2012-12-12
... ENVIRONMENTAL PROTECTION AGENCY [EPA-HQ-ORD-2012-0892; FRL-9761-4] Human Studies Review Board; Notification of a Public Meeting AGENCY: Environmental Protection Agency (EPA). ACTION: Notice. SUMMARY: The EPA Office of the Science Advisor announces a public meeting of the Human Studies Review Board to...
78 FR 57383 - Human Studies Review Board; Notification of a Public Meeting
2013-09-18
... ENVIRONMENTAL PROTECTION AGENCY [EPA-HQ-ORD-2013-0626; FRL-9900-98-ORD] Human Studies Review Board; Notification of a Public Meeting AGENCY: U.S. Environmental Protection Agency (EPA). ACTION: Notice. SUMMARY: The EPA Office of the Science Advisor announces a public meeting of the Human Studies Review Board to...
76 FR 80938 - Human Studies Review Board; Notification of a Public Meeting
2011-12-27
... ENVIRONMENTAL PROTECTION AGENCY [EPA-HQ-ORD-2011-0954; FRL-9611-6] Human Studies Review Board; Notification of a Public Meeting AGENCY: U.S. Environmental Protection Agency. ACTION: Notice. SUMMARY: The EPA Office of the Science Advisor announces a public meeting of the Human Studies Review Board to advise the...
77 FR 65176 - Science Advisory Board (SAB)
2012-10-25
... Atmospheric Administration (NOAA) science programs are of the highest quality and provide optimal support to... Portfolio Review Task Force; (3) Report from the Ecosystem Sciences and Management Working Group on...
77 FR 6789 - National Board for Education Sciences; Meeting
2012-02-09
... Evaluation in the Administration for Children and Families in the Department of Health and Human Services... Director, and the Commissioners of the national centers will give an overview of recent developments at IES... Board will consider the topic, ``The Importance of Disseminating Research Results: How can we better...
77 FR 1072 - Meeting of the National Biodefense Science Board
2012-01-09
... site for the most up-to-date information on the meeting. ADDRESSES: Omni Shoreham Hotel, Palladian... NBSB Web site at http://www.phe.gov/Preparedness/legal/boards/nbsb/Pages/default.aspx prior to the...
75 FR 69920 - (NOAA) Science Advisory Board (SAB)
2010-11-16
... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration (NOAA) Science Advisory... Administration (NOAA), Department of Commerce (DOC). ACTION: Notice of open meeting. SUMMARY: The Science... Administration (NOAA) science programs are of the highest quality and provide optimal support to resource...
78 FR 16254 - (NOAA) Science Advisory Board (SAB)
2013-03-14
... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration (NOAA) Science Advisory... Administration (NOAA), Department of Commerce (DOC). ACTION: Notice of open meeting. SUMMARY: The Science... Administration (NOAA) science programs are of the highest quality and provide optimal support to resource...
DEFF Research Database (Denmark)
Steen, Hanno; Petersen, Jørgen; Mann, Matthias
2001-01-01
acid and peptide entities present in such heteroconjugates. Sample preparation of the peptide-nucleic acid heteroconjugates is, therefore, a crucial step in any mass spectrometry-based analytical procedure. This study demonstrates the performance of four different MS-based strategies to characterize E....... coli single-stranded DNA binding protein (SSB) that was UV-cross-linked to a 5-iodouracil containing DNA oligomer. Two methods were optimized to circumvent the need for standard liquid chromatography and gel electrophoresis, thereby dramatically increasing the overall sensitivity of the analysis...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Editorial Board. Editorial Board. Resonance – Journal of Science Education. Chief Editor. N Sathyamurthy, Jawaharlal Nehru Centre for Advanced Scientific Research, Bangalore ... Guruswamy Kumaraswamy, CSIR-National Chemical Laboratory, Pune
Hayes, Judith
2009-01-01
This slide presentation reviews the requirements that NASA has for the medical service of a crew returning to earth after long duration space flight. The scenarios predicate a water landing. Two scenarios are reviewed that outline the ship-board medical operations team and the ship board science reseach team. A schedule for the each crew upon landing is posited for each of scenarios. The requirement for a heliport on board the ship is reviewed and is on the requirement for a helicopter to return the Astronauts to the Baseline Data Collection Facility (BDCF). The ideal is to integrate the medical and science requirements, to minimize the risks and Inconveniences to the returning astronauts. The medical support that is required for all astronauts returning from long duration space flight (30 days or more) is reviewed. The personnel required to support the team is outlined. The recommendations for medical operations and science research for crew support are stated.
African Journals Online (AJOL)
Science. The journal has a new and more modern layout, published online only, and the editorial. Board was increased to include more disciplines pertaining to marine sciences. While important chal- lenges still lie ahead, we are steadily advancing our standard to increase visibility and dissemination throughout the global ...
77 FR 52695 - National Sea Grant Advisory Board
2012-08-30
..., education and extension, science and technology programs, and other matters as described in the agenda found on the National Sea Grant College Program Web site at http://www.seagrant.noaa.gov/leadership....seagrant.noaa.gov/leadership/advisory_board.html . Dated: August 24, 2012. Andrew Baldus, Acting Chief...
Southeast Asian Ministers of Education Organization (Singapore). Regional Center for Education in Science and Mathematics.
This report details the proceedings of the first meeting of the Governing Board of the SEAMEO Regional Centre for Education in Science and Mathematics held in Penang, Malaysia from October 8-12, 1970. Procedural matters detailed in the report include: (1) the election of officers; (2) the acceptance of the annual report of the events and…
Sadhana | Indian Academy of Sciences
Indian Academy of Sciences (India)
Editorial Board. Sadhana. Editor. N Viswanadham, Indian Institute of Science, Bengaluru. Senior Associate Editors. Arakeri J H, Indian Institute of Science, Bengaluru Hari K V S, Indian Institute of Science, Bengaluru Mujumdar P P, Indian Institute of Science, Bengaluru Manoj Kumar Tiwari, Indian Institute of Technology, ...
77 FR 58356 - Science Advisory Board
2012-09-20
... Atmospheric Administration (NOAA) science programs are of the highest quality and provide optimal support to... terms for the Climate Working Group; and (5) Update from the Research and Development Portfolio Review...
Key Science and Engineering Indicators: 2010 Digest. NSB 10-02
Roesel, Cheryl, Ed.
2010-01-01
The National Science Board (Board) is required under the National Science Foundation (NSF) Act, 42 U.S.C. (United States Code) Section 1863 (j) (1) to prepare and transmit the biennial "Science and Engineering Indicators" ("SEI") report to the President and to the Congress by January 15 of every even-numbered year. The report…
Pharmacology national board examinations: factors that may influence performance.
Neidle, E A; Kahn, N
1977-12-01
Data from a survey of pharmacology courses in 60 dental schools were used to determine whether certain teaching variables affect performance in pharmacology National Board examinations. In addition, three-year class-averaged pharmacology scores and, rarely, one-year averaged scores were correlated with several admissions variables. While correlations between some admissions variables and pharmacology scores were quite good, the averaged pharmacology scores were not powerfully affected by course length, placement of the course in the curriculum, length of the curriculum, or the presence of a dentally trained pharmacologist in the department. It is suggested that other factors, related to the student and his capabilities, influence performance on National Boards. Dental pharmacology courses should be designed to given students the best possible exposure to an important basic science, not to make them perform well on National Boards, because student performance on National Boards may be independent of the nature of the didactic courses.
Extended Meeting of the Editorial Board of the “Golden Horde Review” (Kazan, March 18, 2017
Directory of Open Access Journals (Sweden)
L.S. Giniyatullina
2017-03-01
Full Text Available The extended meeting of the Editorial Board of the “Golden Horde Review” dedicated to the fifth anniversary of the first issue of the journal was held in Kazan on March 18, 2017. Responsible for the journal’s policy reported on the directions of their work with the following reports: Mirgaleev I.M., Cand. Sci. (History, Head of Usmanov Center for Research on the Golden Horde and Tatar Khanates, Sh. Marjani Institute of History of Tatarstan Academy of Sciences, Editor-in-Chief of the journal. Report on the Journal’s Work: Strategic Vision of the Journal’s Development. Khakimov R.S., Dr. Sci. (History, Director of Sh. Marjani Institute of History of Tatarstan Academy of Sciences, Vice President of Tatarstan Academy of Sciences, Academician of Tatarstan Academy of Sciences, Chairman of the Editorial Board. Report on the Editorial Board’s Work. Giniyatullina L.S., Research Fellow of Usmanov Center for Research on the Golden Horde and Tatar Khanates, Sh. Marjani Institute of History of Tatarstan Academy of Sciences, Technical Editor. Plan for the Development of the Site of the Journal. The Role of the Online Version in Promoting the Journal and Its Indexing in Russian and International Scientific Citation Bases. Roman Hautala, Ph.D. (History, Senior Research Fellow of Usmanov Center for Research on the Golden Horde and Tatar Khanates, Sh. Marjani Institute of History of Tatarstan Academy of Sciences; Docent, Department of History, University of Oulu (Finland, English Texts’ Editor. The Development Strategy of the English-Language Part of the Journal. Sayfetdinova E.G., Cand. Sci. (History, Senior Research Fellow of Usmanov Center for Research on the Golden Horde and Tatar Khanates, Sh. Marjani Institute of History of Tatarstan Academy of Sciences, Issuing Editor. Aksanov A.V., Cand. Sci. (History, Senior Research Fellow of Usmanov Center for Research on the Golden Horde and Tatar Khanates, Sh. Marjani Institute of History of Tatarstan
75 FR 59697 - National Sea Grant Advisory Board
2010-09-28
..., science and technology programs, and other matters as described in the agenda found on the National Sea Grant College Program Web site at http://www.seagrant.noaa.gov/leadership/advisory_board.html . DATES... advice. The agenda for this meeting can be found at http://www.seagrant.noaa.gov/leadership/advisory...
76 FR 57023 - National Sea Grant Advisory Board
2011-09-15
..., science and technology programs, and other matters as described in the agenda found on the National Sea Grant College Program Web site at http://www.seagrant.noaa.gov/leadership/advisory_board.html . DATES... advice. The agenda for this meeting can be found at http://www.seagrant.noaa.gov/leadership/advisory...
Preparing for Science at Sea - a Chief Scientists Training Cruise on Board the RV Sikuliaq
Coakley, B.; Pockalny, R. A.
2017-12-01
As part of their education, marine geology and geophysics students spend time at sea, collecting, processing and interpreting data to earn their degrees. While this is a critical component of their preparation, it is an incomplete introduction to the process of doing science at sea. Most students are unfamiliar with the proposal process. Many students spend their time at sea performing assigned tasks without responsibility or participation in cruise planning and execution. In December 2016, we conducted a two-week-long, NSF-funded "Chief Scientist Training Cruise" aboard the R/V Sikuliaq designed to complete their introduction to seagoing science by giving the students the opportunity to plan and execute surveys based hypotheses they formulated. The educational process began with applicants responding to a request for proposals (RFP), which provided a framework for the scientific potential of the cruise. This process continued training through two days of workshops and presentations at the Hawai'i Institute of Geophysics. The students used existing data to define hypotheses, plan surveys, and collect/analyze data to test their hypothesis. The survey design was subject to the time constraints imposed by the ship schedule and the physical constraints imposed by the ship's equipment. The training and sea time made it possible to address all of steps of the scientific process, including proposal writing. Once underway, the combination of conducting the planned surveys and attending daily presentations helped familiarize the students with at-sea operations, the equipment on board the RV Sikuliaq, and the process of writing proposals to NSF for sea-going science. Questionnaires conducted prior to the cruise and in the final days before arriving in port document the success of this training program for developing the abilities and confidence in identifying significant scientific problems, preparing proposals to secure funding, and planning and directing ship surveys.
DEFF Research Database (Denmark)
Minichilli, Alessandro; Zattoni, Alessandro; Nielsen, Sabina
2012-01-01
identify three board processes as micro-level determinants of board effectiveness. Specifically, we focus on effort norms, cognitive conflicts and the use of knowledge and skills as determinants of board control and advisory task performance. Further, we consider how two different institutional settings....... The findings show that: (i) Board processes have a larger potential than demographic variables to explain board task performance; (ii) board task performance differs significantly between boards operating in different contexts; and (iii) national context moderates the relationships between board processes...... and board task performance....
Board and Deans of Amsterdam University, Netherlands
Patrice Loïez
2001-01-01
L. to r.: Dr Thomas Taylor, CERN IT Deputy Division Leader; Prof. Dymph C. van den Boom, Dean Faculty of Social and Behavioural Sciences, Professor in Empirical Thoretical Pedagogy; Prof. Jos Engelen, NIKHEF/University of Amsterdam, Dutch Delegate to the Scientific Policy Committee and Chairman of the LHC Committee; Prof. Jacob van der Gaag, Dean Faculty of Economic Science and Econometry, Professor in Developmenteconomy;Mr Jan van der Boon, CERN Director of Admnistration; Prof. Jan Robert Bausch, Dean Faculty of Dental Medicine, Professor in general Dentistry; Dr Sijbolt J. Noorda, President of the Board of the University of Amsterdam.
Zhu, Yixiao; Jiang, Mingxuan; Ruan, Xiaoke; Chen, Zeyu; Li, Chenjia; Zhang, Fan
2018-05-01
We experimentally demonstrate 6.4 Tb/s wavelength division multiplexed (WDM) direct-detection transmission based on Nyquist twin-SSB modulation over 25 km SSMF with bit error rates (BERs) below the 20% hard-decision forward error correction (HD-FEC) threshold of 1.5 × 10-2. The two sidebands of each channel are separately detected using Kramers-Kronig receiver without MIMO equalization. We also carry out numerical simulations to evaluate the system robustness against I/Q amplitude imbalance, I/Q phase deviation and the extinction ratio of modulator, respectively. Furthermore, we show in simulation that the requirement of steep edge optical filter can be relaxed if multi-input-multi-output (MIMO) equalization between the two sidebands is used.
Spotlight on Ethics: Institutional Review Boards as Systemic Bullies
Carr, Caleb T.
2015-01-01
Bullying, often considered an interpersonal or intergroup behaviour, has not been explored as an unintended artefact of organisational structure. Institutional review boards (IRBs), the 'human research ethics committees' at US universities, help oversee the protection of human research subjects, particularly in the social sciences within…
Planetary protection implementation on future Mars lander missions
Howell, Robert; Devincenzi, Donald L.
1993-01-01
A workshop was convened to discuss the subject of planetary protection implementation for Mars lander missions. It was sponsored and organized by the Exobiology Implementation Team of the U.S./Russian Joint Working Group on Space Biomedical and Life Support Systems. The objective of the workshop was to discuss planetary protection issues for the Russian Mars '94 mission, which is currently under development, as well as for additional future Mars lander missions including the planned Mars '96 and U.S. MESUR Pathfinder and Network missions. A series of invited presentations was made to ensure that workshop participants had access to information relevant to the planned discussions. The topics summarized in this report include exobiology science objectives for Mars exploration, current international policy on planetary protection, planetary protection requirements developed for earlier missions, mission plans and designs for future U.S. and Russian Mars landers, biological contamination of spacecraft components, and techniques for spacecraft bioload reduction. In addition, the recent recommendations of the U.S. Space Studies Board (SSB) on this subject were also summarized. Much of the discussion focused on the recommendations of the SSB. The SSB proposed relaxing the planetary protection requirements for those Mars lander missions that do not contain life detection experiments, but maintaining Viking-like requirements for those missions that do contain life detection experiments. The SSB recommendations were found to be acceptable as a guide for future missions, although many questions and concerns about interpretation were raised and are summarized. Significant among the concerns was the need for more quantitative guidelines to prevent misinterpretation by project offices and better access to and use of the Viking data base of bioassays to specify microbial burden targets. Among the questions raised were how will the SSB recommendations be integrated with existing
Planetary protection implementation on future Mars lander missions
Howell, Robert; Devincenzi, Donald L.
1993-06-01
A workshop was convened to discuss the subject of planetary protection implementation for Mars lander missions. It was sponsored and organized by the Exobiology Implementation Team of the U.S./Russian Joint Working Group on Space Biomedical and Life Support Systems. The objective of the workshop was to discuss planetary protection issues for the Russian Mars '94 mission, which is currently under development, as well as for additional future Mars lander missions including the planned Mars '96 and U.S. MESUR Pathfinder and Network missions. A series of invited presentations was made to ensure that workshop participants had access to information relevant to the planned discussions. The topics summarized in this report include exobiology science objectives for Mars exploration, current international policy on planetary protection, planetary protection requirements developed for earlier missions, mission plans and designs for future U.S. and Russian Mars landers, biological contamination of spacecraft components, and techniques for spacecraft bioload reduction. In addition, the recent recommendations of the U.S. Space Studies Board (SSB) on this subject were also summarized. Much of the discussion focused on the recommendations of the SSB. The SSB proposed relaxing the planetary protection requirements for those Mars lander missions that do not contain life detection experiments, but maintaining Viking-like requirements for those missions that do contain life detection experiments. The SSB recommendations were found to be acceptable as a guide for future missions, although many questions and concerns about interpretation were raised and are summarized. Significant among the concerns was the need for more quantitative guidelines to prevent misinterpretation by project offices and better access to and use of the Viking data base of bio-assays to specify microbial burden targets. Among the questions raised were how will the SSB recommendations be integrated with existing
The CAS-NAS forum for new leaders in space science
Smith, David H.
The space science community is thoroughly international, with numerous nations now capable of launching scientific payloads into space either independently or in concert with others. As such, it is important for national space-science advisory groups to engage with like-minded groups in other spacefaring nations. The Space Studies Board of the US National Academy of Sciences' (NAS') National Research Council has provided scientific and technical advice to NASA for more than 50 years. Over this period, the Board has developed important multilateral and bilateral partnerships with space scientists around the world. The primary multilateral partner is COSPAR, for which the Board serves as the US national committee. The Board's primary bilateral relationship is with the European Science Foundation’s European Space Science Committee. Burgeoning Chinese space activities have resulted in several attempts in the past decade to open a dialogue between the Board and space scientists in China. On each occasion, the external political environment was not conducive to success. The most recent efforts to engage the Chinese space researchers began in 2011 and have proved particularly successful. Although NASA is currently prohibited from engaging in bilateral activities with China, the Board has established a fruitful dialogue with its counterpart in the Chinese Academy of Sciences (CAS). A joint NAS-CAS activity, the Forum for New Leaders in Space Science, has been established to provide opportunities for a highly select group of young space scientists from China and the United States to discuss their research activities in an intimate and collegial environment at meetings to be held in both nations. The presentation will describe the current state of US-China space relations, discuss the goals of the joint NAS-CAS undertaking and report on the activities at the May, 2014, Forum in Beijing and the planning for the November, 2014, Forum in Irvine, California.
Board effectiveness: Investigating payment asymmetry between board members and shareholders
Directory of Open Access Journals (Sweden)
Wuchun Chi
2008-01-01
Full Text Available Board members may well be responsible for dissension between themselves and shareholders since they are simultaneously the setters and receivers of both board remuneration and dividends. They may act out of their own personal interests at the expense of external shareholders. We investigate the impact of ownership structure, board structure and control deviation on payment asymmetry, where excessively high remuneration is paid to board members but considerably lower dividends are distributed to shareholders. We find strong evidence confirming that the smaller the shareholdings of board members and outside blockholders are, the more asymmetric the payments are. With controlling family members on the board and a higher percentage of seats held by independent board members, there is a slight reduction in the likelihood and severity of payment asymmetry. In addition, it is abundantly clear that the larger the board seat-control deviation is, the greater is the likelihood and severity of payment asymmetry. While prior research has primarily focused on board-manager agency issues, the board-shareholder perspective could be even more important in that it is the board that is the most directly delegated agent of shareholders, not the managers
Board of Directors or Supervisory Board
DEFF Research Database (Denmark)
Werlauff, Erik
2009-01-01
The article analyses the legal consequences of the choice now available to Danish public limited companies, which can now opt for a two-tier management structure, in which the management board undertakes both the day-to-day and the overall management, while a supervisory board exercises control...... over the management board, including its appointment and dismissal. The article considers which companies a two-tier structure may be relevant for, and reviews the consequences for the composition, election and functioning of the company organs....
2011-12-21
... Science Research and Development Services Scientific Merit Review Board Panel for Eligibility, Notice of... and Clinical Science Research and Development Services Scientific Merit Review Board will meet on... medical specialties within the general areas of biomedical, behavioral, and clinical science research. The...
76 FR 4299 - National Sea Grant Advisory Board; Meeting
2011-01-25
..., education and extension, science and technology programs, and other matters as described in the agenda found on the National Sea Grant College Program Web site at http://www.seagrant.noaa.gov/leadership... can be found at http://www.seagrant.noaa.gov/leadership/advisory_board.html . Dated: January 19, 2011...
2011-05-03
... Science Research and Development Services Scientific Merit Review Board; Notice of Meeting Amendment The... and Clinical Science Research and Development Services Scientific Merit Review Board have been..., behavioral and clinical science research. The panel meetings will be open to the public for approximately one...
Skip to main content (Press Enter). Toggle navigation Defense Business Board Search Search Defense Business Board: Search Search Defense Business Board: Search Defense Business Board Business Excellence in Defense of the Nation Defense Business Board Home Charter Members Meetings Studies Contact Us The Defense
Patients overwhelmingly prefer inpatient boarding to emergency department boarding.
Viccellio, Peter; Zito, Joseph A; Sayage, Valerie; Chohan, Jasmine; Garra, Gregory; Santora, Carolyn; Singer, Adam J
2013-12-01
Boarding of admitted patients in the emergency department (ED) is a major cause of crowding. One alternative to boarding in the ED, a full-capacity protocol where boarded patients are redeployed to inpatient units, can reduce crowding and improve overall flow. Our aim was to compare patient satisfaction with boarding in the ED vs. inpatient hallways. We performed a structured telephone survey regarding patient experiences and preferences for boarding among admitted ED patients who experienced boarding in the ED hallway and then were subsequently transferred to inpatient hallways. Demographic and clinical characteristics, as well as patient preferences, including items related to patient comfort and safety using a 5-point scale, were recorded and descriptive statistics were used to summarize the data. Of 110 patients contacted, 105 consented to participate. Mean age was 57 ± 16 years and 52% were female. All patients were initially boarded in the ED in a hallway before their transfer to an inpatient hallway bed. The overall preferred location after admission was the inpatient hallway in 85% (95% confidence interval 75-90) of respondents. In comparing ED vs. inpatient hallway boarding, the following percentages of respondents preferred inpatient boarding with regard to the following 8 items: rest, 85%; safety, 83%; confidentiality, 82%; treatment, 78%; comfort, 79%; quiet, 84%; staff availability, 84%; and privacy, 84%. For no item was there a preference for boarding in the ED. Patients overwhelmingly preferred the inpatient hallway rather than the ED hallway when admitted to the hospital. Copyright © 2013 Elsevier Inc. All rights reserved.
