Effect of Wood Aging on Wine Mineral Composition and 87Sr/86Sr Isotopic Ratio.

Science.gov (United States)

Kaya, Ayse D; Bruno de Sousa, Raúl; Curvelo-Garcia, António S; Ricardo-da-Silva, Jorge M; Catarino, Sofia

2017-06-14

The evolution of mineral composition and wine strontium isotopic ratio 87 Sr/ 86 Sr (Sr IR) during wood aging were investigated. A red wine was aged in stainless steel tanks with French oak staves (Quercus sessiliflora Salisb.), with three industrial scale replicates. Sampling was carried out after 30, 60, and 90 days of aging, and the wines were evaluated in terms of general analysis, phenolic composition, total polysaccharides, multielement composition, and Sr IR. Li, Be, Mg, Al, Sc, Ti, V, Mn, Co, Ni, Cu, Zn, Ga, Ge, As, Rb, Sr, Y, Zr, Mo, Sb, Cs, Ba, Pr, Nd, Sm, Eu, Dy, Ho, Er, Yb, Lu, Tl, and Pb elements and 87 Sr/ 86 Sr were determined by quadrupole inductively coupled plasma mass spectrometry (Q-ICP-MS) and Na, K, Ca, and Fe by flame atomic absorption spectrometry (FAAS). Two-way ANOVA was applied to assess wood aging and time effect on Sr IR and mineral composition. Wood aging resulted in significantly higher concentrations of Mg, V, Co, Ni, and Sr. At the end of the aging period, wine exhibited statistically identical Sr IR compared to control. Study suggests that wood aging does not affect 87 Sr/ 86 Sr, not precluding the use of this parameter for wine traceability purposes.

Fluorescence properties of novel near-infrared phosphor CaSc{sub 2}O{sub 4}:Ce{sup 3+}, Nd{sup 3+}

Energy Technology Data Exchange (ETDEWEB)

Meng, J.X., E-mail: tmjx@jnu.edu.c [Department of Chemistry, Jinan University, Guangzhou 510632 (China); Institute of Nanochemistry, Jinan University, Guangzhou 510632 (China); Zhang, F.J.; Peng, W.F.; Wan, W.J.; Xiao, Q.L.; Chen, Q.Q.; Cao, L.W. [Department of Chemistry, Jinan University, Guangzhou 510632 (China); Wang, Z.L. [School of Chemistry and Biotechnology, Yunnan Nationalities University, Kunming 650031 (China)

2010-10-15

Research highlights: Novel near-infrared (NIR) phosphor, CaSc{sub 2}O{sub 4}:Ce{sup 3+}, Nd{sup 3+}, was synthesized. The phosphor gives strong Nd{sup 3+} characteristic NIR emissions in the range of 880-930 nm. The NIR emission intensity gets a 200 times enhancement benefited from the efficient energy transfer from a co-doped Ce{sup 3+}. The energy transfer mechanism was also briefly based on detailed investigation on spectrum and fluorescence lifetime. - Abstract: Novel near-infrared (NIR) phosphor, CaSc{sub 2}O{sub 4}:Ce{sup 3+}, Nd{sup 3+}, was synthesized by co-precipitation method followed by firing at 1300 {sup o}C in reduced atmosphere. When irradiated with blue light, the phosphor gives strong Nd{sup 3+} characteristic NIR emissions in the range of 880-930 nm. The NIR emission intensity gets a 200 times enhancement by co-doping of Ce{sup 3+}. Detailed investigation on spectrum and fluorescence lifetimes indicated the NIR luminescence enhancement is obtained from an energy transfer process. The process initiates with efficient absorption of blue light by Ce{sup 3+} ions via an allowed 4f-5d transition, follow by efficient energy transfer from Ce{sup 3+} to Nd{sup 3+}, and emitting strong Nd{sup 3+} characteristic fluorescence.

Hydration reactions in pastes C3S+C3A+CaSO4.2aq+H20 at 25°C.I

NARCIS (Netherlands)

Corstanje, W.A.; Stein, H.N.; Stevels, J.M.

1973-01-01

A characteristic retardation of the hydration of C3A is found in pastes C3S+C3A+CaSO4.2aq+H2O of weight ratios 1:3:z:4 at certain values of z, when sulphate concentration becomes insufficient for monosulphate formation. This retardation is ascribed to precipitation of amorphous Al(OH)3, when C3A

The effect of CaCl2 on growth rate, wood decay and oxalic acid accumulation in Serpula lacrymans and related brown-rot fungi

DEFF Research Database (Denmark)

Hastrup, Anne Christine Steenkjær; Jensen, Bo; Clausen, Carol. A.

2006-01-01

The dry rot fungus, Serpula lacrymans, is one of the most destructive copper-tolerant fungi causing timber decay in buildings in temperate regions. Calcium and oxalic acid have been shown to play important roles in the mechanism of wood decay. The effect of calcium on growth and decay was evaluated...... for 12 strains of S. lacrymans and compared to five brown-rot fungi. This was done by treating copper citrate (CC)-treated Southern yellow pine (SYP) wood with a CaCl2 solution and estimating the decay rate and amount of soluble oxalic acid in an ASTM soil block test. Decay by S. lacrymans was found....... In summary, a marked decrease was observed in the decay capacity of S. lacrymans in pine treated with CC+CaCl2. The amount of soluble oxalic acid was measured in CC-treated blocks and blocks also treated with CaCl2. Of the comparative brown-rot fungi, both Antrodia vaillantii (TFFH 294) and Postia placenta...

Rates for some reactions involving 42Ca and 44Ca

International Nuclear Information System (INIS)

Cheng, C.W.; King, J.D.

1980-01-01

Ground-state reaction rates have been deduced from recent cross section measurements for the 42 CA(α, n) 45 Ti, 42 Ca(p, γ) 43 Sc, and 44 Ca(p, n) 44 Sc reactions. Comparison of these rates with those calculated from a statistical model of nuclear reactions. (Woosley et al) shows good agreement for the first two, but the 44 Ca(p, n) rate is more than a factor of 2 less than the theoretical prediction. Stellar reaction rates have been derived from the ground-state rates by multiplying the ground-state rates by the ratio of stellar to ground-state rates given by the statistical model. Both ground-state and stellar rates have been represented by analytic functions of the temperature. The role of these reactions in the approach to quasi-equilibrium during explosive silicon burning is discussed

The monoclinic superstructure of the M2Pt6Al15 series (M=Ca, Sc, Y, La, Lu)

International Nuclear Information System (INIS)

Radzieowski, Mathis; Stegemann, Frank; Hoffmann, Rolf-Dieter; Janka, Oliver; Oldenburg Univ.

2017-01-01

The five ternary intermetallic compounds M 2 Pt 6 Al 15 (M=Ca, Sc, Y, La, Lu) were prepared from the elements by arc-melting. The crystal structure was determined via single crystal X-ray diffraction. The title compounds crystallize in a superstructure of the RE 0.67 Pt 2 Al 5 type structure (P6 3 /mmc) in the monoclinic crystal system with space group P12 1 /m1 (Sc 2 Pt 6 Al 15 : a=734.19(2), b=1628.96(10), c=734.19(2) pm, β=119.999(3) ; wR=0.0356, 3034 F 2 values, 68 variables). The superstructure can be derived by the superspace formalism using (3+2)D or (3+1)D interpretations of the diffraction data. The structural relation to the subcell structure is discussed on the basis of a group-subgroup scheme. In the crystal structure strongly bonded [Pt 2 Al 4 ] δ- slabs are alternatingly stacked with ordered layers containing M atoms and Al 3 triangles.

Crystal growth and piezoelectric properties of Ca3Ta(Ga0.9Sc0.1)3Si2O14 bulk single crystal

Science.gov (United States)

Igarashi, Yu; Yokota, Yuui; Ohashi, Yuji; Inoue, Kenji; Yamaji, Akihiro; Shoji, Yasuhiro; Kamada, Kei; Kurosawa, Shunsuke; Yoshikawa, Akira

2018-03-01

Ca3Ta(Ga0.9Sc0.1)3Si2O14 langasite-type single crystal with a diameter of 1 in. was grown by Czochralski (Cz) method. Obtained crystal had good crystallinity and its lattice constants exceeded those of Ca3TaGa3Si2O14 (CTGS) according to the X-ray analysis. A crack-free specimen cut from the grown crystal was used for the measurements of dielectric constant ε11T/ε0, electromechanical coupling factor k12, and piezoelectric constant d11. The accuracies of these measurements were better than those for the crystal grown by micro-pulling-down (μ-PD) method. Substitution of Ga with Sc resulted modification of these constants in the directions opposite to those observed after partial substitution of Ga (of CTGS) with Al. This suggests that increase of |d14| was most probably associated with enlargement of average size of the Ga sites. The crystal reported here had greater dimensions as compared to analogous crystals grown by the μ-PD method. As a result, accuracy of determination of acoustic constants of this material may be improved.

The Effects of CaCO3 Coated Wood Free Paper Usage as Filler on Water Absorption, Mechanical and Thermal Properties of Cellulose-High Density Polyethylene Composites

Directory of Open Access Journals (Sweden)

Emrah PEŞMAN

2016-11-01

Full Text Available In this study some physical, mechanical and thermal characteristics of high density polyethylene (HDPE and CaCO3 coated/pigmented wood free paper fiber composites were investigated. The fillers used in this study were uncoated cellulose, 5.8 %, 11.5 %, 16.5 % and 23.1 % CaCO3 coated wood free paper fibers. Each filler type was mixed with HDPE at 40% by weight fiber loading. In this case, the ratio of CaCO3 in plastic composites were calculated as 0 %, 2.3 %, 4.6 %, 6.6 % and 9.2 % respectively. Increased CaCO3 ratio improved the moisture resistant, flexural and tensile strength of cellulose-HDPE composites. However, the density of the cellulose-HDPE composites increased with CaCO3 addition. Energy Dispersive Spectroscopy on Scanning Electron Microscope analysis demonstrated the uniform distribution of CaCO3 and cellulose fiber in plastic matrix. In addition, the thermal properties of fiber plastic composites were investigated. The results of Differential scanning calorimetry analysis revealed that the crystallinity of the samples decreased with increasing CaCO3 content. Consequently, this work showed that CaCO3 coated waste paper fibers could be used as reinforcing filler against water absorption in thermoplastic matrix.DOI: http://dx.doi.org/10.5755/j01.ms.22.4.14222

Effects of wood vinegar on properties and mechanism of heavy metal competitive adsorption on secondary fermentation based composts.

Science.gov (United States)

Liu, Ling; Guo, Xiaoping; Wang, Shuqi; Li, Lei; Zeng, Yang; Liu, Guanhong

2018-04-15

In this study, secondary municipal solid waste composts (SC) and wood vinegar treated secondary compost (WV-SC) was prepared to investigate the capability for single-heavy metals and multi-metal systems adsorption. The adsorption sequence of WV-SC for the maximum single metals sorption capacities was Cd (42.7mgg -1 ) > Cu (38.6mgg -1 ) > Zn (34.9mgg -1 ) > Ni (28.7mgg -1 ) and showed higher than that of SC adsorption isotherm. In binary/quaternary-metal systems, Ni adsorption showed a stronger inhibitory effect compared with Zn, Cd and Cu on both SC and WV-SC. According to Freundlich and Langmuir adsorption isotherm models, as well as desorption behaviors and speciation analysis of heavy metals, competitive adsorption behaviors were differed from single-metal adsorption. Especially, the three-dimensional simulation of competitive adsorption indicated that the Ni was easily exchanged and desorbed. The amount of exchangeable heavy metal fraction were in the lowest level for the metal-loaded adsorbents, composting treated by wood vinegar improved the adsorbed metals converted to the residue fraction. This was an essential start in estimating the multiple heavy metal adsorption behaviors of secondary composts, the results proved that wood vinegar was an effective additive to improve the composts quality and decrease the metal toxicity. Copyright © 2017 Elsevier Inc. All rights reserved.

A Walk in the Woods: Or, What Is Art?

Science.gov (United States)

Tolstoy, Leo

1999-01-01

Presents a passage from Tolstoy's essay "The School at Yasnaya Polyana." Discusses his experience as a teacher walking through the woods with several children and telling them stories. Describes their reactions and personalities, all very different. (SC)

Growth of Araucaria angustifolia in the Embrapa/Epagri forest reserve, Caçador, SC, Brazil Crescimento de Araucaria angustifolia na Reserva Florestal Embrapa/ Epagri, Caçador, SC

Directory of Open Access Journals (Sweden)

Patricia Póvoa de Mattos

2010-06-01

Full Text Available Araucaria Forest is one of most threatened phyto-physiognomies in the Atlantic Forest domain,
presenting great ecological-economical importance. Nevertheless, there are still lacks of knowledge concerning growth and dynamic of important species, as Araucaria angustifolia. The objective of this work was to recover  the past growth of Araucaria angustifolia, native from Caçador, SC, Brazil, by measuring growth rings and to estimate the average periodic diametric increment. The growth rings were counted and measured, using a stereoscope microscope, in increment cores of 0.5 cm collected from 32 adult trees. The measurements were done with LINTAB measuring table, with 0.01 mm of precision. The samples sizes were irregular, varying from 4.2 to 20.2 cm long. The trees presented average diameter breast height (DBH of 76.3 cm, varying from 10.7 to 141.3 cm. The periodic diameter increment from the last 10 years was 0.4 cm, varying from 0.11 to 1.15 cm. It was observed differences among trees, but there was a tendency of reduction of growth rhythm in larger trees, being more
evident in trees with more than 110 cm of DBH.A Floresta Ombrófila Mista (FOM é uma das fitofisionomias mais ameaçadas da área de domínio da
Mata Atlântica, apresentando grande importância ecológico-econômica. Apesar disso, ainda existem lacunas de conhecimento sobre a produtividade primária, o crescimento e a dinâmica de espécies importantes, como a Araucaria angustifolia. O presente trabalho tem por objetivo estudar o crescimento anual de Araucaria angustifolia, nativa do Município de Caçador, SC, pela medição dos anéis de crescimento. A contagem e medição dos anéis de crescimento foram feitas com o auxílio de um microscópio estereoscópico, em baguetas de 0,5 cm de diâmetro, coletadas de 32 árvores adultas. As medições foram feitas com o medidor de anéis de crescimento LINTAB, com precisão de 0,01 mm. O comprimento das amostras �

Measurement of Gamow-Teller and spin dipole strength in the 45Sc(n,p)45Ca reaction at 198 MeV

International Nuclear Information System (INIS)

Alford, W.P.; Celler, A.; Brown, B.A.; Long, S.; Raywood, K.

1990-11-01

The reaction 45 Sc(n,p) 45 Ca has been studied at an energy of 198 MeV with energy resolution of about 1 MeV. Measurements were carried out at nominal angles 0, 3, 6, 9, 12, 15, and 18 degrees and spectra obtained up to ∼40 MeV excitation energy in 45 Ca. Significant Gamow-Teller strength is observed at an excitation energy of about 7 MeV, somewhat higher than predicted by shell model calculations. The strength observed is in agreement with calculations using g A /g V ≅ 1. The spin dipole giant resonance is seen with centroid at about 15 MeV excitation and total cross section of 25 mb/sr at an angle of 6 degrees. (Author) (22 refs., 9 figs.)

Magnetic dipole moment of the doubly closed-shell plus one proton nucleus $^{49}$Sc

CERN Multimedia

Gaulard, C V; Walters, W; Nishimura, K; Muto, S; Bingham, C R

It is proposed to measure the magnetic moment of $^{49}$Sc by the Nuclear Magnetic Resonance on Oriented Nuclei (NMR-ON) method using the NICOLE on-line nuclear orientation facility. $^{49}$Sc is the neutron rich, doubly closed-shell, nucleus $^{48}$Ca plus one proton. Results will be used to deduce the effective g-factors in the $^{48}$Ca region with reference to nuclear structure and meson exchange current effects.

Lifetime and g-factor measurements in 44Sc

International Nuclear Information System (INIS)

Chevallier, A.; Chavallier, J.; Gross, J.L.; Haas, B.; Schulz, N.; Styczen, J.; Toulemonde, M.

1975-01-01

The lifetimes of the 235 keV, 2 - state and 350 keV, 4 + state in 44 Sc have been measured via the 44 Ca(p, n) 44 Sc reaction with a pulsed proton beam. The time integral perturbed angular distribution technique with an external field was used to measure the precession angles of the 2 - and 4 + states populated by the 30 Si( 16 O, pnγ) 44 Sc reaction. The following values for the mean-lives and g-factors were obtained: π(2 - ) = 8.83(33) ns, g(2 - ) = 0.30(13) and π(4 + ) = 4.52(27)ns, g(4 + ) = 0.90(12). The results for the 2 - state support a rotational description of the negative parity states in 44 Sc. The magnetic moment of the 4 + state is compared to shell model predictions. (orig.) [de

Developments in undergraduate wood science education at Stellenbosch University, South Africa

OpenAIRE

Rypstra,Tim

2011-01-01

In South Africa, Stellenbosch University (SU) is the designated provider of Bachelor, Master and Doctorate level qualifications in Forestry and Wood Products Science. SU provides educational programs to both mechanical (sawmilling, preservation, composite products, furniture, etc.) and the chemical (pulp & paper) processing sectors. To ensure academic quality, SU regularly has her academic programs assessed externally. In 2000, several changes to the then existing 4 year B.Sc. Wood Scienc...

Nano-rod Ca-decorated sludge derived carbon for removal of phosphorus.

Science.gov (United States)

Kong, Lingjun; Han, Meina; Shih, Kaimin; Su, Minhua; Diao, Zenghui; Long, Jianyou; Chen, Diyun; Hou, Li'an; Peng, Yan

2018-02-01

Recovering phosphorus (P) from waste streams takes the unique advantage in simultaneously addressing the crisis of eutrophication and the shortage of P resource. A novel calcium decorated sludge carbon (Ca-SC) was developed from dyeing industry wastewater treatment sludge by decorating calcium (Ca) to effectively adsorb phosphorus from solution. The X-ray diffraction (XRD) and Fourier transform infrared (FTIR) techniques were used to characterize the Ca-SCs, followed by isotherm and kinetic sorption experiments. A preferred design with CaCO 3 to sludge mass ratio of 1:2 was found to have a sorption capacity of 116.82 mg/g for phosphorus. This work reveals the crucial role of well-dispersed nano-rod calcium on the Ca-SC surface for the sorption of phosphorus. Moreover, the decoration of nano-rod calcium was found to further promote the uptake of phosphorus through the formation of hydroxylapatite (Ca 5 (PO 4 ) 3 (OH)). Thus, the development of decorated Ca-SC for sorption of phosphorus is very important in solving the P pollution and resource loss. Copyright © 2017 Elsevier Ltd. All rights reserved.

Effect of scandium on structure and hardening of Al–Ca eutectic alloys

Energy Technology Data Exchange (ETDEWEB)

Belov, N.A., E-mail: nikolay-belov@yandex.ru [National Research and Technological University “MISIS”, 4, Leninsky pr., Moscow 119049 (Russian Federation); Naumova, E.A. [Bauman Moscow State Technical University, 5, 2 ul. Baumanskaya, Moscow, 105005 (Russian Federation); Alabin, A.N. [National Research and Technological University “MISIS”, 4, Leninsky pr., Moscow 119049 (Russian Federation); UC RUSAL, 13/1, Nikoloyamskaya st., Moscow, 109240 (Russian Federation); Matveeva, I.A. [UC RUSAL, 13/1, Nikoloyamskaya st., Moscow, 109240 (Russian Federation)

2015-10-15

The phase composition, structure and hardening of alloys in the aluminium corner of the Al–Ca–Sc system were studied in the range up to 10% Ca and up to 1% S≿. The experimental study (optical, scanning and transmission electron microscopy with electron-microprobe analysis, differential thermal analysis and hardness measurements) was combined with Thermo-Calc software simulation for the optimization of the alloy composition. It was shown that only phases of the binary systems (Al{sub 4}Ca and Al{sub 3}Sc) might be in equilibrium with the aluminium solid solution. It was shown that the (Al) + Al{sub 4}Ca eutectic had a much finer structure as compared with the Al–Si eutectic, which suggests a possibility of reaching higher mechanical properties as compared to commercial alloys of the A356 type. The influence of the annealing temperature within the range up to 600 °C on the structure and hardness of the Al–Ca–Sc experimental alloys was studied. It was determined that the maximum hardening corresponded to the annealing at 300 °C, which was due to the precipitation of Al{sub 3}Sc nanoparticles with their further coarsening. With an example of an Al-7.6% Ca-0.3% Sc model experimental alloy, a principal possibility of manufacturing aluminium casting alloys based on the (Al) + Al{sub 4}Ca eutectic was demonstrated. Unlike commercial alloys of the A356 type, the model alloy does not require quenching, as hardening particles are formed in the course of annealing of casting. - Highlights: • Al–Ca–Sc phase diagram in aluminum corner. • Formation of Al{sub 3}Sc nanoparticles in eutectic (Al) + Al{sub 4}Ca during heating at 300–450 °C. • Hardening and thermal stability of proposed (Al–Ca–Sc) and commercial (Al–Si–Mg, 356 type) eutectic alloys.

Radiochemical study of 45Sc(n,p)45Ca and 89Y(n,p)89Sr reactions in the neutron energy range of 13.9 to 14.7 MeV

International Nuclear Information System (INIS)

Molla, N.I.; Basunia, S.; Miah, M.R.; Hossain, S.M.; Rahman, M.M.; Spellerberg, S.; Qaim, S.M.

1998-01-01

Cross sections for 45 Sc(n,p) 45 Ca and 89 Y(n,p) 89 Sr reactions were measured using the activation technique. Monoenergetic neutrons in the energy range of 13.9 to 14.7 MeV were produced using a D-T neutron generator. The purely β - emitting products 45 Ca and 89 Sr were separated radiochemically; their radioactivity was assayed via low-level β - counting. The measured data complement the available published experimental information, and agree with the results of statistical model calculations. (orig.)

The monoclinic superstructure of the M{sub 2}Pt{sub 6}Al{sub 15} series (M=Ca, Sc, Y, La, Lu)

Energy Technology Data Exchange (ETDEWEB)

Radzieowski, Mathis; Stegemann, Frank; Hoffmann, Rolf-Dieter [Muenster Univ. (Germany). Inst. fuer Anorganische und Analytische Chemie; Janka, Oliver [Muenster Univ. (Germany). Inst. fuer Anorganische und Analytische Chemie; Oldenburg Univ. (Germany). Inst. fuer Chemie

2017-07-01

The five ternary intermetallic compounds M{sub 2}Pt{sub 6}Al{sub 15} (M=Ca, Sc, Y, La, Lu) were prepared from the elements by arc-melting. The crystal structure was determined via single crystal X-ray diffraction. The title compounds crystallize in a superstructure of the RE{sub 0.67}Pt{sub 2}Al{sub 5} type structure (P6{sub 3}/mmc) in the monoclinic crystal system with space group P12{sub 1}/m1 (Sc{sub 2}Pt{sub 6}Al{sub 15}: a=734.19(2), b=1628.96(10), c=734.19(2) pm, β=119.999(3) ; wR=0.0356, 3034 F{sup 2} values, 68 variables). The superstructure can be derived by the superspace formalism using (3+2)D or (3+1)D interpretations of the diffraction data. The structural relation to the subcell structure is discussed on the basis of a group-subgroup scheme. In the crystal structure strongly bonded [Pt{sub 2}Al{sub 4}]{sup δ-} slabs are alternatingly stacked with ordered layers containing M atoms and Al{sub 3} triangles.

P.E.I. wood fuel survey, 1990-91

International Nuclear Information System (INIS)

1991-04-01

In 1991 a wood fuel survey of 450 randomly selected households, representing 1% of the total number of households in Prince Edward Island, was conducted. The survey indicated that 49.8% of the households burned wood, up from 42.1% of households in the 1988-1989 survey. The wood burning households consumed an average of 4.92 cords of wood, consistent with the 4.90 cords in the 1989 survey. The total residential wood consumption was estimated at ca 100,377 cords, an increase from the 89,000 cords used in 1988-89. Wood cutters represented 23.4% of respondents, with buyers representing 25.4% of respondents. The wood burning appliances used by the respondents were: airtight wood stove 39.9%, wood furnace 22.5%, kitchen wood stove 15.7%, combined wood/oil furnace 8.9%, Franklin/non-airtight 4.4%, Kemac unit 4.4%, fireplace insert 3.1%, and open fireplace 1%. The most frequent response among rural wood users cited price as an advantage of wood fuel, while the most frequent response of urban users cited the quality of the heat. 9 figs., 47 tabs

Input-Timing-Dependent Plasticity in the Hippocampal CA2 Region and Its Potential Role in Social Memory.

Science.gov (United States)

Leroy, Felix; Brann, David H; Meira, Torcato; Siegelbaum, Steven A

2017-08-30

Input-timing-dependent plasticity (ITDP) is a circuit-based synaptic learning rule by which paired activation of entorhinal cortical (EC) and Schaffer collateral (SC) inputs to hippocampal CA1 pyramidal neurons (PNs) produces a long-term enhancement of SC excitation. We now find that paired stimulation of EC and SC inputs also induces ITDP of SC excitation of CA2 PNs. However, whereas CA1 ITDP results from long-term depression of feedforward inhibition (iLTD) as a result of activation of CB1 endocannabinoid receptors on cholecystokinin-expressing interneurons, CA2 ITDP results from iLTD through activation of δ-opioid receptors on parvalbumin-expressing interneurons. Furthermore, whereas CA1 ITDP has been previously linked to enhanced specificity of contextual memory, we find that CA2 ITDP is associated with enhanced social memory. Thus, ITDP may provide a general synaptic learning rule for distinct forms of hippocampal-dependent memory mediated by distinct hippocampal regions. Copyright © 2017 Elsevier Inc. All rights reserved.

Location of the major 2Psub(1/2) strength in 49Sc by forward angle heavy-ion j dependence

International Nuclear Information System (INIS)

Kemper, K.W.; Zeller, A.F.; Ophel, T.R.

1977-12-01

Foward angle 48 Ca( 7 Li, 6 He) data show the 4.49 MeV state in 49 Sc to be 2Psub(1/2) and not 2Psub(3/2) as reported in an earlier 48 Ca( 15 N, 14 C) work. The ( 3 He,d) spectroscopic factor of 0.55 indicates that this state has the major components of the 2psub(1/2) strength in 49 Sc. (Author)

Soft spin-dipole resonances in 40Ca

International Nuclear Information System (INIS)

Stuhl, L; Krasznahorkay, A; Csatlós, M; Gulyás, J; Marketin, T; Litvinova, E; Adachi, T; Fujita, H; Hatanaka, K; Hirota, K; Ong, H J; Ishikawa, D; Matsubara, H; Algora, A; Estevez, E; Molina, F; Daeven, J; Guess, C; Meharchand, R; Fujita, Y

2012-01-01

High resolution experimental data has been obtained for the 40,42,44,48 Ca( 3 He,t)Sc charge exchange reaction at 420 MeV beam energy, which favors the spin-isospin excitations. The measured angular distributions were analyzed for each state separately, and the relative spin dipole strength has been extracted for the first time. The low-lying spin-dipole strength distribution in 40 Sc shows some interesting periodic gross feature. It resembles to a soft, damped multi-phonon vibrational band with hω= 1.8 MeV, which might be associated to pairing vibrations around 40 Ca.

Properties of the low-lying negative parity states in 45Sc

International Nuclear Information System (INIS)

Chevallier, J.; Haas, B.; Schulz, N.; Toulemonde, M.

1975-01-01

The electromagnetic decay of negative parity states in 45 Sc up to an excitation energy of 2107keV have been investigated via the 42 Ca(α,pγ) 45 Sc reaction at a bombarding energy of 10.5MeV. Spin and lifetime of the levels as well as branching and mixing ratios of their decay γ-rays have been obtained from proton-gamma angular correlation measurements. Calculations based on the strong coupling model have been performed. The results are compared with experiment [fr

How to make a beetle out of wood: multi-elemental stoichiometry of wood decay, xylophagy and fungivory.

Science.gov (United States)

Filipiak, Michał; Weiner, January

2014-01-01

The majority of terrestrial biomass is wood, but the elemental composition of its potential consumers, xylophages, differs hugely from that of wood. This causes a severe nutritional imbalance. We studied the stoichiometric relationships of 11 elements (C, N, P, K, Ca, Mg, Fe, Zn, Mn, Cu, Na) in three species of pine-xylem-feeding insects, Stictoleptura rubra, Arhopalus rusticus (Coleoptera, Cerambycidae) and Chalcophora mariana (Coleoptera, Buprestidae), to elucidate their mechanisms of tissue growth and to match their life histories to their dietary constraints. These beetles do not differ from other Coleoptera in their absolute elemental compositions, which are approximately 1000 (N), 100 (P, Cu) and 50 (K, Na) times higher than in dead but undecayed pine wood. This discrepancy diminishes along the wood decay gradient, but the elemental concentrations remain higher by an order of magnitude in beetles than in highly decayed wood. Numerical simulation of the life history of S. rubra shows that feeding on nutrient-poor undecayed wood would extend its development time to implausible values, whereas feeding on highly decomposed wood (heavily infected with fungi) would barely balance its nutritional budget during the long development period of this species. The changes in stoichiometry indicate that the relative change in the nutrient levels in decaying wood cannot be attributed solely to carbon loss resulting from decomposer respiration: the action of fungi substantially enriches the decaying wood with nutritional elements imported from the outside of the system, making it a suitable food for wood-eating invertebrates.

SC*994C>T causes the Sc(null) phenotype in Pacific Islanders and successful transfusion of Sc3+ blood to a patient with anti-Sc3.

Science.gov (United States)

Reid, Marion E; Hue-Roye, Kim; Velliquette, Randall W; Larimore, Kathleen; Moscarelli, Sue; Ohswaldt, Nicolas; Lomas-Francis, Christine

2013-01-01

Antigens in the SC blood group system are expressed by the human erythrocyte membrane-associated protein (ERMAP).Two molecular bases have been reported for the Sc,un phenotype:SC*307del2 and SC*994C>T. We report our investigation of the molecular background of five Sc,n1 individuals from the Pacific Islands and describe the successful transfusion of Sc3+ blood to a patient with anti-Sc3 in her plasma. SC (ERMAP) exons 2,3, and 12 and their flanking intronic regions were analyzed. TheSC*994C>T change introduces a restriction enzyme cleavage site for Tsp45I, and polymerase chain reaction (PCR) products from exon 12 were subjected to this PCR-restriction fragment length polymorphism (RFLP) assay. The five samples had the variant SC*994T/T. One sample, from a first cousin of one Marshallese proband, was heterozygous for SC*1514C/T (in the 3' untranslated region); the other four samples were SC*1514C/C(consensus sequence). Samples from white donors (n = 100) and African American donors (n = 99) were tested using the Tsp45IPCR-RFLP assay; all gave a banding pattern that was consistent with the SC*994C/C consensus sequence. In all five samples,our analyses showed homozygosity for the nonsense nucleotide change SC*994C>Tin an allele carrying the nucleotide associated with SLd. Further investigation determined that one of the probands reported previously with the SC*994C>T change was from the Marshall Islands (which form part of the Micronesian Pacific Islands) and the other was from an unspecified location within the large collection of Pacific Islands. Taken together, the five known probands with the SC*994C>T silencing nucleotide change were from the Pacific Islands.

Photoionization study of Ne-like K9+, Ca10+, Sc11+, Ti12+, V13+, Cr14+, Mn15+, and Fe16+ ions using the screening constant by unit nuclear charge method

International Nuclear Information System (INIS)

Goyal, Arun; Khatri, Indu; Sow, Malick; Sakho, Ibrahima; Aggarwal, Sunny; Singh, A.K.; Mohan, Man

2016-01-01

Photoionization of the 2s 2 2p 6 ( 1 S 0 ) ground state of the Ne-like (Z=19–29) ions is presented in this paper. Resonance energies and total natural width of the 2s2p 6 np 1 P series of the Ne-like K 9+ , Ca 10+ , Sc 11+ , Ti 12+ , V 13+ , Cr 14+ , Mn 15+ , and Fe 16+ are reported. All the calculations are made using the Screening constant by unit nuclear charge (SCUNC) formalism. New data for Ne-like K 9+ , Sc 11+ , Ti 12+ , V 13+ , Cr 14+ , and Mn 15+ ions are tabulated. Good agreements are found with available literature data. - Highlights: • Photoionization of ground state of the Ne-like (Z=19–29) presented. • good agreements with scarce literature data. • New data for Ne-like K 9+ , Sc 11+ , Ti 12+ , V 13+ , Cr 14+ , and Mn 15+ ions. • Useful guidelines for application in laboratory, astrophysics, and plasma physics.

Elemental analysis of ash residue from combustion of CCA treated wood waste before and after electrodialytic extraction

DEFF Research Database (Denmark)

Pedersen, Anne Juul; Ottosen, Lisbeth M.