Space science in the twenty-first century: imperatives for the decades 1995 to 2015 : life sciences
National Research Council Canada - National Science Library
1988-01-01
Early in 1984, NASA asked the Space Science Board to undertake a study to determine the principal scientific issues that the disciplines of space science would face during the period from about 1995 to 2015...
Energy Technology Data Exchange (ETDEWEB)
Jon Eisenberg, Director, CSTB
2008-05-13
The Computer Science and Telecommunications Board of the National Research Council considers technical and policy issues pertaining to computer science (CS), telecommunications, and information technology (IT). The functions of the board include: (1) monitoring and promoting the health of the CS, IT, and telecommunications fields, including attention as appropriate to issues of human resources and funding levels and program structures for research; (2) initiating studies involving CS, IT, and telecommunications as critical resources and sources of national economic strength; (3) responding to requests from the government, non-profit organizations, and private industry for expert advice on CS, IT, and telecommunications issues; and to requests from the government for expert advice on computer and telecommunications systems planning, utilization, and modernization; (4) fostering interaction among CS, IT, and telecommunications researchers and practitioners, and with other disciplines; and providing a base of expertise in the National Research Council in the areas of CS, IT, and telecommunications. This award has supported the overall operation of CSTB. Reports resulting from the Board's efforts have been widely disseminated in both electronic and print form, and all CSTB reports are available at its World Wide Web home page at cstb.org. The following reports, resulting from projects that were separately funded by a wide array of sponsors, were completed and released during the award period: 2007: * Summary of a Workshop on Software-Intensive Systems and Uncertainty at Scale * Social Security Administration Electronic Service Provision: A Strategic Assessment * Toward a Safer and More Secure Cyberspace * Software for Dependable Systems: Sufficient Evidence? * Engaging Privacy and Information Technology in a Digital Age * Improving Disaster Management: The Role of IT in Mitigation, Preparedness, Response, and Recovery 2006: * Renewing U.S. Telecommunications
Proceedings – Mathematical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Proceedings – Mathematical Sciences. Current Issue : Vol. 128, Issue 1. Current Issue Volume 128 | Issue 1. March 2018. Home · Volumes & Issues · Special Issues · Forthcoming Articles · Search · Editorial Board · Information for Authors · Subscription ...
Journal of Chemical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Journal of Chemical Sciences. Current Issue : Vol. 130, Issue 3 · Current Issue Volume 130 | Issue 3. March 2018. Home · Volumes & Issues · Special Issues · Forthcoming Articles · Search · Editorial Board · Information for Authors · Subscription ...
Journal of Chemical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Journal of Chemical Sciences. Current Issue : Vol. 130, Issue 4. Current Issue Volume 130 | Issue 4. April 2018. Home · Volumes & Issues · Special Issues · Forthcoming Articles · Search · Editorial Board · Information for Authors · Subscription ...
Proceedings – Mathematical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Proceedings – Mathematical Sciences. Current Issue : Vol. 128, Issue 2. Current Issue Volume 128 | Issue 2. April 2018. Home · Volumes & Issues · Special Issues · Forthcoming Articles · Search · Editorial Board · Information for Authors · Subscription ...
Proceedings – Mathematical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Proceedings – Mathematical Sciences. Current Issue : Vol. 128, Issue 1 · Current Issue Volume 128 | Issue 1. March 2018. Home · Volumes & Issues · Special Issues · Forthcoming Articles · Search · Editorial Board · Information for Authors · Subscription ...
Journal of Chemical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Journal of Chemical Sciences. Current Issue : Vol. 130, Issue 4 · Current Issue Volume 130 | Issue 4. April 2018. Home · Volumes & Issues · Special Issues · Forthcoming Articles · Search · Editorial Board · Information for Authors · Subscription ...
Board members’ contribution to strategy: The mediating role of board internal processes
Directory of Open Access Journals (Sweden)
Carmen Barroso-Castro
2017-05-01
Full Text Available This study aims to explore what directors do on the board, to what extent the processes occurring in the board allow the sharing and integrating of the existing knowledge, thus facilitating the board members’ contributions to strategy. We adopt the view that the internal board processes increase the impact of the cognitive resources on board performance. Using survey data from 200 large Spanish companies we demonstrate that directors’ level of knowledge of the firm and board job-related diversity positively influence the degree of the board's strategic involvement. Additionally, the internal processes that take place within the board – particularly Cognitive Conflict, the Critical and Independent Approach and the Comprehensive Discussion Process – influence the board's strategic involvement and play a partial mediating role on the aforementioned relationships. However, our results show no evidence for a positive relationship between Board Meeting Dynamics and the board's strategic involvement.
An Integrated Science Glovebox for the Gateway Habitat
Calaway, M. J.; Evans, C. A.; Garrison, D. H.; Bell, M. S.
2018-01-01
Next generation habitats for deep space exploration of cislunar space, the Moon, and ultimately Mars will benefit from on-board glovebox capability. Such a glovebox facility will maintain sample integrity for a variety of scientific endeavors whether for life science, materials science, or astromaterials. Glovebox lessons learned from decades of astromaterials curation, ISS on-board sample handling, and robust analog missions provide key design and operational factors for inclusion in on-going habitat development.
Using Arduino microcontroller boards to measure response latencies.
Schubert, Thomas W; D'Ausilio, Alessandro; Canto, Rosario
2013-12-01
Latencies of buttonpresses are a staple of cognitive science paradigms. Often keyboards are employed to collect buttonpresses, but their imprecision and variability decreases test power and increases the risk of false positives. Response boxes and data acquisition cards are precise, but expensive and inflexible, alternatives. We propose using open-source Arduino microcontroller boards as an inexpensive and flexible alternative. These boards connect to standard experimental software using a USB connection and a virtual serial port, or by emulating a keyboard. In our solution, an Arduino measures response latencies after being signaled the start of a trial, and communicates the latency and response back to the PC over a USB connection. We demonstrated the reliability, robustness, and precision of this communication in six studies. Test measures confirmed that the error added to the measurement had an SD of less than 1 ms. Alternatively, emulation of a keyboard results in similarly precise measurement. The Arduino performs as well as a serial response box, and better than a keyboard. In addition, our setup allows for the flexible integration of other sensors, and even actuators, to extend the cognitive science toolbox.
AMIE Camera System on board SMART-1
Josset, J. L.; Beauvivre, S.; Amie Team
The Advanced Moon micro-Imager Experiment AMIE on board ESA SMART-1 the first European mission to the Moon launched on 27th September 2003 is an imaging system with scientific technical and public outreach oriented objectives The science objectives are to image the Lunar Poles permanent shadow areas ice deposit eternal light crater rims ancient Lunar Non-mare volcanism local spectro-photometry and physical state of the lunar sur-face and to map high latitudes regions south mainly at far side South Pole Aitken basin The technical objectives are to perform a laserlink experiment detec-tion of laser beam emitted by ESA Tenerife ground station flight demonstration of new technologies and on-board autonomy navigation The public outreach and educational objectives are to promote planetary exploration We present the AMIE instrument and perfomances with respect to the first results
International Nuclear Information System (INIS)
1996-04-01
An electrical accident was investigated in which a crafts person received serious injuries as a result of coming into contact with a 13.2 kilovolt (kV) electrical cable in the basement of Building 209 in Technical Area 21 (TA-21-209) in the Tritium Science and Fabrication Facility (TSFF) at Los Alamos National Laboratory (LANL). In conducting its investigation, the Accident Investigation Board used various analytical techniques, including events and causal factor analysis, barrier analysis, change analysis, fault tree analysis, materials analysis, and root cause analysis. The board inspected the accident site, reviewed events surrounding the accident, conducted extensive interviews and document reviews, and performed causation analyses to determine the factors that contributed to the accident, including any management system deficiencies. Relevant management systems and factors that could have contributed to the accident were evaluated in accordance with the guiding principles of safety management identified by the Secretary of Energy in an October 1994 letter to the Defense Nuclear Facilities Safety Board and subsequently to Congress
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-04-01
An electrical accident was investigated in which a crafts person received serious injuries as a result of coming into contact with a 13.2 kilovolt (kV) electrical cable in the basement of Building 209 in Technical Area 21 (TA-21-209) in the Tritium Science and Fabrication Facility (TSFF) at Los Alamos National Laboratory (LANL). In conducting its investigation, the Accident Investigation Board used various analytical techniques, including events and causal factor analysis, barrier analysis, change analysis, fault tree analysis, materials analysis, and root cause analysis. The board inspected the accident site, reviewed events surrounding the accident, conducted extensive interviews and document reviews, and performed causation analyses to determine the factors that contributed to the accident, including any management system deficiencies. Relevant management systems and factors that could have contributed to the accident were evaluated in accordance with the guiding principles of safety management identified by the Secretary of Energy in an October 1994 letter to the Defense Nuclear Facilities Safety Board and subsequently to Congress.
Socio-economic Survey of Commercial Fishing Crew in the Northeast
National Oceanic and Atmospheric Administration, Department of Commerce — The Northeast Fisheries Science Center's Social Sciences Branch (SSB) completed a survey of crew, including hired captains, participating in commercial fisheries in...
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Journal of Earth System Science. Current Issue : Vol. 127, Issue 2. Current Issue Volume 127 | Issue 2. March 2018. Home · Volumes & Issues · Special Issues · Forthcoming Articles · Search · Editorial Board · Information for Authors · Subscription ...
National board certification as professional development: What are teachers learning?
Lustick, David Scott
This study investigated the National Board for Professional Teaching Standards' (NBPTS) assessment process in order to identify, quantify, and substantiate possible learning outcomes from the participants. One hundred and twenty candidates for the Adolescent and Young Adult Science (AYA Science) Certificate were studied over a 2-year period using the recurrent institutional cycle research design. This quasi-experimental methodology allowed for the collection of both cross-sectional and longitudinal data insuring a good measure of internal validity regarding observed changes both between and within group means. Multiple assessors scored transcripts of structured interviews with each teacher using the NBPTS' assessment framework according to the 13 standards accomplished science teaching. The scores (aggregated to the group level) provided the quantitative evidence of teacher learning in this study. Significant changes in mean scores from pre to post are reported at the overall, standard group, and individual standard levels. Findings suggest that the intervention had an overall effect size of .475 upon candidates' understanding of science teaching related knowledge. More specifically, most learning was associated with the standards of Scientific Inquiry and Assessment. The results support the hypothesis that the certification process is an effective standards based professional learning opportunity. The learning outcomes discussed in this report (including the identification of Dynamic, Technical, and Deferred Learning categories) should inform debate between educational stakeholders regarding the financial and ideological support of National Board certification as a means of improving teacher quality, provide suggestions for the improvement of the assessment process, and contribute insight into the current divisive state of science education in public education.
78 FR 66384 - Membership of the Merit Systems Protection Board's Performance Review Board
2013-11-05
... MERIT SYSTEMS PROTECTION BOARD Membership of the Merit Systems Protection Board's Performance Review Board AGENCY: Merit Systems Protection Board. ACTION: Notice. SUMMARY: Notice is hereby given of the members of the Merit Systems Protection Board's Performance Review Board. DATES: November 5, 2013...
2012-05-02
... DEPARTMENT OF VETERANS AFFAIRS Joint Biomedical Laboratory Research and Development and Clinical Science Research and Development Services Scientific Merit Review Board, Notice of Meeting Amendment The... Development and Clinical Science Research and Development Services Scientific Merit Review Board have changed...
Socio-economic Survey of Commercial Fishing Vessel Owners in the Northeast
National Oceanic and Atmospheric Administration, Department of Commerce — The Northeast Fisheries Science Center's Social Sciences Branch (SSB) conducted a survey of vessel owners participating in commercial fisheries in the New England...
Hospital board effectiveness: relationships between board training and hospital financial viability.
Molinari, C; Morlock, L; Alexander, J; Lyles, C A
1992-01-01
This study examined whether hospital governing boards that invest in board education and training are more informed and effective decision-making bodies. Measures of hospital financial viability (i.e., selected financial ratios and outcomes) are used as indicators of hospital board effectiveness. Board participation in educational programs was significantly associated with improved profitability, liquidity, and occupancy levels, suggesting that investment in the education of directors is likely to enhance hospital viability and thus increase board effectiveness.
A series of presentations from EPA's Board of Science Councilors review in April 2005 and the Science Forum in May 2005 are being made available to the Regional Planning Organization conference on June 9-10, 2005. Attendees will be able to review the materials during the confere...
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Journal of Earth System Science. Current Issue : Vol. 127, Issue 3 · Current Issue Volume 127 | Issue 3. April 2018. Home · Volumes & Issues · Special Issues · Forthcoming Articles · Search · Editorial Board · Information for Authors · Subscription ...
76 FR 2107 - Human Studies Review Board; Notice of Public Meeting
2011-01-12
... ENVIRONMENTAL PROTECTION AGENCY [EPA-HQ-ORD-2011-0970; FRL-9252-3] Human Studies Review Board; Notice of Public Meeting AGENCY: Environmental Protection Agency (EPA). ACTION: Notice. SUMMARY: The U.S. Environmental Protection Agency (EPA or Agency) Office of the Science Advisor (OSA) announces a public meeting...
75 FR 32461 - Human Studies Review Board; Notice of Public Meeting
2010-06-08
... ENVIRONMENTAL PROTECTION AGENCY [EPA-HQ-ORD-2010-0381; FRL-9159-9] Human Studies Review Board; Notice of Public Meeting AGENCY: Environmental Protection Agency (EPA). ACTION: Notice. SUMMARY: The U.S. Environmental Protection Agency's (EPA or Agency) Office of the Science Advisor (OSA) announces a public meeting...
75 FR 61748 - Human Studies Review Board; Notice of Public Meeting
2010-10-06
... ENVIRONMENTAL PROTECTION AGENCY [EPA-HQ-ORD-2010-0797' FRL-9211-1] Human Studies Review Board; Notice of Public Meeting AGENCY: Environmental Protection Agency (EPA). ACTION: Notice. SUMMARY: The U.S. Environmental Protection Agency (EPA or Agency) Office of the Science Advisor (OSA) announces a public meeting...
Ekuri, Emmanuel Etta
2012-01-01
The Cross River State Science and Technical Education Project was introduced in 1992 by edict number 9 of 20 December 1991, "Cross River State Science and Technical Education Board Edit, 20 December, 1991", with the aim of improving the quality of science teaching and learning in the state. As the success of the project depends…
75 FR 71465 - National Science Board; Sunshine Act Meetings
2010-11-23
...'s Remarks. NSB Action Items: Science of Learning Centers: Extension of Funding for Two Centers. [cir] Learning in Informal and Formal Environments (LIFE) Center. [cir] Center of Excellence for Learning in... two Science of Learning Centers. Closed Committee Reports. Plenary Open Session: 1 p.m.-3 p.m., Room...
High-Speed On-Board Data Processing Platform for LIDAR Projects at NASA Langley Research Center
Beyon, J.; Ng, T. K.; Davis, M. J.; Adams, J. K.; Lin, B.
2015-12-01
The project called High-Speed On-Board Data Processing for Science Instruments (HOPS) has been funded by NASA Earth Science Technology Office (ESTO) Advanced Information Systems Technology (AIST) program during April, 2012 - April, 2015. HOPS is an enabler for science missions with extremely high data processing rates. In this three-year effort of HOPS, Active Sensing of CO2 Emissions over Nights, Days, and Seasons (ASCENDS) and 3-D Winds were of interest in particular. As for ASCENDS, HOPS replaces time domain data processing with frequency domain processing while making the real-time on-board data processing possible. As for 3-D Winds, HOPS offers real-time high-resolution wind profiling with 4,096-point fast Fourier transform (FFT). HOPS is adaptable with quick turn-around time. Since HOPS offers reusable user-friendly computational elements, its FPGA IP Core can be modified for a shorter development period if the algorithm changes. The FPGA and memory bandwidth of HOPS is 20 GB/sec while the typical maximum processor-to-SDRAM bandwidth of the commercial radiation tolerant high-end processors is about 130-150 MB/sec. The inter-board communication bandwidth of HOPS is 4 GB/sec while the effective processor-to-cPCI bandwidth of commercial radiation tolerant high-end boards is about 50-75 MB/sec. Also, HOPS offers VHDL cores for the easy and efficient implementation of ASCENDS and 3-D Winds, and other similar algorithms. A general overview of the 3-year development of HOPS is the goal of this presentation.
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Earth System Science; Volume 123; Issue 4 .... Hydrologic modelling of the effect of snowmelt and temperature on a ... Spatial control of groundwater contamination, using principal component analysis ..... Forthcoming Articles · Search · Editorial Board · Information for Authors · Subscription ...
77 FR 71453 - National Science Board; Sunshine Act Meetings; Notice
2012-11-30
... December 4, 2012 8:00-8:05 a.m. (Chairman's introduction) 8:05 a.m.-12:00 p.m. (CPP) 1:30-2:00 p.m... Committee on Science & Engineering Indicators (SEI) Open Session: 3:45-5:00 p.m. Chairman's Remarks Approval... Science and Engineering Indicators 2014 Narrative Chapter Outlines Update on Science and Engineering...
77 FR 41204 - Sunshine Act Meetings; National Science Board
2012-07-12
... Activities Introduction of Chapter Authors and Discussion of Science and Engineering Indicators 2014... introduction) 8:20-8:30 a.m. (SCF) 8:30-11:00 a.m. (previously noticed continuation of CPP meeting) 11:00-11:45... Chairman's Closing Remarks Committee on Science & Engineering Indicators (SEI) Open Session: 1:30-4:00 p.m...
The dBoard: a Digital Scrum Board for Distributed Software Development
DEFF Research Database (Denmark)
Esbensen, Morten; Tell, Paolo; Cholewa, Jacob Benjamin
2015-01-01
In this paper we present the dBoard - a digital Scrum Board for distributed Agile software development teams. The dBoard is designed as a 'virtual window' between two Scrum team spaces. It connects two locations with live video and audio, which is overlaid with a synchronized and interactive...... digital Scrum board, and it adapts the fidelity of the video/audio to the presence of people in front of it. The dBoard is designed to work (i) as a passive information radiator from which it is easy to get an overview of the status of work, (ii) as a media space providing awareness about the presence...... of remote co-workers, and (iii) as an active meeting support tool. The paper presents a case study of distributed Scrum in a large software company that motivates the design of the dBoard, and details the design and technical implementation of the dBoard. The paper also reports on an initial user study...
Bethard, Jonathan D
2017-01-01
The history of forensic anthropology has been documented by numerous scholars. These contributions have described the work of early pioneers in the field and have described important milestones, such as the founding of the Physical Anthropology Section of the American Academy of Forensic Sciences (AAFS) in 1972 and the American Board of Forensic Anthropology (ABFA) in 1977. This paper contributes to the growing literature on the history of forensic anthropology by documenting the academic training of all individuals who have been granted diplomate status by the ABFA (n = 115). Doctoral dissertation titles were queried to discern broad patterns of research foci. A total of 39 doctoral granting institutions have trained diplomates and 77.3% of board-certified forensic anthropologists wrote dissertations involving skeletal biology, bioarchaeology, or forensic anthropology. Board-certified forensic anthropologists are a broadly trained group of professionals with far-reaching anthropological interests and expertise. © 2016 American Academy of Forensic Sciences.
National Board Certification as Professional Development: What Are Teachers Learning?
Directory of Open Access Journals (Sweden)
David Lustick
2006-02-01
Full Text Available This study investigated the National Board for Professional Teaching Standards’ (NBPTS assessment process in order to identify, quantify, and substantiate learning outcomes from the participants. One hundred and twenty candidates for the Adolescent and Young Adult Science (AYA Science Certificate were studied over a two-year period using the recurrent institutional cycle research design. This quasi-experimental methodology allowed for the collection of both cross-sectional and longitudinal data insuring a good measure of internal validity regarding observed changes between individual and across group means. Transcripts of structured interviews with each teacher were scored by multiple assessors according to the 13 standards of NBPTS’ framework for accomplished science teaching. These scores provided the quantitative evidence of teacher learning in this study. Significant pre-intervention to post-intervention changes to these individual and group means are reported as learning outcomes from the assessment process. Findings suggest that the intervention had significant impact upon candidates’ understanding of knowledge associated with science teaching with an overall effect size of 0.47. Standards associated with greatest gains include Scientific Inquiry and Assessment. The results support the claim that the certification process is an effective standards based professional learning opportunity comparable to other human improvement interventions from related domains. Drawing on qualitative data, we also explore three possible implications of teacher learning outcomes from certification upon classroom practice identified as Dynamic, Technical, and Deferred. These patterns suggest that more than one kind of learning may be taking place in relation to board certification. The discussion then considers the importance of this study for policy making and science teaching communities.
76 FR 77825 - Human Studies Review Board; Notification of a Public Teleconference
2011-12-14
... ENVIRONMENTAL PROTECTION AGENCY [EPA-HQ-ORD-2011-0953; FRL-9506-6] Human Studies Review Board; Notification of a Public Teleconference AGENCY: Environmental Protection Agency. ACTION: Notice. SUMMARY: The EPA Office of the Science Advisor announces a public teleconference of the HSRB to discuss its draft...
76 FR 57026 - Air Force Scientific Advisory Board Notice of Meeting
2011-09-15
... open to the public. The meeting on Thursday, 14 October, will be from 8 a.m.-11:30 a.m. and closed to... Board; Air Force Global Strike Command overview highlighting high priority capability gaps and technology solution partnerships; Air Force Research Laboratory overview focusing on the Air Force Science...
[Geotechnical Board activities and funding]. [Annual] activites report, July 1, 1992--June 30, 1993
Energy Technology Data Exchange (ETDEWEB)
Smeallie, P.H.
1993-07-23
The Geotechnical Board, a part of the US National Research Council, which is the operating arm of the National Academy of Sciences and the National Academy of Engineering, serves to advise the federal government and others on issues where geotechnology can have an impact, such as environmental remediation and infrastructure development. The board met three times during the reporting period to review current projects and to initiate activities that move the knowledge base of geotechnology forward. The board operates with two long-standing national committees, the US National Committee for Rock Mechanics and the US National Committee on Tunneling Technology. It also conducts special studies at the request of the government. A list of attachments is given.
International Nuclear Information System (INIS)
Brennan, N.S.
1982-01-01
A board game comprises a board, a number of counters and two dice. The board is marked to provide a central area, representing the nucleus of an atom, and six or more annular rings extending concentrically around the central area, the rings being divided into 2,8,18,32,48 and 72 squares. Each ring represents an electron shell, and some of the squares are numbered, the number representing the atomic number of different elements. (author)
Development of an Adjustable board and a Rotational Board for Scaffold
Jang, Myunghoun
2017-06-01
Scaffold is widely used in high work-places inside and outside of a building construction site. It is inexpensive and is installed and dismantled easily. Although standards and ledgers of a steel tube and coupler scaffold are installed in a regular distance, the distances of transoms are not equal in some places. Sometimes a working platform or a board is absent in the corner of scaffold. This may cause safety accidents because a foothold is not stable on the transoms. An adjustable safety board and a rotational safety board are suggested in this paper. The adjustable board consists of two footholds. The small one is inserted into the large one. The rotational board covers not only right angle but also acute or obtuse angles. These safety boards for scaffold help to decrease safety accidents in construction sites.
A new era in sports science: the launch of BMC Sports Science, Medicine and Rehabilitation
Moylan, Elizabeth C; Horne, Genevieve
2013-01-01
This Editorial celebrates the launch of BMC Sports Science, Medicine and Rehabilitation within the BMC series of journals published by BioMed Central. BMC Sports Science, Medicine and Rehabilitation incorporates the recently closed Sports Medicine, Arthroscopy, Rehabilitation, Therapy & Technology (SMARTT) with an expanded scope and Editorial Board. BMC Sports Science, Medicine and Rehabilitation will fill its own niche in the BMC series alongside other companion journals including BMC Physio...
Fermilab Friends for Science Education | Programs | Past Donors
Fermilab Friends for Science Education FFSE Home About Us Join Us Support Us Contact Us Our Donors Testimonials Our Donors Board of Directors Board Tools Calendar Join Us Donate Now Get FermiGear! Education DuPage Area Occupational Education Systems Technology Center DuPage/Kane Educational Service Center Fermi
2010-01-01
... and Orders; Milk), DEPARTMENT OF AGRICULTURE FLUID MILK PROMOTION PROGRAM Fluid Milk Promotion Order Definitions § 1160.105 Board. Board means the National Processor Advertising and Promotion Board established... Promotion Board or Board). ...
A new era in sports science: the launch of BMC Sports Science, Medicine and Rehabilitation.
Moylan, Elizabeth C; Horne, Genevieve
2013-03-28
This Editorial celebrates the launch of BMC Sports Science, Medicine and Rehabilitation within the BMC series of journals published by BioMed Central. BMC Sports Science, Medicine and Rehabilitation incorporates the recently closed Sports Medicine, Arthroscopy, Rehabilitation, Therapy & Technology (SMARTT) with an expanded scope and Editorial Board. BMC Sports Science, Medicine and Rehabilitation will fill its own niche in the BMC series alongside other companion journals including BMC Physiology, BMC Musculoskeletal Disorders and BMC Surgery.
Studying Students' Science Literacy: Non-Scientific Beliefs and Science Literacy Measures
Impey, C.; Buxner, S.
2015-11-01
We have been conducting a study of university students' science literacy for the past 24 years. Based on the work of the National Science Board's ongoing national survey of the US public, we have administered the same survey to undergraduate science students at the University of Arizona almost every year since 1989. Results have shown relatively little change in students' overall science literacy, descriptions of science, and knowledge of basic science topics for almost a quarter of a century despite an increase in education interventions, the rise of the internet, and increased access to knowledge. Several trends do exist in students' science literacy and descriptions of science. Students who exhibit beliefs in non-scientific phenomenon (e.g., lucky numbers, creationism) consistently have lower science literacy scores and less correct descriptions of scientific phenomenon. Although not surprising, our results support ongoing efforts to help students generate evidence based thinking.
Tomizawa, Yasuko
2014-02-01
Japan ranks extremely low in global ranking of gender equality. It is not easy for female doctors to acquire leadership positions in member societies of the Japanese Association of Medical Science (JAMS). Very few women are included on editorial boards of English medical journals in Japan. Furthermore, until last year, there had been no female editors in English language journals of surgical societies. The qualifications and criteria for selecting editorial board members of medical journals should be clarified. Medical journals in Japan would gain diversity by including women on editorial boards in the same proportion as women membership in the corresponding medical societies.
78 FR 18978 - Human Studies Review Board; Notification of a Public Webinar/Teleconference
2013-03-28
... ENVIRONMENTAL PROTECTION AGENCY [EPA-HQ-ORD-2013-0115; FRL 9794-8] Human Studies Review Board; Notification of a Public Webinar/ Teleconference AGENCY: U. S. Environmental Protection Agency (EPA). ACTION: Notice. SUMMARY: The EPA Office of the Science Advisor announces a public Webinar/teleconference of the...
Büchner, Vera Antonia; Schreyögg, Jonas; Schultz, Carsten
2014-01-01
The appropriate governance of hospitals largely depends on effective cooperation between governing boards and hospital management. Governing boards play an important role in strategy-setting as part of their support for hospital management. However, in certain situations, this active strategic role may also generate discord within this relationship. The objective of this study is to investigate the impact of the roles, attributes, and processes of governing boards on hospital performance. We examine the impact of the governing board's strategy-setting role on board-management collaboration quality and on financial performance while also analyzing the interaction effects of board diversity and board activity level. The data are derived from a survey that was sent simultaneously to German hospitals and their associated governing board, combined with objective performance information from annual financial statements and quality reports. We use a structural equation modeling approach to test the model. The results indicate that different board characteristics have a significant impact on hospital performance (R = .37). The strategy-setting role and board-management collaboration quality have a positive effect on hospital performance, whereas the impact of strategy-setting on collaboration quality is negative. We find that the positive effect of strategy-setting on performance increases with decreasing board diversity. When board members have more homogeneous backgrounds and exhibit higher board activity levels, the negative effect of the strategy-setting on collaboration quality also increases. Active strategy-setting by a governing board may generally improve hospital performance. Diverse members of governing boards should be involved in strategy-setting for hospitals. However, high board-management collaboration quality may be compromised if managerial autonomy is too highly restricted. Consequently, hospitals should support board-management collaboration about
Model Debate for the Yellow Book Learning in Islamic Boarding School
Apdoludin; Saidek, Abdul Rahim; Islami, Raisul
2016-01-01
This study aimed to determine the effect model of debate in the yellow book learning in schools to improve students' critical thinking skills so they can find a new science. This study was an experimental study with a control group. The study was conducted in classes XI Islamic Boarding School Al-Hidayah Jambi. This study uses two parallel…
Florida SpringBoard® Schools Efficacy Study. Statistical Report 2015-1
Niu, Sunny; Li, Jun; Merriman, Jennifer; Matos-Elefonte, Haifa
2015-01-01
In this study, we compare SpringBoard® (SB) schools that had continuously used the SB English Language Arts (ELA) curriculum for at least three years with comparable non-SB schools. For high schools, the outcomes examined were school-level AP® participation and performance for a) all AP subjects, b) ELA and social science AP subjects, and c) ELA…
Mountford, Meredith
2004-01-01
The qualitative study presented in this article explores motivations for school board membership and conceptions of power held by school board members. The findings of the study suggest a relationship exists between the way board members define power and the type of motivation board members have for service. The implications of these findings for…
2012-01-18
... FARM CREDIT SYSTEM INSURANCE CORPORATION Board Meeting AGENCY: Farm Credit System Insurance Corporation Board; Regular Meeting. SUMMARY: Notice is hereby given of the regular meeting of the Farm Credit System Insurance Corporation Board (Board). DATE AND TIME: The meeting of the Board will be held at the...
75 FR 51291 - National Science Board: Sunshine Act Meetings; Notice
2010-08-19
... Engineering Indicators 2012. Introduction of Chapter Authors and Discussion of Science and Engineering.... Introduction of Chapter Authors and Discussion of Science and Engineering Indicators 2012. Narrative Chapter... Chairman's Introduction Open Session: 7:30 a.m.-7:35 a.m., Room 1235 Committee on Programs and Plans (CPP...
77 FR 15099 - Human Studies Review Board; Notification of a Public Webinar/Teleconference
2012-03-14
... ENVIRONMENTAL PROTECTION AGENCY [EPA-HQ-ORD-2012-0175; FRL-9647-2] Human Studies Review Board; Notification of a Public Webinar/ Teleconference AGENCY: U. S. Environmental Protection Agency. ACTION: Notice. SUMMARY: The EPA Office of the Science Advisor announces a public Webinar/teleconference of the HSRB to...
Does Board Diversity Really Matter?
DEFF Research Database (Denmark)
Rose, Caspar; Munch-Madsen, Peter; Funch, Maja
2013-01-01
We study the impact of female board representation as well as citizenship on corporate performance based on a sample of the largest listed firms in the Nordic countries as well as Germany. We also seek to determine the variation of board structures using factor analysis. We find no support for any...... performance impact relating to female board representation. However, we find an impact of board citizenship on performance showing that board members with a background from common law have a significant positive influence on corporate performance measured as ROA, ROE and ROCE. Consistent with other studies we...... also document that large boards impact corporate performance negatively. Moreover we also show that data set on boards can be explained by four underlying factors. This article adds insight to board determinants of corporate performance as well as the classification of board variation. Specifically...
Ford-Eickhoff, Karen; Plowman, Donde Ashmos; McDaniel, Reuben R
2011-01-01
Despite pressures to change the role of hospital boards, hospitals have made few changes in board composition or director selection criteria. Hospital boards have often continued to operate in their traditional roles as either "monitors" or "advisors." More attention to the direct involvement of hospital boards in the strategic decision-making process of the organizations they serve, the timing and circumstances under which board involvement occurs, and the board composition that enhances their abilities to participate fully is needed. We investigated the relationship between broader expertise among hospital board members, board involvement in the stages of strategic decision making, and the hospital's strategic focus. We surveyed top management team members of 72 nonacademic hospitals to explore the participation of critical stakeholder groups such as the board of directors in the strategic decision-making process. We used hierarchical regression analysis to explore our hypotheses that there is a relationship between both the nature and involvement of the board and the hospital's strategic orientation. Hospitals with broader expertise on their boards reported an external focus. For some of their externally-oriented goals, hospitals also reported that their boards were involved earlier in the stages of decision making. In light of the complex and dynamic environment of hospitals today, those charged with developing hospital boards should match the variety in the external issues that the hospital faces with more variety in board makeup. By developing a board with greater breadth of expertise, the hospital responds to its complex environment by absorbing that complexity, enabling a greater potential for sensemaking and learning. Rather than acting only as monitors and advisors, boards impact their hospitals' strategic focus through their participation in the strategic decision-making process.
Particle Board and Oriented Strand Board Prepared with Nanocellulose-Reinforced Adhesive
Directory of Open Access Journals (Sweden)
Stefan Veigel
2012-01-01
Full Text Available Adhesives on the basis of urea-formaldehyde (UF and melamine-urea-formaldehyde (MUF are extensively used in the production of wood-based panels. In the present study, the attempt was made to improve the mechanical board properties by reinforcing these adhesives with cellulose nanofibers (CNFs. The latter were produced from dissolving grade beech pulp by a mechanical homogenization process. Adhesive mixtures with a CNF content of 0, 1, and 3 wt% based on solid resin were prepared by mixing an aqueous CNF suspension with UF and MUF adhesives. Laboratory-scale particle boards and oriented strand boards (OSBs were produced, and the mechanical and fracture mechanical properties were investigated. Particle boards prepared with UF containing 1 wt% CNF showed a reduced thickness swelling and better internal bond and bending strength than boards produced with pure UF. The reinforcing effect of CNF was even more obvious for OSB where a significant improvement of strength properties of 16% was found. For both, particle board and OSB, mode I fracture energy and fracture toughness were the parameters with the greatest improvement indicating that the adhesive bonds were markedly toughened by the CNF addition.
14 CFR 250.5 - Amount of denied boarding compensation for passengers denied boarding involuntarily.
2010-01-01
... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Amount of denied boarding compensation for passengers denied boarding involuntarily. 250.5 Section 250.5 Aeronautics and Space OFFICE OF THE SECRETARY... boarding compensation for passengers denied boarding involuntarily. (a) Subject to the exceptions provided...
Musso, Carlo
2002-03-01
Italy came in the space business in 1963, being the third nation in the world, after the Soviet Union and the United States, to put an artificial satellite into orbit. In 1988 the Italian Space Agency (ASI) was constituted, with the mandate of planning, coordinating and executing civil space activities in Italy. The core of national space activities is science, for which Italy spends about 25% of the ASI budget, both in national and international programs. The community served by the scientific directorate of ASI is a very wide one, ranging from the science of the Universe and the exploration of the Solar System to life sciences, from Earth observation to the development of new technologies. The success of Italian space research appears under many different points of view. The national satellite BeppoSAX, named after Giuseppe Beppo Occhialini, widely contributed to solve the γ-ray burst puzzle, obtaining the relevant acknowledgment of the ``Bruno Rossi Prize''. Italian researchers kept the PI-ship of various payloads on board ESA missions, such as Epic for XMM-Newton, Ibis for Integral, Virtis and Giada for Rosetta, PFS and Marsis for Mars Express. Also in the field of the cosmic microwave background (CMB) two important experiments are foreseen in the next future, with Italian PIs: SPOrt on board the International Space Station, dedicated to the polarization of CMB, and LFI (Low Frequency Instrument) on board the ESA Planck satellite, to study CMB anisotropy. Meanwhile, a great success has been obtained with the balloon experiment Boomerang. Moreover, ASI started a national scientific and technological small mission program. The first three missions are on their way: Agile (a γ-ray observatory), David (an experiment to test very high frequency data transmission), and a third one, devoted to Earth science. .
Refinement of boards' role required.
Umbdenstock, R J
1987-01-01
The governing board's role in health care is not changing, but new competitive forces necessitate a refinement of the board's approach to fulfilling its role. In a free-standing, community, not-for-profit hospital, the board functions as though it were the "owner." Although it does not truly own the facility in the legal sense, the board does have legal, fiduciary, and financial responsibilities conferred on it by the state. In a religious-sponsored facility, the board fulfills these same obligations on behalf of the sponsoring institute, subject to the institute's reserved powers. In multi-institutional systems, the hospital board's power and authority depend on the role granted it by the system. Boards in all types of facilities are currently faced with the following challenges: Fulfilling their basic responsibilities, such as legal requirements, financial duties, and obligations for the quality of care. Encouraging management and the board itself to "think strategically" in attacking new competitive market forces while protecting the organization's traditional mission and values. Assessing recommended strategies in light of consequences if constituencies think the organization is abandoning its commitments. Boards can take several steps to match their mode of operation with the challenges of the new environment. Boards must rededicate themselves to the hospital's mission. Trustees must expand their understanding of health care trends and issues and their effect on the organization. Boards must evaluate and help strengthen management's performance, rather than acting as a "watchdog" in an adversarial position. Boards must think strategically, rather than focusing solely on operational details. Boards must evaluate the methods they use for conducting business.
Energy Technology Data Exchange (ETDEWEB)
Vicente, J. de; Castilla, J.; Martinez, G.
2007-09-27
Decamp (Dark Energy Survey Camera) is a new instrument designed to explore the universe aiming to reveal the nature of Dark Energy. The camera consists of 72 CCDs and 520 Mpixels. The readout electronics of DECam is based on the Monsoon system. Monsoon is a new image acquisition system developed by the NOAO (National Optical Astronomical Observatory) for the new generation of astronomical cameras. The Monsoon system uses three types of boards inserted in a Eurocard format based crate: master control board, acquisition board and clock board. The direct use of the Monsoon system for DECam readout electronics requires nine crates mainly due to the high number of clock boards needed. Unfortunately, the available space for DECam electronics is constrained to four crates at maximum. The major drawback to achieve such desired compaction degree resides in the clock board signal density. This document describes the changes performed at CIEMAT on the programmable logic of the Monsoon clock board aiming to meet such restricted space constraints. (Author) 5 refs.
International Nuclear Information System (INIS)
Vicente, J. de; Castilla, J.; Martinez, G.
2007-01-01
Decamp (Dark Energy Survey Camera) is a new instrument designed to explore the universe aiming to reveal the nature of Dark Energy. The camera consists of 72 CCDs and 520 Mpixels. The readout electronics of DECam is based on the Monsoon system. Monsoon is a new image acquisition system developed by the NOAO (National Optical Astronomical Observatory) for the new generation of astronomical cameras. The Monsoon system uses three types of boards inserted in a Eurocard format based crate: master control board, acquisition board and clock board. The direct use of the Monsoon system for DECam readout electronics requires nine crates mainly due to the high number of clock boards needed. Unfortunately, the available space for DECam electronics is constrained to four crates at maximum. The major drawback to achieve such desired compaction degree resides in the clock board signal density. This document describes the changes performed at CIEMAT on the programmable logic of the Monsoon clock board aiming to meet such restricted space constraints. (Author) 5 refs
What makes great boards great.
Sonnenfeld, Jeffrey A
2002-09-01
In the wake of meltdowns at WorldCom, Tyco, and Enron, enormous attention has been focused on the companies' boards. It seems inconceivable that business disasters of such magnitude could happen without gross or even criminal negligence on the part of board members. And yet a close examination of those boards reveals no broad pattern of incompetence or corruption. In fact, they followed most of the accepted standards for board operations: Members showed up for meetings; they had money invested in the company; audit committees, compensation committees, and codes of ethics were in place; the boards weren't too small or too big, nor were they dominated by insiders. In other words, they passed the tests that would normally be applied to determine whether a board of directors was likely to do a good job. And that's precisely what's so scary, according to corporate governance expert Jeffrey Sonnenfeld, who suggests that it's time for some new thinking about how corporate boards operate and are evaluated. He proposes thinking not only about how to structure the board's work but also about how to manage it as a social system. Good boards are, very simply, high-functioning work groups. They're distinguished by a climate of respect, trust, and candor among board members and between the board and management. Information is shared openly and on time; emergent political factions are quickly eliminated. Members feel free to challenge one another's assumptions and conclusions, and management encourages lively discussion of strategic issues. Directors feel a responsibility to contribute meaningfully to the board's performance. In addition, good boards assess their own performance, both collectively and individually.
Patel, Dhananjay; Singh, Vinay Kumar; Dalal, U. D.
2017-01-01
Single mode fibers (SMF) are typically used in Wide Area Networks (WAN), Metropolitan Area Networks (MAN) and also find applications in Radio over Fiber (RoF) architectures supporting data transmission in Fiber to the Home (FTTH), Remote Antenna Units (RAUs), in-building networks etc. Multi-mode fibers (MMFs) with low cost, ease of installation and low maintenance are predominantly (85-90%) deployed in-building networks providing data access in local area networks (LANs). The transmission of millimeter wave signals through the SMF in WAN and MAN, along with the reuse of MMF in-building networks will not levy fiber reinstallation cost. The transmission of the millimeter waves experiences signal impairments due to the transmitter non-linearity and modal dispersion of the MMF. The MMF exhibiting large modal dispersion limits the bandwidth-length product of the fiber. The second and higher-order harmonics present in the optical signal fall within the system bandwidth. This causes degradation in the received signal and an unwanted radiation of power at the RAU. The power of these harmonics is proportional to the non-linearity of the transmitter and the modal dispersion of the MMF and should be maintained below the standard values as per the international norms. In this paper, a mathematical model is developed for Second-order Harmonic Distortion (HD2) generated due to non-linearity of the transmitter and chromatic-modal dispersion of the SMF-MMF optic link. This is also verified using a software simulation. The model consists of a Mach Zehnder Modulator (MZM) that generates two m-QAM OFDM Single Sideband (SSB) signals based on phase shift of the hybrid coupler (90° and 120°). Our results show that the SSB signal with 120° hybrid coupler has suppresses the higher-order harmonics and makes the system more robust against the HD2 in the SMF-MMF optic link.
US DOE Perspectives on Advisory Board Effectiveness - 13539
International Nuclear Information System (INIS)
Adler, David
2013-01-01
Federal missions on the Oak Ridge Reservation began with the Manhattan Project, and continues today with major facilities supporting the Nation's Science and National Security missions. While most of the land area on the Oak Ridge Reservation is free of environmental impacts from these activities, significant legacy contamination is associated with specific facilities and past waste management areas. In 1989, the Oak Ridge Reservation (ORR) was placed on National Priorities List, and DOE established its Office of Environmental Management that same year. Three years later, in 1992, the Federal Facility Agreement for the reservation was signed. Three years afterward, the Oak Ridge Site Specific Advisory Board was established to augment ongoing public involvement activities related to Oak Ridge Reservation cleanup activities. One of the early and most impactful decisions the board made was to organize the End Use Working Group. This broad-based group of board members, DOE representatives, and members of the public was formed in 1997 to study future uses for contaminated areas of the reservation. The group was instrumental in building consensus in the Oak Ridge community regarding the long-term end state of reservation lands. The group's recommendations were a fundamental input into Record's of Decision subsequently developed to establish cleanup requirements across the ORR, and they continue to influence decisions being made today. In developing its recommendations on end states, the End Use Working Group came to the realization that long-term stewardship of contaminated areas of the reservation would be necessary, in some cases in perpetuity. It was from this concept that the Oak Ridge SSAB's 15-year involvement in stewardship would begin. A stewardship committee formed by the End Use Working Group wrote Volume 1 of the Stakeholder Report on Stewardship. This document-and its companion Volume 2, which was written a year later-form a crucial foundation for stewardship
US DOE Perspectives on Advisory Board Effectiveness - 13539
Energy Technology Data Exchange (ETDEWEB)
Adler, David [US DOE (United States)
2013-07-01
Federal missions on the Oak Ridge Reservation began with the Manhattan Project, and continues today with major facilities supporting the Nation's Science and National Security missions. While most of the land area on the Oak Ridge Reservation is free of environmental impacts from these activities, significant legacy contamination is associated with specific facilities and past waste management areas. In 1989, the Oak Ridge Reservation (ORR) was placed on National Priorities List, and DOE established its Office of Environmental Management that same year. Three years later, in 1992, the Federal Facility Agreement for the reservation was signed. Three years afterward, the Oak Ridge Site Specific Advisory Board was established to augment ongoing public involvement activities related to Oak Ridge Reservation cleanup activities. One of the early and most impactful decisions the board made was to organize the End Use Working Group. This broad-based group of board members, DOE representatives, and members of the public was formed in 1997 to study future uses for contaminated areas of the reservation. The group was instrumental in building consensus in the Oak Ridge community regarding the long-term end state of reservation lands. The group's recommendations were a fundamental input into Record's of Decision subsequently developed to establish cleanup requirements across the ORR, and they continue to influence decisions being made today. In developing its recommendations on end states, the End Use Working Group came to the realization that long-term stewardship of contaminated areas of the reservation would be necessary, in some cases in perpetuity. It was from this concept that the Oak Ridge SSAB's 15-year involvement in stewardship would begin. A stewardship committee formed by the End Use Working Group wrote Volume 1 of the Stakeholder Report on Stewardship. This document-and its companion Volume 2, which was written a year later-form a crucial
The Defense Science Board 2001 Summer Study on Defense Science and Technology
2002-05-01
HIT” The threat of biological weapons arises in part from a decades-old megatrend in the life sciences. New advances in molecular biology, genetics...99 The Technology Landscape Today.................................... 101 Biological Warfare Defense...planning and programming, today’s environment comprises a broader, more diffuse set of concerns: terrorism, biological warfare, regional tensions
2012-03-26
... Advisory Board; Environmental Economics Advisory Committee AGENCY: Environmental Protection Agency (EPA... Office announces public teleconferences of the SAB Environmental Economics Advisory Committee to conduct... Economics Advisory Committee (EEAC) will hold a public teleconferences to review the EPA draft report...