2006-01-01

Element distribution in a combined fly ash and bottom ash from combustion of copper chromate arsenate (CCA) treated wood waste was investigated by scanning electron microscopy (SEM/EDX) before and after electrodialytic extraction. The untreated ash contained various particles, including pieces...... of incompletely combusted wood rich in Cr and Ca, and irregular particles rich in Si, Al and K. Cr was also found incorporated in silica-based matrix particles. As was associated with Ca in porous (char) particles, indicating that Ca-arsenates had been formed during combustion. Cu was associated with Cr...... in the incompletely combusted wood pieces and was also found in almost pure form in a surface layer of some matrix particles – indicating surface condensation of volatile Cu species. In treated ash, Ca and As were no longer found together, indicating that Ca-arsenates had been dissolved due to the electrodialytic...

Sc-W-Si and Sc-W-Ge ternary systems

International Nuclear Information System (INIS)

Kotur, B.Ya.; Voznyak, O.M.; Bodak, O.I.

1989-01-01

Phase equilibria in Sc-W-Si and Sc-W-Ge ternary systems are investigated at 1070 K. Sc 2+x W 3-x Si 4 ternary compound (0≤x≤1) is determined, its crystal structure (Ce 2 Sc 3 Si 4 structural type), as well as, change of elementary cell parameters and microhardness within homogeneity range are determined. Regularities of component interaction within Sc-M-Si(Ge) (M-Cr, Mo, W) ternary system are determined. Ternary systems with Mo and W are more closer to each other according to the phase equilibria character, than to ternary systems with Cr

Enrichment of Sc{sub 2}O{sub 3} and TiO{sub 2} from bauxite ore residues

Energy Technology Data Exchange (ETDEWEB)

Deng, Bona; Li, Guanghui, E-mail: liguangh@csu.edu.cn; Luo, Jun; Ye, Qing; Liu, Mingxia; Peng, Zhiwei; Jiang, Tao

2017-06-05

Highlights: • Sc{sub 2}O{sub 3} and TiO{sub 2} from bauxite ore residue were successfully enriched. • H{sub 3}PO{sub 4} and NaOH were efficient for enriching Sc{sub 2}O{sub 3} and TiO{sub 2} by removing SiO{sub 2}, Al{sub 2}O{sub 3}, and partial Fe{sub 2}O{sub 3} and CaO. • Enriching mechanism of Sc{sub 2}O{sub 3} and TiO{sub 2} was explicitly explained. - Abstract: As a major byproduct generated in the alumina industry, bauxite ore residue is an important reserve of scandium and titanium. In this study, the feasibility and mechanism of enriching Sc{sub 2}O{sub 3} and TiO{sub 2} from a non-magnetic material, which was obtained from carbothermal reductive roasting and magnetic separation of bauxite ore residue, were investigated based on a two-step (acidic and alkali) leaching process. It was revealed that approximately 78% SiO{sub 2} and 30–40% of CaO, FeO and Al{sub 2}O{sub 3} were removed from a non-magnetic material with 0.0134 wt.% Sc{sub 2}O{sub 3} and 7.64 wt.% TiO{sub 2} by phosphoric acidic leaching, while about 95% Al{sub 2}O{sub 3} and P{sub 2}O{sub 5} were further leached by subsequent sodium hydroxide leaching of the upper-stream leach residue. A Sc{sub 2}O{sub 3}-, TiO{sub 2}- rich material containing 0.044 wt.% Sc{sub 2}O{sub 3} and 25.5 wt.% TiO{sub 2} was obtained, the recovery and the enrichment factor of Sc{sub 2}O{sub 3} and TiO{sub 2} were about 85% and 5, respectively. The enrichment of Sc{sub 2}O{sub 3} was attributed to higher pH (>3.3) of phosphoric acid solution than its dissolution pH{sup 0}, and the enrichment of TiO{sub 2} was mainly associated with the insoluble perovskite (CaTiO{sub 3}) in the acidic solution at ambient temperature. As Sc{sub 2}O{sub 3} and TiO{sub 2} cannot be dissolved in the alkali solution, they were further enriched in the leach residue.

NANOCOATING PROCESS FOR TEXTILES APPLICATIONS AND WOOD PROTECTION

Directory of Open Access Journals (Sweden)

NICULESCU Claudia

2014-05-01

Full Text Available This paper presents the research results obtained in ERA NET MANUCOAT project, coordinated by INCDTP in collaboration with the following partners: INCDMNR-IMNR, SC MGM STAR CONSTRUCT SRL –Romania and IRIS-Spain. The objective of the research was to develop and obtain textile and wood surfaces with self-cleaning, photo catalytic, antibacterial and antifungal properties. An innovative method of manufacturing nanoparticles by hydrothermal process in a single step without any further heat treatment and controlled stoichiometry, tested spray coating technology (sputtering were developed. Full characterization of nanostructured powders in terms of chemical, physical, structural, thermal and technological characteristics was performed. The most important features to be considered in the treatment of wood by sputtering in order to deposit thin layers of TiO2 NPs or TiO2/Ag as the humidity should be below 12% and the maximum roughness P150, depending on the species of wood. Future works envisage optimizing the existing sputtering systems for pilot stage, in order to make nanoparticles deposits on large areas of textile and wood. The results of the research are photocatalytic textiles for surgical gowns, operative fields, hospital bed sheets and curtains and drapes for public spaces.

First measurement of the nonlinear coefficient for Gd_1-xLu_x Ca₄O(BO₃)₃ and Gd_1-xSc_xCa₄O(BO₃)₃ crystals

DEFF Research Database (Denmark)

Andersen, Martin Thalbitzer; Mortensen, Jesper Liltorp; Germershausen, Sven

2007-01-01

The effective nonlinear coefficient and temperature acceptance bandwidth of three Lu and Sc co-doped GdCa4O(B03)3 type nonlinear crystals were measured. NCPM for SHG in to the blue-UV spectral region can be obtained by controlling the co-dopant concentration. Measurements were based on intra-cavi...

The temporoammonic input to the hippocampal CA1 region displays distinctly different synaptic plasticity compared to the Schaffer collateral input in vivo: significance for synaptic information processing

Directory of Open Access Journals (Sweden)

Ayla eAksoy Aksel

2013-08-01

Full Text Available In terms of its sub-regional differentiation, the hippocampal CA1 region receives cortical information directly via the perforant (temporoammonic path (pp-CA1 synapse and indirectly via the tri-synaptic pathway where the last relay station is the Schaffer collateral-CA1 synapse (Sc-CA1 synapse. Research to date on pp-CA1 synapses has been conducted predominantly in vitro and never in awake animals, but these studies hint that information processing at this synapse might be distinct to processing at the Sc-CA1 synapse. Here, we characterized synaptic properties and synaptic plasticity at the pp-CA1 synapse of freely behaving adult rats. We established that field excitatory postsynaptic potentials at the pp-CA1 have longer onset latencies and a shorter time-to-peak compared to the Sc-CA1 synapse. LTP (> 24h was successfully evoked by tetanic afferent stimulation of pp-CA1 synapses. Low frequency stimulation evoked synaptic depression at Sc-CA1 synapses, but did not elicit LTD at pp-CA1 synapses unless the Schaffer collateral afferents to the CA1 region had been severed. Paired-pulse responses also showed significant differences. Our data suggest that synaptic plasticity at the pp-CA1 synapse is distinct from the Sc-CA1 synapse and that this may reflect its specific role in hippocampal information processing.

Effect of wood ash application on soil solution chemistry of tropical acid soils: incubation study.

Science.gov (United States)

Nkana, J C Voundi; Demeyer, A; Verloo, M G

2002-12-01

The objective of this study was to determine the effect of wood ash application on soil solution composition of three tropical acid soils. Calcium carbonate was used as a reference amendment. Amended soils and control were incubated for 60 days. To assess soluble nutrients, saturation extracts were analysed at 15 days intervals. Wood ash application affects the soil solution chemistry in two ways, as a liming agent and as a supplier of nutrients. As a liming agent, wood ash application induced increases in soil solution pH, Ca, Mg, inorganic C, SO4 and DOC. As a supplier of elements, the increase in the soil solution pH was partly due to ligand exchange between wood ash SO4 and OH- ions. Large increases in concentrations of inorganic C, SO4, Ca and Mg with wood ash relative to lime and especially increases in K reflected the supply of these elements by wood ash. Wood ash application could represent increased availability of nutrients for the plant. However, large concentrations of basic cations, SO4 and NO3 obtained with higher application rates could be a concern because of potential solute transport to surface waters and groundwater. Wood ash must be applied at reasonable rates to avoid any risk for the environment.

Water availability and genetic effects on wood properties of loblolly pine (Pinus taeda)

Science.gov (United States)

C. A. Gonzalez-Benecke; T. A. Martin; Alexander Clark; G. F. Peter

2010-01-01

We studied the effect of water availability on basal area growth and wood properties of 11-year-old loblolly pine (Pinus taeda L.) trees from contrasting Florida (FL) (a mix of half-sib families) and South Carolina coastal plain (SC) (a single, half-sib family) genetic material. Increasing soil water availability via irrigation increased average wholecore specific...

Effect of lime and wood ash on the nixtamalization of maize and tortilla chemical and nutritional characteristics.

Science.gov (United States)

Pappa, María Renée; de Palomo, Patricia Palacios; Bressani, Ricardo

2010-06-01

The objective of the study was to obtain information on the chemical composition, functional properties, sensory quality and protein value of tortillas made from the nixtamalization of maize using either lime or wood ashes. The Ca, K, Mg, Fe, and Zn content of lime and wood ashes showed lime to be high in Ca content while wood ash contained more K and about 71% of the Ca content of lime. Both contained relatively high levels of Mg, Fe and Zn, but more so in the wood ashes. The level of reagent for nixtamalization was set at 0.8% of the maize weight. All other processing conditions were kept constant. The pH of the cooking solution was 12.0 for lime and 10.9 for wood ash. The moisture content of maize at 60 min of cooking was 45.8% for both treatments, however after 12 h of soaking, moisture level was 51.0% for the lime treatment and only 46.8% for the ash treatment. Solids (2.4%) in the lime cooking liquor were higher than in the wood ash liquor (1.0%). Chemical composition changes were similar between treatments in masa and tortilla; however, both masa and tortillas absorbed relatively high levels of all minerals including Fe and Zn from the wood ash treatment. The different treatment influenced functional properties particularly hardness and color. Tortilla characteristics were also similar. Protein quality of both alkali cooked products was lower than that of raw corn, more so the product from the wood ash treatment. Although some differences were observed in the sensory studies, human subjects did not dislike the wood ash made tortillas.

Structure and bonding of ScCN and ScNC: Ground and low-lying states

International Nuclear Information System (INIS)

Kalemos, Apostolos; Metropoulos, Aristophanes; Mavridis, Aristides

2012-01-01

Graphical abstract: The experimentally unknown systems ScCN and ScNC have been studied through single reference CISD and CCSD(T) methods. A total of 20 = 10 (ScCN) + 10 (ScNC) states were examined. All states are quite ionic whereas ScNC(X ∼3 Δ) is stabler than ScCN(X ∼3 Δ) by ∼5 kcal/mol. Display Omitted Highlights: ► We have studied through ab initio methods the polytopic system Sc[CN]. ► A series of low lying states for both isomeric forms have been examined. ► Around equilibrium the system displays a pronounced Sc + [CN] − ionic character. - Abstract: We have studied the experimentally unknown Sc[CN] molecular system in both its isomeric forms, scandium cyanide (ScCN) and isocyanide (ScNC), through ab initio computations. We report energetics, geometries, harmonic frequencies, and dipole moments for the first 20 Sc[CN] states correlating diabatically to Sc + ( 3 D, 1 D, 3 F) + CN − (X 1 Σ + ). Both isomers have a pronounced ionic character around equilibrium due to the high electron affinity of the CN group and the low ionization energy of the Sc atom. According to our calculations the ScNC isomer (X ∼3 Δ) is stabler than the ScCN(X ∼3 Δ) by ∼5 kcal/mol.

EVALUATION OF CEMENT-BONDED PARTICLE BOARD PRODUCED FROM AFZELIA AFRICANA WOOD RESIDUES

Directory of Open Access Journals (Sweden)

OLUFEMI A. SOTANNDE

2012-12-01

Full Text Available The study was design to evaluate the physical and mechanical properties of cement-bonded particleboards produced from Afzelia africana wood residues. The production variables investigated were three wood particle types (flakes, flake-sawdust mix and sawdust, three chemical accelerators (CaCl2, MgCl2 and AlCl3 and four wood-cement ratios (1:2.0, 1:2.5, 1:3.0 and 1:3.5. The accelerators were based on 2% by weight of cement used. The boards produced were subjected to physical tests such as density, percentage water absorption and thickness swelling. Mechanical properties evaluated were modulus of rupture, internal bonding strength and compressive strength. The results revealed that the type of particle used, wood-cement ratio and chemical additives had a marked influence on the physical and mechanical properties of the boards (p < 0.05. From quality view point, flake-sawdust composite ranked best while flake boards ranked least. Similarly, CaCl2 had the best influence on the setting of the boards followed by MgCl2 and AlCl3. Finally, it has been shown that particle boards that satisfied the BISON type HZ requirement and ISO 8335 can be produced from Afzelia africana particularly at wood-cement of 1:2.5 and above.

Superhydrophobic coatings on wood substrate for self-cleaning and EMI shielding

Science.gov (United States)

Xing, Yingjie; Xue, Yaping; Song, Jinlong; Sun, Yankui; Huang, Liu; Liu, Xin; Sun, Jing

2018-04-01

A layer of superhydrophobic coating having good electromagnetic shielding and self-cleaning performance was fabricated on a wood surface through an electroless copper plated process. The superhydrophobic property of the wood surface was measured by contact angle (CA) and roll-off angle (RA) measurements. The microstructure and chemical composition of the superhydrophobic coating were analyzed by scanning electron microscopy (SEM), energy dispersive spectrometer (EDS) and X-ray diffraction (XRD). The analysis revealed that the microscale particles were uniformly distributed on the wood surface and the main component of the coating is metallic copper. The as-prepared Cu coatings on wood substrate exhibit a good superhydrophobicity with water contact angle about 160° and rolling angle less than 5°.

Effects of acidity on primary productivity in lakes: phytoplankton. [Lakes Panther, Sagamore, and Woods

Energy Technology Data Exchange (ETDEWEB)

Hendrey, G R

1979-01-01

Relationships between phytoplankton communities and lake acidity are being studied at Woods Lake (pH ca. 4.9), Sagamore Lake (pH ca. 5.5), and Panther Lake (pH ca. 7.0). Numbers of phytoplankton species observed as of July 31, 1979 are Woods 27, Sagamore 38, and Panther 64, conforming to other observations that species numbers decrease with increasing acidity. Patterns of increasing biomass and productivity found in Woods Lake may be atypical of similar oligotrophic lakes in that they develop rather slowly instead of occuring very close to ice-out. Contributions of netplankton (net > 48 ..mu..m), nannoplankton (48 > nanno > 20 ..mu..m) and ultraplankton (20 > ultra >0.45 ..mu..m) to productivity per m/sup -2/ show that the smaller plankton are relatively more important in the more acid lakes. This pattern could be determined by nutrient availability (lake acidification leading to decreased availability of phosphorus). The amount of /sup 14/C-labelled dissolved photosynthate (/sup 14/C-DOM), as a percent of total productivity, is ordered Woods > Sagamore > Panther. This is consistent with a hypothesis that microbial heterotrophic activity is reduced with increasing acidity, but the smaller phytoplankton may be more leaky at low pH. (ERB)

Sc-45 nuclear magnetic resonance analysis of precipitation in dilute Al-Sc alloys

NARCIS (Netherlands)

Celotto, S; Bastow, TJ

Nuclear magnetic resonance (NMR) with Sc-45 is used to determine the solid solubility of scandium in aluminium and to follow the precipitation of Al3Sc during the ageing of an Al-0.06 at.% Sc alloy via the two fully resolved peaks, corresponding to Sc in the solid solution Al matrix and to Sc in the

Canted ferrimagnetism in Ca2+Sc3+ substituted yttrium-iron-garnet

Science.gov (United States)

Pardavi-Horváth, M.; Thavendrarajah, A.; Wigen, P. E.; DeGasperis, P.

1988-11-01

The temperature dependence of the magnetization of Y3-y-zCayLuzFe5-xScxO12 (0.6≤x≤1.2, 0≤y≤0.3, 0≤z≤0.9) epitaxial garnet films was measured from 4.2 K up to the Curie temperature. For x=0.7 and T≥50 K, 4πMs is enhanced by about 10% compared to the magnetization of Sc0.7 YIG. At TJdd/Jad)/da =28 nm.-1 For x=1.2 and T<10 K the magnetization can be influenced by cooling through the Curie point in a magnetic field.

Fabrication of a superhydrophobic surface on a wood substrate

Science.gov (United States)

Wang, Shuliang; Shi, Junyou; Liu, Changyu; Xie, Cheng; Wang, Chengyu

2011-09-01

A layer of lamellar superhydrophobic coating was fabricated on a wood surface through a wet chemical process. The superhydrophobic property of the wood surface was measured by contact angle (CA) measurements. The microstructure and chemical composition of the superhydrophobic coating were analyzed by scanning electron microscopy (SEM), X-ray diffraction (XRD) and Fourier transform infrared spectroscopy (FT-IR). An analytical characterization revealed that the microscale roughness of the lamellar particles was uniformly distributed on the wood surface and that a zinc stearate monolayer (with the hydrophobic groups oriented outward) formed on the ZnO surface as the result of the reaction between stearic acid and ZnO. This process transformed the wood surface from hydrophilic to superhydrophobic: the water contact angle of the surface was 151°, and the sliding angle was less than 5°.

Radiolabeling of DOTATOC with the long-lived positron emitter {sup 44}Sc

Energy Technology Data Exchange (ETDEWEB)

Pruszynski, Marek; Majkowska-Pilip, Agnieszka [Centre of Radiochemistry and Nuclear Chemistry, Institute of Nuclear Chemistry and Technology, Dorodna 16, 03-195 Warszawa (Poland); Loktionova, Natalia S.; Eppard, Elisabeth [Institute of Nuclear Chemistry, Johannes Gutenberg-University of Mainz, Fritz-Strassmann-Weg 2, D-55128 Mainz (Germany); Roesch, Frank, E-mail: frank.roesch@uni-mainz.de [Institute of Nuclear Chemistry, Johannes Gutenberg-University of Mainz, Fritz-Strassmann-Weg 2, D-55128 Mainz (Germany)

2012-06-15

The positron-emitting radionuclide {sup 44}Sc with a half-life of 3.97 h and a {beta}{sup +} branching of 94.3% is of potential interest for clinical PET. As so far it is available from a {sup 44}Ti/{sup 44}Sc generator in Mainz, where long-lived {sup 44}Ti decays to no-carrier-added (nca) {sup 44}Sc. The {sup 44}Sc is a trivalent metal cation and should be suitable for complexation with many well established bifunctional chelators conjugated to peptides or other molecular targeting vectors. Thus, the aim of this work was to investigate the potential of {sup 44}Sc for labeling of DOTA-conjugated peptides. DOTA-D-Phe{sup 1}-Tyr{sup 3}-octreotide (DOTATOC) was used as a model molecule to study and optimize labeling procedure. Reaction parameters such as buffer conditions, concentration of peptide, pH range, reaction temperature and time were optimized. Addition of 21 nmol of DOTATOC to {sup 44}Sc in ammonium acetate buffer pH 4.0 provided labeling yields >98% within 25 min of heating in an oil-bath at 95 Degree-Sign C. This time can be reduced to 3 min only by applying microwave supported heating. {sup 44}Sc-DOTATOC was found to be stable in 0.9% NaCl, PBS pH 7.4, fetal calf and human serums, and also in the presence of competing metal cations (Fe{sup 3+}, Ca{sup 2+}, Cu{sup 2+}, Mg{sup 2+}), as well as other ligand competitors, like EDTA and DTPA, even after almost 25 h incubation at 37 Degree-Sign C. Present study shows that nca {sup 44}Sc forms stable complexes with the macrocyclic ligand DOTA and that {sup 44}Sc-DOTATOC and analog targeting vectors may be synthesized for further preclinical and clinical investigations. - Highlights: Black-Right-Pointing-Pointer Labeling of somatostatin analouges with positron emitter {sup 44}Sc was tested. Black-Right-Pointing-Pointer DOTATOC was labeled with {sup 44}Sc isotope. Black-Right-Pointing-Pointer Optimal conditions for {sup 44}Sc-DOTATOC synthesis were found. Black-Right-Pointing-Pointer Stability of {sup 44}Sc

Electronic structure and physical properties of ScN in pressure: density-functional theory calculations

International Nuclear Information System (INIS)

Guan Pengfei; Wang Chongyu; Yu Tao

2008-01-01

Local density functional is investigated by using the full-potential linearized augmented plane wave (FP-LAPW) method for ScN in the hexagonal structure and the rocksalt structure and for hexagonal structures linking a layered hexagonal phase with wurtzite structure along a homogeneous strain transition path. It is found that the wurtzite ScN is unstable and the layered hexagonal phase, labelled as h o , in which atoms are approximately fivefold coordinated, is metastable, and the rocksalt ScN is stable. The electronic structure, the physical properties of the intermediate structures and the energy band structure along the transition are presented. It is found that the band gaps change from 4.0 to 1.0 eV continuously when c/a value varies from 1.68 to 1.26. It is noticeable that the study of ScN provides an opportunity to apply this kind of material (in wurtzite[h]-derived phase). (condensed matter: electronic structure, electrical, magnetic, and optical properties)

Crystal structure and phase stability of AlSc in the near-equiatomic Al–Sc alloy

Energy Technology Data Exchange (ETDEWEB)

Li, Juan; Huang, Li; Liang, Yongfeng [State Key Laboratory for Advanced Metals and Materials, University of Science and Technology Beijing, 30 Xueyuan Road, Beijing 100083 (China); Ye, Feng, E-mail: yefeng@skl.ustb.edu.cn [State Key Laboratory for Advanced Metals and Materials, University of Science and Technology Beijing, 30 Xueyuan Road, Beijing 100083 (China); Lin, Junpin [State Key Laboratory for Advanced Metals and Materials, University of Science and Technology Beijing, 30 Xueyuan Road, Beijing 100083 (China); Shang, Shunli; Liu, Zikui [Department of Materials Science and Engineering, The Pennsylvania State University, University Park, PA 16802 (United States)

2015-01-05

Highlights: • Two lattice structures of equiatomic Al–Sc compounds are confirmed. • Al–Sc phase at Sc 50 at.% has a space group of Pbam. • Al–Sc phase at Sc 55 at.% has a space group of B2. • B2 AlSc is a metastable phase with Sc 50 at.%. • Lattice transition between two compounds is proposed under local thermal stress. - Abstract: Intermetallic compound AlSc is found in the equiatomic Al–Sc binary alloy. The present work indicates that the orthorhombic AlSc with the Au{sub 2}CuZn-type structure can be formed at 50 at.% Sc, while the CsCl-type (B2) AlSc will be formed at 55 at.% Sc. After annealing at 1100 °C, some orthorhombic AlSc grains transit to the B2 structure, and the annealing at lower temperatures leads to the disappearance of B2 phase, indicating that the B2 AlSc is also a metastable phase in the alloy at lower Sc content (<50 at.%). First-principle calculations at 0 K reveal that the orthorhombic AlSc is more stable than the B2 AlSc with the energy difference between them being 5.4 meV/atom. The fast transition between these two phases, which cannot be interpreted by the mechanism of atomic diffusion, was tentatively analyzed by the volume change based on the calculated atomic positions of these two phases.

Mixture toxicity of wood preservative products in the fish embryo toxicity test.

Science.gov (United States)

Coors, Anja; Dobrick, Jan; Möder, Monika; Kehrer, Anja

2012-06-01

Wood preservative products are used globally to protect wood from fungal decay and insects. We investigated the aquatic toxicity of five commercial wood preservative products, the biocidal active substances and some formulation additives contained therein, as well as six generic binary mixtures of the active substances in the fish embryo toxicity test (FET). Median lethal concentrations (LC50) of the single substances, the mixtures, and the products were estimated from concentration-response curves and corrected for concentrations measured in the test medium. The comparison of the experimentally observed mixture toxicity with the toxicity predicted by the concept of concentration addition (CA) showed less than twofold deviation for all binary mixtures of the active substances and for three of the biocidal products. A more than 60-fold underestimation of the toxicity of the fourth product by the CA prediction was detected and could be explained fully by the toxicity of one formulation additive, which had been labeled as a hazardous substance. The reason for the 4.6-fold underestimation of toxicity of the fifth product could not be explained unambiguously. Overall, the FET was found to be a suitable screening tool to verify whether the toxicity of formulated wood preservatives can reliably be predicted by CA. Applied as a quick and simple nonanimal screening test, the FET may support approaches of applying component-based mixture toxicity predictions within the environmental risk assessment of biocidal products, which is required according to European regulations. Copyright © 2012 SETAC.

Possibilities for the Use of Wood Ashes in Agriculture

Directory of Open Access Journals (Sweden)

Barbara Symanowicz

2018-05-01

The following physical properties of the ashes were determined: colour, solubility, porosity, absorbability, compression strength, degree of fineness, moisture content and spreadability. In the ashes obtained from the combustion of wood in a fireplace furnace, the following parameters were determined: pH H2O, pHKCl (1 mole dm-3 KCl, pHCaCl2 (0.01 mole dm-3 CaCl2 and total alkalinity in terms of the suitability of ashes as a liming agent. The contents of Ctot. and Ntot. were determined with a CHNS/O elemental analyser by Perkin-Elmer and the contents of other elements (macronutrients and heavy metals were specified using the method of atomic emission spectrometry with inductively coupled plasma ICP-AES. Wood ashes are a source of macronutrients for plants. Their contents can be presented in the following series of decreasing values: Ca > C > K > Mg > P > S > N. Out of 1 t of wood ash, approx. 160 kg C, 6 kg N, 20 kg P, 98 kg K, 302 kg Ca, 39 kg Mg and 18 kg S can be introduced into the soil. The content of heavy metals in the analysed ashes was low, and exceeded the acceptable standards for their content in waste materials intended for liming soils. The analysed ashes exhibit good physical and chemical properties. They can be suitable for use in agriculture as a liming agent to be applied on medium and heavy soils.

Platinum determination by instrumental neutron activation analysis with special reference to the spectral interference of Sc-47 on the platinum indicator nuclide Au-199

DEFF Research Database (Denmark)

Alfassi, Z.B.; Probst, T.U.; Rietz, B.

1998-01-01

A method of instrumental neutron activation analysis (INAA) is developed for the determination of platinum by the Au-199 daughter of Pt-199 in the presence of the spectral interference from the Sc-47 daughter of Ca-47. The contributions of the Pt and Ca signals to the integral 157-161 keV peak we...... separated by calculating the number of disintegrations due to the Sc-47 from the signal of her parent Ca-47 at 1297.1 keV gamma-ray. The method was used to calculate the trace concentrations of Pt in air samples, collected on filters, (C) 1998 Elsevier Science B.V....

46 CFR 7.70 - Folly Island, SC to Hilton Head Island, SC.

Science.gov (United States)

2010-10-01

... 46 Shipping 1 2010-10-01 2010-10-01 false Folly Island, SC to Hilton Head Island, SC. 7.70 Section... BOUNDARY LINES Atlantic Coast § 7.70 Folly Island, SC to Hilton Head Island, SC. (a) A line drawn from the...′ W. (Port Royal Sound Lighted Whistle Buoy “2PR”); thence to the easternmost extremity of Hilton Head...

44gSc production using a water target on a 13 MeV cyclotron

International Nuclear Information System (INIS)

Hoehr, Cornelia; Oehlke, Elisabeth; Benard, Francois; Lee, Chris Jaeil; Hou, Xinchi; Badesso, Brian; Ferguson, Simon; Miao, Qing; Yang, Hua; Buckley, Ken; Hanemaayer, Victoire; Zeisler, Stefan; Ruth, Thomas; Celler, Anna; Schaffer, Paul

2014-01-01

Introduction: Access to promising radiometals as isotopes for novel molecular imaging agents requires that they are routinely available and inexpensive to obtain. Proximity to a cyclotron center outfitted with solid target hardware, or to an isotope generator for the metal of interest is necessary, both of which can introduce significant hurdles in development of less common isotopes. Herein, we describe the production of 44 Sc (t 1/2 = 3.97 h, E avg,β + = 1.47 MeV, branching ratio = 94.27%) in a solution target and an automated loading system which allows a quick turn-around between different radiometallic isotopes and therefore greatly improves their availability for tracer development. Experimental yields are compared to theoretical calculations. Methods: Solutions containing a high concentration (1.44–1.55 g/mL) of natural-abundance calcium nitrate tetrahydrate (Ca(NO 3 ) 2 · 4 H 2 O) were irradiated on a 13 MeV proton-beam cyclotron using a standard liquid target. 44g Sc was produced via the 44 Ca(p,n) 44g Sc reaction. Results: 44g Sc was produced for the first time in a solution target with yields sufficient for early radiochemical studies. Saturation yields of up to 4.6 ± 0.3 MBq/μA were achieved using 7.6 ± 0.3 μA proton beams for 60.0 ± 0.2 minutes (number of runs n = 3). Experimental data and calculation results are in fair agreement. Scandium was isolated from the target mixture via solid-phase extraction with 88 ± 6% (n = 5) efficiency and successfully used for radiolabelling experiments. The demonstration of the production of 44 Sc in a liquid target greatly improves its availability for tracer development

Proton-oxygen conductivity in substituted perovskites ATi0.95Mo0.05O3-α (A = Ca, Sr, Ba; M = Sc, Mg) in the reducing hydrogen-containing atmospheres

International Nuclear Information System (INIS)

Gorelov, V.P.; Balakireva, V.B.; Sharova, N.V.

1999-01-01

Electric conductivity depending on temperature, oxygen partial pressure, as well as the number of t i ion transfer and transfer hydrogen numbers in the perovskites ATi 0.95 Mo 0.05 O 3-α (A = Ca, Sr, Ba; M = Sc, Mg) in reducing hydrogen-containing atmospheres in the temperature range of 450-850 deg C have been measured. With the temperature decrease t i increases reaching 1.0 at a temperature of 550 deg C for all compositions. Proton conductivity under conditions of assumed concomitant transfer of either O 2- or OH - has been ascertained [ru

High-resolution clean-sc

NARCIS (Netherlands)

Sijtsma, P.; Snellen, M.

2016-01-01

In this paper a high-resolution extension of CLEAN-SC is proposed: HR-CLEAN-SC. Where CLEAN-SC uses peak sources in “dirty maps” to define so-called source components, HR-CLEAN-SC takes advantage of the fact that source components can likewise be derived from points at some distance from the peak,

Significance of wood extractives for wood bonding.

Science.gov (United States)

Roffael, Edmone

2016-02-01

Wood contains primary extractives, which are present in all woods, and secondary extractives, which are confined in certain wood species. Extractives in wood play a major role in wood-bonding processes, as they can contribute to or determine the bonding relevant properties of wood such as acidity and wettability. Therefore, extractives play an immanent role in bonding of wood chips and wood fibres with common synthetic adhesives such as urea-formaldehyde-resins (UF-resins) and phenol-formaldehyde-resins (PF-resins). Extractives of high acidity accelerate the curing of acid curing UF-resins and decelerate bonding with alkaline hardening PF-resins. Water-soluble extractives like free sugars are detrimental for bonding of wood with cement. Polyphenolic extractives (tannins) can be used as a binder in the wood-based industry. Additionally, extractives in wood can react with formaldehyde and reduce the formaldehyde emission of wood-based panels. Moreover, some wood extractives are volatile organic compounds (VOC) and insofar also relevant to the emission of VOC from wood and wood-based panels.

Heterogeneous studies in pulping of wood: Modelling mass transfer of alkali

OpenAIRE

Simão, João P. F.; Egas, Ana P. V.; Carvalho, M. Graça; Baptista, Cristina M. S. G.; Castro, José Almiro A. M.

2008-01-01

In this paper a heterogeneous lumped parameter model is proposed to describe the mass transfer of effective alkali during the kraft pulping of wood. This model, based on the spatial mean of the concentration profile of effective alkali along the chip thickness, enables the estimation of the effective diffusion coefficient that characterizes the internal resistance to mass transfer and the contribution of the external resistance to mass transfer which has often been neglected. http://www.sc...

PATRIMÔNIO CULTURAL E TURISMO: um estudo de caso do Filò Talian realizado em Caçador (SC

Directory of Open Access Journals (Sweden)

Kênia Zanella

2017-09-01

Full Text Available Este artigo tem como objetivo compreender como o Filò, costume dos imigrantes italianos, poderá ser preservado através da atividade turística no município de Caçador (SC. Trata-se de uma pesquisa qualitativa e exploratória, tendo como método o estudo de caso. Como resultados, verificou-se que o evento ainda se desenvolve de forma familiar e mantém muitas das características originais dos imigrantes, preservando a cultura dos antepassados e despertando o interesse da população local e de outros municípios. Constatou-se, também, que para se tornar um produto turístico, faz-se necessária a ampliação do evento e adaptações em relação à infraestrutura e mão de obra para o atendimento a um público maior ou então manter suas características originais e dedicá-lo ao turismo de experiência, onde o turista poderá vivenciar a realidade local e trocar saberes com a comunidade visitada.