A persistent lack of international representation on editorial boards in environmental biology.
Directory of Open Access Journals (Sweden)
Johanna Espin
2017-12-01
Full Text Available The scholars comprising journal editorial boards play a critical role in defining the trajectory of knowledge in their field. Nevertheless, studies of editorial board composition remain rare, especially those focusing on journals publishing research in the increasingly globalized fields of science, technology, engineering, and math (STEM. Using metrics for quantifying the diversity of ecological communities, we quantified international representation on the 1985-2014 editorial boards of 24 environmental biology journals. Over the course of 3 decades, there were 3,827 unique scientists based in 70 countries who served as editors. The size of the editorial community increased over time-the number of editors serving in 2014 was 4-fold greater than in 1985-as did the number of countries in which editors were based. Nevertheless, editors based outside the "Global North" (the group of economically developed countries with high per capita gross domestic product [GDP] that collectively concentrate most global wealth were extremely rare. Furthermore, 67.18% of all editors were based in either the United States or the United Kingdom. Consequently, geographic diversity-already low in 1985-remained unchanged through 2014. We argue that this limited geographic diversity can detrimentally affect the creativity of scholarship published in journals, the progress and direction of research, the composition of the STEM workforce, and the development of science in Latin America, Africa, the Middle East, and much of Asia (i.e., the "Global South".
A persistent lack of international representation on editorial boards in environmental biology.
Espin, Johanna; Palmas, Sebastian; Carrasco-Rueda, Farah; Riemer, Kristina; Allen, Pablo E; Berkebile, Nathan; Hecht, Kirsten A; Kastner-Wilcox, Kay; Núñez-Regueiro, Mauricio M; Prince, Candice; Rios, Constanza; Ross, Erica; Sangha, Bhagatveer; Tyler, Tia; Ungvari-Martin, Judit; Villegas, Mariana; Cataldo, Tara T; Bruna, Emilio M
2017-12-01
The scholars comprising journal editorial boards play a critical role in defining the trajectory of knowledge in their field. Nevertheless, studies of editorial board composition remain rare, especially those focusing on journals publishing research in the increasingly globalized fields of science, technology, engineering, and math (STEM). Using metrics for quantifying the diversity of ecological communities, we quantified international representation on the 1985-2014 editorial boards of 24 environmental biology journals. Over the course of 3 decades, there were 3,827 unique scientists based in 70 countries who served as editors. The size of the editorial community increased over time-the number of editors serving in 2014 was 4-fold greater than in 1985-as did the number of countries in which editors were based. Nevertheless, editors based outside the "Global North" (the group of economically developed countries with high per capita gross domestic product [GDP] that collectively concentrate most global wealth) were extremely rare. Furthermore, 67.18% of all editors were based in either the United States or the United Kingdom. Consequently, geographic diversity-already low in 1985-remained unchanged through 2014. We argue that this limited geographic diversity can detrimentally affect the creativity of scholarship published in journals, the progress and direction of research, the composition of the STEM workforce, and the development of science in Latin America, Africa, the Middle East, and much of Asia (i.e., the "Global South").
Integrating the Dimensions of NGSS within a Collaborative Board Game about Honey Bees.
Lauren, Hillary; Lutz, Claudia; Wallon, Robert C; Hug, Barbara
2016-01-01
The current reform in U.S. science education calls for the integration of three dimensions of science learning in classroom teaching and learning: Science and Engineering Practices, Crosscutting Concepts, and Disciplinary Core Ideas. While the Next Generation Science Standards provide flexibility in how curriculum and instruction are structured to meet learning goals, there are few examples of existing curricula that portray the integration of these dimensions as "three-dimensional learning." Here, we describe a collaborative board game about honey bees that incorporates scientific evidence on how genetic and environmental factors influence variations of traits and social behavior and requires students to collaboratively examine and use a system model. Furthermore, we show how students used and evaluated the game as a model in authentic classroom settings.
The Perceptions of Georgia School Board Members' Need for Training on School Board Governance
Nutt, Pamela Studdard
2010-01-01
This study explored the perceptions of training needs of school board members in Georgia. The study examined perceptions of school board chairs, board members with 1 to 5 years experience, members with 6 to 10 years experience, members with 11 to 15 years experience and board members with 16 plus years experience in the areas of school board…
2012-09-11
... FARM CREDIT SYSTEM INSURANCE CORPORATION Board Meeting AGENCY: Farm Credit System Insurance Corporation. ACTION: Regular meeting. SUMMARY: Notice is hereby given of the regular meeting of the Farm Credit System Insurance Corporation Board (Board). Date and Time: The meeting of the Board will be held...
76 FR 59110 - Submission for OMB Review; Comment Request
2011-09-23
... DEPARTMENT OF COMMERCE Submission for OMB Review; Comment Request The Department of Commerce will... Flexibility Act. The Social Sciences Branch (SSB) of the NMFS, Northeast Fisheries Science Center (NEFSC) is responsible for estimating the economic and social impacts of fishery management actions. Lack of information...
2010-03-01
... DEPARTMENT OF ENERGY Letter From Secretary of Energy Accepting Defense Nuclear Facilities Safety Board (Board) Recommendation 2009-2 AGENCY: Department of Energy. ACTION: Notice. SUMMARY: The...: The Department of Energy (DOE) acknowledges receipt of Defense Nuclear Facilities Safety Board (Board...
Directory of Open Access Journals (Sweden)
Shenglan Chen
2014-06-01
Full Text Available This paper examines the effects of board affiliation on the corporate pay gap. Using a sample of Chinese listed firms from 2005 to 2011, we find that boards with a greater presence of directors appointed by block shareholders have lower pay gaps. Furthermore, the governance effects of board affiliation with and without pay are distinguished. The empirical results show that board affiliation without pay is negatively related to the pay gap, while board affiliation with pay is positively related to the pay gap. Overall, the results shed light on how block shareholders affect their companies’ pay gaps through board affiliation.
2010-10-01
... TRANSPORTATION GENERAL RULES AND REGULATIONS BOARD ORGANIZATION; DELEGATIONS OF AUTHORITY § 1011.2 The Board. (a... submitted for decision except those assigned to an individual Board Member or employee or an employee board...) The Board may bring before it any matter assigned to an individual Board Member or employee or...
Digest of Key Science and Engineering Indicators, 2008. NSB-08-2
National Science Foundation, 2008
2008-01-01
This digest of key science and engineering indicators draws primarily from the National Science Board's two-volume "Science and Engineering Indicators, 2008" report. The digest serves two purposes: (1) to draw attention to important trends and data points from across the chapters and volumes of "Science and Engineering Indicators, 2008," and (2)…
75 FR 65305 - National Board for Education Sciences
2010-10-22
... Sciences (IES) on, among other things, the establishment of activities to be supported by the Institute, on... Document Format (PDF) on the Internet at the following site: http://www.ed.gov/news/fed-register/index.html... document published in the Federal Register. Free Internet access to the official edition of the Federal...
2013-01-23
... FARM CREDIT SYSTEM INSURANCE CORPORATION Board Meeting AGENCY: Farm Credit System Insurance Corporation. SUMMARY: Notice is hereby given of the regular meeting of the Farm Credit System Insurance Corporation Board (Board). DATE AND TIME: The meeting of the Board will be held at the offices of the Farm...
Health Sciences in Iran; Past and Present
Directory of Open Access Journals (Sweden)
Dehghani R.* PhD
2014-08-01
Full Text Available As this is the first issue of the International Archives of Health Sciences, a scholarly journal of Kashan University of medical Sciences, we start with an editorial of Dr. Rouhullah Dehghani, the editor-in-chief, to explain the aims and views of the editorial board members and the scope of the journal.
National Oceanic and Atmospheric Administration, Department of Commerce — Pilot boarding areas are locations at sea where pilots familiar with local waters board incoming vessels to navigate their passage to a destination port. Pilotage is...
Board Certification in Counseling Psychology
Crowley, Susan L.; Lichtenberg, James W.; Pollard, Jeffrey W.
2012-01-01
Although specialty board certification by the American Board of Professional Psychology (ABPP) has been a valued standard for decades, the vast majority of counseling psychologists do not pursue board certification in the specialty. The present article provides a brief history of board certification in general and some historical information about…
Energy Technology Data Exchange (ETDEWEB)
Smeallie, P.H.
1993-08-11
This report covers the activities of the Geotechnical Board and its two national committees, the US National Committee for Rock Mechanics (USNC/RM) and the US National Committee on Tunneling Technology (USNC/TT), for the period from March 1, 1991 to June 30, 1992. The report covers a 16-month period, through June of this year, to bring the reporting period in line with the National Research Council`s (NRC) fiscal year. Subsequent reports will cover the 12-month period July 1--June 30, unless individual contracts require otherwise. A description of the Geotechnical Board and its committees within the context of the National Academy of Sciences/National Research Council, as well as lists of current members of the board and national committees can be found in Attachment A.
Jackson, Dionne
2005-01-01
The NASA Materials Science Laboratory (MSL) provides science and engineering services to NASA and Contractor customers at KSC, including those working for the Space Shuttle. International Space Station. and Launch Services Programs. These services include: (1) Independent/unbiased failure analysis (2) Support to Accident/Mishap Investigation Boards (3) Materials testing and evaluation (4) Materials and Processes (M&P) engineering consultation (5) Metrology (6) Chemical analysis (including ID of unknown materials) (7) Mechanical design and fabrication We provide unique solutions to unusual and urgent problems associated with aerospace flight hardware, ground support equipment and related facilities.
Hirabayashi, K; Yamamoto, T; Matsuo, S; Hino, S
1998-05-10
We propose free-space optical interconnections for a bookshelf-assembled terabit-per-second-class ATM switch. Thousands of arrayed optical beams, each having a rate of a few gigabits per second, propagate vertically to printed circuit boards, passing through some boards, and are connected to arbitrary transmitters and receivers on boards by polarization controllers and prism arrays. We describe a preliminary experiment using a 1-mm-pitch 2 x 2 beam-collimator array that uses vertical-cavity surface-emitting laser diodes. These optical interconnections can be made quite stable in terms of mechanical shock and temperature fluctuation by the attachment of reinforcing frames to the boards and use of an autoalignment system.
B. Visser (Bauke); S. Dominguez Martinez (Silvia); O.H. Swank (Otto)
2007-01-01
textabstractIt is often assumed that bad corporate performance means a bad CEO. The task of a board of directors is then simple: dismiss the executive. If it fails to do so, the board is said to be indolent. We take a kinder approach to observed board behaviour and point to the problems even
B. Cousins
Open Access Publication Policy ATLAS had recently issued a short statement in support of open access publishing. The mood of the discussions in the December CMS Collaboration Board had appeared to be in favour and so it was being proposed that CMS issue the same statement as that made by ATLAS (the statement is attached to the agenda of this meeting). The Collaboration Board agreed. Election of the Chair of the Collaboration Board Following the agreement to shorten the terms of both the Spokesperson and the Collaboration Board Chair, and to introduce a longer overlap period between the election and the start of the term, the election for the next Collaboration Board Chair was due in December 2007. If the old standard schedule specified in the Constitution were adapted to this date, then the Board should be informed at the present meeting that the election was being prepared. However, it was felt that the experience of the previous year's election of the Spokesperson had shown that it would be desirable to...
Energy Technology Data Exchange (ETDEWEB)
Mulder, John C.; Schwartz, Moses Daniel; Berg, Michael J.; Van Houten, Jonathan Roger; Urrea, Jorge Mario; King, Michael Aaron; Clements, Abraham Anthony; Jacob, Joshua A.
2013-10-01
Critical infrastructures, such as electrical power plants and oil refineries, rely on programmable logic controllers (PLCs) to control essential processes. State of the art security cannot detect attacks on PLCs at the hardware or firmware level. This renders critical infrastructure control systems vulnerable to costly and dangerous attacks. WeaselBoard is a PLC backplane analysis system that connects directly to the PLC backplane to capture backplane communications between modules. WeaselBoard forwards inter-module traffic to an external analysis system that detects changes to process control settings, sensor values, module configuration information, firmware updates, and process control program (logic) updates. WeaselBoard provides zero-day exploit detection for PLCs by detecting changes in the PLC and the process. This approach to PLC monitoring is protected under U.S. Patent Application 13/947,887.
49 CFR 1011.5 - Employee boards.
2010-10-01
... 49 Transportation 8 2010-10-01 2010-10-01 false Employee boards. 1011.5 Section 1011.5... OF TRANSPORTATION GENERAL RULES AND REGULATIONS BOARD ORGANIZATION; DELEGATIONS OF AUTHORITY § 1011.5 Employee boards. This section covers matters assigned to the Accounting Board, a board of employees of the...
Board Size and Board Independence: A Quantitative Study on Banking Industry in Pakistan
Directory of Open Access Journals (Sweden)
Kashif Rashid
2014-12-01
Full Text Available This paper aims to investigate the relationship of board independence and board size with productivity and efficiency of the listed banks on the Karachi Stock Exchange, Pakistan. There is a lack of consensus regarding impact of corporate governance practices in correspondence to number of board members and board independence in banking sector. The derived results of the study show that there is a positive relationship between board independence and bank profitability and efficiency. Independent directors play a crucial role in providing genuine advice during executive decision making process which is an important source for improving overall corporate governance. Moreover, results regarding the role of control variables suggest a positive relationship of the total assets and deposits of the firm with the firm’s performance supporting stewardship theory in the market.
76 FR 77239 - National Institute of Environmental Health Sciences; Notice of Meeting
2011-12-12
... Environmental Health Sciences; Notice of Meeting Pursuant to section 10(a) of the Federal Advisory Committee Act.../boards/ibcercc/ . Place: National Institute of Environmental Health Sciences, Building 101, Rodbell... and Education; 93.894, Resources and Manpower Development in the Environmental Health Sciences; 93.113...
Optimization of Planck-LFI on-board data handling
Energy Technology Data Exchange (ETDEWEB)
Maris, M; Galeotta, S; Frailis, M; Zacchei, A; Fogliani, S; Gasparo, F [INAF-OATs, Via G.B. Tiepolo 11, 34131 Trieste (Italy); Tomasi, M; Bersanelli, M [Universita di Milano, Dipartimento di Fisica, Via G. Celoria 16, 20133 Milano (Italy); Miccolis, M [Thales Alenia Space Italia S.p.A., S.S. Padana Superiore 290, 20090 Vimodrone (Italy); Hildebrandt, S; Chulani, H; Gomez, F [Instituto de Astrofisica de Canarias (IAC), C/o Via Lactea, s/n E38205 - La Laguna, Tenerife (Spain); Rohlfs, R; Morisset, N; Binko, P [ISDC Data Centre for Astrophysics, University of Geneva, ch. d' Ecogia 16, 1290 Versoix (Switzerland); Burigana, C; Butler, R C; Cuttaia, F; Franceschi, E [INAF-IASF Bologna, Via P. Gobetti, 101, 40129 Bologna (Italy); D' Arcangelo, O, E-mail: maris@oats.inaf.i [IFP-CNR, via Cozzi 53, 20125 Milano (Italy)
2009-12-15
To asses stability against 1/f noise, the Low Frequency Instrument (LFI) on-board the Planck mission will acquire data at a rate much higher than the data rate allowed by the science telemetry bandwith of 35.5 Kbps. The data are processed by an on-board pipeline, followed on-ground by a decoding and reconstruction step, to reduce the volume of data to a level compatible with the bandwidth while minimizing the loss of information. This paper illustrates the on-board processing of the scientific data used by Planck/LFI to fit the allowed data-rate, an intrinsecally lossy process which distorts the signal in a manner which depends on a set of five free parameters (N{sub aver}, r{sub 1}, r{sub 2}, q, O) for each of the 44 LFI detectors. The paper quantifies the level of distortion introduced by the on-board processing as a function of these parameters. It describes the method of tuning the on-board processing chain to cope with the limited bandwidth while keeping to a minimum the signal distortion. Tuning is sensitive to the statistics of the signal and has to be constantly adapted during flight. The tuning procedure is based on a optimization algorithm applied to unprocessed and uncompressed raw data provided either by simulations, pre-launch tests or data taken in flight from LFI operating in a special diagnostic acquisition mode. All the needed optimization steps are performed by an automated tool, OCA2, which simulates the on-board processing, explores the space of possible combinations of parameters, and produces a set of statistical indicators, among them: the compression rate C{sub r} and the processing noise epsilon{sub Q}. For Planck/LFI it is required that C{sub r} = 2.4 while, as for other systematics, epsilon{sub Q} would have to be less than 10% of rms of the instrumental white noise. An analytical model is developed that is able to extract most of the relevant information on the processing errors and the compression rate as a function of the signal
Preserving the Legitimacy of Board Certification.
Hanemann, Michael S; Wall, Holly C; Dean, John A
2017-06-01
The aims of this discussion were to inform the medical community about the American Board of Cosmetic Surgery's ongoing attempts in Louisiana to achieve equivalency to American Board of Medical Specialties (ABMS) member boards so that its diplomates may use the term "board certified" in advertising and to ensure public safety by upholding the standards for medical board certification. In 2011, Louisiana passed a truth in medical advertising law, which was intended to protect the public by prohibiting the use of the term "board certified" by improperly credentialed physicians. An American Board of Cosmetic Surgery diplomate petitioned the Louisiana State Board of Medical Examiners to approve a rule that would establish a pathway to equivalency for non-ABMS member boards, whose diplomates have not completed training approved by the Accreditation Council for Graduate Medical Education (ACGME) in the specialty they are certifying. Physicians and physician organizations representing multiple specialties (facial plastic and reconstructive surgery, otolaryngology [head and neck surgery], orthopedic spine surgery, pediatric neurosurgery, dermatology, and plastic surgery) urged the Louisiana State Board of Medical Examiners to clarify its advertising policy, limiting the use of the term "board certified" to physicians who have completed ACGME-approved training in the specialty or subspecialty named in the certificate. The public equates the term "board certified" with the highest level of expertise in a medical specialty. When a certifying board does not require completion of ACGME or American Osteopathic Association (AOA)-accredited training in the specialty it certifies, the result is an unacceptable degree of variability in the education and training standards applied to its diplomates. Independent, third-party oversight of certifying boards and training programs is necessary to ensure quality standards are upheld. Any system that assesses a non-ABMS member or non
76 FR 80954 - National Institute of Environmental Health Sciences; Notice of Meeting
2011-12-27
... Environmental Health Sciences; Notice of Meeting Pursuant to section 10(a) of the Federal Advisory Committee Act.../boards/ibcercc/ . Place: Nat. Inst. of Environmental Health Sciences, Building 101, Rodbell Auditorium... Environmental Health Sciences, National Institutes of Health, 615 Davis Dr., KEY615/3112, Research Triangle Park...
2011-08-24
... Accounting Oversight Board; Order Approving Proposed Board Funding Final Rules for Allocation of the Board's... August 18, 2011. I. Introduction On June 21, 2011, the Public Company Accounting Oversight Board (the... public accounting firm, in amounts that are sufficient to cover the costs of processing and reviewing...
Association of h-index of Editorial Board Members and Impact Factor among Radiology Journals.
Asnafi, Solmaz; Gunderson, Tina; McDonald, Robert J; Kallmes, David F
2017-02-01
h-Index has been proposed as a useful bibliometric measure for quantifying research productivity. In this current study, we analyzed h-indices of editorial board members of Radiology journals and tested the hypothesis that editorial board members of Radiology journals with higher impact factors (IF) have higher h-indices. Sixty-two Radiology journals with IF >1 were included. Editorial board members were identified using the journals' websites. Editors' affiliations and research fields of interest were used to distinguish investigators with similar names. Bibliometric indices including number of publications, total citations, citations per publication, and h-index for each editorial board member were obtained using the Web of Science database. Chi-square or Wilcoxon rank-sum tests were used to test for differences in bibliographic measures or demographics between groups. Among the editorial boards of 62 journals, the median [interquartile range] board h-index was 26 [18, 31] and had 36 [17, 56] members. The median journal IF was 2.27 [1.74, 3.31]. We identified a total of 2204 distinct editors; they had a median [interquartile range] h-index of 23 [13, 35], 120 [58, 215] total publications, 1938 [682, 4634] total citations, and an average of 15.7 [9.96, 24.8] citations per publication. The boards of journals with IF above the median had significantly higher h-indices (P = .002), total publications (P = .01), and total and average citations (both any [P = .003, .009] and nonself-citations [P = .001, .002]) than journals below the median. Our data indicate that board members of Radiology journals with higher IF have greater h-indices compared to lower IF journals. Copyright © 2017 The Association of University Radiologists. Published by Elsevier Inc. All rights reserved.
2003-01-01
Report of Opening Session (pdf 51 KB) Report of Governing Council Meeting(pdf 136 KB) Report of the Finance and Administration Committee (pdf 48 KB) Reports of Science Board and Committees: Science Board (pdf 71 KB) Biological Oceanography Committee (pdf 66 KB) Working Group 14: Effective sampling of micronekton Marine Birds and Mammals Advisory Panel Fishery Science Committee (pdf 36 KB) Working Group 16: Climate change, shifts to fish production, an...
NPS Transit System Passenger Boardings Study: Converting Ticket Sales to Passenger Boardings.
2016-01-01
This report examines the reporting of passenger boardings (unlinked passenger trips) by NPS transit systems that use a ticket sales conversion methodology. By studying and validating the park units' passenger boarding methodology from converting tick...
Lyman Spitzer: Life, Times, and Science
Indian Academy of Sciences (India)
Resonance – Journal of Science Education. Current Issue : Vol. 23, Issue 4. Current Issue Volume 23 | Issue 4. April 2018. Home · Volumes & Issues · Categories · Special Issues · Search · Editorial Board · Information for Authors · Subscription ...
National Research Council Canada - National Science Library
Fraser, Steven
2003-01-01
... (or a cluster of funds); referred to as a Multiple Board Configuration (MBC). In a sample of the largest open-end mutual fund sponsors, I find MBC boards have significantly higher board-level objective-adjusted excess returns than SBC boards...
International Nuclear Information System (INIS)
Alexander, Catherine; Freeman, Jenny; Cantrell, Yvette
2013-01-01
The charter for the Department of Energy's Environmental Management (EM) Site-Specific Advisory Board (SSAB) was approved under the Federal Advisory Committee Act (FACA) in 1994. With a unique mandate to provide public input on issues associated with the cleanup of nuclear legacy sites in the U.S., the EM SSAB comprises eight local boards, which are based at major EM sites. While each board is unique to the community in which it is located and reflects the diversity of the local population, the boards are governed by FACA, related regulations, and DOE policies that are intended to standardize agency advisory board operations. The EM SSAB local boards are made up of a diverse group of citizens who want to understand the mission and goals of the EM program and to help EM achieve those goals for the benefit of their communities. Some are quite passionate about their mission; others need to be coaxed into active participation. Maintaining productive relationships and a supportive environment for effective board operations is the challenge of board management for DOE EM and the board members themselves. DOE draws on research findings and best practices literature from academics and practitioners in the field of public involvement in its board management practices. The EM SSAB is also evaluated annually under the law to ensure that the investment of taxpayer dollars in the board is warranted in light of the contributions of the board. Further evaluation takes place at the agency and site levels in order to identify what aspects of board functioning the agency and board members find important to its success and to address areas where improvement is needed. Board contributions, compliance factors, and measurable outcomes related to board products and process areas are key to agency commitment to ongoing support of the boards and to participant satisfaction and thus continued member involvement. In addition to evaluation of these factors in improving board effectiveness
Giles, Rebecca M.; Shaw, Edward L.
2011-01-01
SMART Board is a technology that combines the functionality of a whiteboard, computer, and projector into a single system. The interactive nature of the SMART Board offers many practical uses for providing an introduction to or review of material, while the large work area invites collaboration through social interaction and communication. As a…
Departmental Appeals Board Decisions
U.S. Department of Health & Human Services — Decisions issued by the Chair and Board Members of the Departmental Appeals Board concerning determinations in discretionary, project grant programs, including...
2011-12-23
... Advisory Board Biogenic Carbon Emissions Panel AGENCY: Environmental Protection Agency (EPA). ACTION... Office announces two teleconferences of the SAB Biogenic Carbon Emissions Panel to review EPA's draft... policy, notice is hereby given that the SAB Biogenic Carbon Emissions Panel will hold two public...
Board diversity in family firms
Menozzi, Anna; Fraquelli, Giovanni; Novara, Jolanda de
2015-01-01
The paper deals with diversity as a key factor to improve the board of directors’ decision process in family firms. The empirical literature about board diversity points at the positive impact of diversity on board functioning and firm performance. The paper uses a statistical diversity index to capture the heterogeneity of board of directors and put it in relation with firm performance, as measured by firm profitability. The empirical analysis is based on a newly collected panel of 327 famil...
DEFF Research Database (Denmark)
Enggaard, Helle; Moselund, Lene
2015-01-01
Projekt ’BuddyBoard’ er kommet i stand via et samarbejde mellem Frederikshavn kommune, Bunker43 og Lab. X. Afdeling en ’Havly’ på Sæby Ældrecenter fungerer som living lab, hvilket betyder, at det udgør et levende laboratorium for udvikling og afprøvning af teknologi (Schultz, 2013). Projektet er....... Bunker43 har udviklet en teknologi (BuddyBoard) til hurtig formidling af billeder fra pårørende og personale til beboere på institutioner. Pårørende og personale uploader billeder via en APP eller en hjemmeside og har mulighed for at tilføje en kort forklarende tekst til hvert billede. Beboeren ser...... billederne via en tablet. Systemet bygger på et simpelt og brugervenligt design, så ældre med kognitive og/eller fysiske funktionsnedsættelser kan anvende teknologien. BuddyBoard fungerer via internettet, og billederne gemmes på en sikret server hos udbyderen, som er Bunker43. Intentionerne med BuddyBoard er...
A caution to Native American institutional review boards about scientism and censorship.
Askland, Andrew
2002-01-01
Native American Institutional Review Boards (IRBs) promote the health and welfare of tribes by reviewing protocols for research studies that focus on their tribes. The benefits of approved protocols should not be overstated lest good studies disappoint because they do not satisfy unachievable expectations. IRBs also should avoid the temptation to censor the outcomes of those studies. Science relies on candor and clarity about results and methods to move forward.
2010-04-01
... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Board staff. 902.3 Section 902.3 Foreign Relations FOREIGN SERVICE GRIEVANCE BOARD ORGANIZATION § 902.3 Board staff. The chairperson shall select the Board's executive secretary and other staff provided for in the Act. The executive secretary and staff...
2011-07-12
... available, the issuer's net asset value. (i)(v) Issuer Accounting Support Fee The term ``issuer accounting... Accounting Oversight Board; Notice of Filing of Proposed Board Funding Final Rules for Allocation of the Board's Accounting Support Fee Among Issuers, Brokers, and Dealers, and Other Amendments to the Board's...
77 FR 57079 - National Board for Education Sciences; Meeting
2012-09-17
... of Education Sciences (IES) on, among other things, the establishment of activities to be supported... in the Federal Register, in text or Adobe Portable Document Format (PDF) on the Internet at the...: The official version of this document is the document published in the Federal Register. Free Internet...
Bringing out the Best Board Behavior
Caruso, Nicholas
2004-01-01
The author's advice for for a school board superintendent is to assume incompetence instead of malevolence. Board members who behave inappropriately are a minority, and those with malicious intent are extremely rare. Most misbehaving board members act out of frustration. They may not understand the appropriate role of a board member.…
Cornforth, Chris
2001-01-01
Based on a survey of charity boards in England and Wales this paper examines what influence board inputs, structures and processes have on board effectiveness. The findings provide mixed support for the normative literature on board effectiveness. Using stepwise logistic regression the research suggests that board inputs and three process variables are important in explaining board effectiveness, namely: board members have the time, skills and experience to do the job; clear board roles and r...
76 FR 12718 - National Board for Education Sciences Meeting
2011-03-08
... Sciences (IES) on, among other things, the establishment of activities to be supported by the Institute..., in text or Adobe Portable Document Format (PDF) on the Internet at the following site: http://www.ed... version of this document is the document published in the Federal Register. Free Internet access to the...
77 FR 20805 - National Board for Education Sciences; Meeting
2012-04-06
... Sciences (IES) on, among other things, the establishment of activities to be supported by the Institute, on... Portable Document Format (PDF) on the Internet at the following site: www.ed.gov/news/fed-register/index... document published in the Federal Register. Free Internet access to the official edition of the Federal...
Governing Board of the Pension Fund
2006-01-01
The Governing Board of the Pension Fund held its 142nd meeting on 14 March 2006. As an introduction to the meeting, the Administrator underlined that, at 12.4%, the performance achieved by the Fund on its assets had been excellent and had taken the Fund's assets at the end of the year to 4,209 MCHF, which was well above the 4 billion Swiss franc mark. The Chairman of the Governing Board, Professor Ferrini, reported on the Board's closed session on 7 March to examine the nominations received for the election of the Vice-Chairmen of the Governing Board of the Pension Fund. The Governing Board had unanimously agreed to recommend the CERN Council to appoint Mr A. J. Naudi and Dr J.-P. Matheys. At its session on 16 March 2006, the Council had followed the recommendation of the Governing Board by re-appointing J.-P. Matheys and A. J. Naudi Vice-Chairmen of the Board until the end of their respective terms of office as members of the Governing Board. Regarding the comparison with other European pension funds launc...
German versus Nordic Board Models
DEFF Research Database (Denmark)
Ringe, Georg
2016-01-01
Board structure is an important component of the individual governance of firms, and the appropriateness of the various models is one of the most debated issues in corporate governance today. A comparison of the Nordic and German approaches to the structure of corporate boards reveals stark...... conceptual differences, as emphasized by the 2014 Lekvall Report on the Nordic Corporate Governance Model. This article provides a conceptual comparison between the two approaches to board structure and confirms the fundamental divergence between both models. However, relying on a number of recent legal...... changes and developments in business practice, the article argues that board practices in the two systems effectively blur the structural distinction, and that board organization is converging in practice. It thereby contributes to the broader debates on functionality and comparative corporate law...
75 FR 30832 - National Biodefense Science Board; Call for Nominees
2010-06-02
...) four individuals from the pharmaceutical, biotechnology and device industries, (c) four academicians... opportunities presented by advances in biological and life sciences, biotechnology, and genetic engineering with...
Human Resources Division
2002-01-01
The Joint Advisory Appeals Board was convened to examine the appeal lodged by Mr Luc Vos with regard to advancement. As the appellant has not objected, the report of the Board and the final decision of the Director-General are brought to the notice of the personnel in accordance with Article R VI 1.20 of the Staff Regulations. The relevant documents will therefore be posted on the notice boards of the Administration Building (N° 60) from 14 to 28 June 2002. Human Resources Division Tel. 74128
Human Resources Division
2001-01-01
The Joint Advisory Appeals Board was convened to examine the appeal lodged by Mr Olivier Francis Martin with regard to indefinite contract. As the appellant has not objected, the report of the Board and the final decision of the Director-General are brought to the notice of the personnel in accordance with Article R VI 1.20 of the Staff Regulations. The relevant documents will therefore be posted on the notice boards of the Administration Building (N° 60) from 8 to 25 June 2001.
2003-01-01
The Joint Advisory Appeals Board was convened to examine the appeal lodged by Mr Aloïs Girardoz with regard to classification and advancement. As the appellant has not objected, the Board's report and the Director-General's decision will be brought to the notice of the personnel in accordance with Article R VI 1.20 of the Staff Regulations. The relevant documents will therefore be posted on the notice boards of the Administration Building (N° 60) from 15 to 29 August 2003. Human Resources Division Tel. 74128
Moore, Michael N; Depledge, Michael H; Fleming, Lora; Hess, Philipp; Lees, David; Leonard, Paul; Madsen, Lise; Owen, Richard; Pirlet, Hans; Seys, Jan; Vasconcelos, Vitor; Viarengo, Aldo
2013-05-01
will impact adversely on efforts to alleviate poverty, sustain the availability of environmental goods and services and improve health and social and economic stability; and thus, will impinge on many policy decisions, both nationally and internationally. Knowledge exchange (KE) will be a key element of any ensuing research. KE will facilitate the integration of biological, medical, epidemiological, social and economic disciplines, as well as the emergence of synergies between seemingly unconnected areas of science and socio-economic issues, and will help to leverage knowledge transfer across the European Union (EU) and beyond. An integrated interdisciplinary systems approach is an effective way to bring together the appropriate groups of scientists, social scientists, economists, industry and other stakeholders with the policy formulators in order to address the complexities of interfacial problems in the area of environment and human health. The Marine Board of the European Science Foundation Working Group on "Oceans and Human Health" has been charged with developing a position paper on this topic with a view to identifying the scientific, social and economic challenges and making recommendations to the EU on policy-relevant research and development activities in this arena. This paper includes the background to health-related issues linked to the coastal environment and highlights the main arguments for an ecosystem-based whole systems approach.
ChalkBoard: Mapping Functions to Polygons
Matlage, Kevin; Gill, Andy
ChalkBoard is a domain specific language for describing images. The ChalkBoard language is uncompromisingly functional and encourages the use of modern functional idioms. ChalkBoard uses off-the-shelf graphics cards to speed up rendering of functional descriptions. In this paper, we describe the design of the core ChalkBoard language, and the architecture of our static image generation accelerator.
Advisory Boards: Gateway to Business Engagement
Meeder, Hans; Pawlowski, Brett
2012-01-01
Interest has been growing in how to build or manage an effective business advisory board. Developing an advisory board is crucial to keeping CTE programs relevant and viable by engaging the support of business and industry. This article delves into how to build and manage a board, and how to re-energize boards that already exist but may be lacking.
Why Not Charter School Boards?
Schlechty, Phillip C.; Cole, Robert W.
1993-01-01
Claiming that individual school board members act in selfish ways, proposes electing entire school board as a slate. Board would collectively be held responsible for performance of the school system and all of its employees. State legislation would be required to specify how interested groups would select a slate and create a charter, which is the…
Association of Regulatory Boards of Optometry
... website of the Association of Regulatory Boards of Optometry (ARBO). ARBO's web site is designed to provide resources to regulatory boards of optometry throughout the world. State/Provincial/Territorial Boards of ...
2003-01-01
The Joint Advisory Appeals Board was convened to examine the appeal lodged by Mr Poul Frandsen concerning his assimilation into the new career structure. As the appellant has not objected, the report of the Board and the final decision of the Director-General are brought to the notice of the personnel in accordance with Article R VI 1.20 of the Staff Regulations. The relevant documents will therefore be posted on the notice boards of the Administration Building (N° 60) from 13 to 24 January 2003. Human Resources Division Tel. 74128
Personnel Division
1999-01-01
The Joint Advisory Appeals Board was convened to examine the appeal lodged by Mr Joào Bento with regard to residential category. As the appellant has not objected, the recommendations of the Board and the final decision of the Director-General are brought to the notice of the personnel in accordance with Article RÊVIÊ1.20 of the Staff Regulations.The relevant documents will therefore be posted on the notice boards of the Administration Building (N¡ 60) from 29 October to 12 November 1999.Personnel DivisionTel. 74128
HR Department
2006-01-01
The Joint Advisory Appeals Board was convened to examine an appeal lodged by a member of the personnel with regard to advancement. The person concerned has requested that the report of the Board and the final decision of the Director-General be brought to the notice of the personnel in accordance with Article R VI 1.20 of the Staff Regulations. The relevant documents will therefore be posted on the notice boards of the Administration Building (No. 60) from 24 March to 10 April 2006. Human Resources Department Tel. 74128
Human Resources Division
2002-01-01
The Joint Advisory Appeals Board was convened to examine the appeal lodged by Mr Jack Blanchard with regard to 'non recognition of specific functions'. As the appellant has not objected, the report of the Board and the final decision of the Director-General are brought to the notice of the personnel in accordance with Article R VI 1.20 of the Staff Regulations. The relevant documents will therefore be posted on the notice boards of the Administration Building (N° 60) from 12th to 26th April 2002. Human Resources Division Tel. 74128
2004-01-01
The Joint Advisory Appeals Board was convened to examine the appeal lodged by Mrs Maria DIMOU with regard to a periodic one-step increase. As the appellant has not objected, the report of the Board and the final decision of the Director-General are brought to the notice of the personnel in accordance with Article R VI 1.20 of the Staff Regulations. The relevant documents will therefore be posted on the notice boards of the Administration Building (N° 60) from 30 April to 14 May 2004. Human Resources Department Tel. 74128
Human Resources Division
2001-01-01
The Joint Advisory Appeals Board was convened to examine the appeal lodged by Mr Joël Lahaye with regard to non-resident allowance. As the appellant has not objected, the report of the Board and the final decision of the Director-General are brought to the notice of the personnel in accordance with Article R VI 1.20 of the Staff Regulations. The relevant documents will therefore be posted on the notice boards of the Administration Building (N° 60) from 18 May to 1st June 2001.
Human Resources Division
2002-01-01
The Joint Advisory Appeals Board was convened to examine the appeal lodged by Mr Bertrand Nicquevert with regard to the non-resident allowance. As the appellant has not objected, the report of the Board and the final decision of the Director-General are brought to the notice of the personnel in accordance with Article R VI 1.20 of the Staff Regulations. The relevant documents will therefore be posted on the notice boards of the Administration Building (N° 60) from 29 November to 13 December 2002. Human Resources Division Tel. 74128
Human Resources Division
2002-01-01
The Joint Advisory Appeals Board was convened to examine the appeal lodged by Mr Antonio Millich with regard to advancement. As the appellant has not objected, the report of the Board and the final decision of the Director-General are brought to the notice of the personnel in accordance with Article R VI 1.20 of the Staff Regulations. The relevant documents will therefore be posted on the notice boards of the Administration Building (N° 60) from 27 September to 11 October 2002. Human Resources Division Tel. 74128
Human Resources Department
2005-01-01
The Joint Advisory Appeals Board was convened to examine an appeal lodged by a member of the personnel with regard to a periodic one-step increase. As the appellant has not objected, the report of the Board and the final decision of the Director-General are brought to the notice of the personnel in accordance with Article R VI 1.20 of the Staff Regulations. The relevant documents will therefore be posted on the notice boards of the Administration Building (N° 60) from 1 to 15 April 2005. Human Resources Department Tel. 74128
Human Resources Division
2002-01-01
The Joint Advisory Appeals Board was convened to examine the appeal lodged by Mr Gert Jan Bossen with regard to dependent child allowance. As the appellant has not objected, the report of the Board and the final decision of the Director-General are brought to the notice of the personnel in accordance with Article R VI 1.20 of the Staff Regulations. The relevant documents will therefore be posted on the notice boards of the Administration Building (N° 60) from 1st to 15 March 2002. Human Resources Division Tel. 74128
Human Resources Division
2002-01-01
The Joint Advisory Appeals Board was convened to examine the appeal lodged by Mr Serge Peraire with regard to exceptional advancement. As the appellant has not objected, the report of the Board and the final decision of the Director-General are brought to the notice of the personnel in accordance with Article R VI 1.20 of the Staff Regulations. The relevant documents will therefore be posted on the notice boards of the Administration Building (N° 60) from 17 to 31 May 2002. Human Resources Division Tel. 74128
Argyle, Andrew
2009-01-01
Step-by-step instructions for making your own PCBs at home. Making your own printed circuit board (PCB) might seem a daunting task, but once you master the steps, it's easy to attain professional-looking results. Printed circuit boards, which connect chips and other components, are what make almost all modern electronic devices possible. PCBs are made from sheets of fiberglass clad with copper, usually in multiplelayers. Cut a computer motherboard in two, for instance, and you'll often see five or more differently patterned layers. Making boards at home is relatively easy
James N Gray–An eScience Visionary
Indian Academy of Sciences (India)
Resonance – Journal of Science Education. Current Issue : Vol. 23, Issue 4. Current Issue Volume 23 | Issue 4. April 2018. Home · Volumes & Issues · Categories · Special Issues · Search · Editorial Board · Information for Authors · Subscription ...
Resonance – Journal of Science Education | News
Indian Academy of Sciences (India)
Resonance – Journal of Science Education. Current Issue : Vol. 23, Issue 4. Current Issue Volume 23 | Issue 4. April 2018. Home · Volumes & Issues · Categories · Special Issues · Search · Editorial Board · Information for Authors · Subscription ...
1995-01-01
In April 1994 the National Research Council received a request from NASA that the NRC's Space Studies Board provide guidance on questions relating to the management of NASA's programs in the space sciences. The issues raised in the request closely reflect questions posed in the agency's fiscal year 1994 Senate appropriations report. These questions included the following: Should all the NASA space science programs be gathered into a 'National Institute for Space Science'? What other organizational changes might be made to improve the coordination and oversight of NASA space science programs? What processes should be used for establishing interdisciplinary science priorities based on scientific merit and other criteria, while ensuring opportunities for newer fields and disciplines to emerge? And what steps could be taken to improve utilization of advanced technologies in future space scienc missions? This report details the findings of the Committee on the Future of Space Science (FOSS) and its three task groups: the Task Group on Alternative Organizations, Task Group on Research Prioritization, and the Task Group on Technology.
Sadhana | Indian Academy of Sciences
Indian Academy of Sciences (India)
The journal covers all branches of engineering science and technology ... to more than one professional group, either because the work is fundamental ... 2016 onwards: 12 issues a year; Impact Factor (2016): 0.465 ... Home · Volumes & Issues · Special Issues · Search · Editorial Board · Information for Authors · Subscription ...
The Kostyuk report: Corporate board practices in Ukraine
Directory of Open Access Journals (Sweden)
Alexander N. Kostyuk
2005-01-01
Full Text Available The author reports on the corporate board practices in Ukraine. The roles of board of directors are mainly about control. The strategic and advisory roles are not developed. The mode of strategic involvement of the members of supervisory boards in Ukraine is mainly about reviewing and approving. Thus, the board of directors in Ukraine is "a rubber stamp". The degree of independence of directors is very low. Major board practices in Ukraine are: small number of independent directors on the board; low frequency of meeting of the board; small number of committees on the board; the management board influences the supervisory board. Board practices in Ukraine need a sort of recommendations, similar to those, made in UK at the end of 1990s, and at the start of the third millennium.
Fermilab Friends for Science Education | Calendar
Fermilab Friends for Science Education FFSE Home About Us Join Us Support Us Contact Us Calendar Directors Board Tools Calendar Join Us Donate Now Get FermiGear! Education Office Search Programs Calendar Join Us/Renew Membership Forms: Online - Print Support Us Donation Forms: Online - Print Tree of
Fermilab Friends for Science Education | Mission
Fermilab Friends for Science Education FFSE Home About Us Join Us Support Us Contact Us Mission Directors Board Tools Calendar Join Us Donate Now Get FermiGear! Education Office Search Programs Calendar Join Us/Renew Membership Forms: Online - Print Support Us Donation Forms: Online - Print Tree of
Internationalilzation of the Firm and its Board
DEFF Research Database (Denmark)
Oxelheim, Lars; Gregoric, Aleksandra; Randøy, Trond
competencies required by firm internationalization positively affect board internationalization, whereas the impact of the internationalization of a firm’s commercial operations is positive but not significant across all model specifications. We find that the higher the number of national board members......, the amount of foreigners on the nomination committee also positively relates to the number of foreigners on the board. Rather than age, the median board tenure negatively impacts the prevalence of foreigners on the supervisory board. This barrier to board internationalization may reflect conservatism, fear...
Debate on science and technology promotion for overcoming economic crisis
International Nuclear Information System (INIS)
1990-05-01
This book records debate point and topic presentation of debate on science and technology promotion for overcoming economic difficulties which lists opening greeting, topic presentation such as innovation of national science technology system, sufficient supply and demand of science and engineering personnel, invigoration of technology research of corporation and general debate. This debate was held by the Policy Board of democratic and liberal party on 22 May 1990 in Press center.
The design of Eco Board Games as an umbrella approach to sustainable product design education
DEFF Research Database (Denmark)
Boks, Casper; McAloone, Tim C.
2009-01-01
The multidisciplinarity and quickly broadening scope of sustainable product design education provide incentives for experimentation with different pedagogical techniques. One of these, involving the development of eco board games, has been used at both the Technical University Denmark and the Nor......The multidisciplinarity and quickly broadening scope of sustainable product design education provide incentives for experimentation with different pedagogical techniques. One of these, involving the development of eco board games, has been used at both the Technical University Denmark...... and the Norwegian University of Science and Technology. This paper aims to reflect on the experiences, in terms of ratonales, learning goals, possible variations of the exercise, delivered course work, and future ambitions....
78 FR 4838 - Science Advisory Board; Notice of Public Meeting
2013-01-23
... Atmospheric Administration (NOAA) science programs are of the highest quality and provide optimal support to...) Presentation of the final report from Research and Development Portfolio Review Task Force; and (2) Review of...