Pine Wood Treated with a Citric Acid and Glycerol Mixture: Biomaterial Performance Improved by a Bio-byproduct

Directory of Open Access Journals (Sweden)

Gatien Geraud Essoua Essoua

2016-02-01

Full Text Available Wood material is a good reservoir for biogenic carbon storage. The use of wood material for outdoor products such as siding in the building construction sector presents limits. These limits are bound to the nature of wood material (hygroscopic property and anatomical structure. They are responsible for the dimensional variation associated with moisture content variations. Fungal attacks and coating layers adhesion on wood surface, are other problems. This research investigated the feasibility of impregnation with environmentally friendly chemicals, i.e., a citric acid-glycerol mixture (CA-G. The anti-swelling efficiency (ASE, hardness, biodegradation, and coating adhesion tests were performed on softwood specimens. ASE results were up to 53%. The equilibrium moisture content of the treated specimens was less than half of the untreated ones. FTIR spectroscopy showed bands at 1720 to 1750 cm-1, indicating the presence of ester bonds, and scanning electron microscopy images confirmed the polymerization and condensation of treatment solution inside the wood structure. Hardness and decay resistance were increased; however, treatment reduces coating adhesion. In conclusion, CA-G represents a promising eco-responsible solution for improving the technical performance of outdoor wood products.

2,5-hexanedione (HD) treatment alters calmodulin, Ca2+/calmodulin-dependent protein kinase II, and protein kinase C in rats' nerve tissues

International Nuclear Information System (INIS)

Wang Qingshan; Hou Liyan; Zhang Cuili; Zhao Xiulan; Yu Sufang; Xie, Ke-Qin

2008-01-01

Calcium-dependent mechanisms, particularly those mediated by Ca 2+ /calmodulin (CaM)-dependent protein kinase II (CaMKII), have been implicated in neurotoxicant-induced neuropathy. However, it is unknown whether similar mechanisms exist in 2,5-hexanedione (HD)-induced neuropathy. For that, we investigated the changes of CaM, CaMKII, protein kinase C (PKC) and polymerization ratios (PRs) of NF-L, NF-M and NF-H in cerebral cortex (CC, including total cortex and some gray), spinal cord (SC) and sciatic nerve (SN) of rats treated with HD at a dosage of 1.75 or 3.50 mmol/kg for 8 weeks (five times per week). The results showed that CaM contents in CC, SC and SN were significantly increased, which indicated elevation of Ca 2+ concentrations in nerve tissues. CaMKII contents and activities were also increased in CC and were positively correlated with gait abnormality, but it could not be found in SC and SN. The increases of PKC contents and activities were also observed in SN and were positively correlated with gait abnormality. Except for that of NF-M in CC, the PRs of NF-L, NF-M and NF-H were also elevated in nerve tissues, which was consistent with the activation of protein kinases. The results suggested that CaMKII might be partly (in CC but not in SC and SN) involved in HD-induced neuropathy. CaMKII and PKC might mediate the HD neurotoxicity by altering the NF phosphorylation status and PRs

Determination of Sc and Th in ScI3-NaI-ThI4 sample

International Nuclear Information System (INIS)

Yuan Hui; Yang Zhihong

1999-01-01

Determination of Sc and Th in ScI 3 -NaI-ThI 4 sample is studied by X-ray fluorescence and complexometry. The effect of working condition of Sc on X-ray fluorescence spectrometer and different sample-making method on the determination of Sc and Th are studied experimentally. The X-ray fluorescence analysis of determination of Sc and Th is developed by polyester film sample-making technique, the measuring precision of Sc and Th is better than 4%. The effect of acidity and temperature on the determining end point of titration is obvious. The results of different complexometric methods are compared. The precision of Sc and Th is less than 2% by comlexometry, it is fit for the routine analysis of ScI 3 -NaI-ThI 4 sample

Wood handbook : wood as an engineering material

Science.gov (United States)

Robert J. Ross; Forest Products Laboratory. USDA Forest Service.

2010-01-01

Summarizes information on wood as an engineering material. Presents properties of wood and wood-based products of particular concern to the architect and engineer. Includes discussion of designing with wood and wood-based products along with some pertinent uses.

WOOD PROPERTIES AND EFFECT OF WOOD PROPERTIES ON THE WOOD FINISHING

Directory of Open Access Journals (Sweden)

Abdulkadir Malkoçoğlu

2006-04-01

Full Text Available Wood is basic raw material for furniture and joinery industries with wood structures. Wood is a biological material that has widely different properties depending on species, geographic area where the tree grew, the growth condition, size of the tree at harvest, sawing, and other manufacturing processes. Wood properties have been characterized within two groups as natural and manufacturing factors that effects finishing performance. Grow rate, density, knots, moisture content, extractives and juvenile wood are natural characteristics. Grain orientation, texture, drying and performance expectations are manufacturing characteristics. In this review, the effects of natural and manufacturing characteristics are discussed on the surface finishing performance of wood.

ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available n CaO19.6989 [Candida albicans SC5314] ... Length = 94 ... Query: 11 ... VKNLPYNTSNSSLYEFFGKYGYINQIRINSSQPG...TCFIIYHNIKNAQRAAQDLNGVNFNG 70 ... VKNLPYNTSNSSLYEFFGKYGYINQIRINSSQPGTCFIIY...HNIKNAQRAAQDLNGVNFNG Sbjct: 1 ... VKNLPYNTSNSSLYEFFGKYGYINQIRINSSQPGTCFIIYHNIKNAQRAAQDLNGVNFNG 60 ...

The cross section measurement for the reactions of 48,46Ti(n,p) 48,46Sc, 50Ti(n, α)47Ca and 58Ni (n, 2n)57Ni, 58Ni(n,p)58m+gCo

International Nuclear Information System (INIS)

Yuan Junqian; Wang Yongchang; Kong Xiangzhong; Yang Jingkang

1992-01-01

The cross sections for the 50 Ti(n, α) 47 Ca, 46 Ti(n, p) 46 Sc, 48 Ti(n, p) 48 Sc and 58 Ni(n, 2n) 57 Ni, 58 Ni(n, p) 58m+g Co reactions have been measured by using the activation method relative to the cross sections of the 27 Al(n, α) 24 Na reaction in the neutron energy range of 13.50-14.81 MeV. The neutron energies were determined by the cross section ratios of the 90 Zr(n, 2n) 89m+g Zr and 93 Nb(n, 2n) 92m Nb reactions. The results obtained are compared with the published and to be published data of several authors

33 CFR 80.712 - Morris Island, SC to Hilton Head Island, SC.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Morris Island, SC to Hilton Head..., SC to Hilton Head Island, SC. (a) A line drawn from the easternmost tip of Folley Island to the... easternmost extremity of Hilton Head at latitude 32°13.0′ N. longitude 80°40.1′ W. [CGD 77-118a, 42 FR 35784...

Room-temperature picosecond high-order stimulated Raman scattering in laser garnet crystal hosts Gd3Ga5O12, Gd3Sc2Ga3O12, and Ca3(Nb,Ga)2Ga3O12

International Nuclear Information System (INIS)

Kaminskii, Alexandr A; Eichler, H J; Findeisen, J; Ueda, Ken-ichi; Fernandez, J; Balda, R

1998-01-01

High-order Stokes and anti-Stokes generation in the visible and near-infrared in cubic laser crystal hosts Gd 3 Ga 5 O 12 , Gd 3 Sc 2 Ga 3 O 12 , and Ca 3 (Nb,Ga) 2 Ga 3 O 12 was observed for the first time. All scattering-laser components were identified and attributed to the SRS-active vibration modes of these garnet crystals. (letters to the editor)

Dependence of isobar-analog state properties on variable part of Coulomb potential

International Nuclear Information System (INIS)

Dzhafarov, I.G.; Kuliev, A.A.; Salamov, D.I.

1986-01-01

Within the framework of the self-consistent approach and with the method of strength functions the fragmentation of isobar-analog state (IAS) properties for all isobarie 0 + -states is investigated. Microscopic values of IAS energy, matrix elements of allowed and forbidden Fermi transitions as well as isospin impurity values in ground states of parent nuclei are obtained. Numerical calculations carried out for 42 Ca 42 Sc, 48 Ca 48 Sc, 64 Zn 64 Ga, 66 Zn 66 Ga, 90 Zr 90 Nb, 208 Pb 208 Bi isobaric nuclei with Woods-Saxon potential, are compared with predictions of different approches and experiment. The developed model by the authors permits to describe sufficiently well the experimental data

Wood : adhesives

Science.gov (United States)

A.H. Conner

2001-01-01

This chapter on wood adhesives includes: 1) Classification of wood adhesives 2) Thermosetting wood adhesives 3) Thermoplastic adhesives, 4) Wood adhesives based on natural sources 5) Nonconventional bonding of wood 6) Wood bonding.

Toxicity, tissue distribution and excretion of 46ScCl3 and 46Sc-EDTA in mice

International Nuclear Information System (INIS)

Lachine, E.E.; Noujaim, A.A.; Ediss, C.; Wiebe, L.I.

1976-01-01

The acute toxicity, differential distribution in tissue, and elimination of ScCl 3 , 46 ScCl 3 , Sc-EDTA and 46 Sc-EDTA, in mice, has been investigated. The LD 50 sup(24hr) doses for ScCl 3 were 440 and 24 mg kg -1 respectively after intraperitioneal and intravenous injection, and 720 and 108 mg kg -1 respectively for Sc-EDTA. 46 ScCl 3 was extensively deposited in the liver and the spleen. 46 Sc-EDTA was rapidly taken up by the kidney with subsequent elimation via the urine. While-body desaturation kinetics for 46 Sc-EDTA were found to fit a three compartmental model. The fast elimination phase (T1/2 = 12.75 min; K = 0.05540 min -1 ) accounted for 74.6% of the dose; the intermediate phase (T1/2 = 40.2 min; K = 0.01722 min -1 ) for 21.8%, and the slow (T1/2 = 5351 min; K = 0.00013 min -1 ) for 3.6% of the dose. (author)

Search for the weak non-analog Fermi branch in the 42Sc ground state beta decay

International Nuclear Information System (INIS)

DelVecchio, R.M.; Daehnick, W.W.

1978-01-01

We have searched for the β-decay branch from the 4 2Sc ground state to the 1.837 MeV level in 4 2Ca. Since both states are J/sup π/ = 0 + , T = 1, this decay is an example of a non-analog Fermi decay which could occur by reason of some mixing of the analog ground states into the lowest excited 0 + state in both 4 2Sc and 4 2Ca. As a signal for this branch, we looked for a subsequent cascade γ ray with a Ge(Li) detector-rabbit arrangement. We found a branching ratio of (2.2 +- 1.7) x 10 - 5 relative to the superallowed ground state to ground state decay. Interpreted as an upper limit, this corresponds to a branching ratio - 5 at the 68% confidence level. This result is at the lower bound of what present theory can predict with a Coulomb force mixing calculation

Magnetic moment of {sup 48}Sc

Energy Technology Data Exchange (ETDEWEB)

Ohtsubo, T., E-mail: tohtsubo@np.gs.niigata-u.ac.jp; Kawamura, Y.; Ohya, S. [Niigata University, Department of Physics (Japan); Izumikawa, T. [Niigata University, Radioisotope Center (Japan); Nishimura, K. [Toyama University, Faculty of Engineering (Japan); Muto, S. [Neutron Science Laboratory, KEK (Japan); Shinozuka, T. [Tohoku University, Cyclotron and Radioisotope Center (Japan)

2007-11-15

Nuclear magnetic resonances were measured for {sup 48}Sc and {sup 44m}Sc oriented at 8 mK in an Fe host metal. The magnetic hyperfine splitting frequencies at an external magnetic field of 0.2 T were determined to be 63.22(11) MHz and 64.81(1) MHz for {sup 48}Sc and {sup 44m}Sc, respectively. With the known magnetic moment of {mu}({sup 44m}Sc)=+3.88 (1) {mu}{sub N}, the magnetic moment of {sup 48}Sc is deduced as {mu}({sup 44}Sc)=+3.785(12) {mu}{sub N}. The measured magnetic moment of {sup 48}Sc is discussed in terms of the shell model using the effective interactions.

Distribution of P, K, Ca, Mg, Cd, Cu, Fe, Mn, Pb and Zn in wood and bark age classes of willows and poplars used for phytoextraction on soils contaminated by risk elements.

Science.gov (United States)

Zárubová, Pavla; Hejcman, Michal; Vondráčková, Stanislava; Mrnka, Libor; Száková, Jiřina; Tlustoš, Pavel

2015-12-01

Fast-growing clones of Salix and Populus have been studied for remediation of soils contaminated by risk elements (RE) using short-rotation coppice plantations. Our aim was to assess biomass yield and distributions of elements in wood and bark of highly productive willow (S1--[Salix schwerinii × Salix viminalis] × S. viminalis, S2--Salix × smithiana clone S-218) and poplar (P1--Populus maximowiczii × Populus nigra, P2--P. nigra) clones with respect to aging. The field experiment was established in April 2008 on moderately Cd-, Pb- and Zn- contaminated soil. Shoots were harvested after four seasons (February 2012) and separated into annual classes of wood and bark. All tested clones grew on contaminated soils, with highest biomass production and lowest mortality exhibited by P1 and S2. Concentrations of elements, with exception of Ca and Pb, decreased with age and were higher in bark than in wood. The Salix clones were characterised by higher removal of Cd, Mn and Zn compared to the Populus clones. Despite generally higher RE content in young shoots, partly due to lower wood/bark ratios and higher RE concentrations in bark, the overall removal of RE was higher in older wood classes due to higher biomass yield. Thus, longer rotations seem to be more effective when phytoextraction strategy is considered. Of the four selected clones, S1 exhibited the best removal of Cd and Zn and is a good candidate for phytoextraction.

Evolution of Spin fluctuations in CaFe2As2 with Co-doping.

Science.gov (United States)

Sapkota, A.; Das, P.; Böhmer, A. E.; Abernathy, D. L.; Canfield, P. C.; Kreyssig, A.; McQueeney, R. J.; Goldman, A. I.

Spin fluctuations are an essential ingredient for superconductivity in Fe-based supercondcutors. In Co-doped BaFe2As2, the system goes from the antiferromagnetic (AFM) state to the superconducting (SC) state with Co doping, and the spin fluctuations also evolve from well-defined spin waves with spin gap in the AFM regime to gapless overdamped or diffused fluctuations in the SC regime. CaFe2As2 has a stronger magneto-elastic coupling than BaFe2As2 and no co-existence of SC and AFM region as observed in BaFe2As2 with Co doping. Here, we will discuss the evolution of spin fluctuations in CaFe2As2 with Co doping. Work at the Ames Laboratory was supported by US DOE, Basic Energy Sciences, Division of Material Sciences and Engineering, under contract No. DE-AC02-07CH11358. This research used resources of SNS, a DOE office of science user facility operated by ORNL.

Topotactic oxidation pathway of ScTiO3 and high-temperature structure evolution of ScTiO3.5 and Sc4Ti3O12-type phases.

Science.gov (United States)

Shafi, Shahid P; Hernden, Bradley C; Cranswick, Lachlan M D; Hansen, Thomas C; Bieringer, Mario

2012-02-06

The novel oxide defect fluorite phase ScTiO(3.5) is formed during the topotactic oxidation of ScTiO(3) bixbyite. We report the oxidation pathway of ScTiO(3) and structure evolution of ScTiO(3.5), Sc(4)Ti(3)O(12), and related scandium-deficient phases as well as high-temperature phase transitions between room temperature and 1300 °Cusing in-situ X-ray diffraction. We provide the first detailed powder neutron diffraction study for ScTiO(3). ScTiO(3) crystallizes in the cubic bixbyite structure in space group Ia3 (206) with a = 9.7099(4) Å. The topotactic oxidation product ScTiO(3.5) crystallizes in an oxide defect fluorite structure in space group Fm3m (225) with a = 4.89199(5) Å. Thermogravimetric and differential thermal analysis experiments combined with in-situ X-ray powder diffraction studies illustrate a complex sequence of a topotactic oxidation pathway, phase segregation, and ion ordering at high temperatures. The optimized bulk synthesis for phase pure ScTiO(3.5) is presented. In contrast to the vanadium-based defect fluorite phases AVO(3.5+x) (A = Sc, In) the novel titanium analogue ScTiO(3.5) is stable over a wide temperature range. Above 950 °C ScTiO(3.5) undergoes decomposition with the final products being Sc(4)Ti(3)O(12) and TiO(2). Simultaneous Rietveld refinements against powder X-ray and neutron diffraction data showed that Sc(4)Ti(3)O(12) also exists in the defect fluorite structure in space group Fm3m (225) with a = 4.90077(4) Å. Sc(4)Ti(3)O(12) undergoes partial reduction in CO/Ar atmosphere to form Sc(4)Ti(3)O(11.69(2)).

CERN: SC-33

Energy Technology Data Exchange (ETDEWEB)

Anon.

1991-06-15

On 22 April a forward-looking CERN also looked back for a day, when the 'SC-33' event reviewed the achievements of CERN's first machine, the 600 MeV SynchroCyclotron (SC), which closed down on 17 December after 33 years of valiant service.

Pilot-scale investigation of the robustness and efficiency of a copper-based treated wood wastes recycling process

Energy Technology Data Exchange (ETDEWEB)

Coudert, Lucie [INRS-ETE (Canada); Blais, Jean-François, E-mail: blaisjf@ete.inrs.ca [INRS-ETE (Canada); Mercier, Guy [INRS-ETE (Canada); Cooper, Paul [University of Toronto (Canada); Gastonguay, Louis [IREQ (Canada); Morris, Paul [FPInnovations (Canada); Janin, Amélie; Reynier, Nicolas [INRS-ETE (Canada)

2013-10-15

Highlights: • A leaching process was studied for metals removal from CCA-treated wood wastes. • This decontamination process was studied at pilot scale (130-L reactor). • Removals up to 98% of As, 88% of Cr, and 96% of Cu were obtained from wood wastes. • The produced leachates can be treated by chemical precipitation. -- Abstract: The disposal of metal-bearing treated wood wastes is becoming an environmental challenge. An efficient recycling process based on sulfuric acid leaching has been developed to remove metals from copper-based treated wood chips (0 < x < 12 mm). The present study explored the performance and the robustness of this technology in removing metals from copper-based treated wood wastes at a pilot plant scale (130-L reactor tank). After 3× 2 h leaching steps followed by 3× 7 min rinsing steps, up to 97.5% of As, 87.9% of Cr, and 96.1% of Cu were removed from CCA-treated wood wastes with different initial metal loading (>7.3 kg m{sup −3}) and more than 94.5% of Cu was removed from ACQ-, CA- and MCQ-treated wood. The treatment of effluents by precipitation–coagulation was highly efficient; allowing removals more than 93% for the As, Cr, and Cu contained in the effluent. The economic analysis included operating costs, indirect costs and revenues related to remediated wood sales. The economic analysis concluded that CCA-treated wood wastes remediation can lead to a benefit of 53.7 US$ t{sup −1} or a cost of 35.5 US$ t{sup −1} and that ACQ-, CA- and MCQ-treated wood wastes recycling led to benefits ranging from 9.3 to 21.2 US$ t{sup −1}.

Catalytic fast pyrolysis of white oak wood in-situ using a bubbling fluidized bed reactor

Science.gov (United States)

Catalytic fast pyrolysis was performed on white oak wood using two zeolite-type catalysts as bed material in a bubbling fluidized bed reactor. The two catalysts chosen, based on a previous screening study, were Ca2+ exchanged Y54 (Ca-Y54) and a proprietary ß-zeolite type catalyst (catalyst M) both ...

Novel 2D or 3D alkaline-earth metal sulfonate-phosphonates based on [O 3S-C 2H 4-PO 3H] 2- ligand

Science.gov (United States)

Du, Zi-Yi; Wen, He-Rui; Xie, Yong-Rong

2008-11-01

Three novel alkaline-earth metal sulfonate-phosphonates based on [O 3S-C 2H 4-PO 3H] 2- ligand, namely, [Ca(O 3SC 2H 4PO 3H)(H 2O) 2] ( 1), [Sr(O 3SC 2H 4PO 3H)] ( 2) and [Ba 2(O 3SC 2H 4PO 3H) 2] ( 3), have been synthesized by hydrothermal reactions. They represent the first structurally characterized alkaline-earth metal complexes of phosphonic acid attached with a sulfonate group. The structure of compound 1 features a 2D layer based on 1D chains of [Ca 2(PO 3) 2] bridged by -CH 2-CH 2-SO 3- groups. Compounds 2 and 3 show pillar-layer architecture based on two different inorganic layers linked by -CH 2-CH 2- groups. The inorganic layer in compound 2 features a 1D chain of edge-sharing SrO 8 polyhedra whereas that in compound 3 features an edge-sharing Ba 2O 14 di-polyhedral unit which is further corner-shared with four neighboring ones. The [O 3S-C 2H 4-PO 3H] 2- ligand shows diverse coordination modes in the three alkaline-earth metal sulfonate-phosphonates.

CERN: SC-33

International Nuclear Information System (INIS)

Anon.

1991-01-01

On 22 April a forward-looking CERN also looked back for a day, when the 'SC-33' event reviewed the achievements of CERN's first machine, the 600 MeV SynchroCyclotron (SC), which closed down on 17 December after 33 years of valiant service

S-C Mylonites

NARCIS (Netherlands)

Lister, G.S.; Snoke, A.W.

1984-01-01

Two types of foliations are commonly developed in mylonites and mylonitic rocks: (a) S-surfaces related to the accumulation of finite strain and (b) C-surfaces related to displacement discontinuities or zones of relatively high shear strain. There are two types of S-C mylonites. Type I S-C

First-in-Human PET/CT Imaging of Metastatic Neuroendocrine Neoplasms with Cyclotron-Produced 44Sc-DOTATOC: A Proof-of-Concept Study.

Science.gov (United States)

Singh, Aviral; van der Meulen, Nicholas P; Müller, Cristina; Klette, Ingo; Kulkarni, Harshad R; Türler, Andreas; Schibli, Roger; Baum, Richard P

2017-05-01

44 Sc is a promising positron emission tomography (PET) radionuclide (T 1/2  = 4.04 hours, E β+average  = 632 keV) and can be made available, using a cyclotron production route, in substantial quantities as a highly pure product. Herein, the authors report on a first-in-human PET/CT study using 44 Sc-DOTATOC prepared with cyclotron-produced 44 Sc. The production of 44 Sc was carried out through the 44 Ca(p,n) 44 Sc nuclear reaction at Paul Scherrer Institut, Switzerland. After separation, 44 Sc was shipped to Zentralklinik Bad Berka, Germany, where radiolabeling was performed, yielding radiochemically pure 44 Sc-DOTATOC. Two patients, currently followed up after peptide receptor radionuclide therapy of metastatic neuroendocrine neoplasms, participated in this proof-of-concept study. Blood sampling was performed before and after application of 44 Sc-DOTATOC. PET/CT acquisitions, performed at different time points after injection of 44 Sc-DOTATOC, allowed detection of even very small lesions on delayed scans. No clinical adverse effects were observed and the laboratory hematological, renal, and hepatic profiles remained unchanged. In this study, cyclotron-produced 44 Sc was used in the clinic for the first time. It is attractive for theranostic application with 177 Lu, 90 Y, or 47 Sc as therapeutic counterparts. 44 Sc-based radiopharmaceuticals will be of particular value for PET facilities without radiopharmacy, to which they can be shipped from a centralized production site.

Determination of 46Sc in water

International Nuclear Information System (INIS)

Huo Bijun; Ji Zhaogang; Wang Juying

1985-01-01

Analytical procedures for the determination of 46 Sc in water is presented. 46 Sc in water is concentrated with Fe(OH) 3 ; Then 46 Sc is extracted with TBP and purified by precipitating it with Amygdalic Acid. Finally the precipitate is ignited into Sc 2 O 3 under 800 deg C and β-activity is counted. In this method chemical reeovery for Sc was (90.8 +- 2.8)% and radiochemical recovery for 46 Sc was (89.8 +- 3.8)%. Purification factors for some of the relevant Radionuclides ranged from 10 3 to 10 5

The effect of Sc additions on the microstructure and age hardening behaviour of as cast Al–Sc alloys

International Nuclear Information System (INIS)

Costa, S.; Puga, H.; Barbosa, J.; Pinto, A.M.P.

2012-01-01

Highlights: ► The Sc effect on the microstructure and ageing behaviour of Al–Sc alloys is studied. ► Cast into copper mould allows the elimination of solution heat treatment. ► Directly aged as cast alloys exhibits higher hardness and precipitation kinetics. ► Sc addition and optimised ageing result in an increase in Al–Sc mechanical properties. -- Abstract: The grain refinement effect and the ageing behaviour of Al–0.5 wt.% Sc, Al–0.7 wt.% Sc, and Al–1 wt.% Sc alloys are studied on the basis of optic microscopy (OM), scanning electron microscopy (SEM), X-ray diffraction (XRD) observations and hardness measurements. In Al–Sc alloys the higher grain refinement is observed for Sc contents greater than 0.5 wt.% accompanied by a notorious morphology modification, from coarse columnar grains to a fine perfect equiaxed structure. The as cast structures are characterised by a rich supersaturated solid solution in Sc, that promotes a great age hardening response at 250 °C and 300 °C. The age hardening curves also demonstrate a low overageing kinetics for all the alloys. Although the higher Sc content in solid solution for the alloys with 0.7 and 1 wt.% Sc, the age hardening response of all the Al–Sc alloys remains similar. The direct age hardening response of the as cast Al–0.5 wt.% Sc is shown to be greater than the solutionised and age hardened alloy.

Late Permian wood-borings reveal an intricate network of ecological relationships.

Science.gov (United States)

Feng, Zhuo; Wang, Jun; Rößler, Ronny; Ślipiński, Adam; Labandeira, Conrad

2017-09-15

Beetles are the most diverse group of macroscopic organisms since the mid-Mesozoic. Much of beetle speciosity is attributable to myriad life habits, particularly diverse-feeding strategies involving interactions with plant substrates, such as wood. However, the life habits and early evolution of wood-boring beetles remain shrouded in mystery from a limited fossil record. Here we report new material from the upper Permian (Changhsingian Stage, ca. 254-252 million-years ago) of China documenting a microcosm of ecological associations involving a polyphagan wood-borer consuming cambial and wood tissues of the conifer Ningxiaites specialis. This earliest evidence for a component community of several trophically interacting taxa is frozen in time by exceptional preservation. The combination of an entry tunnel through bark, a cambium mother gallery, and up to 11 eggs placed in lateral niches-from which emerge multi-instar larval tunnels that consume cambium, wood and bark-is ecologically convergent with Early Cretaceous bark-beetle borings 120 million-years later.Numerous gaps remain in our knowledge of how groups of organisms interacted in ancient ecosystems. Here, Feng and colleagues describe a late Permian fossil wood-boring beetle microcosm, with the oldest known example of complex tunnel geometry, host tissue response, and the presence of fungi within.

Sanitation options for managing oak wood infested with the invasive goldspotted oak borer (Coleoptera: Buprestidae) in Southern California

Science.gov (United States)

Michael I. Jones; Tom W. Coleman; Andrew D. Graves; Mary Louise. Flint; Steven J. Seybold

2013-01-01

Movement of invasive wood-boring insects in wood products presents a threat to forest health and a management challenge for public and private land managers. The goldspotted oak borer, Agrilus auroguttatus Schaeffer (Coleoptera: Buprestidae), is a new pest in San Diego and Riverside Cos., CA, believed to have been introduced on firewood. This beetle...

Cord Wood Testing in a Non-Catalytic Wood Stove

Energy Technology Data Exchange (ETDEWEB)

Butcher, T. [Brookhaven National Lab. (BNL), Upton, NY (United States); Trojanowski, R. [Brookhaven National Lab. (BNL), Upton, NY (United States); Wei, G. [Brookhaven National Lab. (BNL), Upton, NY (United States)

2014-06-30

EPA Method 28 and the current wood stove regulations have been in-place since 1988. Recently, EPA proposed an update to the existing NSPS for wood stove regulations which includes a plan to transition from the current crib wood fuel to cord wood fuel for certification testing. Cord wood is seen as generally more representative of field conditions while the crib wood is seen as more repeatable. In any change of certification test fuel, there are questions about the impact on measured results and the correlation between tests with the two different fuels. The purpose of the work reported here is to provide data on the performance of a noncatalytic stove with cord wood. The stove selected has previously been certified with crib wood which provides a basis for comparison with cord wood. Overall, particulate emissions were found to be considerably higher with cord wood.

Apical P2XR contribute to [Ca2+]i signaling and Isc in mouse renal MCD.

Science.gov (United States)

Li, Liuzhe; Lynch, I Jeanette; Zheng, Wencui; Cash, Melanie N; Teng, Xueling; Wingo, Charles S; Verlander, Jill W; Xia, Shen-Ling

2007-08-03

We examined P2X receptor expression and distribution in the mouse collecting duct (CD) and their functional role in Ca(2+) signaling. Both P2X(1) and P2X(4) were detected by RT-PCR and Western blot. Immunohistochemistry demonstrated apical P2X(1) and P2X(4) immunoreactivity in principal cells in the outer medullary CD (OMCD) and inner medullary CD (IMCD). Luminal ATP induced an increase in Ca(2+) signaling in native medullary CD (MCD) as measured by fluorescence imaging. ATP also induced an increase in Ca(2+) signaling in MCD cells grown in primary culture but not in the presence of P2XR antagonist PPNDS. Short circuit current (I(sc)) measurement with mouse IMCD cells showed that P2XR agonist BzATP induced a larger I(sc) than did P2YR agonist UTP in the apical membrane. Our data reveal for the first time that P2X(1) and P2X(4) are cell-specific with prominent immunoreactivity in the apical area of MCD cells. The finding that P2XR blockade inhibits ATP-induced Ca(2+) signaling suggests that activation of P2XR is a key step in Ca(2+)-dependent purinergic signaling. The result that activation of P2XR produces large I(sc) indicates the necessity of P2XR in renal CD ion transport.

Mineral preservatives in the wood of Stradivari and Guarneri.

Directory of Open Access Journals (Sweden)

Joseph Nagyvary

Full Text Available Following the futile efforts of generations to reach the high standard of excellence achieved by the luthiers in Cremona, Italy, by variations of design and plate tuning, current interest is being focused on differences in material properties. The long-standing question whether the wood of Stradivari and Guarneri were treated with wood preservative materials could be answered only by the examination of wood specimens from the precious antique instruments. In a recent communication (Nature, 2006, we reported about the degradation of the wood polymers in instruments of Stradivari and Guarneri, which could be explained only by chemical manipulations, possibly by preservatives. The aim of the current work was to identify the minerals from the small samples of the maple wood which were available to us from the antique instruments. The ashes of wood from one violin and one cello by Stradivari, two violins by Guarneri, one viola by H. Jay, one violin by Gand-Bernardel were analyzed and compared with a variety of commercial tone woods. The methods of analysis were the following: back-scattered electron imaging, X-ray fluorescence maps for individual elements, wave-length dispersive spectroscopy, energy dispersive X-ray spectroscopy and quantitative microprobe analysis. All four Cremonese instruments showed the unmistakable signs of chemical treatments in the form of chemicals which are not present in natural woods, such as BaSO4, CaF2, borate, and ZrSiO4. In addition to these, there were also changes in the common wood minerals. Statistical evaluation of 12 minerals by discriminant analysis revealed: a. a difference among all four Cremona instruments, b. the difference of the Cremonese instruments from the French and English antiques, and c. only the Cremonese instruments differed from all commercial woods. These findings may provide the answer why all attempts to recreate the Stradivarius from natural wood have failed. There are many obvious

Solid-State NMR Spectroscopy Proves the Presence of Penta-coordinated Sc Sites in MIL-100(Sc).

Science.gov (United States)

Giovine, Raynald; Volkringer, Christophe; Ashbrook, Sharon E; Trébosc, Julien; McKay, David; Loiseau, Thierry; Amoureux, Jean-Paul; Lafon, Olivier; Pourpoint, Frédérique

2017-07-18

Advanced solid-state NMR methods and first-principles calculations demonstrate for the first time the formation of penta-coordinated scandium sites. These coordinatively unsaturated sites were shown during the thermal activation of scandium-based metal-organic frameworks (MOFs). A 45 Sc NMR experiment allows their specific observation in activated Sc 3 BTB 2 (H 3 BTB=1,3,5-tris(4-carboxyphenyl)benzene) and MIL-100(Sc) MOFs. The assignment of the ScO 5 groups is supported by the DFT calculations of NMR parameters. The presence of ScO 5 Lewis acid sites in MIL-100(Sc) explains furthermore its catalytic activity. The first NMR experiment to probe 13 C- 45 Sc distances is also introduced. This advanced solid-state NMR pulse sequence allows the demonstration of the shrinkage of the MIL-100(Sc) network when the activation temperature is raised. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

Construction, expression, and function of 6B11ScFv-mIL-12, a fusion protein that attacks human ovarian carcinoma.