76 FR 42750 - National Science Board: Sunshine Act Meetings; Notice
2011-07-19
... DISCUSSED: Thursday, July 28, 2011 Chairman's Introduction Open Session: 7:40-7:45 a.m., Room 1235...: Authorization to Fund Petascale Computing Committee on Science and Engineering Indicators (SEI) Open Session: 11...
Adeyinka Theresa Ajayi; Ajibade Idowu Samuel; Oladiti Abiodun Akeem
2017-01-01
Marketing Board system was one of the mechanisms of British colonial policy in Nigeria. Primary products were channeled through the Boards to Europe at the expense of both the Nigerian state and the farmers, the producers of these commodities. This study examines produce buying via Marketing Boards in Nigeria and specifically interrogates the fiscal role of Western Nigeria Marketing Board. It argues that the Marketing Boards, in spite of their exploitative nature was beneficial to the regiona...
Saatcioglu, Argun; Moore, Suzanne; Sargut, Gokce; Bajaj, Aarti
2011-01-01
Social capital refers to the nature of ties within a social unit, as well as the unit's external relationships. We draw from organizational sociology and political science, and also build upon existing insights in school board research, to offer an approach that address the effects of "bonding" (internal ties) and "bridging"…
GOVERNING BOARD OF THE PENSION FUND
2004-01-01
The Governing Board held its 120th and 121st meetings on 4 November and 2 December 2003 respectively. At the first of these two meetings, the Board first continued its examination of ESO's requests. In connection to this, the Board heard a presentation of the requests by M. Bloch, ESO's Head of Personnel, including a proposal that ESO's contributions and benefits to its beneficiaries be paid in euros. This option had previously been examined by the Working Group on ESO's Requests which had submitted a negative opinion to the Governing Board. Mr Bloch informed the Board that ESO was suspending that request and therefore invited the Governing Board to concentrate on the other options. After some discussion, the Governing Board decided that the euro-based request should be deemed withdrawn and that the Working Group would resume its examination of the other options put forward by ESO at the beginning of the year. At the same meeting, J.-P. Matheys reported on the recent meeting of the Working Group on Actuarial...
HR Department
2007-01-01
The Joint Advisory Appeals Board was convened to examine an internal appeal lodged by a member of the personnel with regard to the decision not to grant him an indefinite contract. The person concerned has requested that the report of the Board and the final decision of the Director-General be brought to the notice of the members of the personnel, in accordance with Article R VI 1.18 of the Staff Regulations. The relevant documents will therefore be posted on the notice board of the Main building (Bldg. 60) from 24 September to 7 October 2007. Human Resources Department
2003-01-01
The Joint Advisory Appeals Board was convened to examine the appeal lodged by Mrs Judith Igo-Kemenes concerning the application of procedures foreseen by Administrative Circular N§ 26 (Rev. 3). As the appellant has not objected, the report of the Board and the final decision of the Director-General are brought to the notice of the personnel in accordance with Article R VI 1.20 of the Staff Regulations. The relevant documents will therefore be posted on the notice boards of the Administration Building (N° 60) from 6 to 20 June 2003. Human Resources Division Tel. 74128
HR Department
2008-01-01
The Joint Advisory Appeals Board has examined the internal appeal lodged by a member of the personnel with regard to the decision not to grant him an indefinite contract. The person concerned has not objected to the report of the Board and the final decision of the Director-General being brought to the notice of the members of the personnel. In application of Article R VI 1.18 of the Staff Regulations, these documents will therefore be posted on the notice board of the Main Building (Bldg. 500) from 26 May to 6 June 2008. Human Resources Department (73911)
HR Department
2008-01-01
The Joint Advisory Appeals Board was convened to examine an internal appeal lodged by a member of the personnel with regard to the decision not to grant him an indefinite contract. The person concerned has not objected to the report of the Board and the final decision of the Director-General being brought to the notice of the members of the personnel, in accordance with Article R VI 1.18 of the Staff Regulations. These documents will therefore be posted on the notice board of the Main Building (Bldg. 60) from 21 January to 3 February 2008. Human Resources Department (73911)
Corporate boards and bank loan contracting
Francis, Bill; Hasan, Iftekhar; Koetter, Michael; Wu, Qiang
2012-01-01
We investigate the role of corporate boards in bank loan contracting. We find that when corporate boards are more independent, both price and nonprice loan terms (e.g., interest rates, collateral, covenants, and performance-pricing provisions) are more favorable, and syndicated loans comprise more lenders. In addition, board size, audit committee structure, and other board characteristics influence bank loan prices. However, they do not consistently affect all nonprice loan terms except for a...
Cultural differences and board gender diversity
Carrasco , Amélia; Francoeur , Claude; Réal , Isabelle; Laffarga , Joaquina; Ruiz-Barbadillo , Emiliano
2012-01-01
International audience; As evidence of the continuing interest raised by "board gender diversity", major studies (Catalyst, 2008; World Economic Forum, 2010; European Board Diversity Analysis, 2010) were recently carried out and have all led to reports confirming the imbalance of women on boards and the need to address this issue. Moreover, our analysis of these reports indicates that the low proportion of women observed on corporate boards varies across countries, which raises the question a...
George, Anna Ray Bayless
A study was conducted to determine the relationship between the credentials held by science teachers who taught at a school that administered the Science Texas Assessment on Knowledge and Skills (Science TAKS), the state standardized exam in science, at grade 11 and student performance on a state standardized exam in science administered in grade 11. Years of teaching experience, teacher certification type(s), highest degree level held, teacher and school demographic information, and the percentage of students who met the passing standard on the Science TAKS were obtained through a public records request to the Texas Education Agency (TEA) and the State Board for Educator Certification (SBEC). Analysis was performed through the use of canonical correlation analysis and multiple linear regression analysis. The results of the multiple linear regression analysis indicate that a larger percentage of students met the passing standard on the Science TAKS state attended schools in which a large portion of the high school science teachers held post baccalaureate degrees, elementary and physical science certifications, and had 11-20 years of teaching experience.
International Nuclear Information System (INIS)
2009-01-01
At the request of the outgoing Chairperson of the Board of Governors, her statement delivered in the Board of Governors meeting on 22 September 2009, regarding the working arrangements of the Board, is reproduced herewith for information
Vandenbrouke, Elien; Knockaert, Mirjam; Ucbasaran, Deniz
2017-01-01
Corporate governance research has extensively studied the relationship between outside board characteristics and outside board involvement. We add to this literature by investigating the extent to which interactions between outside board members and the top management team (TMT) affect the functioning of the outside board. Building on conflict theory, our study shows how conflict between TMT and outside board is an important antecedent for outside board service involvement. Specifically, draw...
Sokoto Journal of Veterinary Sciences: Submissions
African Journals Online (AJOL)
Author Guidelines. The Editorial Board of the Sokoto Journal of Veterinary Sciences (SJVS) wishes to invite research articles, case reports and review articles for ... be accompanied by a cover letter verifying that the final manuscript has been seen and approved by all authors and transferring copyright ownership to SJVS.
Board Size, Non-Executive Board Members and Financial Performance in Non-Usury Banks in Iran
Directory of Open Access Journals (Sweden)
GholamReza Karami
2016-07-01
Full Text Available Prior studies investigating the relation between the financial performance and corporate governance mechanisms for firms in Tehran Stock Exchange mainly exclude banks due to their different types of rules and structure. We study the relation between corporate governance structure and financial performance of the banks under the non-usury banking act. We study various corporate governance factors including board size and the number of non-executive board members using a sample of 21 banks for 2010 to 2012. Result show a significant positive correlation among board size and financial performance. However, non-executive board members do not correlate with financial performance.
Energy Technology Data Exchange (ETDEWEB)
Alexander, Catherine [U.S. Dept. of Energy, Office of Environmental Management, Office of Intergovernmental and Community Activities, 1000 Independence Avenue, S.W.,Washington, D.C. 20585 (United States); Freeman, Jenny [Strata-G, LLC, 2027 Castaic Lane, Knoxville, TN 37932 (United States); Cantrell, Yvette [Restoration Services, Inc., 136 Mitchell Road, Oak Ridge, TN 37830 (United States)
2013-07-01
The charter for the Department of Energy's Environmental Management (EM) Site-Specific Advisory Board (SSAB) was approved under the Federal Advisory Committee Act (FACA) in 1994. With a unique mandate to provide public input on issues associated with the cleanup of nuclear legacy sites in the U.S., the EM SSAB comprises eight local boards, which are based at major EM sites. While each board is unique to the community in which it is located and reflects the diversity of the local population, the boards are governed by FACA, related regulations, and DOE policies that are intended to standardize agency advisory board operations. The EM SSAB local boards are made up of a diverse group of citizens who want to understand the mission and goals of the EM program and to help EM achieve those goals for the benefit of their communities. Some are quite passionate about their mission; others need to be coaxed into active participation. Maintaining productive relationships and a supportive environment for effective board operations is the challenge of board management for DOE EM and the board members themselves. DOE draws on research findings and best practices literature from academics and practitioners in the field of public involvement in its board management practices. The EM SSAB is also evaluated annually under the law to ensure that the investment of taxpayer dollars in the board is warranted in light of the contributions of the board. Further evaluation takes place at the agency and site levels in order to identify what aspects of board functioning the agency and board members find important to its success and to address areas where improvement is needed. Board contributions, compliance factors, and measurable outcomes related to board products and process areas are key to agency commitment to ongoing support of the boards and to participant satisfaction and thus continued member involvement. In addition to evaluation of these factors in improving board
Editorial introduction. Special Issue for the European Academy of Forensic Science
Meuwly, Didier; Meuwly, D.
2013-01-01
On behalf of the Editorial Board, I would like to welcome you to this special edition of Forensic Science International. It commemorates the conference of the European Academy of Forensic Science held in The Hague from August 20th to 24th 2012 and reflects the diversity and the scientific level
Optimal back-to-front airplane boarding
Bachmat, Eitan; Khachaturov, Vassilii; Kuperman, Ran
2013-06-01
The problem of finding an optimal back-to-front airplane boarding policy is explored, using a mathematical model that is related to the 1+1 polynuclear growth model with concave boundary conditions and to causal sets in gravity. We study all airplane configurations and boarding group sizes. Optimal boarding policies for various airplane configurations are presented. Detailed calculations are provided along with simulations that support the main conclusions of the theory. We show that the effectiveness of back-to-front policies undergoes a phase transition when passing from lightly congested airplanes to heavily congested airplanes. The phase transition also affects the nature of the optimal or near-optimal policies. Under what we consider to be realistic conditions, optimal back-to-front policies lead to a modest 8-12% improvement in boarding time over random (no policy) boarding, using two boarding groups. Having more than two groups is not effective.
Optimal back-to-front airplane boarding.
Bachmat, Eitan; Khachaturov, Vassilii; Kuperman, Ran
2013-06-01
The problem of finding an optimal back-to-front airplane boarding policy is explored, using a mathematical model that is related to the 1+1 polynuclear growth model with concave boundary conditions and to causal sets in gravity. We study all airplane configurations and boarding group sizes. Optimal boarding policies for various airplane configurations are presented. Detailed calculations are provided along with simulations that support the main conclusions of the theory. We show that the effectiveness of back-to-front policies undergoes a phase transition when passing from lightly congested airplanes to heavily congested airplanes. The phase transition also affects the nature of the optimal or near-optimal policies. Under what we consider to be realistic conditions, optimal back-to-front policies lead to a modest 8-12% improvement in boarding time over random (no policy) boarding, using two boarding groups. Having more than two groups is not effective.
2013-05-14
... DEPARTMENT OF VETERANS AFFAIRS Joint Biomedical Laboratory Research and Development and Clinical Science Research and Development Services Scientific Merit Review Board; Notice of Meetings; Amendment The... Joint Biomedical Laboratory Research and Development and Clinical Science Research and Development...
Directory of Open Access Journals (Sweden)
Alyssa H. Cho
2014-08-01
Full Text Available Despite women earning similar numbers of graduate degrees as men in STEM disciplines, they are underrepresented in upper level positions in both academia and industry. Editorial board memberships are an important example of such positions; membership is both a professional honor in recognition of achievement and an opportunity for professional advancement. We surveyed 10 highly regarded journals in environmental biology, natural resource management, and plant sciences to quantify the number of women on their editorial boards and in positions of editorial leadership (i.e., Associate Editors and Editors-in-Chief from 1985 to 2013. We found that during this time period only 16% of subject editors were women, with more pronounced disparities in positions of editorial leadership. Although the trend was towards improvement over time, there was surprising variation between journals, including those with similar disciplinary foci. While demographic changes in academia may reduce these disparities over time, we argue journals should proactively strive for gender parity on their editorial boards. This will both increase the number of women afforded the opportunities and benefits that accompany board membership and increase the number of role models and potential mentors for early-career scientists and students.
VME bus based microcomputer system boards
International Nuclear Information System (INIS)
Chandra, A.K.; Ganesh, G.; Mayya, Anuradha; Chachondia, A.S.; Premraj, M.K.
1991-01-01
Several operator information systems for nuclear plants has been developed in the Division and these have involved extensive use of microcomputer boards for achieving various functions. Standard VME bus based boards have been developed to provide the most used functions. These boards have been fabricated and tested and used in several systems including Channel Temperature Monitoring systems, Disturbance Recording Systems etc. and are also proposed to be used in additional systems under developement. The use of standard bus and boards provides considerable savings in engineering time, prototyping, testing and evaluation costs, and maintenance support. This report desribes the various boards developed and the functions available on each. (author). 4 refs., 11 figs., 3 appendixes
From Global Firms to Global Boards?
DEFF Research Database (Denmark)
Thomsen, Steen; Gregoric, Aleksandra; Randøy, Trond
2011-01-01
. This indicates some support for the view that different kinds of firm internationalization – commercial versus financial - might lead to different types of board internationalization. We find no evidence that the internationalization of boards is limited by the conservatism of existing national board members...
Gender Distribution Among American Board of Medical Specialties Boards of Directors.
Walker, Laura E; Sadosty, Annie T; Colletti, James E; Goyal, Deepi G; Sunga, Kharmene L; Hayes, Sharonne N
2016-11-01
Since 1995, women have comprised more than 40% of all medical school graduates. However, representation at leadership levels in medicine remains considerably lower. Gender representation among the American Board of Medical Specialties (ABMS) boards of directors (BODs) has not previously been evaluated. Our objective was to determine the relative representation of women on ABMS BODs and compare it with the in-training and in-practice gender composition of the respective specialties. The composition of the ABMS BODs was obtained from websites in March 2016 for all Member Boards. Association of American Medical Colleges and American Medical Association data were utilized to identify current and future trends in gender composition. Although represented by a common board, neurology and psychiatry were evaluated separately because of their very different practices and gender demographic characteristics. A total of 25 specialties were evaluated. Of the 25 specialties analyzed, 12 BODs have proportional gender representation compared with their constituency. Seven specialties have a larger proportion of women serving on their boards compared with physicians in practice, and 6 specialties have a greater proportion of men populating their BODs. Based on the most recent trainee data (2013), women have increasing workforce representation in almost all specialties. Although women in both training and practice are approaching equal representation, there is variability in gender ratios across specialties. Directorship within ABMS BODs has a more equitable gender distribution than other areas of leadership in medicine. Further investigation is needed to determine the reasons behind this difference and to identify opportunities to engage women in leadership in medicine. Copyright © 2016 Mayo Foundation for Medical Education and Research. Published by Elsevier Inc. All rights reserved.
Plasma Science Committee (PLSC)
International Nuclear Information System (INIS)
1990-01-01
The Plasma Science Committee (PLSC) is a standing committee under the auspices of the Board on Physics and Astronomy, Commission on Physical Sciences, Mathematics, and Applications of the National Academy of Sciences--National Research Council. Plasma sciences represent a broad and diverse field. The PLSC has accepted the responsibility of monitoring the continuing development and assessing the general health of the field as whole. Although select advisory bodies have been created to address specific issues that affect plasma science, such as the Fusion Policy Advisory Committee (FPAC), the PLSC provides a focus for the plasma science community that is unique and essential. The membership of the PLSC is drawn from research laboratories in universities, industry, and government. Areas of expertise on the committee include accelerators and beams, space physics, astrophysics, computational physics and applied mathematics, fusion plasmas, fundamental experiments and theory, radiation sources, low temperature plasmas, and plasma-surface interactions. The PLSC is well prepared to respond to requests for studies on specific issues. This report discusses ion of the PLSC work
Busyairi AS, M.
2017-01-01
Islamic Boarding School which serves as native Islamic education institution is a continuation of education tradition grown strongly in Islamization history in unitary nation Republic of Indonesia. The education of Islamic Boarding School is also a sub-system of National Education with the purpose to make intelligent national life, to make…
14 CFR 250.8 - Denied boarding compensation.
2010-01-01
... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Denied boarding compensation. 250.8 Section... PROCEEDINGS) ECONOMIC REGULATIONS OVERSALES § 250.8 Denied boarding compensation. (a) Every carrier shall tender to a passenger eligible for denied boarding compensation, on the day and place the denied boarding...
Governing Board of the Pension Fund
2004-01-01
The Governing Board of the Pension Fund held its one-hundred-and-twenty-seventh meeting on 4, 5 and 6 October. During the meeting, the Governing Board heard a report by the actuary on the Actuarial Review as at 1 January 2004. The Governing Board then examined the conclusions to be drawn and the action to be taken as a result of the Review. During its first half-day meeting the Board heard a report on the meetings of the CERN Finance Committee and Council on 15 and 16 September. As a result, the Board asked its Chairman to consult the President of the CERN Council in order to find out about the terms of reference and the composition of the working group on pensions set up by the Council. Next the Board examined a request for compensation to the Fund for the reduction in active members between 2001 and 2003. It was the third such request which the Governing Board would be making to the CERN Council following the latter's 1995 decision to reduce staff numbers. The request related to the previous three years (...
Currency Boards; The Ultimate Fix?
Atish R. Ghosh
1998-01-01
The growing integration of world capital markets has made it fashionable to argue that only extreme exchange rate regimes are sustainable. Short of adopting a common currency, currency board arrangements represent the most extreme form of exchange rate peg. This paper compares the macroeconomic performance of countries with currency boards to those with other forms of pegged exchange rate regime. Currency boards are indeed associated with better inflation performance, even allowing for potent...
HR Department
2008-01-01
The Joint Advisory Appeals Board has examined the internal appeal lodged by a member of the personnel against the decision to grant him only a periodic one-step advancement for the 2006 reference year. The person concerned has not objected to the report of the Board and the final decision of the Director-General being brought to the attention of the members of the personnel. In application of Article R VI 1.18 of the Staff Regulations, these documents will therefore be posted on the notice board of the Main building (bldg. 500) from 1 September to 14 September 2008. Human Resources Department (73911)
HR Department
2008-01-01
The Joint Advisory Appeals Board has examined the internal appeal lodged by a member of the personnel with regard to the decision not to award him a periodic one-step advancement for the 2006 reference year. The person concerned has not objected to the report of the Board and the final decision of the Director-General being brought to the notice of the members of the personnel. In application of Article R VI 1.18 of the Staff Regulations, these documents will therefore be posted on the notice board of the Main building (Bldg. 500) from 17 March to 30 March 2008. Human Resources Department Tel. 73911
HR Department
2008-01-01
The Joint Advisory Appeals Board has examined the internal appeal lodged by a member of the personnel against the decision to grant him only a periodic one-step advancement for the 2006 reference year. The person concerned has not objected to the report of the Board and the final decision of the Director-General being brought to the attention of the members of the personnel. In application of Article R VI 1.18 of the Staff Regulations, these documents will therefore be posted on the notice board of the Main Building (Bldg. 500) from 1 September to 14 September 2008. Human Resources Department (73911)
33 CFR 401.90 - Boarding for inspections.
2010-07-01
... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Boarding for inspections. 401.90... OF TRANSPORTATION SEAWAY REGULATIONS AND RULES Regulations General § 401.90 Boarding for inspections... approved means of boarding. Pigeon holes are not accepted as a means of boarding and an alternate safe...
Giesy, John P; Solomon, Keith R; Kacew, Sam; Mackay, Donald; Stobo, Gerald; Kennedy, Steven
2016-07-01
Technology and scientific advancements are accelerating changes in society at a pace that is challenging the abilities of government regulatory agencies and legal courts to understand the benefits and costs of these changes to humans, wildlife, and their environments. The social, economic, and political facets of concern, such as the potential effects of chemicals, complicate the preparation of regulatory standards and practices intended to safeguard the public. Court judges and attorneys and, in some cases, lay juries are tasked with interpreting the data and implications underlying these new advancements, often without the technical background necessary to understand complex subjects and subsequently make informed decisions. Here, we describe the scientific-quasi-judicial process adopted in Canada under the Canadian Environmental Protection Act, 1999, which could serve as a model for resolving conflicts between regulatory agencies and the regulated community. An example and process and lessons learned from the first Board of Review, which was for decamethylcyclopentasiloxane (D5; CAS# 541-02-06), are provided. Notable among these lessons are: 1) the need to apply state-of-the-science insights into the regulatory process, 2) to encourage agencies to continuously review and update their assessment processes, criteria, and models, and 3) provide these processes in guidance documents that are transparent and available to all stakeholders and generally foster closer cooperation between regulators, the academic community, industry, and nongovernment organizations (NGOs). Integr Environ Assess Manag 2016;12:572-579. © 2015 SETAC. © 2015 SETAC.
Halladay, Jacqueline R; Donahue, Katrina E; Sleath, Betsy; Reuland, Dan; Black, Adina; Mitchell, C Madeline; Breland, Carol E; Coyne-Beasley, Tamera; Mottus, Kathleen; Watson, Sable Noelle; Lewis, Virginia; Wynn, Mysha; Corbie-Smith, Giselle
2017-01-01
Engaging stakeholders in research carries the promise of enhancing the research relevance, transparency, and speed of getting findings into practice. By describing the context and functional aspects of stakeholder groups, like those working as community advisory boards (CABs), others can learn from these experiences and operationalize their own CABs. Our objective is to describe our experiences with diverse CABs affiliated with our community engagement group within our institution's Clinical Translational Sciences Award (CTSA). We identify key contextual elements that are important to administering CABs. A group of investigators, staff, and community members engaged in a 6-month collaboration to describe their experiences of working with six research CABs. We identified the key contextual domains that illustrate how CABS are developed and sustained. Two lead authors, with experience with CABs and identifying contextual domains in other work, led a team of 13 through the process. Additionally, we devised a list of key tips to consider when devising CABs. The final domains include (1) aligned missions among stakeholders (2) resources/support, (3) defined operational processes/shared power, (4) well-described member roles, and (5) understanding and mitigating challenges. The tips are a set of actions that support the domains. Identifying key contextual domains was relatively easy, despite differences in the respective CAB's condition of focus, overall mission, or patient demographics represented. By contextualizing these five domains, other research and community partners can take an informed approach to move forward with CAB planning and engaged research.
International Nuclear Information System (INIS)
Utes, M.