Science.gov (United States)

Cheng, Hongyan; Ye, Xue; Chang, Xiaohong; Ma, Ruiqiong; Cong, Xu; Niu, Yidong; Zhang, Menglei; Liu, Kai; Cui, Heng; Sang, Jianli

2015-04-01

We previously produced an anti-idiotypic monoclonal antibody, 6B11, which mimics ovarian cancer antigen CA166-9 and induces cellular and humoral immunity. Here, to enhance the immunogenicity of 6B11, we constructed the 6B11ScFv-mIL-12 fusion protein (FP), by fusing single-chain fragment of 6B11 variable region (6B11ScFv) with mouse interleukin-12 (mIL-12), which was expressed in eukaryotic 293EBNA cells transfected with pSBI vectors. A binding activity assay showed 6B11ScFv-mIL-12 to have activities of both 6B11 and mIL-12-it specifically bound both ovarian monoclonal antibody COC166-9 and rabbit anti-mouse IL-12 antibody. The immune activity assay showed 6B11ScFv-mIL-12 to promote proliferation of lymphocytes stimulated by phytohemagglutinin, increase the absolute numbers and percentages of CD3(-)/CD56(+) natural killer cells and CD3(+)/CD56(+) natural killer T cells among peripheral lymphocytes, and increase interferon-γ. The FP was specifically cytotoxic to the CA166-9(+) ovarian cancer cell lines HOC1A and SKOV3 and inhibited growth of ID8 subcutaneous tumors in C57BL/6J mice. This study provides an experimental basis for clinical use of 6B11ScFv-mIL-12 in ovarian cancer therapy. To our knowledge, this is the first report of a fusion protein from an anti-idiotypic antibody and IL-12.

Electron Microscopy Observation of Biomineralization within Wood Tissues of Kurogaki

Directory of Open Access Journals (Sweden)

Kazue Tazaki

2017-07-01

Full Text Available Interactions between minerals and microorganisms play a crucial role in living wood tissues. However, living wood tissues have never been studied in the field. Fortunately, we found several kurogaki (black persimmon; Diospyros kaki trees at Tawara in Kanazawa, Ishikawa, Japan. Here, we report the characterization of kurogaki based on scanning electron microscopy equipped with energy-dispersive spectroscopy (SEM-EDS and transmission electron microscopy (TEM, associated with inductively coupled plasma-mass spectrometry (ICP-MS analyses, X-ray fluorescence analyses (XRF and X-ray powder diffraction (XRD analyses. This study aims to illustrate the ability of various microorganisms associated with biominerals within wood tissues of kurogaki, as shown by SEM-EDS elemental content maps and TEM images. Kurogaki grows very slowly and has extremely hard wood, known for its striking black and beige coloration, referred to as a “peacock pattern”. However, the scientific data for kurogaki are very limited. The black “peacock pattern” of the wood mainly comprises cellulose and high levels of crystal cristobalite. As per the XRD results, the black taproot contains mineralized 7 Å clays (kaolinite, cellulose, apatite and cristobalite associated with many microorganisms. The chemical compositions of the black and beige portions of the black persimmon tree were obtained by ICP-MS analyses. Particular elements such as abundant Ca, Mg, K, P, Mn, Ba, S, Cl, Fe, Na, and Al were concentrated in the black region, associated with Pb and Sr elements. SEM-EDS semi-qualitative analyses of kurogaki indicated an abundance of P and Ca in microorganisms in the black region, associated with Pb, Sr, S, Mn, and Mg elements. On the other hand, XRF and XRD mineralogical data showed that fresh andesite, weathered andesite, and the soils around the roots of kurogaki correlate with biomineralization of the black region in kurogaki roots, showing clay minerals (kaolinite and

Modelling inorganic biocide emission from treated wood in water

Energy Technology Data Exchange (ETDEWEB)

Tiruta-Barna, Ligia, E-mail: Ligia.barna@insa-toulouse.fr [Universite de Toulouse, INSA, UPS, INP, LISBP, 135 Avenue de Rangueil, F-31077 Toulouse (France); INRA, UMR792, Laboratoire d' Ingenierie des Systemes Biologiques et des Procedes, F-31400 Toulouse (France); CNRS, UMR5504, F-31400 Toulouse (France); Schiopu, Nicoleta [Universite Paris-Est, CSTB- Scientific and Technical Centre for the Building Industry, ESE/Environment, 24, rue Joseph Fourier, 38400 Saint Martin d' Heres (France)

2011-09-15

Highlights: {center_dot} We developed a mechanistic model for biocide metals fixation/mobilisation in wood. {center_dot} This is the first chemical model explaining the biocide leaching from treated wood. {center_dot} The main fixation mechanism is the surface complexation with wood polymers. {center_dot} The biocide mobilization is due to metal-DOC complexation and pH effect. - Abstract: The objective of this work is to develop a chemical model for explaining the leaching behaviour of inorganic biocides from treated wood. The standard leaching test XP CEN/TS14429 was applied to a commercial construction material made of treated Pinus sylvestris (Copper Boron Azole preservative). The experimental results were used for developing a chemical model under PHREEQC (a geochemical software, with LLNL, MINTEQ data bases) by considering the released species detected in the eluates: main biocides Cu and B, other trace biocides (Cr and Zn), other elements like Ca, K, Cl, SO{sub 4}{sup -2}, dissolved organic matter (DOC). The model is based on chemical phenomena at liquid/solid interfaces (complexation, ion exchange and hydrolysis) and is satisfactory for the leaching behaviour representation. The simulation results confronted with the experiments confirmed the hypotheses of: (1) biocide fixation by surface complexation reactions with wood specific sites (carboxyl and phenol for Cu, Zn, Cr(III), aliphatic hydroxyl for B, ion exchange to a lesser extent) and (2) biocide mobilisation by extractives (DOC) coming from the wood. The maximum of Cu, Cr(III) and Zn fixation occurred at neutral pH (including the natural pH of wood), while B fixation was favoured at alkaline pH.

Assessment of the wood waste resource and its position in the wood / wood-energy sector - Synthesis

International Nuclear Information System (INIS)

Guinard, Ludovic; Deroubaix, Gerard; Roux, Marie-Lise; Levet, Anne-Laure; Quint, Vincent

2015-04-01

The first objective of this study is to obtain a better knowledge of the 'wood wastes' issue, to propose a photography of the wood waste sector (productions, trades, consumptions), and then to elaborate different prospective scenarios on the use of wood waste volumes while taking into account possible evolutions on the medium or short term of the regulation and market of the wood/wood energy sector. The considered wastes come from industrial production, from the use of wood-based products, and from the end of life of products potentially containing wood. The authors present bibliographical sources and the adopted methodology, briefly describe the 'wood waste' system with its actors, and then report their assessment of wood wastes. They propose a global assessment as well as detailed assessments with respect to waste origins: wood trade and distribution, industries, craft, households and communities, building sector, public and private tertiary sector, packaging. They also address the collection and management of wood wastes by public services, and present the different types of valorisation (panel fabrication, energy, and others). They discuss exports, and then present different scenarios: a trend-based scenario, and two prospective scenarios with a priority to energetic valorisation or to material valorisation of wood wastes. These scenarios are compared

Insights into intraspecific wood density variation and its relationship to growth, height and elevation in a treeline species.

Science.gov (United States)

Fajardo, A

2018-05-01

The wood economics spectrum provides a general framework for interspecific trait-trait coordination across wide environmental gradients. Whether global patterns are mirrored within species constitutes a poorly explored subject. In this study, I first determined whether wood density co-varies together with elevation, tree growth and height at the within-species level. Second, I determined the variation of wood density in different stem parts (trunk, branch and twigs). In situ trunk sapwood, trunk heartwood, branch and twig densities, in addition to stem growth rates and tree height were determined in adult trees of Nothofagus pumilio at four elevations in five locations spanning 18° of latitude. Mixed effects models were fitted to test relationships among variables. The variation in wood density reported in this study was narrow (ca. 0.4-0.6 g cm -3 ) relative to global density variation (ca. 0.3-1.0 g cm -3 ). There was no significant relationship between stem growth rates and wood density. Furthermore, the elevation gradient did not alter the wood density of any stem part. Trunk sapwood density was negatively related to tree height. Twig density was higher than branch and trunk densities. Trunk heartwood density was always significantly higher than sapwood density. Negative across-species trends found in the growth-wood density relationship may not emerge as the aggregate of parallel intraspecific patterns. Actually, trees with contrasting growth rates show similar wood density values. Tree height, which is tightly related to elevation, showed a negative relationship with sapwood density. © 2018 German Society for Plant Sciences and The Royal Botanical Society of the Netherlands.

Infectivity-associated PrP(Sc) and disease duration-associated PrP(Sc) of mouse BSE prions.

Science.gov (United States)

Miyazawa, Kohtaro; Okada, Hiroyuki; Masujin, Kentaro; Iwamaru, Yoshifumi; Yokoyama, Takashi

2015-01-01

Disease-related prion protein (PrP(Sc)), which is a structural isoform of the host-encoded cellular prion protein, is thought to be a causative agent of transmissible spongiform encephalopathies. However, the specific role of PrP(Sc) in prion pathogenesis and its relationship to infectivity remain controversial. A time-course study of prion-affected mice was conducted, which showed that the prion infectivity was not simply proportional to the amount of PrP(Sc) in the brain. Centrifugation (20,000 ×g) of the brain homogenate showed that most of the PrP(Sc) was precipitated into the pellet, and the supernatant contained only a slight amount of PrP(Sc). Interestingly, mice inoculated with the obtained supernatant showed incubation periods that were approximately 15 d longer than those of mice inoculated with the crude homogenate even though both inocula contained almost the same infectivity. Our results suggest that a small population of fine PrP(Sc) may be responsible for prion infectivity and that large, aggregated PrP(Sc) may contribute to determining prion disease duration.

DEMONSTRATION OF A NO-VOC/NO-HAP WOOD KITCHEN CABINET COATING SYSTEM

Science.gov (United States)

The report gives results of the development and demonstration of a no-VOC (volatile organic compound)/no-HAP (hazardous air pollutant) wood furniture coating system at two cabinet manufacturing plants: one in Portland, OR, and the other in Redwood City, CA. Technology transfer ef...

SC tuning fork

CERN Document Server

The tuning fork used to modulate the radiofrequency system of the synchro cyclotron (SC) from 1957 to 1973. This piece is an unused spare part. The SC was the 1st accelerator built at CERN. It operated from August 1957 until it was closed down at the end of 1990. In the SC the magnetic field did not change with time, and the particles were accelerated in successive pulses by a radiofrequency voltage of some 20kV which varied in frequency as they spiraled outwards towards the extraction radius. The frequency varied from 30MHz to about 17Mz in each pulse. The tuning fork vibrated at 55MHz in vacuum in an enclosure which formed a variable capacitor in the tuning circuit of the RF system, allowing the RF to vary over the appropriate range to accelerate protons from the centre of the macine up to 600Mev at extraction radius. In operation the tips of the tuning fork blade had an amplitude of movement of over 1 cm. The SC accelerator underwent extensive improvements from 1973 to 1975, including the installation of a...

Measurement for commercial exposives with SC-DSC test. Sangyoyo bakuhayaku no SC-DSC sokutei

Energy Technology Data Exchange (ETDEWEB)

Yabashi, H.; Wada, Y.; Hwang, D.; Akutsu, Y.; Tamura, M.; Yoshida, T. (The University of Tokyo, Tokyo (Japan). Faculty of Engineering); Matsuzawa, T. (Nippon Kayaku Co. Ltd., Tokyo (Japan))

1991-08-30

The sealed cell differential scanning calorimetry (SC-DSC) was sintroduced of commercial blasting explosives. As a series of testing the commercial blasting explosives in performance, an SC-DSC test was made to compare the critical detonability line with that resulting therefrom. From the result of SC-DSC measurement, the critical dilution rate was estimated of commercial blasting explosives to become without detonating propagation. As a result, all the explosives with exception of ANFO one were assumed to have a possibility of detonating propagation so that the ANFO explosive was known to be material, unable to exactly evaluate the detonability by the SC-DSC test. The explosion heat, then calculated by the REITP2 in order to assume how the reaction proceeded in the DSC cell, was compared with the reaction heat measured by the SC-DSC test. As a result, the calculated value was known to be almost equal to or slightly larger than the measured one. 15 refs., 4 figs., 2 tabs.

Application of photocuring technique on wood surface and its prospects in Bangladesh

International Nuclear Information System (INIS)

Bhattcacharia, S.K.; Khan, Mubarak A.

2005-01-01

Photocuring technique has unveiled a new horizon in polymer science. Application of photocuring technique on wood surface has enhanced the use of low grade wood. As Bangladesh is an overpopulated country, necessity of good quality wood is increasing day by day. So low grade wood, like Simul or Partex, locally produced particleboard, would come out with great use. As Partex board, produced from Jute sticks and various types of indigenous low grade wood and particle board are abundant in Bangladesh, so photocuring could play a major role to improve the quality of low grade wood and serve the nation. Already, a lot of research works were carried out by the local scientists to improve the wood surface using UV curing method. Different formulations were also developed by the local scientists using various oligomer, monomer and different types of additives. The used oligomers are epoxy, polyester, urethane, etc. and monomers of different functionalities and used additives are acrylic monomer, CaCO 3 , sand, MgSiO 3 , talc, etc. Thin films were prepared on glass plate with different formulations using UV radiation and different characteristics properties (pendulum hardness, abrasion, gloss (60 deg. and 20 deg.), microscratch hardness, weathering effect, adhesion strength, etc.) were studied. Now, a Pilot Plant has already been established with the financial assistance by the government of Bangladesh, worth US$ 3.5 million

Chapter 6: Wood energy and competing wood product markers

Science.gov (United States)

Kenneth E. Skog; Robert C. Abt; Karen Abt

2014-01-01

Understanding the effect of expanding wood energy markets is important to all wood-dependent industries and to policymakers debating the implementation of public programs to support the expansion of wood energy generation. A key factor in determining the feasibility of wood energy projects (e.g. wood boiler or pellet plant) is the long-term (i.e. 20-30year) supply...

Wood adhesives : vital for producing most wood products

Science.gov (United States)

Charles R. Frihart

2011-01-01

A main route for the efficient utilization of wood resources is to reduce wood to small pieces and then bond them together (Frihart and Hunt 2010). Although humankind has been bonding wood since early Egyptian civilizations, the quality and quantity of bonded wood products has increased dramatically over the past 100 years with the development of new adhesives and...

Effect of combustion condition on cytotoxic and inflammatory activity of residential wood combustion particles

Science.gov (United States)

Jalava, Pasi I.; Salonen, Raimo O.; Nuutinen, Kati; Pennanen, Arto S.; Happo, Mikko S.; Tissari, Jarkko; Frey, Anna; Hillamo, Risto; Jokiniemi, Jorma; Hirvonen, Maija-Riitta

2010-05-01

Residential heating is an important local source of fine particles and may cause significant exposure and health effects in populations. We investigated the cytotoxic and inflammatory activity of particulate emissions from normal (NC) and smouldering (SC) combustion in one masonry heater. The PM 1-0.2 and PM 0.2 samples were collected from the dilution tunnel with a high-volume cascade impactor (HVCI). Mouse RAW 264.7 macrophages were exposed to the PM-samples for 24 h. Inflammatory mediators, (IL-6, TNFα and MIP-2), and cytotoxicity (MTT-test), were measured. Furthermore, apoptosis and cell cycle of macrophages were analyzed. The HVCI particulate samples were characterized for ions, elements and PAH compounds. Assays of elemental and organic carbon were conducted from parallel low volume samples. All the samples displayed mostly dose-dependent inflammatory and cytotoxic activity. SC samples were more potent than NC samples at inducing cytotoxicity and MIP-2 production, while the order of potency was reversed in TNFα production. SC-PM 1-0.2 sample was a significantly more potent inducer of apoptosis than the respective NC sample. After adjustment for the relative toxicity with emission factor (mg MJ -1), the SC-PM emissions had clearly higher inflammatory and cytotoxic potential than the NC-PM emissions. Thus, operational practice in batch burning of wood and the resultant combustion condition clearly affect the toxic potential of particulate emissions.

α-ScVSe2O8, β-ScVSe2O8, and ScVTe2O8: new quaternary mixed metal oxides composed of only second-order Jahn-Teller distortive cations.

Science.gov (United States)

Kim, Yeong Hun; Lee, Dong Woo; Ok, Kang Min

2013-10-07

Three new quaternary scandium vanadium selenium/tellurium oxides, α-ScVSe2O8, β-ScVSe2O8, and ScVTe2O8 have been synthesized through hydrothermal and standard solid-state reactions. Although all three reported materials are stoichiometrically similar, they exhibit different crystal structures: α-ScVSe2O8 has a three-dimensional framework structure consisting of ScO6, VO6, and SeO3 groups. β-ScVSe2O8 reveals another three-dimensional framework composed of ScO7, VO5, and SeO3 polyhedra. ScVTe2O8 shows a layered structure with ScO6, VO4, and TeO4 polyhedra. Interestingly, the constituent cations, that is, Sc(3+), V(5+), Se(4+), and Te(4+) are all in a distorted coordination environment attributable to second-order Jahn-Teller (SOJT) effects. Complete characterizations including infrared spectroscopy, elemental analyses, thermal analyses, dipole moment calculation, and the magnitudes of out-of-center distortions for the compounds are reported. Transformation reactions suggest that α-ScVSe2O8 may change to β-ScVSe2O8, and then to Sc2(SeO3)3·H2O under hydrothermal conditions.

Wood frame systems for wood homes

Directory of Open Access Journals (Sweden)

Julio Cesar Molina

2010-12-01

Full Text Available The use of constructive systems that combine strength, speed, with competitive differential techniques and mainly, compromising with the environment, is becoming more popular in Brazil. The constructive system in wood frame for houses of up to five stories is very interesting, because it is a light system, structured in reforested treated wood which allows the combination of several materials, besides allowing speed in the construction and total control of the expenses already in the project phase for being industrialized. The structural behavior of the wood frame is superior to the structural masonry in strength, thermal and acoustic comfort. However, in Brazil, the wood frame is still little known and used, due to lack of technical knowledge about the system, prejudice associated the bad use of the wood as construction material, or still, in some cases, lack of normalization. The aim of this manuscript consists of presenting the main technical characteristics and advantages of the constructive system in wood frame homes, approaching the main stages of the constructive process through examples, showing the materials used in the construction, in addition the main international normative recommendations of the project. Thus, this manuscript also hopes to contribute to the popularization of the wood frame system in Brazil, since it is a competitive, fast and ecologically correct system. Moreover, nowadays, an enormous effort of the technical, commercial and industrial section has been accomplished for the development of this system in the country.

Neuronal Regulation of Schwann Cell Mitochondrial Ca(2+) Signaling during Myelination.

Science.gov (United States)

Ino, Daisuke; Sagara, Hiroshi; Suzuki, Junji; Kanemaru, Kazunori; Okubo, Yohei; Iino, Masamitsu

2015-09-29

Schwann cells (SCs) myelinate peripheral neurons to promote the rapid conduction of action potentials, and the process of myelination is known to be regulated by signals from axons to SCs. Given that SC mitochondria are one of the potential regulators of myelination, we investigated whether SC mitochondria are regulated by axonal signaling. Here, we show a purinergic mechanism that sends information from neurons to SC mitochondria during myelination. Our results show that electrical stimulation of rat sciatic nerve increases extracellular ATP levels enough to activate purinergic receptors. Indeed, electrical stimulation of sciatic nerves induces Ca(2+) increases in the cytosol and the mitochondrial matrix of surrounding SCs via purinergic receptor activation. Chronic suppression of this pathway during active myelination suppressed the longitudinal and radial development of myelinating SCs and caused hypomyelination. These results demonstrate a neuron-to-SC mitochondria signaling, which is likely to have an important role in proper myelination. Copyright © 2015 The Authors. Published by Elsevier Inc. All rights reserved.

Neuronal Regulation of Schwann Cell Mitochondrial Ca2+ Signaling during Myelination

Directory of Open Access Journals (Sweden)

Daisuke Ino

2015-09-01

Full Text Available Schwann cells (SCs myelinate peripheral neurons to promote the rapid conduction of action potentials, and the process of myelination is known to be regulated by signals from axons to SCs. Given that SC mitochondria are one of the potential regulators of myelination, we investigated whether SC mitochondria are regulated by axonal signaling. Here, we show a purinergic mechanism that sends information from neurons to SC mitochondria during myelination. Our results show that electrical stimulation of rat sciatic nerve increases extracellular ATP levels enough to activate purinergic receptors. Indeed, electrical stimulation of sciatic nerves induces Ca2+ increases in the cytosol and the mitochondrial matrix of surrounding SCs via purinergic receptor activation. Chronic suppression of this pathway during active myelination suppressed the longitudinal and radial development of myelinating SCs and caused hypomyelination. These results demonstrate a neuron-to-SC mitochondria signaling, which is likely to have an important role in proper myelination.

Implementation of the environment management system within SC Aedificia Carpati S.A

Energy Technology Data Exchange (ETDEWEB)

Tanislav, A.; Rizea, D. [S.C Aedificia Carpati S.A, Bucharest (Romania)

2000-07-01

The implementation process followed by S.C Aedificia Carpati S.A for the Environment Management System (EMS) was explained. It took into account the requirements of sustainable development and environmental protection. Established in 1992, the company is active in the fields of monument restoration and the production of aluminium furnishings, marble, stone, wood processing, pre-cast concrete and concrete production. The implementation of EMS was based on aspects of: (1) human, physical and financial resources, (2) EMS alignment and integration, (3) consciousness and motivation of the environment protection, (4)knowledge, skills and training, (5) operational management, (6) preparation and reaction to critical situations, and (7) practical aspects regarding EMS within the company. The company practices wastes recycling of marble, plywood floors, walls and other demolition partitions and light concrete.

Micron-scale intra-ring analyses of δ13C in early Eocene Arctic wood from Ellesmere Island

Science.gov (United States)

Schubert, B.; Jahren, H.; Eberle, J.; Sternberg, L.

2009-12-01

Early Eocene (ca. 53 Ma) fossil assemblages on Ellesmere Island (75 oN paleolatitude), provide rich information about the plant and animal life of the lush polar ecosystems of the time. Fossil wood recovered from Ellesmere Island is abundant and not permineralized; however, morphological features such as growth rings and resin canals have been obliterated by compression. We report on exceptionally high-resolution intra-ring analyses of δ13C within fossil wood, sampled at ~30 micron intervals across several centimeters of wood sample. Clear patterns in systematic seasonal increases and decreases in wood δ13C allowed us to identify at least 5 annual cycles in the wood. The patterns of increase and decrease in δ13C were consistent with patterns observed for evergreen wood, and distinct from the deciduous patterns we have observed for Metasequoia fossil wood from the middle Eocene (ca. 45 Ma) Arctic site on Axel Heiberg Island. We believe that the high point in the δ13C value of wood seen in each cycle corresponds to the highest environmental temperatures during the annual cycle, as has been seen for modern evergreens (e.g., Barbour et al., 2002). Modern studies have also noted that high temperature periods are correlated with the highest vapor-pressure and soil-water deficits of the annual cycle; these environmental factors would cause the plant to change its discrimination during photosynthesis. We will discuss the relatively low amplitude of δ13C fluctuations (0.5-1.0 ‰) clearly defined by Ellesmere fossil wood, in comparison to observations on modern common evergreens (2.0-4.0 ‰), and speculate that this difference implies greatly dampened seasonal temperature fluctuations in Eocene polar environments, relative to today. Barbour M.M., Walcroft A.S., Farquhar G.D., 2002, Seasonal variation in δ13C and δ18O of cellulose from growth rings of Pinus radiata. Plant, Cell and Environment: v. 25, p. 1483-1499.

Wood

DEFF Research Database (Denmark)

Unterrainer, Walter

2014-01-01

come from? How is it harvested? How is it manufactured and treated ? How are the buildings detailed and protected against weather during construction to keep them dry and make them long-life ? In a period of climate change, forests are the last lungs of the planet to sequestrate CO2. Their global size......Wood – a sustainable building material ? For thousands of years and all over the planet, wood has been used as a building material and exciting architecture has been created in wood. The fantastic structural, physical and aesthetic properties of the material as well as the fact that wood...

Wood burning

Energy Technology Data Exchange (ETDEWEB)

Winkelmann, H

1955-01-01

Discussed are the use of wood as a fuel, the technique of wood combustion and the operation of wood-burning stoves for cooking and heating. In addition, there is a section which reviews the use of wood stoves in various countries and lists manufacturers of stoves, central heating furnaces and in some cases sawdust burners.

Two anionically derivatized scandium oxoselenates(IV): ScF[SeO3] and Sc2O2[SeO3

Science.gov (United States)

Greiner, Stefan; Chou, Sheng-Chun; Schleid, Thomas

2017-02-01

Scandium fluoride oxoselenate(IV) ScF[SeO3] and scandium oxide oxoselenate(IV) Sc2O2[SeO3] could be synthesized through solid-state reactions. ScF[SeO3] was obtained phase-pure, by reacting mixtures of Sc2O3, ScF3 and SeO2 (molar ratio: 1:1:3) together with CsBr as fluxing agent in corundum crucibles embedded into evacuated glassy silica ampoules after firing at 700 °C for seven days. Sc2O2[SeO3] first emerged as by-product during the attempts to synthesize ScCl[SeO3] following aforementioned synthesis route and could later be reproduced from appropriate Sc2O3/SeO3 mixtures. ScF[SeO3] crystallizes monoclinically in space group P21/m with a=406.43(2), b =661.09(4), c=632.35(4) pm, β=93.298(3)° and Z=2. Sc2O2[SeO3] also crystallizes in the monoclinic system, but in space group P21/n with a=786.02(6), b=527.98(4), c=1086.11(8) pm, β=108.672(3)° for Z=4. The crystal structures of both compounds are strongly influenced by the stereochemically active lone pairs of the ψ1-tetrahedral [SeO3]2- anions. They also show partial structures, where the derivatizing F- or O2- anions play an important role. For ScF[SeO3] chains of the composition 2+∞ 1[FS c 2 / 2 ] form from connected [FSc2]5+ dumbbells, while [OSc3]7+ pyramids and [OSc4]10+ tetrahedra units are condensed to layers according to 2+ ∞ 2[O2Sc2 ] in Sc2O2[SeO3].

Effects of wood ash on soil solution and chemistry of leaves in a beech stand

International Nuclear Information System (INIS)

Tothova, Slavka

2005-01-01

The short-term effects of wood ash fertilization on chemistry of soil solution and leaves were investigated in 4-year-old beech stand (Fagus sylvatica L.) on dystric cambisol in Central Spis. Four plots - the control plot and three plots with different ash treatments (different dose, date and method of application) were established. Plate lysimeters were installed under the upper layer of soil in depth 2 cm and 20 cm on the control plot and plot P1 with addition of wood ash 5 t/ha on the whole surface. Soil solution was collected in May - October 2002 every two weeks. Composite samples, which represent a one - month period, were analysed for pH, K, Ca, Mg, and NO 3 - . The leaves were collected 4 or 10 months after the treatment and analysed on Ca, K, Mg, P, S, N and heavy metals Cd, Pb, Cr and Hg. In the ash treatment the content of macronutrient increased (mainly K, Ca). Addition of ash did not increase of the content heavy metal in leaves

Compensation of native donor doping in ScN: Carrier concentration control and p-type ScN

Science.gov (United States)

Saha, Bivas; Garbrecht, Magnus; Perez-Taborda, Jaime A.; Fawey, Mohammed H.; Koh, Yee Rui; Shakouri, Ali; Martin-Gonzalez, Marisol; Hultman, Lars; Sands, Timothy D.

2017-06-01

Scandium nitride (ScN) is an emerging indirect bandgap rocksalt semiconductor that has attracted significant attention in recent years for its potential applications in thermoelectric energy conversion devices, as a semiconducting component in epitaxial metal/semiconductor superlattices and as a substrate material for high quality GaN growth. Due to the presence of oxygen impurities and native defects such as nitrogen vacancies, sputter-deposited ScN thin-films are highly degenerate n-type semiconductors with carrier concentrations in the (1-6) × 1020 cm-3 range. In this letter, we show that magnesium nitride (MgxNy) acts as an efficient hole dopant in ScN and reduces the n-type carrier concentration, turning ScN into a p-type semiconductor at high doping levels. Employing a combination of high-resolution X-ray diffraction, transmission electron microscopy, and room temperature optical and temperature dependent electrical measurements, we demonstrate that p-type Sc1-xMgxN thin-film alloys (a) are substitutional solid solutions without MgxNy precipitation, phase segregation, or secondary phase formation within the studied compositional region, (b) exhibit a maximum hole-concentration of 2.2 × 1020 cm-3 and a hole mobility of 21 cm2/Vs, (c) do not show any defect states inside the direct gap of ScN, thus retaining their basic electronic structure, and (d) exhibit alloy scattering dominating hole conduction at high temperatures. These results demonstrate MgxNy doped p-type ScN and compare well with our previous reports on p-type ScN with manganese nitride (MnxNy) doping.

Investigation of Sc(3) state in nonaqueous solutions by the 45Sc NMR method of high permission

International Nuclear Information System (INIS)

Buslaev, Yu.A.; Kirakosyan, G.A.; Tarasov, V.P.

1980-01-01

The ScCl 3 + CH 3 CN and ScCl 3 + KNCS + CH 3 CN solutions have been studied by a high-resolution NMR 45 Sc method. It has been estimated that in acetonitrile solutions, with competing ligands of Cl - and NCS - being available, hexacoordination Sc(3) complexes of various compositions are formed, and solvent molecules also take part in formation of the coordination sphere of scandium. Chemical shifts in NMR 45 Sc signals depend linearly on the number of chlor- or NCS - ions bound to scandium(3). This made it possible to determine the value of chemical shifts in signals of all 28 potential complexes formed in a system with three competing ligands

Region-specific roles of the prelimbic cortex, the dorsal CA1, the ventral DG and ventral CA1 of the hippocampus in the fear return evoked by a sub-conditioning procedure in rats.

Science.gov (United States)

Fu, Juan; Xing, Xiaoli; Han, Mengfi; Xu, Na; Piao, Chengji; Zhang, Yue; Zheng, Xigeng

2016-02-01

The return of learned fear is an important issue in anxiety disorder research since an analogous process may contribute to long-term fear maintenance or clinical relapse. A number of studies demonstrate that mPFC and hippocampus are important in the modulation of post-extinction re-expression of fear memory. However, the region-specific role of these structures in the fear return evoked by a sub-threshold conditioning (SC) is not known. In the present experiments, we first examined specific roles of the prelimbic cortex (PL), the dorsal hippocampus (DH, the dorsal CA1 area in particular), the ventral hippocampus (the ventral dentate gyrus (vDG) and the ventral CA1 area in particular) in this fear return process. Then we examined the role of connections between PL and vCA1 with this behavioral approach. Rats were subjected to five tone-shock pairings (1.0-mA shock) to induce conditioned fear (freezing), followed by three fear extinction sessions (25 tone-alone trials each session). After a post-test for extinction memory, some rats were retrained with the SC procedure to reinstate tone-evoked freezing. Rat groups were injected with low doses of the GABAA agonist muscimol to selectively inactivate PL, DH, vDG, or vCA1 120 min before the fear return test. A disconnection paradigm with ipsilateral or contralateral muscimol injection of the PL and the vCA1 was used to examine the role of this pathway in the fear return. We found that transient inactivation of these areas significantly impaired fear return (freezing): inactivation of the prelimbic cortex blocked SC-evoked fear return in particular but did not influence fear expression in general; inactivation of the DH area impaired fear return, but had no effect on the extinction retrieval process; both ventral DG and ventral CA1 are required for the return of extinguished fear whereas only ventral DG is required for the extinction retrieval. These findings suggest that PL, DH, vDG, and vCA1 all contribute to the fear

Competitive outcomes between wood-decaying fungi are altered in burnt wood.