1997-01-01
The SVX Sequencer boards are 9U by 280mm circuit boards that reside in slots 2 through 21 of each of eight Eurocard crates in the D0 Detector Platform. The basic purpose is to control the SVX chips for data acquisition and when a trigger occurs, to gather the SVX data and relay the data to the VRB boards in the Movable Counting House. Functions and features are as follows: (1) Initialization of eight SVX chip strings using the MIL-STD-1553 data bus; (2) Real time manipulation of the SVX control lines to effect data acquisition, digitization, and readout based on the NRZ/Clock signals from the Controller; (3) Conversion of 8-bit electrical SVX readout data to an optical signal operating at 1.062 Gbit/sec, sent to the VRB. Eight HDIs will be serviced per board; (4) Built-in logic analyzer which can record the most important control and data lines during a data acquisition cycle and put this recorded information onto the 1553 bus; (5) Identification header and end of data trailer tacked onto data stream; (6) 1553 register which can read the current values of the control and data lines; (7) 1553 register which can test the optical link; (8) 1553 registers for crossing pulse width, calibration pulse voltage, and calibration pipeline select; (9) 1553 register for reading the optical drivers status link; (10) 1553 register for power control of SVX chips and ignoring bad SVX strings; (11) Front panel displays and LEDs show the board status at a glance; (12) In-system programmable EPLDs are programmed via 1553 or Altera's 'Bitblaster'; (13) Automatic readout abort after 45us; (14) Supplies BUSY signal back to Trigger Framework; (15) Supports a heartbeat system to prevent excessive SVX current draw; and (16) Supports a SVX power trip feature if heartbeat failure occurs.
Optimal boarding method for airline passengers
Energy Technology Data Exchange (ETDEWEB)
Steffen, Jason H.; /Fermilab
2008-02-01
Using a Markov Chain Monte Carlo optimization algorithm and a computer simulation, I find the passenger ordering which minimizes the time required to board the passengers onto an airplane. The model that I employ assumes that the time that a passenger requires to load his or her luggage is the dominant contribution to the time needed to completely fill the aircraft. The optimal boarding strategy may reduce the time required to board and airplane by over a factor of four and possibly more depending upon the dimensions of the aircraft. I explore some features of the optimal boarding method and discuss practical modifications to the optimal. Finally, I mention some of the benefits that could come from implementing an improved passenger boarding scheme.
Scheetz, Nanci A; Martin, David S
2006-01-01
THE STUDY was designed to identify specific components of teacher excellence, focusing initially on the characteristics of the small number of teachers of the deaf who are certified by the National Board for Professional Teaching Standards (NBPTS), then comparing those with the characteristics of other teachers identified as master teachers by university faculty in teacher preparation in deafness. Classroom observation, written lesson plans, teacher questionnaires on beliefs, and content analysis of interactive electronic focus groups were used to compare the two groups of teachers. Results indicated similarities between Board-certified and non-Board-certified master teachers in regard to teacher behaviors and commitment to well-founded pedagogical principles. Differences were found in classroom priorities and in the greater level of interconnectivity expressed by Board-certified teachers as the result of becoming Board certified. Recommendations are made for preparing teachers of deaf students.
76 FR 55422 - National Science Board; Sunshine Act Meetings; Notice
2011-09-07
...: Jennie L. Moehlmann, [email protected] , (703) 292-7000. PUBLIC AFFAIRS CONTACT: Dana Topousis, dtopousi.... Phil Stokes, SAGUARO Program. Dr. Jennie Scott, Director of Curriculum and Articulation Services, Pima... Professor, School of Life Science, Arizona State University. CSB Subcommittee on Facilities (SCF) Open...
Are board meetings proactive or reactive to performance?
Directory of Open Access Journals (Sweden)
Yi Wang
2008-11-01
Full Text Available The purpose of this paper is to investigate the relationship between the intensity of board activity, as represented by board meeting frequency, and firm financial performance, using data from the top 500 Australian companies. Firm performance measures include return on assets, return on equity and shareholder return; several control variables are introduced in the analysis. The results indicate that board meeting frequency has a positive impact on subsequent shareholder return. Regarding the explanatory factors for the level of board activity, it is reported that firms with more board committees tend to have relatively more board and committee meetings; firms with larger boards have less board meetings. In addition, lower managerial ownership leads to more committee meetings.
12 CFR 907.12 - Finance Board procedures.
2010-01-01
... 12 Banks and Banking 7 2010-01-01 2010-01-01 false Finance Board procedures. 907.12 Section 907.12 Banks and Banking FEDERAL HOUSING FINANCE BOARD FEDERAL HOUSING FINANCE BOARD ORGANIZATION AND OPERATIONS PROCEDURES Case-by-Case Determinations; Review of Disputed Supervisory Determinations § 907.12 Finance Board procedures. (a) Notice of Receipt...
Terrazas-Arellanes, Fatima E.; Knox, Carolyn; Walden, Emily
2015-01-01
The 2006 National Science Board called for new strategies and instructional materials for teachers to better serve English Learners' (EL) needs. Bilingual Collaborative Online Projects in science were created to assist ELs' construction of science knowledge, facilitate academic English acquisition, and improve science learning. Two bilingual…
42 CFR 426.489 - Board remands.
2010-10-01
... decision; and (2) Explains why the case is being remanded and the specific actions ordered by the Board. (b) Action by an ALJ on remand. An ALJ takes any action that is ordered by the Board and may take any additional action that is not inconsistent with the Board's remand order. ...
39 CFR 3.2 - Compensation of Board.
2010-07-01
... 39 Postal Service 1 2010-07-01 2010-07-01 false Compensation of Board. 3.2 Section 3.2 Postal Service UNITED STATES POSTAL SERVICE THE BOARD OF GOVERNORS OF THE U.S. POSTAL SERVICE BOARD OF GOVERNORS (ARTICLE III) § 3.2 Compensation of Board. Section 202(a)(1) of title 39 provides for the compensation of...
Presidential Search: An Overview for Board Members
Association of Governing Boards of Universities and Colleges, 2012
2012-01-01
The selection of a president is a governing board's most important responsibility, and the search process is the board's best opportunity to help guide its institution into a successful new era. This guide outlines the leadership roles during a search (those of the board, the board chair, the search committee, and others), briefs board…
12 CFR 985.4 - Finance Board oversight.
2010-01-01
... 12 Banks and Banking 7 2010-01-01 2010-01-01 false Finance Board oversight. 985.4 Section 985.4 Banks and Banking FEDERAL HOUSING FINANCE BOARD OFFICE OF FINANCE THE OFFICE OF FINANCE § 985.4 Finance Board oversight. (a) Oversight and enforcement actions. The Finance Board shall have the same regulatory oversight authority and enforcement powers...
Griffiths, Matt
2017-01-04
Ofsted inspects and regulates services that care for children and young people, including boarding facilities. Medication management is an integral part of caring for children in boarding schools, and robust systems must be in place to pass inspection. These systems must cover how medicines are dispensed, administered and stored at the facility, risk assessments, identifying which pupils can manage their own medicines and the individual health needs of boarders, so that care plans can be put in place for children with specific needs.
46 CFR 78.90-1 - Pilot boarding operation.
2010-10-01
... 46 Shipping 3 2010-10-01 2010-10-01 false Pilot boarding operation. 78.90-1 Section 78.90-1... Boarding Operations § 78.90-1 Pilot boarding operation. (a) The master shall ensure that pilot boarding... instructions. (b) The master shall ensure compliance with the following during pilot boarding operations: (1...
Human Resources Division
2001-01-01
The Joint Advisory Appeals Board was convened to examine the appeal lodged by Mr Neil Calder, Mrs Sudeshna Datta Cockerill, Mrs Andrée Fontbonne, Mrs Moniek Laurent and Mr Ulrich Liptow with regard to membership in the Pension Fund under the period with a Paid Associate contract, appeals dealt with on a collective basis. As the appellants have not objected, the report of the Board and the final decision of the Director-General are brought to the notice of the personnel in accordance with Article R VI 1.20 of the Staff Regulations. The relevant documents will therefore be posted on the notice boards of the Administration Building (N° 60) from 10 to 31 August 2001.
Women on professional society and journal editorial boards.
Morton, Melinda J; Sonnad, Seema S
2007-07-01
Membership on a professional medical society or journal editorial board is a marker of influence and prestige for those in academic medicine. This study presents the first comprehensive quantification of women on these boards and the implications for women in medicine. The numbers of women and men on professional society and journal editorial boards across 28 specialties (March 2004) were counted. The number of women holding multiple roles on these boards and the number of women holding top leadership positions on these boards were counted, and these proportions were compared. Three-thousand-four-hundred-seventy-three individuals on 39 professional medical society boards and 54 journal editorial boards were included. Eighty-three percent (2,884) of board members were male. Men occupied > 80% of top leadership positions on these boards. Thirty-five of the 589 women in the study held multiple roles. Anesthesiology (p women on boards in comparison to the total women in the specialty. Internal medicine, plastic surgery, cardiology and general surgery had nearly equivalent proportions; in otolaryngology and family medicine, female board members slightly exceeded the proportion of women in the field. Women's representation on society and editorial boards does not always reflect their presence in medical specialties, and it is critically lacking in certain specialties. Efforts should be made to attain parity of women leaders on these boards. Further efforts should be made to eliminate barriers to women's leadership in medicine.
International Nuclear Information System (INIS)
Blackman, N.S.; Gummer, W.K.
1982-02-01
This paper has been prepared to provide an overview of the responsibilities and activities of the Atomic Energy Control Board. It is designed to address questions that are often asked concerning the establishment of the Atomic Energy Control Board, its enabling legislation, licensing and compliance activities, federal-provincial relationships, international obligations, and communications with the public
Directory of Open Access Journals (Sweden)
Sandra Guerra
2008-01-01
Full Text Available Scholarly investigations on the board of directors, although intense from the mid-1990s onward, did not lead to entirely convincing results. This study proposes discussion on building a multidisciplinary and integrated theoretical framework able to capture the complexity and distinctive dimensions of the board as a group decision-making process. This is achieved through an essay developed from analytical and descriptive review of the literature. A synthesis on board research is presented, aiming to understand theoretical models lenses used to study corporate governance issues. The strengths and weaknesses of these models are pointed out, and their influence on board investigation is observed. This essay concludes by proposing a research agenda that considers the addition of psychological and sociological approaches to economic models of the analysis of group decision-making
How well-run boards make decisions.
Useem, Michael
2006-11-01
In the aftermath of seismic debacles like those that toppled Enron and WorldCom, corporate boards have been shaken up and made over. More directors are independent these days, for instance, and corporations now disclose directors' salaries and committee members' names. Research shows that most of the changes are having a positive effect on companies' performance. They are primarily structural, though, and don't go to the heart of a board's work: making the choices that shape a firm's future. Which decisions boards own and how those calls are made are largely hidden from the public. As a result, boards are often unable to learn from the best governance practices of their counterparts at other companies. This article pulls back the curtain and provides an inside look. Drawing on interviews with board members and executives at 31 companies, along with a close examination of three boardroom decisions, the author identifies several formal processes that can help companies improve their decision making: creating calendars that specify when the board and the standing committees will consider key items; drafting charters that define the decisions committees are responsible for; and developing decision protocols that divvy up responsibilities between directors and executives. The author also identifies a number of informal decision-making principles: Items that are strategically significant and touch on the firm's core values should go to the board. Large decisions should be divided into small pieces, so the board can devote sufficient attention to each one. Directors must remain vigilant to ensure that their decisions are effectively implemented. The CEO and either the nonexecutive chair or the lead director should engage in ongoing dialogue regarding which decisions to take to the full board and when. And directors should challenge assumptions before making yes-or-no decisions on management proposals.
12 CFR 980.6 - Finance Board consent.
2010-01-01
... 12 Banks and Banking 7 2010-01-01 2010-01-01 false Finance Board consent. 980.6 Section 980.6 Banks and Banking FEDERAL HOUSING FINANCE BOARD NEW FEDERAL HOME LOAN BANK ACTIVITIES NEW BUSINESS ACTIVITIES § 980.6 Finance Board consent. The Finance Board may at any time provide consent for a Bank to undertake a particular new business activity and...
Governing Board of the Pension Fund
2005-01-01
The Governing Board of the Pension Fund held its one-hundred-and-thirtieth meeting on 18 January 2005. At the meeting, it took note of the Preliminary Draft Report by the CERN Council Working Group on the procedures for the appointment of the Chairman and the terms of office of members appointed by the Council to the Governing Board of the Pension Fund (Osnes Report). As the report constituted a preliminary version, the Governing Board took the view that it was not appropriate for it to state its position on the content for the time being, especially since some aspects, particularly those relating to the procedure for the appointment of the Council's representatives fell within the latter's remit. Nevertheless, given that a number of the issues raised in the report also related to the general operation of the bodies of the Pension Fund (Governing Board, Investment Committee, Administrator), the Governing Board instructed its Chairman, J. Bezemer, to inform the Council, at its session in March, that the Board...
GOVERNING BOARD OF THE PENSION FUND
2002-01-01
The Governing Board held its 108th and 109th meetings on 5 February and 5 March respectively. At the first of these meetings, the Board heard a report by its Chairman, P. Levaux, on the CERN Council Session of December 2001. The Chairman reported that the Board that the 0.8% adjustment of pensions proposed by the Governing Board had been accepted as well as an amendment to the Rules of the Fund reducing the period of service required for entitlement to a deferred retirement pension from 10 to 5 years. The Governing Board also heard a report by the Chairman of the Investment Committee, G. Maurin, on the Committee's two January meetings. At the first of these, the Committee had addressed its structure and operating methods. Various proposals had been put forward aimed at increasing the Committee's efficiency and response time. Specific proposals will be submitted to the Governing Board during the year. In addition, on the basis of two specially commissioned studies, the Committee had examined the issue of curre...
4 CFR 22.2 - Board Consideration [Rule 2].
2010-01-01
... 4 Accounts 1 2010-01-01 2010-01-01 false Board Consideration [Rule 2]. 22.2 Section 22.2 Accounts... OFFICE CONTRACT APPEALS BOARD § 22.2 Board Consideration [Rule 2]. (a) Offices. The office of the Board... consideration of a matter by all members of the Contract Appeals Board will not be granted in any appeal filed...
Panel Board From Coconut Fibre And Pet Bottle
Ngadiman, Norhayati; Kaamin, Masiri; Abd. Kadir, Aslila; Sahat, Suhaila; Zaini, Aziza; Raihana Nor Zentan, Siti; Ain Ahmad, Nur; Amran, Wan Haizatul Aisyhah Wan
2018-03-01
The rate of global deforestation and its impact on the environment has led particle board manufacture to search for alternative feedstock, especially in countries where wood is less available compared to other cellulosic natural product. Based on the properties of coconut fibre and PET bottle, these two materials can be recycle as raw material for manufacture of panel board. As for this study, the coconut fibre were used as the filler and PET bottle as outer lining of the panel board. Two types of coconut fibre were used which are grinding and un-grinding coconut fibre. At first, the coconut fibre are undergoes softening, grinding, drying and sieving process, while PET bottle was cleaning, shredding, sieving before compacted using hydraulic hot press machine. There are four types of testing that been carried out which are swelling, water absorption, Modulus of Elasticity (MOE) and Modulus of Rupture (MOR). The result show the conventional board has the highest value for MOE test, so it's indicate that the conventional board is less strength from the coconut fibre board. As for water absorption test, the average water absorption of coconut fibre based panel board is less than conventional board. Overall, the coconut fibre board is better than conventional panel board because coconut fibre board are less swelling, has low water absorption, high modulus of rupture and low modulus of elasticity. Based on the finding, this coconut fibre panel board has potential as a stronger and long-lasting panel board than the conventional board in the market. Other than that, the panel also have their own aesthetic value since the recycled plastic bottle used as outer lining is colourful and giving aesthetic value.
Roger, Véronique L; Boerwinkle, Eric; Crapo, James D; Douglas, Pamela S; Epstein, Jonathan A; Granger, Christopher B; Greenland, Philip; Kohane, Isaac; Psaty, Bruce M
2015-03-15
In 2013, the National Heart, Lung, and Blood Institute assembled a working group on epidemiology and population sciences from its Advisory Council and Board of External Experts. The working group was charged with making recommendations to the National Heart, Lung, and Blood Advisory Council about how the National Heart, Lung, and Blood Institute could take advantage of new scientific opportunities and delineate future directions for the epidemiology of heart, lung, blood, and sleep diseases. Seven actionable recommendations were proposed for consideration. The themes included 1) defining the compelling scientific questions and challenges in population sciences and epidemiology of heart, lung, blood, and sleep diseases; 2) developing methods and training mechanisms to integrate "big data" science into the practice of epidemiology; 3) creating a cohort consortium and inventory of major studies to optimize the efficient use of data and specimens; and 4) fostering a more open, competitive approach to evaluating large-scale longitudinal epidemiology and population studies. By building on the track record of success of the heart, lung, blood, and sleep cohorts to leverage new data science opportunities and encourage broad research and training partnerships, these recommendations lay a strong foundation for the transformation of heart, lung, blood, and sleep epidemiology. © The Author 2015. Published by Oxford University Press on behalf of the Johns Hopkins Bloomberg School of Public Health. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Board self-evaluation: the Bayside Health experience.
Duncan-Marr, Alison; Duckett, Stephen J
2005-08-01
Board evaluation is a critical component of good governance in any organisation. This paper describes the board self-evaluation process used by Bayside Health, a public health service in Melbourne. The question of how governing boards can assess their performance has received increasing attention over the past decade. In particular, the increasing demand for accountability to shareholders and regulators experienced by corporate sector Boards has resulted in greater scrutiny of board performance, with the market and the balance sheet providing some basis for assessment. Performance evaluation of governing boards in the public sector has been more challenging. Performance evaluation is complex in a sector that is not simply driven by the bottom line, where the stakeholders involve both government and the broader community, and where access to, and the quality and safety of the services provided, are often the major public criteria by which performance may be judged. While some practices from the corporate sector can be applied successfully in the public sector, this is not always the case, and public sector boards such as the Board of Directors of Bayside Health have been developing ways to evaluate and improve their performance.
Bartram, Peter N.
1989-01-01
The current Life Sciences Laboratory Equipment (LSLE) microcomputer for life sciences experiment data acquisition is now obsolete. Among the weaknesses of the current microcomputer are small memory size, relatively slow analog data sampling rates, and the lack of a bulk data storage device. While life science investigators normally prefer data to be transmitted to Earth as it is taken, this is not always possible. No down-link exists for experiments performed in the Shuttle middeck region. One important aspect of a replacement microcomputer is provision for in-flight storage of experimental data. The Write Once, Read Many (WORM) optical disk was studied because of its high storage density, data integrity, and the availability of a space-qualified unit. In keeping with the goals for a replacement microcomputer based upon commercially available components and standard interfaces, the system studied includes a Small Computer System Interface (SCSI) for interfacing the WORM drive. The system itself is designed around the STD bus, using readily available boards. Configurations examined were: (1) master processor board and slave processor board with the SCSI interface; (2) master processor with SCSI interface; (3) master processor with SCSI and Direct Memory Access (DMA); (4) master processor controlling a separate STD bus SCSI board; and (5) master processor controlling a separate STD bus SCSI board with DMA.
2010-01-01
... of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE POPCORN PROMOTION, RESEARCH, AND CONSUMER INFORMATION Popcorn Promotion, Research, and Consumer Information Order Definitions § 1215.2 Board. Board...
Does firm performance affect board independence?
Directory of Open Access Journals (Sweden)
Yi Wang
2010-07-01
Full Text Available This paper seeks to shed some light on the antecedents of board independence. Specifically, it attempts to test the conceptual frameworks which make different predictions about the effect of firm performance on the level of board independence. The results provide support for the perspective that appointing more independent members to the boards may merely represent firms’ attempts to comply with institutional pressures. It is found that higher blockholder shareholdings lead to lower independence on the board, and audit and remuneration committees. Moreover, larger firms have relatively more independent directors sitting on nomination and remuneration committees.
Social Responsibility in the Board Room
DEFF Research Database (Denmark)
Ege, Mette; Geisler, Kathrine; Knudsen, Jette Steen
When do board directors pay attention to corporate social responsibility (CSR) issues? Board directors have traditionally focused on maximizing shareholder profit and viewed corporate governance narrowly as a way to meet this goal. They have paid little or no attention to CSR issues because...... they see CSR as a contrast to profit maximization. We argue in this article that companies can no longer ignore CSR. We propose that three conditions must be met in order for boards to pay attention to CSR. First, the board must have a mind-set that considers CSR as contributing value to the firm. Second...
Why monetary board: Monetary board and endogenic price flexibility
Directory of Open Access Journals (Sweden)
Bašić Tamara
2004-01-01
Full Text Available The paper presents a model which proves that a unilateral exchange rate fixing, i.e. monetary board, as opposed to certain opinions, is an optimal policy since it increases flexibility of nominal prices, which is the ultimate goal of a flexible exchange rate policy. A suitable calibration of the model shows that the higher the initial price flexibility, the lower the difference needed for "utility increase" in getting the producers to switch from fixed to flexible prices. The results obtained in all cases indicate that exchange rate fixing increases price flexibility, which proves that a unilateral exchange rate fixing, i.e. monetary board, could be an optimal monetary policy.
2010-04-01
... DEPARTMENT OF COMMERCE International Trade Administration U.S. Travel and Tourism Advisory Board: Meeting of the U.S. Travel and Tourism Advisory Board AGENCY: International Trade Administration, U.S... Tourism Advisory Board (Board) will hold a meeting to discuss topics related to the travel and tourism...
Resonance – Journal of Science Education | News
Indian Academy of Sciences (India)
Keywords. Scalars; four-vectors; lorentz transformation; special relativity. ... Resonance – Journal of Science Education. Current Issue : Vol. 23, Issue 4. Current Issue Volume 23 | Issue 4. April 2018. Home · Volumes & Issues · Categories · Special Issues · Search · Editorial Board · Information for Authors · Subscription ...
Keast, Russell S J; Swinburn, Boyd A; Sayompark, Dhoungsiri; Whitelock, Susie; Riddell, Lynn J
2015-01-28
Excessive sugar-sweetened beverage (SSB) consumption has been associated with overweight and obesity. Caffeine is a common additive to SSB, and through dependence effects, it has the potential to promote the consumption of caffeine-containing foods. The objective of the present study was to assess the influence that caffeine has on the consumption of SSB. Participants (n 99) were blindly assigned to either a caffeinated SSB (C-SSB) or a non-caffeinated SSB (NC-SSB) group. Following randomisation, all participants completed a 9 d flavour-conditioning paradigm. They then completed a 28 d ad libitum intake intervention where they consumed as much or as little of C-SSB or NC-SSB as desired. The amount consumed (ml) was recorded daily, 4 d diet diaries were collected and liking of SSB was assessed at the start and end of the intervention. Participants (n 50) consuming the C-SSB had a daily SSB intake of 419 (sd 298) ml (785 (sd 559) kJ/d) over the 28 d intervention, significantly more than participants (n 49) consuming the NC-SSB (273 (sd 278) ml/d, 512 (sd 521) kJ/d) (P=0.05). However, participants who consumed the C-SSB liked the SSB more than those who consumed the NC-SSB (6.3 v. 6.0 on a nine-point hedonic scale, P= 0.022). The addition of low concentrations of caffeine to the SSB significantly increases the consumption of the SSB. Regulating caffeine as a food additive may be an effective strategy to decrease the consumption of nutrient-poor high-energy foods and beverages.
2010-01-01
... of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE PORK PROMOTION, RESEARCH, AND CONSUMER INFORMATION Pork Promotion, Research, and Consumer Information Order Definitions § 1230.4 Board. Board means...
Panel Board From Coconut Fibre And Pet Bottle
Directory of Open Access Journals (Sweden)
Ngadiman Norhayati
2018-01-01
Full Text Available The rate of global deforestation and its impact on the environment has led particle board manufacture to search for alternative feedstock, especially in countries where wood is less available compared to other cellulosic natural product. Based on the properties of coconut fibre and PET bottle, these two materials can be recycle as raw material for manufacture of panel board. As for this study, the coconut fibre were used as the filler and PET bottle as outer lining of the panel board. Two types of coconut fibre were used which are grinding and un-grinding coconut fibre. At first, the coconut fibre are undergoes softening, grinding, drying and sieving process, while PET bottle was cleaning, shredding, sieving before compacted using hydraulic hot press machine. There are four types of testing that been carried out which are swelling, water absorption, Modulus of Elasticity (MOE and Modulus of Rupture (MOR. The result show the conventional board has the highest value for MOE test, so it’s indicate that the conventional board is less strength from the coconut fibre board. As for water absorption test, the average water absorption of coconut fibre based panel board is less than conventional board. Overall, the coconut fibre board is better than conventional panel board because coconut fibre board are less swelling, has low water absorption, high modulus of rupture and low modulus of elasticity. Based on the finding, this coconut fibre panel board has potential as a stronger and long-lasting panel board than the conventional board in the market. Other than that, the panel also have their own aesthetic value since the recycled plastic bottle used as outer lining is colourful and giving aesthetic value.
75 FR 47030 - National Science Board; Sunshine Act Meetings; Notice
2010-08-04
... Committee on Programs and Plans. STATUS: Open. LOCATION: This meeting will be held by teleconference... Programs and Plans, pursuant to NSF regulations (45 CFR part 614), the National Science Foundation Act, as... business and other matters specified, as follows: DATE AND TIME: August 12, 2010 at 3 p.m. EDT. SUBJECT...
2010-12-21
... DEPARTMENT OF COMMERCE International Trade Administration U.S. Travel and Tourism Advisory Board: Meeting of the U.S. Travel and Tourism Advisory Board AGENCY: International Trade Administration, U.S... agenda for an open meeting of the U.S. Travel and Tourism Advisory Board (Board). The agenda may change...
2011-04-18
... DEPARTMENT OF COMMERCE International Trade Administration U.S. Travel and Tourism Advisory Board: Meeting of the U.S. Travel and Tourism Advisory Board AGENCY: International Trade Administration, U.S... agenda for an open meeting of the U.S. Travel and Tourism Advisory Board (Board). The agenda may change...
2011-08-29
... DEPARTMENT OF COMMERCE International Trade Administration U.S. Travel and Tourism Advisory Board: Meeting of the U.S. Travel and Tourism Advisory Board AGENCY: International Trade Administration, U.S... agenda for an open meeting of the U.S. Travel and Tourism Advisory Board (Board). The agenda may change...
36 CFR 222.11 - Grazing advisory boards.
2010-07-01
... such boards, the area to be covered, and the number of advisers on each board. (3) Processing Petitions... permittees are nominated and board members are elected. Nominations will be made by petition with all term...
Hardware Testing for the Optical PAyload for Lasercomm Science (OPALS)
Slagle, Amanda
2011-01-01
Hardware for several subsystems of the proposed Optical PAyload for Lasercomm Science (OPALS), including the gimbal and avionics, was tested. Microswitches installed on the gimbal were evaluated to verify that their point of actuation would remain within the acceptable range even if the switches themselves move slightly during launch. An inspection of the power board was conducted to ensure that all power and ground signals were isolated, that polarized components were correctly oriented, and that all components were intact and securely soldered. Initial testing on the power board revealed several minor problems, but once they were fixed the power board was shown to function correctly. All tests and inspections were documented for future use in verifying launch requirements.
36 CFR 242.10 - Federal Subsistence Board.
2010-07-01
... consultants to the Board. (d) Powers and duties. (1) The Board shall meet at least twice per year and at such... for the decision, in writing, in a timely fashion. (2) The Board shall provide available and...
50 CFR 100.10 - Federal Subsistence Board.
2010-10-01
... actively involved as consultants to the Board. (d) Powers and duties. (1) The Board shall meet at least... forth the factual basis and the reasons for the decision, in writing, in a timely fashion. (2) The Board...
How two-tier boards can be more effective
dr. Stefan Peij; Pieter-Jan Bezemer; Laura de Kruijs; Gregory Maassen
2014-01-01
Purpose – This study seeks to explore how non-executive directors address governance problems on Dutch two-tier boards. Within this board model, challenges might be particularly difficult to address due to the formal separation of management boards' decision-management from supervisory boards'
Computer board for radioactive ray test
International Nuclear Information System (INIS)
Zuo Mingfu
1996-05-01
The present status of the radioactive-ray test system for industrial applications, the newly designed computer board for overcoming the shortcomings of the current system are described. The functions, measurement principles and the feature of the board as well as the test results for this board are discussed. The board puts together many functions of the radioactive-ray test system, such as energy calibration, MCS, etc.. It also provides many other subordinate practical function such as motor control, ADC and so on. The board summarizes two sets of test parts into one and therefore composes a powerful unit for the system. Not only can it replace all units in a normal test system for signal analysis, signal process, data management, and motor control, but also can be used in more complex test systems, such as those for double source/double energy/double channel testing, multichannel testing, position testing and core positioning, etc.. The board makes the test system more easier to achieve miniaturization, computerization goals, and therefore improves the quality of the test and reduces the cost of the system. (10 refs., 8 figs.)
A Feminist Framework for Nurses on Boards.
Sundean, Lisa J; Polifroni, E Carol
Nurses' knowledge, skills, and expertise uniquely situate them to contribute to health care transformation as equal partners in organizational board governance. The Institute of Medicine, the 10,000 Nurses on Boards Coalition, and a growing number of nurse and health care scholars advocate nurse board leadership; however, nurses are rarely appointed as voting board members. When no room is made for nurses to take a seat at the table, the opportunity is lost to harness the power of nursing knowledge for health care transformation and social justice. No philosophical framework underpins the emerging focus on nurse board leadership. The purpose of this article is to add to the extant nursing literature by suggesting feminism as a philosophical framework for nurses on boards. Feminism contributes to the knowledge base of nursing as it relates to the expanding roles of nurses in health care transformation, policy, and social justice. Furthermore, a feminist philosophical framework for nurses on boards sets the foundation for new theory development and validates ongoing advancement of the nursing profession. Copyright © 2016 Elsevier Inc. All rights reserved.
Diversity in Board of Directors: Review of Diversity as a Factor to Enhance Board Performance
Directory of Open Access Journals (Sweden)
Pechersky Alexander
2016-06-01
Full Text Available In light of growing corporate influence in the business world and thus increasing further need to improve framework of corporate governance for shareholders’ protection, diversity is examined as a necessary factor to enhance monitoring and leadership functions of board of directors. This article analyses empirical studies with samples on various countries in order to examine effect of board composition and diversity on primary responsibilities of Board of Directors. Author is providing theoretical overview of diversity benefits and practical perspective of gender, qualifications, and background diversity in board performance. Our results show an added value of gender diversity to company performance in social and healthcare industries. Furthermore, author shows a rather negative effect of gender quotas. This study sheds a light on empirical researches and a need to include additional cultural factors called country readiness factors.
Understanding the roles of NHS trust board members.
Deffenbaugh, J
1996-01-01
The establishment of NHS trust boards on a business format was a recent innovation resulting from the NHS reforms. In order to realize benefits for patients, it is essential that boards operate effectively. Explores within the framework of corporate governance, the practical implications of board member roles. Drawing on experience of strategy formulation at board level, analyses and clarifies the roles, and presents recommendations to increase board effectiveness.
KEBUTUHAN DAN TANTANGAN AUDIT SYARIAH DAN AUDITOR SYARIAH
Nugraheni, Peni
2017-01-01
Audited financial statement is the ways to make sure that information available on that report can be used to make decision, because there is an opinion of independent person (auditor) whether it presents a true and fair view of the company or not. Islamic bank established Shariah Supervisory Board (SSB) that one of its functions is to issue report about the compliance of Islamic bank in all activities with Islamic principles. This report is published with the external auditor’s annual report...
2010-11-24
... teleconference, to give EPA as much time as possible to process your request. Dated: November 16, 2010. Anthony... Board can be found on the SAB Web site at http://www.epa.gov/sab . SUPPLEMENTARY INFORMATION: Pursuant... advisory activity can be found on the SAB Web site at: http://yosemite.epa.gov/sab/sabproduct.nsf/fedrgstr...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Resonance – Journal of Science Education. Current Issue : Vol. 23, Issue 4. Current Issue Volume 23 | Issue 4. April 2018. Home · Volumes & Issues · Categories · Special Issues · Search · Editorial Board · Information for Authors · Subscription ...
Harrington-Lueker, Donna
1993-01-01
Peacekeeping strategies for school-board meetings include developing a code of conduct that spells out guidelines for behavior and then enforcing it; bringing in a neutral observer to help board members work through what is really worrying them; and concentrating on policy. (MLF)
76 FR 21877 - Environmental Management Advisory Board
2011-04-19
... DEPARTMENT OF ENERGY Environmental Management Advisory Board AGENCY: Department of Energy. ACTION: Notice of call for nominations for appointment to the Environmental Management Advisory Board. SUMMARY... Environmental Management Advisory Board. DATES: Nominations will be accepted through May 13, 2011. ADDRESSES...
Gungor, Sema Nur; Ozer, Dilek Zeren; Ozkan, Muhlis
2013-01-01
This study re-evaluated 454 science projects that were prepared by primary school students between 2007 and 2011 within the scope of Science Projects Event for Primary School Students. Also, submitted to TUBITAK BIDEB Bursa regional science board by MNE regional work groups in accordance with scientific research methods and techniques, including…
32 CFR 881.3 - Individual Service Review Board.
2010-07-01
... 32 National Defense 6 2010-07-01 2010-07-01 false Individual Service Review Board. 881.3 Section... Individual Service Review Board. (a) The Commander, Headquarters Air Force Personnel Center (HQ AFPC/CC) establishes the Individual Service Review Board as necessary. (b) The Board consists of military members in...
Embedded controllers for local board-control
Neufeld, Niko; Mini, Giuseppe; Sannino, Mario; Guzik, Zbigniew; Jacobsson, Richard; Jost, Beat
2005-01-01
The LHCb experiment at CERN has a large number of custom electronic boards performing high-speed data-processing. Like in any large experiment the control and monitoring of these crate-mounted boards must be integrated into the overall control-system. Traditionally this has been done by using buses like VME on the back-plane of the crates. LHCb has chosen to equip every board with an embedded micro-controller and connecting them in a large Local Area Network. The intelligence of these devices allows complex (soft) real-time control and monitoring, required for modern powerful FPGA driven electronics. Moreover each board has its own, isolated control access path, which increases the robustness of the entire system. The system is now in pre-production at several sites and will go into full production during next year. The hardware and software will be discussed and experiences from the R&D and pre-production will be reviewed, with an emphasis on advantages and difficulties of this approach to board-control.
GOVERNING BOARD OF THE PENSION FUND
2003-01-01
The Governing Board of the Pension Fund held its one hundred and twelfth and one hundred and thirteenth meetings on 5 November and 3 December 2002 respectively. At the first of these meetings, the Governing Board firstly took note of the favourable stance adopted by TREF with respect to a pension adjustment of 0.6% for 2003. TREF had also examined the proposed technical amendments to the Pension Fund's Rules and Regulations, as reported in Weekly Bulletin N° 44/2002, relating to a) clarification of the roles of the Governing Board and the Administrator, b) the procedure for appointing the Chairman, Vice-Chairmen and Administrator of the Fund, c) the Governing Board's voting rules and d) the role and composition of the Investment Committee. These amendments were to be submitted to the CERN Council for approval at its December meeting*. The Governing Board then considered a request submitted by the CERN Pensioners' Association (GAC) for an extraordinary adjustment of pensions. The request entailed making an ...
Tumor boards and the quality of cancer care.
Keating, Nancy L; Landrum, Mary Beth; Lamont, Elizabeth B; Bozeman, Samuel R; Shulman, Lawrence N; McNeil, Barbara J
2013-01-16
Despite the widespread use of tumor boards, few data on their effects on cancer care exist. We assessed whether the presence of a tumor board, either general or cancer specific, was associated with recommended cancer care, outcomes, or use in the Veterans Affairs (VA) health system. We surveyed 138 VA medical centers about the presence of tumor boards and linked cancer registry and administrative data to assess receipt of stage-specific recommended care, survival, or use for patients with colorectal, lung, prostate, hematologic, and breast cancers diagnosed in the period from 2001 to 2004 and followed through 2005. We used multivariable logistic regression to assess associations of tumor boards with the measures, adjusting for patient sociodemographic and clinical characteristics. All statistical tests were two-sided. Most facilities (75%) had at least one tumor board, and many had several cancer-specific tumor boards. Presence of a tumor board was associated with only seven of 27 measures assessed (all P < .05), and several associations were not in expected directions. Rates of some recommended care (eg, white blood cell growth factors with cyclophosphamide, adriamycin, vincristine, and prednisone in diffuse large B-cell lymphoma) were lower in centers with hematologic-specialized tumor boards (39.4%) than in centers with general tumor boards (61.3%) or no tumor boards (56.4%; P = .002). Only one of 27 measures was statistically significantly associated with tumor boards after applying a Bonferroni correction for multiple comparisons. We observed little association of multidisciplinary tumor boards with measures of use, quality, or survival. This may reflect no effect or an effect that varies by structural and functional components and participants' expertise.
Board Directors and Corporate Social Responsibility
Mariana Nedelcu (Bunea)
2014-01-01
The boards of directors and corporate social responsibility (CSR) have been the subject of much study and debate in the corporate governance circles over the two last decades. With issues ranging from poor corporate reporting to excessive executive compensation often splashed in the headlines, the role of boards comes into the media limelight as never before. Boards of directors are also becoming increasingly aware of corporate social responsibility issues.
78 FR 73187 - Black Hills National Forest Advisory Board
2013-12-05
... DEPARTMENT OF AGRICULTURE Forest Service Black Hills National Forest Advisory Board AGENCY: Forest Service, USDA. ACTION: Notice of meeting. SUMMARY: The Black Hills National Forest Advisory Board (Board... all members of the Advisory Board; (2) provide orientation to Board Members on Basic Laws governing...
An effective board from a team perspective
Directory of Open Access Journals (Sweden)
Eythor Ivar Jonsson
2006-11-01
Full Text Available This paper looks at boards from a team perspective, where insights from research on teams are used to discuss some classical problems of corporate governance. The Enron-case is used as an underlying theme as it portrays some of the biggest challenges that boards face today. Theories developed within the team literature emphasise that for boards to become more effective they need more time and better access to information as a source of knowledge, more structure and purposeful roles for directors and for the board in general, and they need to become smaller and more focused. In effect, the culture of teams could have avoided some of the blunders of the Enron board.
The Problem: Low-Achieving Districts and Low-Performing Boards
Directory of Open Access Journals (Sweden)
David E. Lee
2014-10-01
Full Text Available Effective school districts maintain superintendent and school board collegiality which can foster success and connectedness among members. Delagardelle and Alsbury (2008 found that superintendents and board members are not consistent in their perceptions about the work the board does, and Glass (2007 found that states do not require boards to undergo evaluation for effectiveness. In the current study, 115 board meetings were observed using the School Board Video Project (SBVP survey, which was created in 2012 by researchers to uncover school board meetings’ effectiveness. MANOVA, Univariate ANOVA, and Pearson Chi-Square test results revealed significant differences between low-, medium-, and high-performing districts’ school board meetings. Evidence indicated that low-performing districts’ board meetings were: less orderly; had less time spent on student achievement; lacked respectful and attentive engagement across speakers; had board meeting members who seemed to advance their own agenda; had less effective working relationships among the governance team; had fewer board members who relied on the superintendent for advice and input; had one member, other than the board president, stand out for taking excessive time during meetings; and did not focus on policy items as much as high- and medium-performing school districts. The research concluded that more school board members from low-performing districts needed training to improve their effectiveness. Furthermore, highly refined and target-enhanced school board training programs might lead to lasting governance success and more effective teaming that could improve district, and ultimately, student achievement.
Accelerators: Sparking Innovation and Transdisciplinary Team Science in Disparities Research
Horowitz, Carol R.; Shameer, Khader; Gabrilove, Janice; Atreja, Ashish; Shepard, Peggy; Goytia, Crispin N.; Smith, Geoffrey W.; Dudley, Joel; Manning, Rachel; Bickell, Nina A.; Galvez, Maida P.
2017-01-01
Development and implementation of effective, sustainable, and scalable interventions that advance equity could be propelled by innovative and inclusive partnerships. Readied catalytic frameworks that foster communication, collaboration, a shared vision, and transformative translational research across scientific and non-scientific divides are needed to foster rapid generation of novel solutions to address and ultimately eliminate disparities. To achieve this, we transformed and expanded a community-academic board into a translational science board with members from public, academic and private sectors. Rooted in team science, diverse board experts formed topic-specific “accelerators”, tasked with collaborating to rapidly generate new ideas, questions, approaches, and projects comprising patients, advocates, clinicians, researchers, funders, public health and industry leaders. We began with four accelerators—digital health, big data, genomics and environmental health—and were rapidly able to respond to funding opportunities, transform new ideas into clinical and community programs, generate new, accessible, actionable data, and more efficiently and effectively conduct research. This innovative model has the power to maximize research quality and efficiency, improve patient care and engagement, optimize data democratization and dissemination among target populations, contribute to policy, and lead to systems changes needed to address the root causes of disparities. PMID:28241508
Science in the archives pasts, presents, futures
2017-01-01
"Science in the Archives" reveals affinities and continuities among the sciences of the archives, across many disciplines and centuries, in order to present a better picture of essential archival practices and, thereby, the meaning of science. For in both the natural and human sciences, archives of the most diverse forms make cumulative, collective knowledge possible. Yet in contrast to laboratories, observatories, or the field, archives have yet to be studied across the board as central sites of science. The volume covers episodes in the history of astronomy, geology, genetics, classical philology, climatology, history, medicine, and ancient natural philosophy, as well as fundamental practices such as collecting, retrieval strategies, and data mining. The time frame spans doxology in Greco-Roman antiquity to NSA surveillance techniques and the quantified-self movement. Each chapter explores the practices, politics, economics, and open-ended potential of the sciences of the archives, making this the first boo...
Kocher, Mininder S; Dichtel, Laura; Kasser, James R; Gebhardt, Mark C; Katz, Jeffery N
2008-02-01
Specialty board certification status has become the de facto standard of competency by which the profession and the public recognize physician specialists. However, the relationship between orthopedic board certification and physician performance has not been established. Rates of medical malpractice claims, hospital disciplinary actions, and state medical board disciplinary actions were compared between 1309 board-certified (BC) and 154 non-board-certified (NBC) orthopedic surgeons in 3 states. There was no significant difference between BC and NBC surgeons in medical malpractice claim proportions (BC, 19.1% NBC, 16.9% P = .586) or in hospital disciplinary action proportions (BC, 0.9% NBC, 0.8% P = 1.000). There was a significantly higher proportion of state medical board disciplinary action for NBC surgeons (BC, 7.6% NBC, 13.0% P = .028). An association between board certification status and physician performance is necessary to validate its status as the de facto standard of competency. In this study, BC surgeons had lower rates of state medical board disciplinary action.
Improving School Board Effectiveness: A Balanced Governance Approach
Alsbury, Thomas L., Ed.; Gore, Phil, Ed.
2015-01-01
"Improving School Board Effectiveness" offers a clarifying and essential look at the evolving role of school boards and how they contribute to efforts to improve student learning. It examines how board members can establish effective district priorities, and it explores those board policies and actions that result in shared, districtwide…
Impact of Theoretical Chemistry on Chemical and Biological Sciences
Indian Academy of Sciences (India)
Resonance – Journal of Science Education. Current Issue : Vol. 23, Issue 3 · Current Issue Volume 23 | Issue 3. March 2018. Home · Volumes & Issues · Categories · Special Issues · Search · Editorial Board · Information for Authors · Subscription ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Resonance – Journal of Science Education. Current Issue : Vol. 23, Issue 3 · Current Issue Volume 23 | Issue 3. March 2018. Home · Volumes & Issues · Categories · Special Issues · Search · Editorial Board · Information for Authors · Subscription ...
29 CFR 1207.2 - Requests for Mediation Board action.
2010-07-01
... 29 Labor 4 2010-07-01 2010-07-01 false Requests for Mediation Board action. 1207.2 Section 1207.2 Labor Regulations Relating to Labor (Continued) NATIONAL MEDIATION BOARD ESTABLISHMENT OF SPECIAL ADJUSTMENT BOARDS § 1207.2 Requests for Mediation Board action. (a) Requests for the National Mediation Board...
46 CFR 96.40-1 - Pilot boarding equipment.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Pilot boarding equipment. 96.40-1 Section 96.40-1... CONTROL AND MISCELLANEOUS SYSTEMS AND EQUIPMENT Pilot Boarding Equipment § 96.40-1 Pilot boarding... boat or other vessel. (b) Each vessel must have suitable pilot boarding equipment available for use on...
46 CFR 195.40-1 - Pilot boarding equipment.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Pilot boarding equipment. 195.40-1 Section 195.40-1... CONTROL AND MISCELLANEOUS SYSTEMS AND EQUIPMENT Pilot Boarding Equipment § 195.40-1 Pilot boarding... boat or other vessel. (b) Each vessel must have suitable pilot boarding equipment available for use on...
46 CFR 35.01-55 - Pilot boarding operation.
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false Pilot boarding operation. 35.01-55 Section 35.01-55... Requirements § 35.01-55 Pilot boarding operation. (a) The master shall ensure that pilot boarding equipment is... instructions. (b) The master shall ensure compliance with the following during pilot boarding operations: (1...