Science.gov (United States)

Edman, Mattias; Eriksson, Anna-Maria

2016-06-01

Fire is an important disturbance agent in boreal forests where it creates a wide variety of charred and other types of heat-modified dead wood substrates, yet how these substrates affect fungal community structure and development within wood is poorly understood. We allowed six species of wood-decaying basidiomycetes to compete in pairs in wood-discs that were experimentally burnt before fungal inoculation. The outcomes of interactions in burnt wood differed from those in unburnt control wood for two species:Antrodia sinuosanever lost on burnt wood and won over its competitor in 67% of the trials compared to 40% losses and 20% wins on unburnt wood. In contrast, Ischnoderma benzoinumwon all interactions on unburnt wood compared to 33% on burnt wood. However, the responses differed depending on the identity of the competing species, suggesting an interaction between competitor and substrate type. The observed shift in competitive balance between fungal species probably results from chemical changes in burnt wood, but the underlying mechanism needs further investigation. Nevertheless, the results indicate that forest fires indirectly structure fungal communities by modifying dead wood, and highlight the importance of fire-affected dead wood substrates in boreal forests. © FEMS 2016. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

Development of standardized radioactive 46Sc solution

International Nuclear Information System (INIS)

Du Hongshan; Jia Zhang; Yu Yiguang; Sun Naiyao

1988-01-01

A method of preparation of standardized radioactive 46 Sc solution is developed. The separation of 46 Sc, the composition of 46 Sc solution and its stability, and radioactivity measurement of 46 Sc are systematically studied. The results obtained in the study and in the applications in many laboratories have shown that our method is effective and reliable

Potential wood protection strategies using physiological requirements of wood degrading fungi

NARCIS (Netherlands)

Sailer, M.F.; Etten, B.D. van

2004-01-01

Due to the increasing restrictions in the use of wood preserving biocides a number of potential biocide free wood preserving alternatives are currently assessed. Wood degrading fungi require certain conditions in the wood in order to be able to use wood as a food source. This paper discusses the

Knowledge insufficient: the management of haemoglobin SC disease.

Science.gov (United States)

Pecker, Lydia H; Schaefer, Beverly A; Luchtman-Jones, Lori

2017-02-01

Although haemoglobin SC (HbSC) accounts for 30% of sickle cell disease (SCD) in the United States and United Kingdom, evidence-based guidelines for genotype specific management are lacking. The unique pathology of HbSC disease is complex, characterized by erythrocyte dehydration, intracellular sickling and increased blood viscosity. The evaluation and treatment of patients with HbSC is largely inferred from studies of SCD consisting mostly of haemoglobin SS (HbSS) patients. These studies are underpowered to allow definitive conclusions about HbSC. We review the pathophysiology of HbSC disease, including known and potential differences between HbSS and HbSC, and highlight knowledge gaps in HbSC disease management. Clinical and translational research is needed to develop targeted treatments and to validate management recommendations for efficacy, safety and impact on quality of life for people with HbSC. © 2016 John Wiley & Sons Ltd.

SC-FDMA for mobile communications

CERN Document Server

Abd El-Samie, Fathi E

2013-01-01

SC-FDMA for Mobile Communications examines Single-Carrier Frequency Division Multiple Access (SC-FDMA). Explaining this rapidly evolving system for mobile communications, it describes its advantages and limitations and outlines possible solutions for addressing its current limitations. The book explores the emerging trend of cooperative communication with SC-FDMA and how it can improve the physical layer security. It considers the design of distributed coding schemes and protocols for wireless relay networks where users cooperate to send their data to the destination. Supplying you with the re

Precipitation in cold-rolled Al-Sc-Zr and Al-Mn-Sc-Zr alloys prepared by powder metallurgy

KAUST Repository

Vlach, Martin

2013-12-01

The effects of cold-rolling on thermal, mechanical and electrical properties, microstructure and recrystallization behaviour of the AlScZr and AlMnScZr alloys prepared by powder metallurgy were studied. The powder was produced by atomising in argon with 1% oxygen and then consolidated by hot extrusion at 350 C. The electrical resistometry and microhardness together with differential scanning calorimetry measurements were compared with microstructure development observed by transmission and scanning electron microscopy, X-ray diffraction and electron backscatter diffraction. Fine (sub)grain structure developed and fine coherent Al3Sc and/or Al3(Sc,Zr) particles precipitated during extrusion at 350 C in the alloys studied. Additional precipitation of the Al3Sc and/or Al3(Sc,Zr) particles and/or their coarsening was slightly facilitated by the previous cold rolling. The presence of Sc,Zr-containing particles has a significant antirecrystallization effect that prevents recrystallization at temperatures minimally up to 420 C. The precipitation of the Al6Mn- and/or Al 6(Mn,Fe) particles of a size ~ 1.0 μm at subgrain boundaries has also an essential antirecrystallization effect and totally suppresses recrystallization during 32 h long annealing at 550 C. The texture development of the alloys seems to be affected by high solid solution strengthening by Mn. The precipitation of the Mn-containing alloy is highly enhanced by a cold rolling. The apparent activation energy of the Al3Sc particles formation and/or coarsening and that of the Al6Mn and/or Al 6(Mn,Fe) particle precipitation in the powder and in the compacted alloys were determined. The cold deformation has no effect on the apparent activation energy values of the Al3Sc-phase and the Al 6Mn-phase precipitation. © 2013 Elsevier Inc.

Precipitation in cold-rolled Al-Sc-Zr and Al-Mn-Sc-Zr alloys prepared by powder metallurgy

KAUST Repository

Vlach, Martin; Stulí ková , Ivana; Smola, Bohumil; Kekule, Tomá š; Kudrnová , Hana; Daniš, Stanislav; Gemma, Ryota; Očená šek, Vladivoj; Má lek, Jaroslav; Tanprayoon, Dhritti; Neubert, Volkmar

2013-01-01

The effects of cold-rolling on thermal, mechanical and electrical properties, microstructure and recrystallization behaviour of the AlScZr and AlMnScZr alloys prepared by powder metallurgy were studied. The powder was produced by atomising in argon with 1% oxygen and then consolidated by hot extrusion at 350 C. The electrical resistometry and microhardness together with differential scanning calorimetry measurements were compared with microstructure development observed by transmission and scanning electron microscopy, X-ray diffraction and electron backscatter diffraction. Fine (sub)grain structure developed and fine coherent Al3Sc and/or Al3(Sc,Zr) particles precipitated during extrusion at 350 C in the alloys studied. Additional precipitation of the Al3Sc and/or Al3(Sc,Zr) particles and/or their coarsening was slightly facilitated by the previous cold rolling. The presence of Sc,Zr-containing particles has a significant antirecrystallization effect that prevents recrystallization at temperatures minimally up to 420 C. The precipitation of the Al6Mn- and/or Al 6(Mn,Fe) particles of a size ~ 1.0 μm at subgrain boundaries has also an essential antirecrystallization effect and totally suppresses recrystallization during 32 h long annealing at 550 C. The texture development of the alloys seems to be affected by high solid solution strengthening by Mn. The precipitation of the Mn-containing alloy is highly enhanced by a cold rolling. The apparent activation energy of the Al3Sc particles formation and/or coarsening and that of the Al6Mn and/or Al 6(Mn,Fe) particle precipitation in the powder and in the compacted alloys were determined. The cold deformation has no effect on the apparent activation energy values of the Al3Sc-phase and the Al 6Mn-phase precipitation. © 2013 Elsevier Inc.

Band structure of the quaternary Heusler alloys ScMnFeSn and ScFeCoAl

Science.gov (United States)

Shanthi, N.; Teja, Y. N.; Shaji, Shephine M.; Hosamani, Shashikala; Divya, H. S.

2018-04-01

In our quest for materials with specific applications, a theoretical study plays an important role in predicting the properties of compounds. Heusler alloys or compounds are the most studied in this context. More recently, a lot of quaternary Heusler compounds are investigated for potential applications in fields like Spintronics. We report here our preliminary study of the alloys ScMnFeSn and ScFeCoAl, using the ab-initio linear muffin-tin orbital method within the atomic sphere approximation (LMTO-ASA). The alloy ScMnFeSn shows perfect half-metallicity, namely, one of the spins shows a metallic behaviour and the other spin shows semi-conducting behaviour. Such materials find application in devices such as the spin-transfer torque random access memory (STT-MRAM). In addition, the alloy ScMnFeSn is found to have an integral magnetic moment of 4 µB, as predicted by the Slater-Pauling rule. The alloy ScFeCoAl does not show half-metallicity.

Metal leaching in mine tailings: short-term impact of biochar and wood ash amendments.

Science.gov (United States)

Beauchemin, Suzanne; Clemente, Joyce S; MacKinnon, Ted; Tisch, Bryan; Lastra, Rolando; Smith, Derek; Kwong, John

2015-01-01

Biochar is perceived as a promising amendment to reclaim degraded, metal-contaminated lands. The objective of this study was to compare the potential of biochar and wood ash amendments to reduce metal(loid) leaching in mine tailings. A 2-mo leaching experiment was conducted in duplicate on acidic and alkaline tailings, each mixed with 5 wt.% of one of the following amendments: three wood-derived, fast-pyrolysis biochars (OC > 57 wt.%) and two wood ash materials (organic carbon [OC] ≤ 16 wt.%); a control test with no carbon input was also added. The columns were leached with water after 1, 2, 4, 8, 16, 32, and 64 d, and the leachates were monitored for dissolved metals, OC, and pH. For the acidic and alkaline tailings, the most significant impact on metal mobility was observed with wood ash materials due to their greater neutralization potential (>15% CaCO eq.) compared with biochar (≤3.3% CaCO eq.). An increase of 1 pH unit in the wood ash-treated alkaline tailings led to an undesirable mobilization of As and Se. The addition of biochar did not significantly reduce the leaching of the main contaminants (Cu and Ni in the acidic tailings and As in the alkaline tailings) over 2 mo. The Se attenuation noted in some biochar-treated acid tailings may be mainly due to a slight alkaline effect rather than Se removal by biochar, given the low capacity for the fresh biochars to retain Se under acidic conditions (pH 4.5). The increased loss of dissolved OC in the biochar-amended systems was of short duration and was not associated with metal(loid) mobilization. Copyright © Her Majesty the Queen in Right of Canada, as represented by the Minister of Agriculture and Agri-Food Canada.

Biodiesel production using heterogeneous catalysts including wood ash and the importance of enhancing byproduct glycerol purity

International Nuclear Information System (INIS)

Uprety, Bijaya K.; Chaiwong, Wittavat; Ewelike, Chinomnso; Rakshit, Sudip K.

2016-01-01

Highlights: • Comparison of biodiesel production using homogeneous and heterogeneous catalysts. • Comparative study of CaO and CaO supported on alumina for biodiesel production. • Tradeoff between biodiesel conversion rate and purity. • Ash from birch bark and wood pellet industry explored as a potential catalyst. - Abstract: Transesterification of vegetable oils or animal fats with methanol in the presence of catalysts produces fatty acid methyl esters (FAME) and glycerol as a co-product. This study was focused on a comparative study of the transesterification of refined, bleached and deodorized palm oil (RBD palm oil) using a heterogeneous catalysts CaO with and without γ-alumina (γ-Al_2O_3) as a support. The results were also compared to that using sodium hydroxide (NaOH), which is a homogenous catalyst. Parameters like the amount of catalyst, the molar ratio of methanol to oil, reaction time and reaction temperature that affect methyl ester and glycerol formation were analyzed and the optimum conditions were determined. The FAME and glycerol content (96.75% and 92.73% respectively) obtained using CaO were lower in purity compared to that using CaO/Al_2O_3 (97.66% and 96.36% respectively). In the second phase of our work, wood ash from two different sources (birch bark & flyash from a biomass based power plant), which were calcined at 800 °C were studied for their potential use as a cheap renewable alternative heterogeneous catalyst. Both the wood ash samples were found to have good potential for use in such production process, but needs to be optimized further to obtain biodiesel which meets fuel biodiesel specifications. Both CaO and CaO supported on alumina produces FAME to levels that meet the fuel specifications required for blending with diesel. However, the latter produces a purer form of byproduct glycerol that can be easily converted to value added products, without the need for purification. On this basis the supported catalyst is

Wood ash to treat sewage sludge for agricultural use

Energy Technology Data Exchange (ETDEWEB)

White, R.K. [Clemson Univ., SC (United States)

1993-12-31

About 90% of the three million tons of wood ash generated in the United States from wood burning facilities is being landfilled. Many landfills are initiated tipping fees and/or restrictions on the disposal of special wastes such as ash. The purpose of this work was to evaluate (1) the feasibility of using wood ash to stabilize sewage sludge and (2) the fertilizer and liming value of the sludge/ash mixture on plant response and soil pH. Research showed that wood ash, when mixed with sludge, will produce a pH above 12.0, which meets US EPA criteria for pathogen reduction for land application on non-direct food chain crops. Different ratios of wood ash to sludge mixtures were tested and the 1:1 ratio (by weight) was found to be optimal. Five replications of wood ash from four sources were tested for moisture content, pH and fertilizer nutrients. The pH of the ash/sludge mixture (1:1) on day one ranged from 12.4 to 13.2. In most cases the pH remained the same over a 21 day test or only dropped 0.1 to 0.3 units. Analyses of the mixtures showed that heavy metal concentrations (As, B, Cd, Co, Cr, Cu, Mn, Mo, Ni, Pb, S, Se, Zn) were low. The 1:1 ash/sludge mixture had a calcium carbonate equivalency of 17%. Green house pot studies using tall fescue grass were loadings of 300 to 750 pounds per acre of TKN-N than for 500 lb/acre of 10-10-10 commercial fertilizer. Plant tissue analysis showed N, P, K, Ca, and Mg levels to be within the sufficiency range for tall fescue.

Hydrothermal fabrication of hydroxyapatite on the PEG-grafted surface of wood from Chinese Glossy Privet

Science.gov (United States)

Wang, Ning; Cai, Chuanjie; Cai, Dongqing; Cheng, Junjie; Li, Shengli; Wu, Zhengyan

2012-10-01

Wood-hydroxyapatite composite material was developed by depositing hydrated calcium hydrogen phosphate (HCHP) on the surface of wood from Chinese Glossy Privet (CGP) with polyethylene glycol (PEG, HO(CH2CH2O)nH) as the grafting agent and subsequent hydrothermal vapor treatment. The results illustrated that HCHP could adhere quickly and strongly on the PEG-grafted wood surface. Moreover, this HCHP could be efficiently transformed to hydroxyapatite (HA, Ca10(PO4)6(OH)2) by hydrothermal vapor treatment. IR, XRD analysis and SEM observation indicated that the fabricated hydroxyapatite was pure and its morphology was uniform and microporous. This work provides a new fabricating approach of biocompatible material which may have some potential applications as bone-repairing material.

Wood Identification of 18th Century Furniture. Interpreting Wood Naming Inventoires

Directory of Open Access Journals (Sweden)

Rocio Astrid BERNAL

2011-09-01

Full Text Available The 18th century Portuguese church furniture represents an extraordinary richness recognised worldwide, which demands safeguarding and valorisation. The identification of the wood of furniture artworks is the most important component for its comprehension and preservation. In this work wood anatomical characters of an 18th century Portuguese decorative furniture set from the Colegiada de São Martinho de Cedofeita, in Porto, were analysed to identify the woods used for manufacturing and to clarify their common names. Furthermore, the objectives were to recognise some of the criteria for choice of wood as well as the source of each wood. The woods identified from 16 fragments belong to Apuleia sp., Acacia sp., Neolamarckia sp. and Castanea sativa. Apuleia sp. and Acacia sp. woods most likely arrived from Brazil, while the Neolamarckia sp. woods likely arrived from India and the C. sativa woods from Portugal. The results are in accordance with the known Portuguese colonial sea routes of the 15th -18th centuries. Interestingly the terms found in the inventories can refer to finishing methods instead to the name of the woods, as for instance “oil wood” can refer to “oiled wood” or “linseed oiled wood”. The species choice may be related to the mechanical properties of the wood as well as the original tree size. Two large planks of Acacia sp. were used for the top of the “Portuguese arcaz”, and Apuleia sp. was found on main structural elements of this set of furniture, suggesting that wood colour was also important. Woods from Neolamarckia sp. and C. sativa, were also identified, being Castanea wood present only in the most recent pieces of the furniture set.

Energy wood. Part 2b: Wood pellets and pellet space-heating systems

International Nuclear Information System (INIS)

Nussbaumer, T.

2002-01-01

The paper gives an overview on pellet utilization including all relevant process steps: Potential and properties of saw dust as raw material, pellet production with drying and pelletizing, standardization of wood pellets, storage and handling of pellets, combustion of wood pellets in stoves and boilers and applications for residential heating. In comparison to other wood fuels, wood pellets show several advantages: Low water content and high heating value, high energy density, and homogeneous properties thus enabling stationary combustion conditions. However, quality control is needed to ensure constant properties of the pellets and to avoid the utilization of contaminated raw materials for the pellet production. Typical data of efficiencies and emissions of pellet stoves and boilers are given and a life cycle analysis (LCA) of wood pellets in comparison to log wood and wood chips is described. The LCA shows that wood pellets are advantageous thanks to relatively low emissions. Hence, the utilization of wood pellet is proposed as a complementary technology to the combustion of wood chips and log wood. Finally, typical fuel cost of wood pellets in Switzerland are given and compared with light fuel oil. (author)

Wood-related occupations, wood dust exposure, and sinonasal cancer.

Science.gov (United States)

Hayes, R B; Gerin, M; Raatgever, J W; de Bruyn, A

1986-10-01

A case-control study was conducted to examine the relations between type of woodworking and the extent of wood dust exposure to the risks for specific histologic types of sinonasal cancer. In cooperation with the major treatment centers in the Netherlands, 116 male patients newly diagnosed between 1978 and 1981 with primary malignancies of epithelial origin of this site were identified for study. Living controls were selected from the municipal registries, and deceased controls were selected from the national death registry. Interviews were completed for 91 (78%) cases and 195 (75%) controls. Job histories were coded by industry and occupation. An index of exposure was developed to classify the extent of occupational exposure to wood dust. When necessary, adjustment was made for age and usual cigarette use. The risk for nasal adenocarcinoma was elevated by industry for the wood and paper industry (odds ratio (OR) = 11.9) and by occupation for those employed in furniture and cabinet making (OR = 139.8), in factory joinery and carpentry work (OR = 16.3), and in association with high-level wood dust exposure (OR = 26.3). Other types of nasal cancer were not found to be associated with wood-related industries or occupations. A moderate excess in risk for squamous cell cancer (OR = 2.5) was associated with low-level wood dust exposure; however, no dose-response relation was evident. The association between wood dust and adenocarcinoma was strongest for those employed in wood dust-related occupations between 1930 and 1941. The risk of adenocarcinoma did not appear to decrease for at least 15 years after termination of exposure to wood dust. No cases of nasal adenocarcinoma were observed in men whose first exposure to wood dust occurred after 1941.

Effect of cement/wood ratios and wood storage conditions on hydration temperature, hydration time, and compressive strength of wood-cement mixtures

Science.gov (United States)

Andy W.C. Lee; Zhongli Hong; Douglas R. Phillips; Chung-Yun Hse

1987-01-01

This study investigated the effect of cement/wood ratios and wood storage conditions on hydration temperature, hydration time, and compressive strength of wood-cement mixtures made from six wood species: southern pine, white oak, southern red oak, yellow-poplar, sweetgum, and hickory. Cement/wood ratios varied from 13/1 to 4/1. Wood storage conditions consisted of air-...

A novel artificial microRNA expressing AAV vector for phospholamban silencing in cardiomyocytes improves Ca2+ uptake into the sarcoplasmic reticulum.

Directory of Open Access Journals (Sweden)

Tobias Gröβl

Full Text Available In failing rat hearts, post-transcriptonal inhibition of phospholamban (PLB expression by AAV9 vector-mediated cardiac delivery of short hairpin RNAs directed against PLB (shPLBr improves both impaired SERCA2a controlled Ca2+ cycling and contractile dysfunction. Cardiac delivery of shPLB, however, was reported to cause cardiac toxicity in canines. Thus we developed a new AAV vector, scAAV6-amiR155-PLBr, expressing a novel engineered artificial microRNA (amiR155-PLBr directed against PLB under control of a heart-specific hybrid promoter. Its PLB silencing efficiency and safety were compared with those of an AAV vector expressing shPLBr (scAAV6-shPLBr from an ubiquitously active U6 promoter. Investigations were carried out in cultured neonatal rat cardiomyocytes (CM over a period of 14 days. Compared to shPLBr, amiR155-PLBr was expressed at a significantly lower level, resulting in delayed and less pronounced PLB silencing. Despite decreased knockdown efficiency of scAAV6-amiR155-PLBr, a similar increase of the SERCA2a-catalyzed Ca2+ uptake into sarcoplasmic reticulum (SR vesicles was observed for both the shPLBr and amiR155-PLBr vectors. Proteomic analysis confirmed PLB silencing of both therapeutic vectors and revealed that shPLBr, but not the amiR155-PLBr vector, increased the proinflammatory proteins STAT3, STAT1 and activated STAT1 phosphorylation at the key amino acid residue Tyr701. Quantitative RT-PCR analysis detected alterations in the expression of several cardiac microRNAs after treatment of CM with scAAV6-shPLBr and scAAV6-amiR155-PLBr, as well as after treatment with its related amiR155- and shRNAs-expressing control AAV vectors. The results demonstrate that scAAV6-amiR155-PLBr is capable of enhancing the Ca2+ transport function of the cardiac SR PLB/SERCA2a system as efficiently as scAAV6-shPLBr while offering a superior safety profile.

The colours of Hubble Sc galaxy nuclei

International Nuclear Information System (INIS)

Iskudaryan, S.G.

1975-01-01

The colorimetric data on the nuclei of the Sc galaxies are given. Comparison of the following parameters: color of a nucleus, integral color of a galaxy, Byurakan class, and spectral type of normal spirals gives the possibility to conclude: (1) The colors of the nuclei of the Sc galaxies have a high dispersion in its values. In all Byurakan classes the galaxies with intensely red and blue nuclei occur; (2) Some Sc galaxies exhibit a discrepancy between the spectral and morphological types. The results of colorimetry of nuclei indicate that almost all such Sc galaxies have intensely red nuclei which, naturally, provide for these late spectral types. It can be assumed that the intensely red color of the nuclei of such Sc galaxies is a result of a new type of activity of these nuclei; and (3) some Sc galaxies show the characteristics of the Markarian objects

Wood pellet seminar

International Nuclear Information System (INIS)

Aarniala, M.; Puhakka, A.

2001-01-01

The objective of the wood pellet seminar, arranged by OPET Finland and North Karelia Polytechnic, was to deliver information on wood pellets, pellet burners and boilers, heating systems and building, as well as on the activities of wood energy advisors. The first day of the seminar consisted of presentations of equipment and products, and of advisory desks for builders. The second day of the seminar consisted of presentations held by wood pellet experts. Pellet markets, the economy and production, the development of the pellet markets and their problems (in Austria), the economy of heating of real estates by different fuel alternatives, the production, delivery and marketing of wood pellets, the utilization of wood pellet in different utilization sites, the use of wood pellets in detached houses, pellet burners and fireplaces, and conversion of communal real estate houses to use wood pellets were discussed in the presentations. The presentations held in the third day discussed the utilization of wood pellets in power plants, the regional promotion of the production and the use of pellets. The seminar consisted also of visits to pellet manufacturing plant and two pellet burning heating plants

Projected wood energy impact on US forest wood resources

Energy Technology Data Exchange (ETDEWEB)

Skog, K.E. [USDA Forest Service, Madison, WI (United States)

1993-12-31

The USDA Forest Service has developed long-term projections of wood energy use as part of a 1993 assessment of demand for and supply of resources from forest and range lands in the United States. To assess the impact of wood energy demand on timber resources, a market equilibrium model based on linear programming was developed to project residential, industrial, commercial, and utility wood energy use from various wood energy sources: roundwood from various land sources, primary wood products mill residue, other wood residue, and black liquor. Baseline projections are driven by projected price of fossil fuels compared to price of wood fuels and the projected increase in total energy use in various end uses. Wood energy use is projected to increase from 2.67 quad in 1986 to 3.5 quad in 2030 and 3.7 quad in 2040. This is less than the DOE National Energy Strategy projection of 5.5 quad in 2030. Wood energy from forest sources (roundwood) is projected to increase from 3.1 billion (10{sup 9}) ft{sup 3} in 1986 to 4.4. billion ft{sup 3} in 2030 and 4.8 billion ft{sup 3} in 2040 (88, 124 and 136 million m{sup 3}, respectively). This rate of increase of roundwood use for fuel -- 0.8 percent per year -- is virtually the same as the projected increase rate for roundwood for pulpwood. Pulpwood roundwood is projected to increase from 4.2 billion ft{sup 3} in 1986 to 6.0 billion ft{sup 3} in 2030 and 6.4 billion ft{sup 3} in 2040 (119, 170 and 183 million m{sup 3}, respectively).

Growth of high-density ZnO nanorods on wood with enhanced photostability, flame retardancy and water repellency

Science.gov (United States)

Kong, Lizhuo; Tu, Kunkun; Guan, Hao; Wang, Xiaoqing

2017-06-01

Zinc oxide (ZnO) nanorod arrays were successfully assembled on the wood surface in situ via a two-step process consisting of formation of ZnO seeds and subsequent crystal growth under hydrothermal conditions at a low temperature. The morphology and crystalline structure of the formed ZnO nanorods were studied by field-emission scanning electron microscopy (FE-SEM) and X-ray diffraction (XRD). Highly dense and uniform arrays of ZnO nanorods with well-defined hexagonal facets were generated on the wood surface by tuning the concentration of the ZnO growth solution during the hydrothermal treatment. Accelerated weathering tests indicated that the assembled ZnO nanorod arrays were highly protective against UV radiation and greatly enhanced the photostability of the coated wood. Meanwhile, the ZnO nanorod-coated wood can withstand continuous exposure to flame with only minor smoldering in contrast with the pristine wood catching fire easily and burning rapidly. Moreover, when further modified with low-surface-energy stearic acid, the ZnO nanorod decorated wood surface can be transformed into a superhydrophobic surface, with a water contact angle (CA) of ∼154°. Such ZnO nanorod-modified woods with enhanced photostability, flame retardancy and water repellency offer an interesting alternative to conventional wood preservation strategies, highlighting their potential applications in some novel wood products.

Finishing of wood

Science.gov (United States)

R. Sam Williams

1999-01-01

The primary function of any wood finish (paint, varnish, and stain, for example) is to protect the wood surface, help maintain a certain appearance, and provide a cleanable surface. Although wood can be used both outdoors and indoors without finishing, unfinished wood surfaces exposed to the weather change color, are roughened by photodegradation and surface checking,...

Wood fuels utilization in Central Europe - the wood fuels consumption and the targets of utilization

International Nuclear Information System (INIS)

Alakangas, E.

1999-01-01

Following subjects are discussed in this presentation: The share of bioenergy of the total energy consumption in EU region; the wood fuels consumption in EU region in 1995; the division of bioenergy utilization (households, wood- based district heating, wood consumption in industry, power generation from wood and residues, biofuels, biogas and sludges); wood fuels consumption in households in EU countries in 1995; wood consumption in France; the additional wood fuel consumption potential in France; Blan bois - wood energy program; French wood energy markets; German wood energy markets; energy consumption in Germany; wood consumption in Bavaria; the wood fuels potential in Bavaria; wood fuels consumption in households in Bavaria; wood fuels consumption for district heating in Bavaria; fuel prices in Bavaria; Environmental regulations in Germany; small boiler markets in Germany; Energy consumption in Austria; small-scale utilization of wood fuels; utilization of wood energy. (Slides, additional information from the author)

Wood construction and magnetic characteristics of impregnated type magnetic wood

International Nuclear Information System (INIS)

Oka, Hideo; Hojo, Atsushi; Seki, Kyoushiro; Takashiba, Toshio

2002-01-01

The results of experiments involving the AC and DC magnetic characteristics of impregnated type magnetic wood were studied by taking into consideration the wood construction and fiber direction. The experimental results show that the sufficient amount of impregnated magnetic fluid varies depending on the fiber direction and length, and the grain face of the wood material. The impregnated type magnetic wood sample that is fully impregnated by magnetic fluid has a 60% saturation magnetization compared to the saturation magnetization of magnetic fluid. Samples for which the wood fiber direction was the same as the direction of the magnetic path had a higher magnetization intensity and permeability

Trace Element Partitioning Between low-Ca Pyroxene and Ultracalcic Liquids.

Science.gov (United States)

Pertermann, M.; Schmidt, M. W.; Pettke, T.

2003-12-01

Low-Ca pyroxene or pigeonite ( ˜0.25-0.35 Ca per formula unit, pfu) is an important residual phase during high temperature melting of refractory mantle (e.g., ankaramite formation). High-Ca cpx (>0.6-0.7 Ca pfu) may be residual to relatively low temperature melting of fertile mantle (MOR and OI), but the opx-cpx solvus narrows considerably at higher temperatures (>1330-1350° C), leading to coexisting opx and low-Ca cpx. Little is known about the trace element partitioning of such low-Ca cpx at upper mantle conditions. Our new partitioning experiments investigate the role of low-Ca cpx during melting of depleted peridotite. Nominally anhydrous experiments with graphite-lined Pt-capsules were conducted at 1.4 GPa and 1360-1370° C. The synthetic starting material is close in composition to an ultracalcic liquid saturated in opx+pigeonite+olivine+spinel. The experiments yielded assemblages of glass, low-Ca cpx, ol, and minor Cr-spinel; opx is absent. The low-Ca clinopyroxenes have 0.20 and 0.32 Ca pfu at 1370 and 1360° C, respectively, and tetrahedral Al of 0.046 and 0.067 pfu. The liquids have ˜50 wt% SiO2, ˜12.5 wt% CaO and CaO/Al2O3 of 1.44-1.54. Pyroxenes and glasses were analyzed for trace elements (La, Ce, Nd, Sm, Eu, Gd, Dy, Er Yb, Lu, Sc, Y, Sr, Zr, Hf, V, Cr, Mn, Co, Zn) by LA-ICP-MS using a 193 nm ArF excimer laser coupled to an Elan 6100 mass spectrometer. Ablation occurred in He, and ablation spot sizes were 15-30 μ m for minerals and 50 μ m for glasses. Trace element concentrations in pyroxenes were low for most 3+ and 4+ cations. This resulted in small mineral/melt partition coefficients (D-values), approximately an order of magnitude lower than those for high-Ca cpx associated with peridotite melting, thus making the low-Ca cpx partitioning behavior rather similar to the behavior of peridotitic opx. Cpx with 0.32 Ca pfu has slightly elevated D-values for 3+ cations when compared to the 0.20 Ca pfu cpx: DSc = 0.45, DY = 0.11, DSm = 0.054 and DYb

Growth of high-density ZnO nanorods on wood with enhanced photostability, flame retardancy and water repellency

Energy Technology Data Exchange (ETDEWEB)

Kong, Lizhuo; Tu, Kunkun; Guan, Hao [Research Institute of Wood Industry, Chinese Academy of Forestry, Beijing 100091 (China); Wang, Xiaoqing, E-mail: wangxq@caf.ac.cn [Research Institute of Forestry New Technology, Chinese Academy of Forestry, Beijing 100091 (China); Research Institute of Wood Industry, Chinese Academy of Forestry, Beijing 100091 (China)

2017-06-15

Highlights: • ZnO nanorod arrays were deposited on the wood surface via a hydrothermal process. • The assembled ZnO nanorod arrays greatly enhanced the photostability of wood. • The treated wood can sustain direct exposure to flame with only minor smoldering. • The ZnO-coated wood modified with stearic acid showed a superhydrophobic surface. - Abstract: Zinc oxide (ZnO) nanorod arrays were successfully assembled on the wood surface in situ via a two-step process consisting of formation of ZnO seeds and subsequent crystal growth under hydrothermal conditions at a low temperature. The morphology and crystalline structure of the formed ZnO nanorods were studied by field-emission scanning electron microscopy (FE-SEM) and X-ray diffraction (XRD). Highly dense and uniform arrays of ZnO nanorods with well-defined hexagonal facets were generated on the wood surface by tuning the concentration of the ZnO growth solution during the hydrothermal treatment. Accelerated weathering tests indicated that the assembled ZnO nanorod arrays were highly protective against UV radiation and greatly enhanced the photostability of the coated wood. Meanwhile, the ZnO nanorod-coated wood can withstand continuous exposure to flame with only minor smoldering in contrast with the pristine wood catching fire easily and burning rapidly. Moreover, when further modified with low-surface-energy stearic acid, the ZnO nanorod decorated wood surface can be transformed into a superhydrophobic surface, with a water contact angle (CA) of ∼154°. Such ZnO nanorod-modified woods with enhanced photostability, flame retardancy and water repellency offer an interesting alternative to conventional wood preservation strategies, highlighting their potential applications in some novel wood products.

Growth of high-density ZnO nanorods on wood with enhanced photostability, flame retardancy and water repellency

International Nuclear Information System (INIS)

Kong, Lizhuo; Tu, Kunkun; Guan, Hao; Wang, Xiaoqing

2017-01-01

Highlights: • ZnO nanorod arrays were deposited on the wood surface via a hydrothermal process. • The assembled ZnO nanorod arrays greatly enhanced the photostability of wood. • The treated wood can sustain direct exposure to flame with only minor smoldering. • The ZnO-coated wood modified with stearic acid showed a superhydrophobic surface. - Abstract: Zinc oxide (ZnO) nanorod arrays were successfully assembled on the wood surface in situ via a two-step process consisting of formation of ZnO seeds and subsequent crystal growth under hydrothermal conditions at a low temperature. The morphology and crystalline structure of the formed ZnO nanorods were studied by field-emission scanning electron microscopy (FE-SEM) and X-ray diffraction (XRD). Highly dense and uniform arrays of ZnO nanorods with well-defined hexagonal facets were generated on the wood surface by tuning the concentration of the ZnO growth solution during the hydrothermal treatment. Accelerated weathering tests indicated that the assembled ZnO nanorod arrays were highly protective against UV radiation and greatly enhanced the photostability of the coated wood. Meanwhile, the ZnO nanorod-coated wood can withstand continuous exposure to flame with only minor smoldering in contrast with the pristine wood catching fire easily and burning rapidly. Moreover, when further modified with low-surface-energy stearic acid, the ZnO nanorod decorated wood surface can be transformed into a superhydrophobic surface, with a water contact angle (CA) of ∼154°. Such ZnO nanorod-modified woods with enhanced photostability, flame retardancy and water repellency offer an interesting alternative to conventional wood preservation strategies, highlighting their potential applications in some novel wood products.

Wood preservatives and pressure-treated wood: considerations for historic-preservation projects

Science.gov (United States)

Ronald W. Anthony; Stan T. Lebow

2015-01-01

Wood, an abundant resource throughout most of the world, has been used as a building material for thousands of years. Many historic buildings have been built primarily of wood, and masonry and stone buildings generally have wood elements, both structural and architectural. As a biological material, wood is both remarkably complex and yet quite durable if well...

Saccharomyces cerevisiae Differential Functionalization of Presumed ScALT1 and ScALT2 Alanine Transaminases Has Been Driven by Diversification of Pyridoxal Phosphate Interactions

Directory of Open Access Journals (Sweden)

Erendira Rojas-Ortega

2018-05-01

Full Text Available Saccharomyces cerevisiae arose from an interspecies hybridization (allopolyploidiza-tion, followed by Whole Genome Duplication. Diversification analysis of ScAlt1/ScAlt2 indicated that while ScAlt1 is an alanine transaminase, ScAlt2 lost this activity, constituting an example in which one of the members of the gene pair lacks the apparent ancestral physiological role. This paper analyzes structural organization and pyridoxal phosphate (PLP binding properties of ScAlt1 and ScAlt2 indicating functional diversification could have determined loss of ScAlt2 alanine transaminase activity and thus its role in alanine metabolism. It was found that ScAlt1 and ScAlt2 are dimeric enzymes harboring 67% identity and intact conservation of the catalytic residues, with very similar structures. However, tertiary structure analysis indicated that ScAlt2 has a more open conformation than that of ScAlt1 so that under physiological conditions, while PLP interaction with ScAlt1 allows the formation of two tautomeric PLP isomers (enolimine and ketoenamine ScAlt2 preferentially forms the ketoenamine PLP tautomer, indicating a modified polarity of the active sites which affect the interaction of PLP with these proteins, that could result in lack of alanine transaminase activity in ScAlt2. The fact that ScAlt2 forms a catalytically active Schiff base with PLP and its position in an independent clade in “sensu strictu” yeasts suggests this protein has a yet undiscovered physiological function.

Saccharomyces cerevisiae Differential Functionalization of Presumed ScALT1 and ScALT2 Alanine Transaminases Has Been Driven by Diversification of Pyridoxal Phosphate Interactions

Science.gov (United States)

Rojas-Ortega, Erendira; Aguirre-López, Beatriz; Reyes-Vivas, Horacio; González-Andrade, Martín; Campero-Basaldúa, Jose C.; Pardo, Juan P.; González, Alicia

2018-01-01

Saccharomyces cerevisiae arose from an interspecies hybridization (allopolyploidiza-tion), followed by Whole Genome Duplication. Diversification analysis of ScAlt1/ScAlt2 indicated that while ScAlt1 is an alanine transaminase, ScAlt2 lost this activity, constituting an example in which one of the members of the gene pair lacks the apparent ancestral physiological role. This paper analyzes structural organization and pyridoxal phosphate (PLP) binding properties of ScAlt1 and ScAlt2 indicating functional diversification could have determined loss of ScAlt2 alanine transaminase activity and thus its role in alanine metabolism. It was found that ScAlt1 and ScAlt2 are dimeric enzymes harboring 67% identity and intact conservation of the catalytic residues, with very similar structures. However, tertiary structure analysis indicated that ScAlt2 has a more open conformation than that of ScAlt1 so that under physiological conditions, while PLP interaction with ScAlt1 allows the formation of two tautomeric PLP isomers (enolimine and ketoenamine) ScAlt2 preferentially forms the ketoenamine PLP tautomer, indicating a modified polarity of the active sites which affect the interaction of PLP with these proteins, that could result in lack of alanine transaminase activity in ScAlt2. The fact that ScAlt2 forms a catalytically active Schiff base with PLP and its position in an independent clade in “sensu strictu” yeasts suggests this protein has a yet undiscovered physiological function. PMID:29867852

Integrated control of wood destroying basidiomycetes combining Cu-based wood preservatives and Trichoderma spp.

Science.gov (United States)

Ribera, Javier; Fink, Siegfried; Bas, Maria Del Carmen; Schwarze, Francis W M R

2017-01-01

The production of new generation of wood preservatives (without addition of a co-biocide) in combination with an exchange of wood poles on identical sites with high fungal inoculum, has resulted in an increase of premature failures of wood utility poles in the last decades. Wood destroying basidiomycetes inhabiting sites where poles have been installed, have developed resistance against wood preservatives. The objective of the in vitro studies was to identify a Trichoderma spp. with a highly antagonistic potential against wood destroying basidiomycetes that is capable of colonizing Cu-rich environments. For this purpose, the activity of five Trichoderma spp. on Cu-rich medium was evaluated according to its growth and sporulation rates. The influence of the selected Trichoderma spp. on wood colonization and degradation by five wood destroying basidiomycetes was quantitatively analyzed by means of dry weight loss of wood specimens. Furthermore, the preventative effect of the selected Trichoderma spp. in combination with four Cu-based preservatives was also examined by mass loss and histological changes in the wood specimens. Trichoderma harzianum (T-720) was considered the biocontrol agent with higher antagonistic potential to colonize Cu-rich environments (up to 0.1% CuSO4 amended medium). T. harzianum demonstrated significant preventative effect on wood specimens against four wood destroying basidiomycetes. The combined effect of T. harzianum and Cu-based wood preservatives demonstrated that after 9 months incubation with two wood destroying basidiomycetes, wood specimens treated with 3.8 kg m-3 copper-chromium had weight losses between 55-65%, whereas containers previously treated with T. harzianum had significantly lower weight losses (0-25%). Histological studies on one of the wood destroying basidiomycetes revealed typical decomposition of wood cells by brown-rot fungi in Cu-impregnated samples, that were notably absent in wood specimens previously exposed to T

Integrated control of wood destroying basidiomycetes combining Cu-based wood preservatives and Trichoderma spp.

Directory of Open Access Journals (Sweden)

Javier Ribera

Full Text Available The production of new generation of wood preservatives (without addition of a co-biocide in combination with an exchange of wood poles on identical sites with high fungal inoculum, has resulted in an increase of premature failures of wood utility poles in the last decades. Wood destroying basidiomycetes inhabiting sites where poles have been installed, have developed resistance against wood preservatives. The objective of the in vitro studies was to identify a Trichoderma spp. with a highly antagonistic potential against wood destroying basidiomycetes that is capable of colonizing Cu-rich environments. For this purpose, the activity of five Trichoderma spp. on Cu-rich medium was evaluated according to its growth and sporulation rates. The influence of the selected Trichoderma spp. on wood colonization and degradation by five wood destroying basidiomycetes was quantitatively analyzed by means of dry weight loss of wood specimens. Furthermore, the preventative effect of the selected Trichoderma spp. in combination with four Cu-based preservatives was also examined by mass loss and histological changes in the wood specimens. Trichoderma harzianum (T-720 was considered the biocontrol agent with higher antagonistic potential to colonize Cu-rich environments (up to 0.1% CuSO4 amended medium. T. harzianum demonstrated significant preventative effect on wood specimens against four wood destroying basidiomycetes. The combined effect of T. harzianum and Cu-based wood preservatives demonstrated that after 9 months incubation with two wood destroying basidiomycetes, wood specimens treated with 3.8 kg m-3 copper-chromium had weight losses between 55-65%, whereas containers previously treated with T. harzianum had significantly lower weight losses (0-25%. Histological studies on one of the wood destroying basidiomycetes revealed typical decomposition of wood cells by brown-rot fungi in Cu-impregnated samples, that were notably absent in wood specimens

The ternary systems Sc-Sm(Dy)-Si at 870 K

International Nuclear Information System (INIS)

Kotur, B.Ya.; Mokra, I.Ya.; Toporinskij, A.Ya.

1991-01-01

Isothermal cross sections of the ternary systems Sc-Sm-Si and Sc-Dy-Si at 870 K have been plotted. Investigation of scandium and disprosium in ternary systems have been examined by X-ray diffraction and microstructure analysis. Besides literary data on binary systems Sc-Si, Sm-Si, Dy-Si have been used. Formation of limited (Sc-Sm-Si, Sc-Dy-Si) and continuous (Sc-Dy-Si) solid solutions based on bisilicides of Sc and Sm(Dy) is discovered. Two and five ternary compounds in Sc-Sm-Si and Sc-Dy-Si systems have been determined and their crystal structure has been established. When investigating of Sc-(rare earth element)-Si ternary systems and should take into account the specific interaction of scandium and samarium with REE

Wood composites

Science.gov (United States)

Lars Berglund; Roger M. Rowell

2005-01-01

A composite can be defined as two or more elements held together by a matrix. By this definition, what we call “solid wood” is a composite. Solid wood is a three-dimensional composite composed of cellulose, hemicelluloses and lignin (with smaller amounts of inorganics and extractives), held together by a lignin matrix. The advantages of developing wood composites are (...

Market opportunities for the utilization of wood waste generated by small sawmills

International Nuclear Information System (INIS)

1992-01-01

Analysis of the amounts and types of wood residue from the British Columbia sawmill and logging industry shows that only ca 50% of the residue is being utilized. On a large scale, increased utilization will mainly be achieved through use for the generation of energy. For small sawmills, a more innovative approach to the problem is needed. To assist in developing the innovative markets and uses for wood residues from the small mills, a series of in-depth interviews was conducted with sawmill operators, resource agencies, and users of wood residue throughout British Columbia. The user markets include other sawmills; pulp, paper, and particleboard plants; energy applications; and agriculture. The results of the interviews are tabulated and analyzed to demonstrate the broad spectrum of wood residue uses currently available as well as those that are emerging. For many small sawmill operations in remote areas, utilization of residues is not economical. As environmental regulations become more stringent, the cost and difficulty of handling or disposing residue will increase, and utilization (even if not economical) will become a valid option compared to disposal. A number of emerging markets for wood residue are noted, many of which are in the agricultural field. Other products which can be made out of wood residues are hog fuel and fuel pellets or briquettes. Small sawmills will not have the residue volumes or funds to establish a briquette plant, but they have expressed interest in supplying residue to any such plant that can be established in their area. 16 refs., 5 figs., 3 tabs

Bacteria in decomposing wood and their interactions with wood-decay fungi.

Science.gov (United States)

Johnston, Sarah R; Boddy, Lynne; Weightman, Andrew J

2016-11-01

The fungal community within dead wood has received considerable study, but far less attention has been paid to bacteria in the same habitat. Bacteria have long been known to inhabit decomposing wood, but much remains underexplored about their identity and ecology. Bacteria within the dead wood environment must interact with wood-decay fungi, but again, very little is known about the form this takes; there are indications of both antagonistic and beneficial interactions within this fungal microbiome. Fungi are hypothesised to play an important role in shaping bacterial communities in wood, and conversely, bacteria may affect wood-decay fungi in a variety of ways. This minireview considers what is currently known about bacteria in wood and their interactions with fungi, and proposes possible associations based on examples from other habitats. It aims to identify key knowledge gaps and pressing questions for future research. © FEMS 2016. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

Non_standard Wood

DEFF Research Database (Denmark)

Tamke, Martin

. Using parametric design tools and computer controlled production facilities Copenhagens Centre for IT and Architecture undertook a practice based research into performance based non-standard element design and mass customization techniques. In close cooperation with wood construction software......, but the integration of traditional wood craft techniques. The extensive use of self adjusting, load bearing wood-wood joints contributed to ease in production and assembly of a performance based architecture....

Thermal Properties of Wood-Plastic Composites Prepared from Hemicellulose-extracted Wood Flour

Directory of Open Access Journals (Sweden)

A.A. Enayati

2013-01-01

Full Text Available Hemicellulose of Southern Yellow Pine wood spices was extracted by pressurized hot water at three different temperatures: 140°C, 155°C and 170°C. Compounding with PP (polypropylene was performed by extrusion after preparing wood flour and sieving to determine its mesh size. The ratio of wood to polymer was 50:50 based on oven-dry weight of wood flour. All extraction treatments and control samples were compounded under two sets of conditions, without and with 2% MAPP as coupling agent. Injection molding was used to make tensile test samples (dogbone from the pellets made by extrusion. Thermal properties of wood-plastic composites were studied by TGA and DSC while the thermal stability of pretreated wood flours, PP and MAPP were studied by TGA as well. The greater weight loss of wood materials was an indication that higher treatment temperature increases the extractability of hemicellulose. The removal of hemicellulose by extraction improves thermal stability of wood flour, especially for extraction at 170°C. Wood-plastic composites made from extracted fibers at 170°C showed the highest thermal stability. Coupling agent did not have a significant effect on thermal stability but it improved the degree of crystallinity of the composites.Surface roughness of wood fiber increased after treatment. Extraction of hemicellulose increased the degree of crystallinity but it was not significant except for samples from treated wood flour at 170°C and with MAPP.

Hydride vapor phase epitaxy growth of GaN, InGaN, ScN, and ScAIN

NARCIS (Netherlands)

Bohnen, T.

2010-01-01

Chemical vapor deposition (CVD); hydride vapor phase epitaxy (HVPE); gallium nitride (GaN); indium gallium nitride (InGaN); scandium nitride (ScN); scandium aluminum nitride (ScAlN); semiconductors; thin films; nanowires; III nitrides; crystal growth - We studied the HVPE growth of different III

Breast cancer 1 (BrCa1 may be behind decreased lipogenesis in adipose tissue from obese subjects.

Directory of Open Access Journals (Sweden)

Francisco J Ortega

Full Text Available CONTEXT: Expression and activity of the main lipogenic enzymes is paradoxically decreased in obesity, but the mechanisms behind these findings are poorly known. Breast Cancer 1 (BrCa1 interacts with acetyl-CoA carboxylase (ACC reducing the rate of fatty acid biosynthesis. In this study, we aimed to evaluate BrCa1 in human adipose tissue according to obesity and insulin resistance, and in vitro cultured adipocytes. RESEARCH DESIGN AND METHODS: BrCa1 gene expression, total and phosphorylated (P- BrCa1, and ACC were analyzed in adipose tissue samples obtained from a total sample of 133 subjects. BrCa1 expression was also evaluated during in vitro differentiation of human adipocytes and 3T3-L1 cells. RESULTS: BrCa1 gene expression was significantly up-regulated in both omental (OM; 1.36-fold, p = 0.002 and subcutaneous (SC; 1.49-fold, p = 0.001 adipose tissue from obese subjects. In parallel with increased BrCa1 mRNA, P-ACC was also up-regulated in SC (p = 0.007 as well as in OM (p = 0.010 fat from obese subjects. Consistent with its role limiting fatty acid biosynthesis, both BrCa1 mRNA (3.5-fold, p<0.0001 and protein (1.2-fold, p = 0.001 were increased in pre-adipocytes, and decreased during in vitro adipogenesis, while P-ACC decreased during differentiation of human adipocytes (p = 0.005 allowing lipid biosynthesis. Interestingly, BrCa1 gene expression in mature adipocytes was restored by inflammatory stimuli (macrophage conditioned medium, whereas lipogenic genes significantly decreased. CONCLUSIONS: The specular findings of BrCa1 and lipogenic enzymes in adipose tissue and adipocytes reported here suggest that BrCa1 might help to control fatty acid biosynthesis in adipocytes and adipose tissue from obese subjects.

Lignin-Retaining Transparent Wood.

Science.gov (United States)

Li, Yuanyuan; Fu, Qiliang; Rojas, Ramiro; Yan, Min; Lawoko, Martin; Berglund, Lars

2017-09-11

Optically transparent wood, combining optical and mechanical performance, is an emerging new material for light-transmitting structures in buildings with the aim of reducing energy consumption. One of the main obstacles for transparent wood fabrication is delignification, where around 30 wt % of wood tissue is removed to reduce light absorption and refractive index mismatch. This step is time consuming and not environmentally benign. Moreover, lignin removal weakens the wood structure, limiting the fabrication of large structures. A green and industrially feasible method has now been developed to prepare transparent wood. Up to 80 wt % of lignin is preserved, leading to a stronger wood template compared to the delignified alternative. After polymer infiltration, a high-lignin-content transparent wood with transmittance of 83 %, haze of 75 %, thermal conductivity of 0.23 W mK -1 , and work-tofracture of 1.2 MJ m -3 (a magnitude higher than glass) was obtained. This transparent wood preparation method is efficient and applicable to various wood species. The transparent wood obtained shows potential for application in energy-saving buildings. © 2017 The Authors. Published by Wiley-VCH Verlag GmbH & Co. KGaA.

Ultimate internal pressure capacity assessment of SC structure

International Nuclear Information System (INIS)

Park, Hyungkui; Choi, Inkil

2013-01-01

An SC structure applied to a containment building can be quite effective. However, an SC structure cannot be applied to a containment building, because its internal pressure resistance performance has not been verified. The containment building, which undergoes ultimate internal pressure, resists the internal pressure through a pre-stress tendon. It is hard to apply a tendon to an SC structure because of its structural characteristics. Therefore, the internal pressure resistance performance of the SC structure itself should be ensured to apply it to a structure with internal pressure resistance. In this study, the suitability of an SC structure as a substitution for the tendon of a pressure resistant structure was evaluated. A containment structure model was used in this study, because it was representative structures that resistance of ultimate internal pressure be required. In this study, a nonlinear analysis was performed to evaluate and compare the behaviors of tendon model and SC structure model. By comparing the internal pressure-displacement according to the structure type, the stability of SC structure model was assessed

Ab-initio studies of the Sc adsorption and the ScN thin film formation on the GaN(000-1)-(2 × 2) surface

International Nuclear Information System (INIS)

Guerrero-Sánchez, J.; Sánchez-Ochoa, F.; Cocoletzi, Gregorio H.; Rivas-Silva, J.F.; Takeuchi, Noboru

2013-01-01

First principles total energy calculations have been performed to investigate the initial stages of the Sc adsorption and ScN thin film formation on the GaN(000-1)-(2 × 2) surface. Studies are done within the periodic density functional theory as implemented in the PWscf code of the Quantum ESPRESSO package. The Sc adsorption at high symmetry sites results in the bridge site as the most stable structure. When a Sc monolayer is deposited above the surface the T4 site results as the most stable geometry. The Sc migration into the first Ga monolayer induces the Ga displaced ad-atom to be adsorbed at the T4-2 site. A ScN bilayer may be obtained under the Ga monolayer. Finally a ScN bilayer may be formed in the wurtzite phase above the surface. The formation energy plots show that in the moderate Ga-rich conditions we obtain the formation of a ScN bilayer under the gallium monolayer. However at N-rich conditions the formation of ScN bilayer above the surface is the most favorable structure. We report the density of states to explain the electronic structure of the most favorable geometries. - Highlights: • Studies of the initial stages in the formation of Sc and ScN structures on GaN • In the adsorption of Sc on the GaN the Br site is the most favorable geometry. • When a Sc replaces a Ga of the first monolayer the displaced Ga occupies a T4-2 site. • For Ga-rich conditions there is formation of ScN under the Ga monolayer. • In N-rich conditions there is formation of ScN in the wurtzite phase

Mechanics of Wood Machining

CERN Document Server

Csanády, Etele

2013-01-01

Wood is one of the most valuable materials for mankind, and since our earliest days wood materials have been widely used. Today we have modern woodworking machine and tools; however, the raw wood materials available are continuously declining. Therefore we are forced to use this precious material more economically, reducing waste wherever possible. This new textbook on the “Mechanics of Wood Machining” combines the quantitative, mathematical analysis of the mechanisms of wood processing with practical recommendations and solutions. Bringing together materials from many sources, the book contains new theoretical and experimental approaches and offers a clear and systematic overview of the theory of wood cutting, thermal loading in wood-cutting tools, dynamic behaviour of tool and work piece, optimum choice of operational parameters and energy consumption, the wear process of the tools, and the general regularities of wood surface roughness. Diagrams are provided for the quick estimation of various process ...

Soil-wood interactions

NARCIS (Netherlands)

Wal, van der Annemieke; klein Gunnewiek, Paulien; Boer, de Wietse

2017-01-01

Wood-inhabiting fungi may affect soil fungal communities directly underneath decaying wood via their exploratory hyphae. In addition, differences in wood leachates between decaying tree species may influence soil fungal communities. We determined the composition of fungi in 4-yr old decaying logs

Enhancement of blue upconversion luminescence in hexagonal NaYF{sub 4}:Yb,Tm by using K and Sc ions

Energy Technology Data Exchange (ETDEWEB)

Kale, Vishal, E-mail: vishal.kale@utu.fi; Soukka, Tero [University of Turku, Department of Biochemistry and Food Chemistry/Biotechnology (Finland); Hoelsae, Jorma; Lastusaari, Mika [University of Turku, Department of Chemistry (Finland)

2013-08-15

Hexagonal ({beta})-NaYF{sub 4} is recognized as one of the most efficient hosts for NIR to blue and green upconversion (UC). A new method to tune the blue UC emission in {beta}-NaYF{sub 4}:Yb,Tm nanocrystals through the possible substitution of the host material with different concentrations of K{sup +} and Sc{sup 3+} ions was investigated in detail. In this work, Na{sub 1-x}K{sub x}YF{sub 4}:Yb,Tm and NaY{sub 1-x}Sc{sub x}F{sub 4}:Yb,Tm nanocrystals were synthesized with varying Na:K and Y:Sc ratios. X-ray diffraction, transmission electron microscopy, and UC luminescence spectroscopy showed that size, morphology, and UC luminescence intensity were affected by the addition of K{sup +} and Sc{sup 3+} ions. Substituted ions disturbed the local symmetry and also resulted in changes in the crystal field. The distance between Yb{sup 3+} and Tm{sup 3+} was affected by different concentration of K{sup +} and Sc{sup 3+} ions, and those differences in the distance are responsible for tuning UC luminescence. This study revealed that when the concentration of K{sup +} and Sc{sup 3+} ions were nominally increased from 20 to 100 mol% during synthesis, hexagonal NaYF{sub 4} changed to structurally different KYF{sub 4} and Na{sub 3}ScF{sub 6} so that the solid solubility became difficult. We also demonstrate that the added K{sup +} does not enter into the NaYF{sub 4} lattice, but it still plays an important role by controlling the Na/R ratio. K{sup +} and Sc{sup 3+} ion concentration of 20 mol% during the synthesis was found to result in materials with size 30-35 nm, and shows ca. four times brighter UC emission than the previously reported lanthanide based nanocrystals. The enhancement in UC luminescence intensity makes upconversion nanophosphors versatile imaging tools for diagnosis.Graphical Abstract.

Wood energy-commercial applications

Science.gov (United States)

Kennel, R. P.

1978-01-01

Wood energy is being widely investigated in many areas of the country because of the many obvious benefits of wood fuel such as the low price per million Btus relative to coal, oil, and gas; the wide availability of noncommercial wood and the proven ability to harvest it; established technology which is reliable and free of pollution; renewable resources; better conservation for harvested land; and the potential for jobs creation. The Southeastern United States has a specific leadership role in wood energy based on its established forest products industry experience and the potential application of wood energy to other industries and institutions. Significant questions about the widespread usage of wood energy are being answered in demonstrations around the country as well as the Southeast in areas of wood storage and bulk handling; high capitalization costs for harvesting and combustion equipment; long term supply and demand contracts; and the economic feasibility of wood energy outside the forest products industry.

Who's Counting Dead Wood ?

OpenAIRE

Woodall, C. W.; Verkerk, H.; Rondeux, Jacques; Ståhl, G.

2009-01-01

Dead wood in forests is a critical component of biodiversity, carbon and nutrient cycles, stand structure, and fuel loadings. Until recently, very few countries have conducted systematic inventories of dead wood resources across their forest lands. This may be changing as an increasing number of countries implement dead wood inventories. A recent survey looks at the status and attributes of forest dead wood inventories in over 60 countries. About 13 percent of countries inventory dead wood gl...

Domestic Wood Burning in a Residential Area: PM2.5 Trace Elements and Black Smoke

International Nuclear Information System (INIS)

Molnar, P.; Gustafson, P.; Johannesson, S.; Barregaard, L.; Saellsten, G.; Boman, J.

2005-01-01

Indoor and outdoor levels of PM2.5 have been studied in a residential area in Hagfors, a small town in Sweden. The sampling took place during typical Swedish winter conditions with sub-zero temperatures and full snow cover between February 10th and Mars 6th, 2003. The area consists of single houses having different heating systems. Some of the houses are heated by burning wood; some use heat pumps while others use direct electrical heating. 13 houses burning wood in boilers or similar for heating and 10 houses heated by other means but situated in the same area were selected for this study. Only houses without tobacco smoke were selected since this is one of the major sources of indoor particles. The objectives of the study were to identify levels and differences in composition of aerosol particles outdoors and inside houses with boilers using wood as fuel and houses heated in other ways. For K, Ca, Mn, Zn and Rb significantly higher (p < 0.05) indoor concentration for wood burners were found. The elements most often referred to as markers for wood burning are K and Zn. In addition, Si, S, Cl, Br and Rb are also mentioned as markers (Hedberg et al., 2002, Moloi et al., 2003). Black smoke was linked to wood burning, although not fully significant (p-value 0.07), as seen in figure 1a. Within the wood-burning group, some houses have concentrations comparable to the concentrations in the houses where no wood is used, while the others have much higher concentrations. These houses also have higher concentrations of K compared to the other wood burners. The possible reasons are different types of wood burning appliances and their placement in the houses as well as possible leakage. Sulphur, although sometimes linked to wood burning, shows no relationship to wood burning in this study. In figure 1b it can be seen that the indoor concentrations of sulphur is clearly lower compared to outdoor concentrations and that the levels indoors do not differ between wood and non-wood

Occurrence patterns of dead wood and wood-dependent lichens in managed boreal forest landscapes

OpenAIRE

Svensson, Måns

2013-01-01

Dead wood is a key resource for biodiversity, on which thousands of forest organisms are dependent. Because of current forest management, there has been a large-scale change in dead wood amounts and qualities, and consequently, many wood-dependent species are threatened. The general aim of this thesis is to increase our understanding of habitat requirements and occurrence patterns of wood-dependent lichens in managed, boreal forest landscapes. We surveyed dead wood and wood-dependent lichens ...

Energy from wood - an overview

International Nuclear Information System (INIS)

Nussbaumer, T.

2000-01-01

The present publication is the introduction to a series of papers on fundamentals and applications of wood energy. It summarizes figures and data of the actual situation of fuel wood utilization in Switzerland and its potential for the future. Further, the advantages of bio-energy are discussed and the possibilities of funding for bio-energy in Switzerland are described. Wood contributes with 2.5% to the total energy demand in Switzerland nowadays. However, the utilization of wood energy can be more than doubled, which is one of the targets of the Swiss energy policy. The supply chains for the different types of fuel wood are described and specifications and prices of log wood, forestry wood chips and wood residues are presented. The main applications of wood energy are residential heating with manually operated wood boilers and stoves, on the one hand, and heat production with automatic wood furnaces in industry and communities, on the other hand. Automatic furnaces have been promoted in the past ten years and hence they contribute nowadays with more than 50% to the energy supply from wood with a further growing share. As an assistance for further information, a list of institutions and addresses in the field of wood energy in Switzerland is given in the paper. (author)

On the preparation of fire-wood splitting machines equipped with feeder devices

International Nuclear Information System (INIS)

Jaeaeskelaeinen, M.

1995-01-01

As part of the Bionergy research programme, the TTS Institute's Department of Forestry conducted a study on firewood splitting machines manufactured by Bilke Oy and Peurala Oy. The said machines are the first of their kind in Finland to be equipped with a feeder device. The Bilke unit is fed by a conveyor belt arrangement while the Peurala unit is equipped with a feeder roll. In addition, both machine types are equipped with a conveyor belt discharging device (e.g. for discharging split wood directly into a trailer). The Bilke unit can also be operated on extraction racks in the woods as the stems due to be split are fed into it from the side and the conveyor discharges the split wood rearwards into the trailer. The trailer can be hooked onto the splitting unit's draw-hook. At the landing, the Bilke unit was used to split a total of 14.2 m 3 and the Peurala unit 8.0 m 3 of approx. 3-metrelong stems averaging 9 cm in diameter. In addition to this, the Bilke unit was used to split ca. 17 m 3 of 3.5 metre-long stems with on average diameter of ca. 6 cm; the stems were in bunches alongside the extraction racks. The person operating the machines for the purposes of this study was a 27-year- old forest worker. The mean productivity achieved at the landing when using the Bilke unit was 7.7 m 3 while that of the Peurala unit was 5.8 m 3 per effective hour. When operated in the woods, the productivity achieved with the Bilke unit (excluding felling-cross cutting-delimbing-bunching and forest haulage work) was 2.8 m 3 /h. When applying a productivity of 1.7 m 3 for felling-cross cutting- delimbing-bunching work and 5.5. m 3 for forest haulage, the entire harvesting chain's productivity was 0.9 m 3 per effective hour

Energy Levels and Radiative Rates for Transitions in F-like Sc XIII and Ne-like Sc XII and Y XXX

Science.gov (United States)

Aggarwal, Kanti

2018-05-01

Energy levels, radiative rates and lifetimes are reported for F-like Sc~XIII and Ne-like Sc~XII and Y~XXX for which the general-purpose relativistic atomic structure package ({\\sc grasp}) has been adopted. For all three ions limited data exist in the literature but comparisons have been made wherever possible to assess the accuracy of the calculations. In the present work the lowest 102, 125 and 139 levels have been considered for the respective ions. Additionally, calculations have also been performed with the flexible atomic code ({\\sc fac}) to (particularly) confirm the accuracy of energy levels.

Wood preservative testing

Science.gov (United States)

Rebecca Ibach; Stan T. Lebow

2012-01-01

Most wood species used in commercial and residential construction have little natural biological durability and will suffer from biodeterioration when exposed to moisture. Historically, this problem has been overcome by treating wood for outdoor use with toxic wood preservatives. As societal acceptance of chemical use changes, there is continual pressure to develop and...

Radiation Protection Section (SC/SL/RP)

CERN Document Server

2006-01-01

We should like to inform you that the Radiation Protection Section (SC/SL/RP) located on the Prévessin site has moved from Building 865 (ground floor) to new premises in Wing A of Building 892 (second floor). Telephone numbers remain the same. SC/SL/RP section

Long-term leaching of nutrients and contaminants from wood combustion ashes

DEFF Research Database (Denmark)

Maresca, Alberto; Hyks, J.; Astrup, Thomas Fruergaard

2018-01-01

With increasing amounts of woody biomass being combusted for energy purposes worldwide, more wood ash is being generated and needs management. As an alternative to landfilling, residues may be utilised for liming and fertilising purposes on forest soils. Comprehensive evaluations of long-term lea......With increasing amounts of woody biomass being combusted for energy purposes worldwide, more wood ash is being generated and needs management. As an alternative to landfilling, residues may be utilised for liming and fertilising purposes on forest soils. Comprehensive evaluations of long......-term leaching from these residues are needed in order to assess potential environmental impacts associated with their utilisation. Two Danish wood ash samples, one fly ash and one mixed ash (a combination of fly ash and bottom ash), were evaluated in long-term percolation column tests (up to L/S ∼2000 L....../kg), in order to quantify the release of major, minor and trace metal(loid)s. While columns of three different lengths were used, the leaching of individual elements could be described as a function of the L/S ratio – irrespective of the column length. At L/S 1000 L/kg, the cumulative releases of K, S, Na, Ca...

Preparation of Stable Superhydrophobic Coatings on Wood Substrate Surfaces via Mussel-Inspired Polydopamine and Electroless Deposition Methods

Directory of Open Access Journals (Sweden)

Kaili Wang

2017-06-01

Full Text Available Mussel-inspired polydopamine (PDA chemistry and electroless deposition approaches were used to prepare stable superhydrophobic coatings on wood surfaces. The as-formed PDA coating on a wood surface exhibited a hierarchical micro/nano roughness structure, and functioned as an “adhesive layer” between the substrate and a metallic film by the metal chelating ability of the catechol moieties on PDA, allowing for the formation of a well-developed micro/nanostructure hierarchical roughness. Additionally, the coating acted as a stable bridge between the substrate and hydrophobic groups. The morphology and chemical components of the prepared superhydrophobic wood surfaces were characterized by scanning electron microscopy (SEM, Fourier transform infrared (FT-IR spectroscopy, and X-ray photoelectron spectroscopy (XPS. The PDA and octadecylamine (OA modified surface showed excellent superhydrophobicity with a water contact angle (CA of about 153° and a rolling angle (RA of about 9°. The CA further increased to about 157° and RA reduced to about 5° with the Cu metallization. The superhydrophobic material exhibited outstanding stability in harsh conditions including ultraviolet aging, ultrasonic washing, strong acid-base and organic solvent immersion, and high-temperature water boiling. The results suggested that the PDA/OA layers were good enough to confer robust, degradation-resistant superhydrophobicity on wood substrates. The Cu metallization was likely unnecessary to provide significant improvements in superhydrophobic property. However, due to the amazing adhesive capacity of PDA, the electroless deposition technique may allow for a wide range of potential applications in biomimetic materials.

Wood Dust

Science.gov (United States)

Learn about wood dust, which can raise the risk of cancers of the paranasal sinuses and nasal cavity. High amounts of wood dust are produced in sawmills, and in the furniture-making, cabinet-making, and carpentry industries.

Wood Smoke

Science.gov (United States)

Smoke is made up of a complex mixture of gases and fine, microscopic particles produced when wood and other organic matter burn. The biggest health threat from wood smoke comes from fine particles (also called particulate matter).

Utilization potential of wood clones of Eucalyptus urophylla in the production of wood-cement panels

Directory of Open Access Journals (Sweden)

Lourival Marin Mendes

2011-03-01

Full Text Available The objective of this study was to evaluate the potential of using clones of Eucalyptus urophylla in the production of wood-cement panels. The study used six clones of Eucalyptus urophylla with 8 years of age, from the Companhia Mineira de Metais, located in Paracatu - MG. For the formation of the panels it was used Portland cement CP V - ARI / Plus, possessing high initial resistance to mineral binder and calcium chloride (CaCl2 as accelerator for the cement curing. The panels were produced with the following parameters: dimensions of 49.5 x 49.5 x 1.5 cm, nominal density of 1.2 g/cm ³, relation wood: cement (1:2.5 and relation water: cement (1:1.5. The results can showed that: (1 for thickness swelling in two and twenty-four hours, only clones 19.28 and 58 attended the specifications, (2 for water absorption, clone 62 showed the best results, (3 to internal bond, only clone 58 didn`t attend specifications, (4 for the compression, clones 19.36 and 58 showed the best results, (5 for MOE and MOR, none of the clones presented values compatible to the bison process. It is suggested the continuation of this line of research, including the manipulation of variables of production, so that all properties be compatible to the minimum required standards.

Wood thermoplastic composites

Science.gov (United States)

Daniel F. Caulfield; Craig Clemons; Roger M. Rowell

2010-01-01

The wood industry can expand into new sustainable markets with the formation of a new class of composites with the marriage of the wood industry and the plastics industry. The wood component, usually a flour or fiber, is combined with a thermoplastic to form an extrudable, injectable or thermoformable composite that can be used in many non-structural applications....

How spectroscopy and microspectroscopy of degraded wood contribute to understand fungal wood decay.

Science.gov (United States)

Fackler, Karin; Schwanninger, Manfred

2012-11-01

Nuclear magnetic resonance, mid and near infrared, and ultra violet (UV) spectra of wood contain information on its chemistry and composition. When solid wood samples are analysed, information on the molecular structure of the lignocellulose complex of wood e.g. crystallinity of polysaccharides and the orientation of the polymers in wood cell walls can also be gained. UV and infrared spectroscopy allow also for spatially resolved spectroscopy, and state-of-the-art mapping and imaging systems have been able to provide local information on wood chemistry and structure at the level of wood cells (with IR) or cell wall layers (with UV). During the last decades, these methods have also proven useful to follow alterations of the composition, chemistry and physics of the substrate wood after fungi had grown on it as well as changes of the interactions between the wood polymers within the lignocellulose complex caused by decay fungi. This review provides an overview on how molecular spectroscopic methods could contribute to understand these degradation processes and were able to characterise and localise fungal wood decay in its various stages starting from the incipient and early ones even if the major share of research focussed on advanced decay. Practical issues such as requirements in terms of sample preparation and sample form and present examples of optimised data analysis will also be addressed to be able to detect and characterise the generally highly variable microbial degradation processes within their highly variable substrate wood.

Facile and scalable preparation of highly wear-resistance superhydrophobic surface on wood substrates using silica nanoparticles modified by VTES

Energy Technology Data Exchange (ETDEWEB)

Jia, Shanshan; Liu, Ming [College of Materials Science and Engineering, Central South University of Forestry and Technology, Changsha 410004 (China); Wu, Yiqiang, E-mail: wuyq0506@126.com [College of Materials Science and Engineering, Central South University of Forestry and Technology, Changsha 410004 (China); Hunan Provincial Collaborative Innovation Center for High-efficiency Utilization of Wood and Bamboo Resources, Central South University of Forestry and Technology, Changsha 410004 (China); Luo, Sha [College of Materials Science and Engineering, Central South University of Forestry and Technology, Changsha 410004 (China); Qing, Yan, E-mail: qingyan0429@163.com [College of Materials Science and Engineering, Central South University of Forestry and Technology, Changsha 410004 (China); Hunan Provincial Collaborative Innovation Center for High-efficiency Utilization of Wood and Bamboo Resources, Central South University of Forestry and Technology, Changsha 410004 (China); Chen, Haibo [College of Materials Science and Engineering, Central South University of Forestry and Technology, Changsha 410004 (China)

2016-11-15

Graphical abstract: Highly wear-resistance superhydrophobic surface on wood substrates was fabricated using silica nanoparticles modified by VTES. Display Omitted - Highlights: • Superhydrophobic surface on wood substrates was efficiently fabricated using nanoparticles modified by VTES. • The superhydrophobic surface exhibited a CA of 154° and a SAclose to 0°. • The superhydrophobic surface showed a durable and robust wear-resistance performance. - Abstract: In this study, an efficient, facile method has been developed for fabricating superhydrophobic surfaces on wood substrates using silica nanoparticles modified by VTES. The as-prepared superhydrophobic wood surface had a water contact angle of 154° and water slide angle close to 0°. Simultaneously, this superhydrophobic wood showed highly durable and robust wear resistance when having undergone a long period of sandpaper abrasion or being scratched by a knife. Even under extreme conditions of boiling water, the superhydrophobicity of the as-prepared wood composite was preserved. Characterizations by scanning electron microscopy, energy-dispersive X-ray spectroscopy, and Fourier transform infrared spectroscopy showed that a typical and tough hierarchical micro/nanostructure was created on the wood substrate and vinyltriethoxysilane contributed to preventing the agglomeration of silica nanoparticles and serving as low-surface-free-energy substances. This superhydrophobic wood was easy to fabricate, mechanically resistant and exhibited long-term stability. Therefore, it is considered to be of significant importance in the industrial production of functional wood, especially for outdoor applications.

MINERAL ELEMENTS IN WOODS OF EUCALYPTUS AND BLACK WATTLE AND ITS INFLUENCE IN A BLEACHED KRAFT PULP MILL

Directory of Open Access Journals (Sweden)

André Fredo

2009-09-01

Full Text Available Effluents are one of the most important problems in a pulp mill regarding to environmental subjects. With the purpose to reduce them, the mills are closing the internal cycles and reducing the water consumption. The wood, as the most significant source of non-process elements to the system, is responsible for some troubles to the industrial process. With the aim of evaluating their intake and to offer some informations for closing the loop, the contents of Al, Ca, Cu, Fe, K, Mg, Mn, Na, Ni, and Si were analysed in Acacia mearnsii, Eucalyptus dunnii, Eucalyptus globulus globulus, Eucalyptus grandis and Eucalyptus saligna woods. Wood samples were prepared by oven burning and acidic digestion methods, following analysis by ICP (inductively coupled plasm. Using also the results from silvicultural evaluation of trees and stands, they were calculated which elements were carried out from the site in larger amounts (K, Ca, Na, Al, Mn and Si and the species which exported largest amount of these elements (Eucalyptus dunnii and Eucalyptus globulus. The species with lower growth were Eucalyptus globulus and Eucalyptus dunnii, that leads to a bigger elements input and more potential industrial troubles. It was observed a range of 3.8 (Eucalyptus grandis up to 6 (Eucalyptus dunnii kg of analised mineral elements introduced to the process per ton of umbleached pulp produced. The Acacia mearnsii showed the lower level for Fe, Mn and Ni, being useful for oxygen, ozone and peroxide bleaching. The silicon observed in woods was in low concentration although the high values of this element in industrial liquor cycle. This leads to state that there is some contamination with soil when harvesting and handling the wood. Special care must be taken with both high ash and high mineral elements species, such as Eucalyptus dunnii and Eucalyptus globulus.

Spinning cylinder experiments SC-I and SC-II: A review of results and analyses provided to the FALSIRE project

International Nuclear Information System (INIS)

Morland, E.; Sherry, A.H.

1993-01-01

A series of six large-scale experiments have been carried out at AEA Technology using the Spinning Cylinder test facility. Results from two of those experiments (SC-I and SC-II) have been provided to Project FALSIRE and are reviewed in this paper. The Spinning Cylinder tests were carried out using hollow cylinders of 1.4m outer diameter, 0.2m wall thickness and 1.3m length, containing full-length axial defects and fabricated from a modified A508 Class 3 steel. The first Spinning Cylinder test (SC-I) was an investigation of stable ductile growth induced via mechanical (primary) loading and under conditions of contained yielding. Mechanical loading was provided in the hoop direction by rotating the cylinder about its major axis within an enclosed oven. The second test (SC-II) investigated stable ductile growth under severe thermal shock (secondary) loading again under conditions of contained yielding. In this case thermal shock was produced by spraying cold water on the inside surface of the heated cylinder whilst it was rotating. For each experiment, results are presented in terms of a number of variables, eg. crack growth, temperature, stress, strain and applied K and J. In addition, an overview of the analyses of the FALSIRE Phase-1 report is also presented with respect to test SC-I and SC-II. 4 refs., 14 figs., 13 tabs

Effective single chain antibody (scFv) concentrations in vivo via adenoviral vector mediated expression of secretory scFv

NARCIS (Netherlands)

Arafat, WO; Gomez-Navarro, J; Buchsbaum, DJ; Xiang, J; Casado, E; Barker, SD; Mahasreshti, PJ; Haisma, HJ; Barnes, MN; Siegal, GP; Alvarez, RD; Hemminki, A; Nettelbeck, DM; Curiel, DT

Single chain antibodies (scFv) represent powerful interventional agents for the achievement of targeted therapeutics. The practical utility of these agents have been limited, however, by difficulties related to production of recombinant scFv and the achievement of effective and sustained levels of

Hemoglobin C, S-C, and E Diseases

Science.gov (United States)

... quickly than others, resulting in chronic anemia. Hemoglobin C disease Hemoglobin C disease occurs mostly in blacks. ... a common complication of hemoglobin C disease. Hemoglobin S-C disease Hemoglobin S-C disease occurs in people who ...

Life cycle environmental impacts of different construction wood waste and wood packaging waste processing methods

OpenAIRE

Manninen, Kaisa; Judl, Jáchym; Myllymaa, Tuuli

2016-01-01

This study compared the life cycle environmental impacts of different wood waste processing methods in three impact categories: climate impact, acidification impacts and eutrophication impacts. The wood waste recovery methods examined were the use of wood waste in terrace boards made out of wood composite which replace impregnated terrace boards, incineration of wood waste in a multi-fuel boiler instead of peat and the use of wood waste in the production of particleboard in either Finland or ...

Mathematical Simulation of Temperature Profiles within Microwave Heated Wood Made for Wood-Based Nano composites

International Nuclear Information System (INIS)

Li, X.; He, X.; Lv, J.; Wu, Y.; Luo, Y.; Chen, H.

2013-01-01

High intensive microwave pretreatment is a new method to modify wood for the fabrication of wood-based nano composites. Based on the physical law on heat transfer, a mathematical model to describe the temperature profiles within wood heated by high intensive microwave was established and simulated in this research. The results showed that the temperature profiles within wood were related to microwave heating methods; The temperature inside wood firstly increased and then gradually decreased along the direction of microwave transmission when the unilateral microwave heating was applied, and the temperature difference along the thickness direction of wood was very significant; The temperature with wood firstly increased and then gradually decreased from the wood surface to interior when the bilateral microwave heating was applied. Compared with the unilateral microwave heating, bilateral microwave heating is a better microwave heating method for the more uniform wood microwave pretreatment.

Many Roles of Wood Adhesives

Science.gov (United States)

Charles R. Frihart

2014-01-01

Although wood bonding is one of the oldest applications of adhesives, going back to early recorded history (1), some aspects of wood bonds are still not fully understood. Most books in the general area of adhesives and adhesion do not cover wood bonding. However, a clearer understanding of wood bonding and wood adhesives can lead to improved products. This is important...

Urban Wood Waste Resource Assessment

Energy Technology Data Exchange (ETDEWEB)

Wiltsee, G.

1998-11-20

This study collected and analyzed data on urban wood waste resources in 30 randomly selected metropolitan areas in the United States. Three major categories wood wastes disposed with, or recovered from, the municipal solid waste stream; industrial wood wastes such as wood scraps and sawdust from pallet recycling, woodworking shops, and lumberyards; and wood in construction/demolition and land clearing debris.

Radioactivity of Wood and Environment

International Nuclear Information System (INIS)

Hus, M.; Kosutic, K.; Lulic, S.

2003-01-01

Nuclear experiments in the atmosphere and nuclear accidents caused global deposition of artificial radionuclides in the soil of Earth's northern hemisphere, the territory of the Republic of Croatia included. Soil contamination by radionuclides resulted in their deposition in plants growing on the contaminated soil as well as in the trees. Large area of the Republic of Croatia is covered with wood, which is exploited in manufacture of industrial wood and for firewood. From approximately 3 million cubic metres of wood exploited annually, nearly one third serves for firewood. In the process of burning a smaller portion of radionuclides deposited in the wood evaporates and goes to atmosphere while a larger portion is retained in the ash. In this paper are presented the results of natural radionuclides 4 0K , 2 32T h and 2 38U as well as of artificial radionuclide 1 37C s content determination in the wood, wood briquette, charcoal and in ash remained after burning the wood, wood briquette and charcoal. The obtained results are discussed from wood radiocontamination aspect and from the aspect of potential environmental radiocontamination by the products from wood burning process. (author)

Wood construction under cold climate

DEFF Research Database (Denmark)

Wang, Xiaodong; Hagman, Olle; Sundqvist, Bror

2014-01-01

As wood constructions increasingly use engineered wood products worldwide, concerns arise about the integrity of the wood and adhesives system. The glueline stability is a crucial issue for engineered wood application, especially under cold climate. In this study, Norway spruce (Picea abies...... affected shear strength of wood joints. As temperature decreased, the shear strength decreased. PUR resin resulted in the strongest shear strength at all temperatures tested. MF resin responded to temperature changes in a similar ways as the PUR resin. The shear strength of wood joints with EPI resins...... specimens need to be tested in further work to more completely present the issue. The EN 301 and EN 302 may need to be specified based on wood species....

European wood-fuel trade

International Nuclear Information System (INIS)

Hillring, B.; Vinterbaeck, J.

2001-01-01

This paper discusses research carried out during the l990s on European wood fuel trade at the Department of Forest Management and Products, SLU, in Sweden. Utilisation of wood-fuels and other biofuels increased very rapidly in some regions during that period. Biofuels are replacing fossil fuels which is an effective way to reduce the future influence of green house gases on the climate. The results indicate a rapid increase in wood-fuel trade in Europe from low levels and with a limited number of countries involved. The chief products traded are wood pellets, wood chips and recycled wood. The main trading countries are, for export, Germany and the Baltic states and, for import, Sweden, Denmark and to some extent the Netherlands. In the future, the increased use of biofuel in European countries is expected to intensify activity in this trade. (orig.)

Controversy. The wood war

International Nuclear Information System (INIS)

James, O.

2010-01-01

The author comments the conflict emerging in France between industries exploiting wood for construction and those exploiting it as a heating material for power generation. The first ones accuse the others to steal their raw material, to pull the prices up, and to destabilize the sector. This conflict takes place notably around sawmill wastes which are used either by wood panel fabricators or by wood pellets producers. Both sectors are claiming they are creating more jobs than the other. The French forest indeed offers good opportunities for both sectors, but other countries which are lacking forest surfaces, are buying wood in France. Several issues are matter of discussion: burning wood seems to go against the reduction of greenhouse gas emissions, subsidies awarded to big heater projects. The situation of the wood sector in Austria, Finland and Poland is briefly presented

Xylitol production by yeasts isolated from rotting wood in the Galápagos Islands, Ecuador, and description of Cyberlindnera galapagoensis f.a., sp. nov.

Science.gov (United States)

Guamán-Burneo, Maria C; Dussán, Kelly J; Cadete, Raquel M; Cheab, Monaliza A M; Portero, Patricia; Carvajal-Barriga, Enrique J; da Silva, Sílvio S; Rosa, Carlos A

2015-10-01

This study evaluated D-xylose-assimilating yeasts that are associated with rotting wood from the Galápagos Archipelago, Ecuador, for xylitol production from hemicellulose hydrolysates. A total of 140 yeast strains were isolated. Yeasts related to the clades Yamadazyma, Kazachstania, Kurtzmaniella, Lodderomyces, Metschnikowia and Saturnispora were predominant. In culture assays using sugarcane bagasse hemicellulose hydrolysate, Candida tropicalis CLQCA-24SC-125 showed the highest xylitol production, yield and productivity (27.1 g L(-1) xylitol, Y p/s (xyl) = 0.67 g g(-1), Qp = 0.38 g L(-1). A new species of Cyberlindnera, strain CLQCA-24SC-025, was responsible for the second highest xylitol production (24 g L(-1), Y p/s (xyl) = 0.64 g g(-1), Qp = 0.33 g L(-1) h(-1)) on sugarcane hydrolysate. The new xylitol-producing species Cyberlindnera galapagoensis f.a., sp. nov., is proposed to accommodate the strain CLQCA-24SC-025(T) (=UFMG-CM-Y517(T); CBS 13997(T)). The MycoBank number is MB 812171.

INCREASING OF THE EXPRESSION OF RECOMBINANT scFv-ANTIBODIES EFFICIENCY

Directory of Open Access Journals (Sweden)

O.V. Galkin

2017-10-01

Full Text Available Obtaining single-chain variable fragments (scFv of recombinant antibodies in E. coli cells is often associated with numerous problems causing low yields or inactive conformation of the product. The aim of this work was to study the influence of staphylococcal protein A fragment fused with scFv antibodies (SpA-tag on the efficiency of expression of final product. Examination of scFv antibodies of different origin and specificity has shown that in similar expression systems fused scFv is synthesized in much higher quantities than free scFv. Furthermore, the scFv antibodies in fused form retained their antigen-binding properties and the SpA fragment the ability to bind other immunoglobulins. Thus, the proposed strategy can be considered effective in improving the efficiency of scFv-antibodies production in E. coli cells.

Application of micro-PIXE, MRI and light microscopy for research in wood science and dendroecology

International Nuclear Information System (INIS)

Merela, M.; Pelicon, P.; Vavpetic, P.; Regvar, M.; Vogel-Mikus, K.; Sersa, I.; Policnik, H.; Pokorny, B.; Levanic, T.; Oven, P.

2009-01-01

Beech (Fagus sylvatica L.) branches were topped and after five months the wound response was analyzed by PIXE, 3D-MRI and light microscopy. From freshly cut and deeply frozen sample 30 μm thick longitudinal-radial tissue sections were prepared for anatomical investigations and micro-PIXE analysis. Light microscopy revealed the structural response to wounding, i.e. occurrence of the reaction zone between the exposed and dehydrated dead tissue and healthy sound wood. The reaction zone was characterized by tylosis in vessels and accumulation of colored deposits in parenchyma cells, fibres and vessels. 3D MRI of a parallel sample showed that the moisture content in the reaction zone was three times higher than in normal healthy wood. Micro-PIXE mapping at margins of compromised wood in beech revealed an increased concentration of potassium in the reaction zone. The increase in the calcium concentration was associated with the dehydrated tissue adjacent to reaction zones. In addition, micro-PIXE was used to determine the elemental distribution in annual tree rings. This may be relevant for retrospective assessment of environmental pollution in wood by measuring yearly increments as a biomonitoring tool. The analysis of European larch (Larix decidua Mill.) wood revealed a high similarity between optical characteristics (i.e. late versus earlywood) and elemental (e.g. Cl, K, Ca, Mn, Zn) distribution.

Manufacture of wood-pellets doubles. Biowatti Oy started a wood pellet plant in Turenki

International Nuclear Information System (INIS)

Rantanen, M.

1999-01-01

Wood pellets have many advantages compared to other fuels. It is longest processed biofuel with favorable energy content. It is simple to use, transport and store. Heating with wood pellets is cheaper than with light fuel oil, and approximately as cheap as utilization of heavy fuel oil, about 110 FIM/MWh. The taxable price of wood pellets is about 550 FIM/t. Stokers and American iron stoves are equally suitable for combustion of wood pellets. Chip fueled stokers are preferred in Finland, but they are also suitable for the combustion of wood pellets. Wood pellets is an environmentally friendly product, because it does not increase the CO 2 load in the atmosphere, and its sulfur and soot emissions are relatively small. The wood pelletizing plant of Biowatti Oy in Turenki was started in an old sugar mill. The Turenki sugar mill was chosen because the technology of the closed sugar factory was suitable for production of wood pellets nearly as such, and required only by slight modifications. A press, designed for briquetting of sugar beat clippings makes the pellets. The Turenki mill will double the volume of wood pellet manufacture in Finland during the next few years. At the start the annual wood pellet production will be 20 000 tons, but the environmental permit allows the production to be increased to 70 000 tons. At first the mill uses planing machine chips as a raw material in the production. It is the most suitable raw material, because it is already dry (moisture content 8-10%), and all it needs is milling and pelletizing. Another possible raw material is sawdust, which moisture content is higher than with planing machine chips. Most of the wood pellets produced are exported e.g. to Sweden, Denmark and Middle Europe. In Sweden there are over 10 000 single-family houses using wood pellets. Biowatti's largest customer is a power plant located in Stockholm, which combusts annually about 200 000 tons of wood pellets

Reliable and non-destructive positioning of larvae of wood-destroying beetles in wood

International Nuclear Information System (INIS)

Kerner, G.; Thiele, H.; Unger, W.

1980-01-01

Living larvae of wood-destroying insects (house longhorn beetle, deathwatch) can be determined in wood by both X-ray technique and vibration measurements. For such examinations convenient commercial devices were used and tested under laboratory conditions. The methods complement each other and lead to a rationalization of the tests of wood preservatives against wood-destroying insects. It seems to be promising to apply the test methods also to timber already used for building

Request for wood samples

NARCIS (Netherlands)

NN,

1977-01-01

In recent years the wood collection at the Rijksherbarium was greatly expanded following a renewed interest in wood anatomy as an aid for solving classification problems. Staff members of the Rijksherbarium added to the collection by taking interesting wood samples with them from their expeditions

Functional lignocellulosic material for the remediation of copper(II) ions from water: Towards the design of a wood filter.

Science.gov (United States)

Vitas, Selin; Keplinger, Tobias; Reichholf, Nico; Figi, Renato; Cabane, Etienne

2018-05-09

In this study, the chemical modification of bulk beech wood is described along with its utilization as biosorbent for the remediation of copper from water. The material was prepared by esterification using anhydrides, and reaction conditions were optimized to propose a greener process, in particular by reducing the amount of solvent. This modification yields a lignocellulosic material whose native structure is preserved, with an increased amount of carboxylic groups (up to 3 mmol/g). We demonstrate that the material can remove up to 95% of copper from low concentration solutions (100- 500 ppm). The adsorption efficiency decreases with concentrated copper solutions, and we show that a limited number of -COOH groups participate in copper binding (ca. 0.1 Cu/-COOH). This result suggests a limited accessibility of -COOH groups in the wood scaffold. This was demonstrated by the characterization of -COOH and copper distributions inside wood. Raman and EDX imaging confirmed that most -COOH groups are located inside the wood cell walls, thereby limiting interactions with copper. According to this study, critical limitations of bulk wood as a biosorbent were identified, and the results will be used to improve the material and design an efficient wood filter for heavy metal remediation. Copyright © 2018 Elsevier B.V. All rights reserved.

Wood fuel and the environment

International Nuclear Information System (INIS)

Foster, C.A.

1992-01-01

The purpose of this paper is to try and demonstrate the role that the use of Wood as a Fuel can play in our environment. The term ''Wood Fuel'', for the purposes of these proceedings, refers to the use of wood obtained from the forest or the farm. It does not refer to waste wood from for example buildings. The role of wood fuel in the environment can be assessed at many different levels. In this paper three different scales of ''Environment'' and the role of wood fuel in each, will be considered. These three scales are namely the global environment, the local environment, and the National (community) environment. (Author)

Altered Ca2+ homeostasis induces Calpain-Cathepsin axis activation in sporadic Creutzfeldt-Jakob disease.

Science.gov (United States)

Llorens, Franc; Thüne, Katrin; Sikorska, Beata; Schmitz, Matthias; Tahir, Waqas; Fernández-Borges, Natalia; Cramm, Maria; Gotzmann, Nadine; Carmona, Margarita; Streichenberger, Nathalie; Michel, Uwe; Zafar, Saima; Schuetz, Anna-Lena; Rajput, Ashish; Andréoletti, Olivier; Bonn, Stefan; Fischer, Andre; Liberski, Pawel P; Torres, Juan Maria; Ferrer, Isidre; Zerr, Inga

2017-04-27

Sporadic Creutzfeldt-Jakob disease (sCJD) is the most prevalent form of human prion disease and it is characterized by the presence of neuronal loss, spongiform degeneration, chronic inflammation and the accumulation of misfolded and pathogenic prion protein (PrP Sc ). The molecular mechanisms underlying these alterations are largely unknown, but the presence of intracellular neuronal calcium (Ca 2+ ) overload, a general feature in models of prion diseases, is suggested to play a key role in prion pathogenesis.Here we describe the presence of massive regulation of Ca 2+ responsive genes in sCJD brain tissue, accompanied by two Ca 2+ -dependent processes: endoplasmic reticulum stress and the activation of the cysteine proteases Calpains 1/2. Pathogenic Calpain proteins activation in sCJD is linked to the cleavage of their cellular substrates, impaired autophagy and lysosomal damage, which is partially reversed by Calpain inhibition in a cellular prion model. Additionally, Calpain 1 treatment enhances seeding activity of PrP Sc in a prion conversion assay. Neuronal lysosomal impairment caused by Calpain over activation leads to the release of the lysosomal protease Cathepsin S that in sCJD mainly localises in axons, although massive Cathepsin S overexpression is detected in microglial cells. Alterations in Ca 2+ homeostasis and activation of Calpain-Cathepsin axis already occur at pre-clinical stages of the disease as detected in a humanized sCJD mouse model.Altogether our work indicates that unbalanced Calpain-Cathepsin activation is a relevant contributor to the pathogenesis of sCJD at multiple molecular levels and a potential target for therapeutic intervention.

PET imaging of 64Cu-DOTA-scFv-anti-PSMA lipid nanoparticles (LNPs): Enhanced tumor targeting over anti-PSMA scFv or untargeted LNPs

International Nuclear Information System (INIS)

Wong, Patty; Li, Lin; Chea, Junie; Delgado, Melissa K.; Crow, Desiree; Poku, Erasmus; Szpikowska, Barbara; Bowles, Nicole; Channappa, Divya; Colcher, David; Wong, Jeffrey Y.C.; Shively, John E.; Yazaki, Paul J.

2017-01-01

Introduction: Single chain (scFv) antibodies are ideal targeting ligands due to their modular structure, high antigen specificity and affinity. These monovalent ligands display rapid tumor targeting but have limitations due to their fast urinary clearance. Methods: An anti-prostate membrane antigen (PSMA) scFv with a site-specific cysteine was expressed and evaluated in a prostate cancer xenograft model by Cu-64 PET imaging. To enhance tumor accumulation, the scFv-cys was conjugated to the co-polymer DSPE-PEG-maleimide that spontaneously assembled into a homogeneous multivalent lipid nanoparticle (LNP). Results: The targeted LNP exhibited a 2-fold increase in tumor uptake compared to the scFv alone using two different thiol ester chemistries. The anti-PSMA scFv-LNP exhibited a 1.6 fold increase in tumor targeting over the untargeted LNP. Conclusions: The targeted anti-PSMA scFv-LNP showed enhanced tumor accumulation over the scFv alone or the untargeted DOTA-micelle providing evidence for the development of this system for drug delivery. Advances in knowledge and implications for patient care: Anti-tumor scFv antibody fragments have not achieved their therapeutic potential due to their fast blood clearance. Conjugation to an LNP enables multivalency to the tumor antigen as well as increased molecular size for chemotherapy drug delivery.

A Further Study of the Products of Sc and Dioxygen Reactions

Science.gov (United States)

Bauschlicher, Charles W., Jr.; Zhou, Mingfei; Andrews, Lester; Johnson, J. R. Tobias; Panas, Itai; Snis, Anders; Roos, Bjoern O.; Arnold, James O. (Technical Monitor)

1999-01-01

The products of the reaction of Sc and dioxygen have been reinvestigated. By adding the electron-trapping molecule CC14, additional information about the IR spectra has been obtained, as well as the observation of new bands. New ab initio calculations are also performed on possible products of the Sc plus O2 reaction. The previously observed band at 722.5 per cm is assigned as the b2 mode of ScO2(-). Bands arising from ScO(+), Sc(O2)(+), and(O2)ScO are also assigned. We are still unable to assign any bands to OScO. The problems associated with the computational study of ScO2 are discussed.

Synthesis and Isolation of the Titanium-Scandium Endohedral Fullerenes-Sc2 TiC@Ih -C80 , Sc2 TiC@D5h -C80 and Sc2 TiC2 @Ih -C80 : Metal Size Tuning of the Ti(IV) /Ti(III) Redox Potentials.

Science.gov (United States)

Junghans, Katrin; Ghiassi, Kamran B; Samoylova, Nataliya A; Deng, Qingming; Rosenkranz, Marco; Olmstead, Marilyn M; Balch, Alan L; Popov, Alexey A

2016-09-05

The formation of endohedral metallofullerenes (EMFs) in an electric arc is reported for the mixed-metal Sc-Ti system utilizing methane as a reactive gas. Comparison of these results with those from the Sc/CH4 and Ti/CH4 systems as well as syntheses without methane revealed a strong mutual influence of all key components on the product distribution. Whereas a methane atmosphere alone suppresses the formation of empty cage fullerenes, the Ti/CH4 system forms mainly empty cage fullerenes. In contrast, the main fullerene products in the Sc/CH4 system are Sc4 C2 @C80 (the most abundant EMF from this synthesis), Sc3 C2 @C80 , isomers of Sc2 C2 @C82 , and the family Sc2 C2 n (2 n=74, 76, 82, 86, 90, etc.), as well as Sc3 CH@C80 . The Sc-Ti/CH4 system produces the mixed-metal Sc2 TiC@C2 n (2 n=68, 78, 80) and Sc2 TiC2 @C2 n (2 n=80) clusterfullerene families. The molecular structures of the new, transition-metal-containing endohedral fullerenes, Sc2 TiC@Ih -C80 , Sc2 TiC@D5h -C80 , and Sc2 TiC2 @Ih -C80 , were characterized by NMR spectroscopy. The structure of Sc2 TiC@Ih -C80 was also determined by single-crystal X-ray diffraction, which demonstrated the presence of a short Ti=C double bond. Both Sc2 TiC- and Sc2 TiC2 -containing clusterfullerenes have Ti-localized LUMOs. Encapsulation of the redox-active Ti ion inside the fullerene cage enables analysis of the cluster-cage strain in the endohedral fullerenes through electrochemical measurements. © 2016 The Authors. Published by Wiley-VCH Verlag GmbH & Co. KGaA.

Wood-plastic combination

International Nuclear Information System (INIS)

Schaudy, R.

1978-02-01

A review on wood-plastic combinations is given including the production (wood and plastic component, radiation hardening, curing), the obtained properties, present applications and prospects for the future of these materials. (author)

Energy Levels, wavelengths and hyperfine structure measurements of Sc II

Science.gov (United States)

Hala, Fnu; Nave, Gillian

2018-01-01

Lines of singly ionized Scandium (Sc II) along with other Iron group elements have been observed [1] in the region surrounding the massive star Eta Carinae [2,3] called the strontium filament (SrF). The last extensive analysis of Sc II was the four-decade old work of Johansson & Litzen [4], using low-resolution grating spectroscopy. To update and extend the Sc II spectra, we have made observation of Sc/Ar, Sc/Ne and Sc/Ge/Ar hollow cathode emission spectrum on the NIST high resolution FT700 UV/Vis and 2 m UV/Vis/IR Fourier transform spectrometers (FTS). More than 850 Sc II lines have been measured in the wavelength range of 187 nm to 3.2 μm. connecting a total of 152 energy levels. The present work also focuses to resolve hyperfine structure (HFS) in Sc II lines. We aim to obtain accurate transition wavelengths, improved energy levels and HFS constants of Sc II. The latest results from work in progress will be presented.Reference[1] Hartman H, Gull T, Johansson S and Smith N 2004 Astron. Astrophys. 419 215[2] Smith N, Morse J A and Gull T R 2004 Astrophys. J. 605 405[3] Davidson K and Humphreys R M 1997 Annu. Rev. Astron. Astrophys. 35[4] Johansson S and Litzén U 1980 Phys. Scr. 22 49

Economy of wood supply

International Nuclear Information System (INIS)

Imponen, V.

1993-01-01

Research and development of wood fuels production was vigorous in the beginning of the 1980's. Techniques and working methods used in combined harvesting and transportation of energy and merchantable wood were developed in addition to separate energy wood delivery. After a ten year silent period the research on this field was started again. At present the underutilization of forest supplies and the environmental effects of energy production based on fossil fuels caused the rebeginning of the research. One alternative for reduction of the price of wood fuels at the utilization site is the integration of energy and merchantable wood deliveries together. Hence the harvesting and transportation devices can be operated effectively, and the organizational costs are decreased as well. The wood delivery costs consist of the stumpage price, the harvesting and transportation costs, and of general expenses. The stumpage price form the largest cost category (over 50 %) of the industrial merchantable wood delivery, and the harvesting and transportation costs in the case of thinningwood delivery. Forest transportation is the largest part of the delivery costs of logging residues. The general expenses, consisting of the management costs and the interest costs of the capital bound to the storages, form a remarkable cost category in delivery of low-rank wood for energy or conversion purposes. The costs caused by the harvesting of thinningwood, the logging residues, chipping and crushing, the lorry transportation are reviewed in this presentation

An Analysis of the U.S. Wood Products Import Sector: Prospects for Tropical Wood Products Exporters

Directory of Open Access Journals (Sweden)

W.A.R.T.W. Bandara

2012-10-01

Full Text Available The U.S. has dramatically altered its wood product imports and exports during the past few years,and at present, it is the second largest wood product importer in the world. Hence, an understanding ofmarket structures, factors in selecting foreign suppliers, and the emphasis placed on environmentalissues/certification are critical to understand from the perspective of wood products importers in the U.S.This study provides an analysis of the U.S. wood products import sector with special emphasis on currentand future opportunities for tropical wood products exporters to the U.S. market.In this study, 158 wood products importers in the U.S. were surveyed using a mailingquestionnaire. The adjusted response rate was 40.6 percent. Results indicated that most of the respondentswere small to medium scale firms, but major importers of wood products. According to respondents,wood products to the U.S. mainly come from Brazil, Chile, and China. From the importers’ perspective,Brazilian wood products ranked first for its quality followed by wood products from Chile and Finland.Product quality, long term customer relationships, on-time delivery of orders, fair prices, and supplierreputation were the factors deemed important in selecting overseas suppliers. Majority of respondentswere importing certified wood products. FSC, SFI, and ISO 14000 were the mostly accepted certificationprograms. However, certification was not a major factor in foreign supplier selection criteria. Whenconsidered the U.S. wood products importers’ tendency to diversify their products and species imported,attractive opportunities exist for wood products suppliers from tropical countries.

Sc-Decorated WS_2 Nanoribbons as Hydrogen Storage Media

International Nuclear Information System (INIS)

Xu Bin; Wang Yu-Sheng; Zhang Jing; Song Na-Hong; Li Meng; Yi Lin

2016-01-01

The hydrogen storage behavior of Sc-decorated WS_2 monolayer and WS_2 nanoribbons is systematically studied by using first principles calculations based on the density functional theory. The present results indicate that an Sc-decorated WS_2 monolayer is not suitable for storing hydrogen due to the weak interaction between the monolayer WS_2 sheet and the Sc atoms. It is found that both the hybridization mechanism and the Coulomb attraction make the Sc atoms stably adsorb on the edges of WS_2 nanoribbons without clustering. The 2Sc/WS_2 NRs system can adsorb at most eight H_2 molecules with average adsorption energy of 0.20 eV/H_2. The results show that the desorption of H_2 is possible by lowering the pressure or by increasing the temperature. (paper)

Wood's lamp examination

Science.gov (United States)

... this page: //medlineplus.gov/ency/article/003386.htm Wood lamp examination To use the sharing features on this page, please enable JavaScript. A Wood lamp examination is a test that uses ultraviolet ( ...

Wood preservation

Science.gov (United States)

Rebecca E. Ibach

1999-01-01

When left untreated in many outdoor applications, wood becomes subject to degradation by a variety of natural causes. Although some trees possess naturally occurring resistance to decay (Ch. 3, Decay Resistance), many are in short supply or are not grown in ready proximity to markets. Because most commonly used wood species, such as Southern Pine, ponderosa pine, and...

CORRELATION BETWEEN SEED TESTS AND FIELD EMERGENCE OF TWO MAIZE HYBRIDS (SC704 AND SC500)

OpenAIRE

A.A. ALILOO; B. SHOKATI

2011-01-01

Early emergence and stand establishment of maize (Zea mays L.) are considered to be the most important yield-contributing factors. The influence of seed vigor on these factors is vital. Therefore, five laboratory tests and field experiment were conducted on basis of a randomized complete block design (RCBD) with five replications in 2011, to evaluate the correlation among the seed vigor tests and field emergence of two maize hybrids (SC704 and SC500). In laboratory tests, differences between ...

The use of new, aqueous chemical wood modifications to improve the durability of wood-plastic composites

Science.gov (United States)

Rebecca E. Ibach; Craig M. Clemons; George C. Chen

2017-01-01

The wood flour used in wood-plastic composites (WPCs) can biologically deteriorate and thus the overall mechanical performance of WPCs decrease when exposed to moisture and fungal decay. Protecting the wood flour by chemical modification can improve the durability of the wood in a nontoxic way so it is not harmful to the environment. WPCs were made with modified wood...

Moisture Transport in Wood

DEFF Research Database (Denmark)

Astrup, Thomas; Hansen, Kurt Kielsgaard; Hoffmeyer, Preben

2005-01-01

Modelling of moisture transport in wood is of great importance as most mechanical and physical properties of wood depend on moisture content. Moisture transport in porous materials is often described by Ficks second law, but several observations indicate that this does not apply very well to wood....... Recently at the Technical University of Denmark, Department of Civil Engineering, a new model for moisture transport in wood has been developed. The model divides the transport into two phases, namely water vapour in the cell lumens and bound water in the cell walls....

Depletion of Arabidopsis SC35 and SC35-like serine/arginine-rich proteins affects the transcription and splicing of a subset of genes.

Science.gov (United States)

Yan, Qingqing; Xia, Xi; Sun, Zhenfei; Fang, Yuda

2017-03-01

Serine/arginine-rich (SR) proteins are important splicing factors which play significant roles in spliceosome assembly and splicing regulation. However, little is known regarding their biological functions in plants. Here, we analyzed the phenotypes of mutants upon depleting different subfamilies of Arabidopsis SR proteins. We found that loss of the functions of SC35 and SC35-like (SCL) proteins cause pleiotropic changes in plant morphology and development, including serrated leaves, late flowering, shorter roots and abnormal silique phyllotaxy. Using RNA-seq, we found that SC35 and SCL proteins play roles in the pre-mRNA splicing. Motif analysis revealed that SC35 and SCL proteins preferentially bind to a specific RNA sequence containing the AGAAGA motif. In addition, the transcriptions of a subset of genes are affected by the deletion of SC35 and SCL proteins which interact with NRPB4, a specific subunit of RNA polymerase II. The splicing of FLOWERING LOCUS C (FLC) intron1 and transcription of FLC were significantly regulated by SC35 and SCL proteins to control Arabidopsis flowering. Therefore, our findings provide mechanistic insight into the functions of plant SC35 and SCL proteins in the regulation of splicing and transcription in a direct or indirect manner to maintain the proper expression of genes and development.

Inside the guts of wood-eating catfishes: can they digest wood?

Science.gov (United States)

German, Donovan P

2009-11-01

To better understand the structure and function of the gastrointestinal (GI) tracts of wood-eating catfishes, the gross morphology, length, and microvilli surface area (MVSA) of the intestines of wild-caught Panaque nocturnus, P. cf. nigrolineatus "Marañon", and Hypostomus pyrineusi were measured, and contrasted against these same metrics of a closely related detritivore, Pterygoplichthys disjunctivus. All four species had anatomically unspecialized intestines with no kinks, valves, or ceca of any kind. The wood-eating catfishes had body size-corrected intestinal lengths that were 35% shorter than the detritivore. The MVSA of all four species decreased distally in the intestine, indicating that nutrient absorption preferentially takes place in the proximal and mid-intestine, consistent with digestive enzyme activity and luminal carbohydrate profiles for these same species. Wild-caught Pt. disjunctivus, and P. nigrolineatus obtained via the aquarium trade, poorly digested wood cellulose (<33% digestibility) in laboratory feeding trials, lost weight when consuming wood, and passed stained wood through their digestive tracts in less than 4 h. Furthermore, no selective retention of small particles was observed in either species in any region of the gut. Collectively, these results corroborate digestive enzyme activity profiles and gastrointestinal fermentation levels in the fishes' GI tracts, suggesting that the wood-eating catfishes are not true xylivores such as beavers and termites, but rather, are detritivores like so many other fishes from the family Loricariidae.

LCA-based optimization of wood utilization under special consideration of a cascading use of wood.

Science.gov (United States)

Höglmeier, Karin; Steubing, Bernhard; Weber-Blaschke, Gabriele; Richter, Klaus

2015-04-01

Cascading, the use of the same unit of a resource in multiple successional applications, is considered as a viable means to improve the efficiency of resource utilization and to decrease environmental impacts. Wood, as a regrowing but nevertheless limited and increasingly in demand resource, can be used in cascades, thereby increasing the potential efficiency per unit of wood. This study aims to assess the influence of cascading wood utilization on optimizing the overall environmental impact of wood utilization. By combining a material flow model of existing wood applications - both for materials provision and energy production - with an algebraic optimization tool, the effects of the use of wood in cascades can be modelled and quantified based on life cycle impact assessment results for all production processes. To identify the most efficient wood allocation, the effects of a potential substitution of non-wood products were taken into account in a part of the model runs. The considered environmental indicators were global warming potential, particulate matter formation, land occupation and an aggregated single score indicator. We found that optimizing either the overall global warming potential or the value of the single score indicator of the system leads to a simultaneous relative decrease of all other considered environmental impacts. The relative differences between the impacts of the model run with and without the possibility of a cascading use of wood were 7% for global warming potential and the single score indicator, despite cascading only influencing a small part of the overall system, namely wood panel production. Cascading led to savings of up to 14% of the annual primary wood supply of the study area. We conclude that cascading can improve the overall performance of a wood utilization system. Copyright © 2015 Elsevier Ltd. All rights reserved.

DiSC-OPAL

DEFF Research Database (Denmark)

Kemal, Mohammed Seifu; Pedersen, Rasmus; Iov, Florin

2017-01-01

of such systems. The simulation tool should be able to model Electrical Grid and flexible assets with different time scales and resolution levels fulfilling specific functionalities. In this paper DiSC-OPAL, an OPAL-RT compatible toolbox library for modelling of assets is presented. The library is suitable...

New indides Sc{sub 6}Co{sub 2.18}In{sub 0.82}, Sc{sub 10}Ni{sub 9}In{sub 19.44} and ScCu{sub 4}In-synthesis, structure, and crystal chemistry

Energy Technology Data Exchange (ETDEWEB)

Zaremba, R.I.; Rodewald, U. Ch.; Poettgen, R. [Inst. fuer Anorganische und Analytische Chemie, Westfaelische Wilhelms-Univ. Muenster (Germany); Kalychak, Y.M.; Zaremba, V.I. [Inorganic Chemistry Dept., Ivan Franko National Univ. of Lviv, Lviv (Ukraine)

2006-08-15

New indides Sc{sub 6}Co{sub 2.18}In{sub 0.82}, Sc{sub 10}Ni{sub 9}In{sub 19.44} and ScCu{sub 4}In have been synthesized from the elements by arc-melting. Single crystals were grown by special annealing modes. The thee indides were investigated via X-ray powder and single crystal diffraction: Ho{sub 6}Co{sub 2}Ga type, Immm, a = 886.7(3), b = 878.0(2), c = 932.1(3) pm, wR2 = 0.0517, 711 F{sup 2} values, 35 variables for Sc{sub 6}Co{sub 2.18}In{sub 0.82}, Ho{sub 10}Ni{sub 9}In{sub 20} type, P4/nmm, a = 1287.5(2), c = 884.7(1) pm, wR2 = 0.0642, 1221 F{sup 2} values, 63 variables for Sc{sub 10}Ni{sub 9}In{sub 19.44}, and MgCu{sub 4}Sn type, anti F 43m, a = 704.03(7) pm, wR2 = 0.0267, 101 F{sup 2} values, and 7 variables for ScCu{sub 4}In. The scandium rich indide Sc{sub 6}Co{sub 2.18}In{sub 0.82} contains two Co{sub 2} dumb-bells at Co-Co distances of 221 and 230 pm. Each cobalt atom within these dumb-bells has a tricapped trigonal prismatic coordination. The In1 site has a distorted cube-like coordination by scandium and shows a mixed occupancy (36%) with cobalt. The In2 atoms have distorted icosahedral scandium coordination. As a consequence of the small size of the scandium atoms, the In4 site in Sc{sub 10}Ni{sub 9}In{sub 19.44} shows defects and was furthermore refined with a split model leading to a new distorted variant within the family of Ho{sub 10}Ni{sub 9}In{sub 20} compounds. ScCu{sub 4}In is an ordered version of the cubic Laves phase with scandium and indium atoms in the CN16 voids of the copper substructure. The Cu-Cu distances within the three-dimensional network of corner-sharing tetrahedra are 248.6 and 249.2 pm. The crystal chemical peculiarities of these three indide structures are briefly discussed. (orig.)

PET Imaging of 64Cu-DOTA-scFv-Anti-PSMA Lipid Nanoparticles (LNPs): Enhanced Tumor Targeting over Anti-PSMA scFv or Untargeted LNPs

Science.gov (United States)

Wong, Patty; Li, Lin; Chea, Junie; Delgado, Melissa K.; Crow, Desiree; Poku, Erasmus; Szpikowska, Barbara; Bowles, Nicole; Channappa, Divya; Colcher, David; Wong, Jeffrey Y.C.; Shively, John E.; Yazaki, Paul J.

2017-01-01

Introduction Single chain (scFv) antibodies are ideal targeting ligands due to their modular structure, high antigen specificity and affinity. These monovalent ligands display rapid tumor targeting but have limitations due to their fast urinary clearance. Methods An anti-prostate membrane antigen (PSMA) scFv with a site-specific cysteine was expressed and evaluated in a prostate cancer xenograft model by Cu-64 PET imaging. To enhance tumor accumulation, the scFv-cys was conjugated to the co-polymer DSPE-PEG-maleimide that spontaneously assembled into a homogeneous multivalent lipid nanoparticle (LNP). Results The targeted LNP exhibited a 2-fold increase in tumor uptake compared to the scFv alone using two different thiol ester chemistries. The anti-PSMA scFv-LNP exhibited a 1.6 fold increase in tumor targeting over the untargeted LNP. Conclusions The targeted anti-PSMA scFv-LNP showed enhanced tumor accumulation over the scFv alone or the untargeted DOTA-micelle providing evidence for the development of this system for drug delivery. Advances in Knowledge and implications for patient care Anti-tumor scFv antibody fragments have not achieved their therapeutic potential due to their fast blood clearance. Conjugation to a LNP enables multivalency to the tumor antigen as well as increased molecular size for chemotherapy drug delivery. PMID:28126683

Creation of Wood Dust during Wood Processing: Size Analysis, Dust Separation, and Occupational Health

Directory of Open Access Journals (Sweden)

Eva Mračková

2015-11-01

Full Text Available Mechanical separators and fabric filters are being used to remove airborne fine particles generated during the processing and handling of wood. Such particles might have a harmful effect on employee health, not only in small- but also in large-scale wood processing facilities. The amount of wood dust and its dispersion conditions vary according to geometric boundary conditions. Thus, the dispersion conditions could be changed by changing the linear size of the particles. Moreover, the smaller the particles are, the more harmful they can be. It is necessary to become familiar with properties, from a health point of view, of wood dust generated from processing. Wood dust has to be sucked away from the processing area. The fractional separation efficiency of wood dust can be improved using exhaust and filtering devices. Filtration efficiency depends on moisture content, particle size, and device performance. Because of the carcinogenicity of wood dust, the concentration of wood dust in air has to be monitored regularly. Based on the results hereof, a conclusion can be made that both mechanical separators of types SEA and SEB as well as the fabric filters with FINET PES 1 textile are suitable for the separation of wet saw dust from all types of wooden waste produced within the process.

Reactivity and burnout of wood fuels

DEFF Research Database (Denmark)

Dall'Ora, Michelangelo

This thesis deals with the combustion of wood in pulverised fuel power plants. In this type of boiler, the slowest step in the wood conversion process is char combustion, which is one of the factors that not only determine the degree of fuel burnout, but also affect the heat release profile...... of different aspects relevant to wood combustion, including wood structure and composition, wood pyrolysis, wood char properties and wood char oxidation. The full scale campaign, which is the subject of Chapter 3, included sampling of wood fuel before and after milling and sampling of gas and particles...... at the top of the combustion chamber. The collected samples and data are used to obtain an evaluation of the mills in operation at the power plant, the particle size distribution of the wood fuel, as well as the char conversion attained in the furnace. In Chapter 4 an experimental investigation...

Application of molecular genetic methods for identification of wood-decaying fungi in wood constructions

OpenAIRE

Elena Bobeková; Michal Tomšovský; Petr Horáček

2008-01-01

The aim of the paper is to evaluate the utilization of molecular biology methods for detection of wood decaying fungi directly from decomposed wood using a commercial DNA extraction kit developed for soil substrates (PowerSoil™ DNA isolation kit). The experiment based on dry rot fungus (Serpula lacrymans) detection from inoculated wooden pieces under laboratory conditions was followed by field detection of wood-decaying fungi from wood structures on building constructions. Fungal DNA was ide...

Molecular and functional characterization of peptidoglycan-recognition protein SC2 (PGRP-SC2) from Nile tilapia (Oreochromis niloticus) involved in the immune response to Streptococcus agalactiae.

Science.gov (United States)

Gan, Zhen; Chen, Shannan; Hou, Jing; Huo, Huijun; Zhang, Xiaolin; Ruan, Baiye; Laghari, Zubair Ahmed; Li, Li; Lu, Yishan; Nie, Pin

2016-07-01

PGRP-SC2, the member of PGRP family, plays an important role in regulation of innate immune response. In this paper, a PGRP-SC2 gene of Nile tilapia, Oreochromis niloticus (designated as On-PGRP-SC2) was cloned and its expression pattern under the infection of Streptococcus agalactiae was investigated. Sequence analysis showed main structural features required for amidase activity were detected in the deduced amino acid sequence of On-PGRP-SC2. In healthy tilapia, the On-PGRP-SC2 transcripts could be detected in all the examined tissues, with the most abundant expression in the muscle. When infected with S. agalactiae, there was a clear time-dependent expression pattern of On-PGRP-SC2 in the spleen, head kidney and brain. The assays for the amidase activity suggested that recombinant On-PGRP-SC2 protein had a Zn(2+)-dependent PGN-degrading activity. Moreover, our works showed that recombinant On-PGRP-SC2 protein could significantly reduce bacterial load in target organs attacked by S. agalactiae. These findings indicated that On-PGRP-SC2 may play important roles in the immune response to S. agalactiae in Nile tilapia. Copyright © 2016 Elsevier Ltd. All rights reserved.

Adhesive interactions with wood

Science.gov (United States)

Charles R. Frihart

2004-01-01

While the chemistry for the polymerization of wood adhesives has been studied systematically and extensively, the critical aspects of the interaction of adhesives with wood are less clearly understood. General theories of bond formation need to be modified to take into account the porosity of wood and the ability of chemicals to be absorbed into the cell wall....

Composite structure of wood cells in petrified wood

International Nuclear Information System (INIS)

Nowak, Jakub; Florek, Marek; Kwiatek, Wojciech; Lekki, Janusz; Chevallier, Pierre; Zieba, Emil; Mestres, Narcis; Dutkiewicz, E.M.; Kuczumow, Andrzej

2005-01-01

Special kinds of petrified wood of complex structure were investigated. All the samples were composed of at least two different inorganic substances. The original cell structure was preserved in each case. The remnants of the original biological material were detected in some locations, especially in the cell walls. The complex inorganic structure was superimposed on the remnant organic network. The first inorganic component was located in the lumena (l.) of the cells while another one in the walls (w.) of the cells. The investigated arrangements were as follows: calcite (l.)-goethite-hematite (w.)-wood from Dunarobba, Italy; pyrite (l.)-calcite (w.)-wood from Lukow, Poland; goethite (l.)-silica (w.)-wood from Kwaczala, Poland. The inorganic composition was analysed and spatially located by the use of three spectral methods: electron microprobe, X-ray synchrotron-based microprobe, μ-PIXE microprobe. The accurate mappings presenting 2D distribution of the chemical species were presented for each case. Trace elements were detected and correlated with the distribution of the main elements. In addition, the identification of phases was done by the use of μ-Raman and μ-XRD techniques for selected and representative points. The possible mechanisms of the described arrangements are considered. The potential synthesis of similar structures and their possible applications are suggested

Composite structure of wood cells in petrified wood

Energy Technology Data Exchange (ETDEWEB)

Nowak, Jakub [Department of Chemistry, Catholic University of Lublin, 20-718 Lublin (Poland); Florek, Marek [Department of Chemistry, Catholic University of Lublin, 20-718 Lublin (Poland); Kwiatek, Wojciech [Institute of Nuclear Physics, Department of Nuclear Spectroscopy, 31-342 Cracow (Poland); Lekki, Janusz [Institute of Nuclear Physics, Department of Nuclear Spectroscopy, 31-342 Cracow (Poland); Chevallier, Pierre [LPS, CEN Saclay et LURE, Universite Paris-Sud, Bat 209D, F-91405 Orsay (France); Zieba, Emil [Department of Chemistry, Catholic University of Lublin, 20-718 Lublin (Poland); Mestres, Narcis [Institut de Ciencia de Materials de Barcelona (ICMAB), Campus de la UAB, E-08193-Bellaterra (Spain); Dutkiewicz, E.M. [Institute of Nuclear Physics, Department of Nuclear Spectroscopy, 31-342 Cracow (Poland); Kuczumow, Andrzej [Department of Chemistry, Catholic University of Lublin, 20-718 Lublin (Poland)

2005-04-28

Special kinds of petrified wood of complex structure were investigated. All the samples were composed of at least two different inorganic substances. The original cell structure was preserved in each case. The remnants of the original biological material were detected in some locations, especially in the cell walls. The complex inorganic structure was superimposed on the remnant organic network. The first inorganic component was located in the lumena (l.) of the cells while another one in the walls (w.) of the cells. The investigated arrangements were as follows: calcite (l.)-goethite-hematite (w.)-wood from Dunarobba, Italy; pyrite (l.)-calcite (w.)-wood from Lukow, Poland; goethite (l.)-silica (w.)-wood from Kwaczala, Poland. The inorganic composition was analysed and spatially located by the use of three spectral methods: electron microprobe, X-ray synchrotron-based microprobe, {mu}-PIXE microprobe. The accurate mappings presenting 2D distribution of the chemical species were presented for each case. Trace elements were detected and correlated with the distribution of the main elements. In addition, the identification of phases was done by the use of {mu}-Raman and {mu}-XRD techniques for selected and representative points. The possible mechanisms of the described arrangements are considered. The potential synthesis of similar structures and their possible applications are suggested.

Sustainable wood waste management in Nigeria

Directory of Open Access Journals (Sweden)

Owoyemi Jacob Mayowa

2016-09-01

Full Text Available Wood industries produce large volumes of residues which must be utilized, marketed or properly disposed of. Heaps of wood residues are common features in wood industries throughout the year. In Nigeria, this residue is generally regarded as waste and this has led to open burning practices, dumping in water bodies or dumping in an open area which constitutes environmental pollution. Sawmills in Nigeria generated over 1,000,000 m3 of wood waste in 2010 while about 5000 m3 of waste was generated in plywood mills. Nigeria generates about 1.8 million tons of sawdust annually and 5.2 million tons of wood wastes. The impact of improper disposal of waste wood on the environment affects both the aquatic and terrestrial ecosystems. Also burning of waste wood releases greenhouse gases into the atmosphere causing various health issues. Reuse/recycling of these wood residues in Nigeria will reduce the pressure on our ever decreasing forests, reduce environmental pollution, create wealth and employment. The literature available on this subject was reviewed and this article, therefore, focuses on the various methods of wood waste disposal and its utilization in Nigerian wood industries, the effects of wood waste on the environment as well as on human health and the benefits of proper wood waste management practices.

Development of SC structure modularization in Nuclear Power Plant

International Nuclear Information System (INIS)

Mun, Taeyoup

2008-01-01

New Focus on NPP are Rising Concerns on Global Warming, Potential energy crisis (geo-political), Improved reliability and safety of nuclear power plant, Advent of Generation 3+ NPP technology and Economical Energy Resource. New NPPs are 6 units in Korea and 23 in Asia being built, 32 units being planned in China by 2020 (150 by 2050), 10 units being planned in US by 2020 and IAEA expects $200 billions on NPP construction next 25 years (up to 30% of total world energy). □ SC(Steel Plate Concrete) structure · Steel Plate is used as a Structural Element instead of Reinforcing Bars in RC · SC structure consists of Steel Plate with Headed Studs. Connected by Tie-bars - The Primary Purpose of Tie-bars is to Stiffen and Hold Together the Plates during Construction Process - Headed Studs are Welded to the Inside of Steel Plate for composite action □ Benefits of SC Structure · Shorten Construction Duration for Re bar, Forming and Scaffolding Works · Minimize Site Labors · Improve the Construction Quality · Enable Construction Sites to be kept Clean □ SC Modularization · Fit for Modular Construction for Structural Features · Fit for Modular Construction for Structural Features · Inattentively Effective for Integrated Modules · Pre-fabrication, Pre-assembly and Modularization □ Project Overview · Project Name: Development of SC structure for Modularization in NPP · Project Type: Electric Power Industry R and D (Ministry of Knowledge Economy) · Duration: Sep. 2005 ∼ Aug. 2008 (36 Months) · Research Team and Scopes - Project Management: Korea Hydro and Nuclear Power Company (KHNP) - Development of Code and Standards for SC Structure: Korea Society of Steel Construction (KSSC) Korea Electric Power Research Institute (KEPRI) - Development of SC Structural Analysis and Design: Korea Power Engineering Company (KOPEC) - Development of Construction Techniques for SC Modularization: KHNP, Korea Institute of Nuclear Safety(KINS), KOPEC □ Performance

Pascal-SC a computer language for scientific computation

CERN Document Server

Bohlender, Gerd; von Gudenberg, Jürgen Wolff; Rheinboldt, Werner; Siewiorek, Daniel

1987-01-01

Perspectives in Computing, Vol. 17: Pascal-SC: A Computer Language for Scientific Computation focuses on the application of Pascal-SC, a programming language developed as an extension of standard Pascal, in scientific computation. The publication first elaborates on the introduction to Pascal-SC, a review of standard Pascal, and real floating-point arithmetic. Discussions focus on optimal scalar product, standard functions, real expressions, program structure, simple extensions, real floating-point arithmetic, vector and matrix arithmetic, and dynamic arrays. The text then examines functions a

Structure and function of wood

Science.gov (United States)

Alex Wiedenhoeft

2010-01-01

Wood is a complex biological structure, a composite of many chemistries and cell types acting together to serve the needs of a living plant. Attempting to understand wood in the context of wood technology, we have often overlooked the key and basic fact that wood evolved over the course of millions of years to serve three main functions in plants― conduction of water...

Wood pellets : a worldwide fuel commodity

International Nuclear Information System (INIS)

Melin, S.

2005-01-01

Aspects of the wood pellet industry were discussed in this PowerPoint presentation. Details of wood pellets specifications were presented, and the wood pellet manufacturing process was outlined. An overview of research and development activities for wood pellets was presented, and issues concerning quality control were discussed. A chart of the effective calorific value of various fuels was provided. Data for wood pellet mill production in Canada, the United States and the European Union were provided, and various markets for Canadian wood pellets were evaluated. Residential sales as well as Canadian overseas exports were reviewed. Production revenues for British Columbia and Alberta were provided. Wood pellet heat and electricity production were discussed with reference to prefabricated boilers, stoves and fireplaces. Consumption rates, greenhouse gas (GHG) emissions, and fuel ratios for wood pellets and fossil fuels were compared. Price regulating policies for electricity and fossil fuels have prevented the domestic expansion of the wood pellet industry. There are currently no incentives for advanced biomass combustion to enter British Columbia markets, and this has led to the export of wood pellets. It was concluded that climate change mitigation policies will be a driving force behind market expansion for wood pellets. tabs., figs

Thermodynamic modeling of the Sc-Zn system coupled with first-principles calculation

Directory of Open Access Journals (Sweden)

Tang C.

2012-01-01

Full Text Available The Sc-Zn system has been critically reviewed and assessed by means of CALPHAD (CALculation of PHAse Diagram approach. By means of first-principles calculation, the enthalpies of formation at 0 K for the ScZn, ScZn2, Sc17Zn58, Sc3Zn17 and ScZn12 have been computed with the desire to assist thermodynamic modeling. A set of self-consistent thermodynamic parameters for the Sc-Zn system is then obtained. The calculated phase diagram and thermodynamic properties agree well with the experimental data and first-principles calculations, respectively.

Acoustic and adsorption properties of submerged wood

Science.gov (United States)

Hilde, Calvin Patrick

Wood is a common material for the manufacture of many products. Submerged wood, in particular, is used in niche markets, such as the creation of musical instruments. An initial study performed on submerged wood from Ootsa Lake, British Columbia, provided results that showed that the wood was not suitable for musical instruments. This thesis re-examined the submerged wood samples. After allowing the wood to age unabated in a laboratory setting, the wood was retested under the hypothesis that the physical acoustic characteristics would improve. It was shown, however, that the acoustic properties became less adequate after being left to sit. The adsorption properties of the submerged wood were examined to show that the submerged wood had a larger accessible area of wood than that of control wood samples. This implied a lower amount of crystalline area within the submerged wood. From the combined adsorption and acoustic data for the submerged wood, relationships between the moisture content and speed of sound were created and combined with previous research to create a proposed model to describe how the speed of sound varies with temperature, moisture content and the moisture content corresponding to complete hydration of sorption sites within the wood.

Urban Wood Waste Resource Assessment; TOPICAL

International Nuclear Information System (INIS)

Wiltsee, G.

1998-01-01

This study collected and analyzed data on urban wood waste resources in 30 randomly selected metropolitan areas in the United States. Three major categories wood wastes disposed with, or recovered from, the municipal solid waste stream; industrial wood wastes such as wood scraps and sawdust from pallet recycling, woodworking shops, and lumberyards; and wood in construction/demolition and land clearing debris

Moisture Performance of wood-plastic composites reinforced with extracted and delignified wood flour

Science.gov (United States)

Yao Chen; Nicole M. Stark; Mandla A. Tshabalala; Jianmin Gao; Yongming Fan

2014-01-01

This study investigated the effect of using extracted and delignified wood flour on water sorption properties of wood–plastic composites. Wood flour (WF) extraction was performed with three solvent systems: toluene/ethanol (TE), acetone/water (AW), and hot water (HW); delignification was conducted using sodium chlorite/acetic acid solution. A 24 full-factorial...

Survival, growth, wood basic density and wood biomass of seven ...

African Journals Online (AJOL)

A performance comparison of seven-year-old individuals of 13 Casuarina species/provenances in terms of survival, growth (diameter, height and volume), wood basic density and wood biomass was undertaken at Kongowe, Kibaha, Tanzania. The trial was laid out using a randomised complete block design with four ...

Chapter 9: Wood Energy

Science.gov (United States)

Francisco X. Aguilar; Karen Abt; Branko Glavonjic; Eugene Lopatin; Warren  Mabee

2016-01-01

The availabilty of information on wood energy continues to improve, particularly for commoditized woodfuels.  Wood energy consumption and production vary in the UNECE region because demand is strngly affected by weather and the prices of competing energy sources.  There has been an increase in wood energy in the power-and-heat sector in the EU28 and North American...

Iron Stain on Wood

Science.gov (United States)

Mark Knaebe

2013-01-01

Iron stain, an unsightly blue–black or gray discoloration, can occur on nearly all woods. Oak, redwood, cypress, and cedar are particularly prone to iron stain because these woods contain large amounts of tannin-like extractives. The discoloration is caused by a chemical reaction between extractives in the wood and iron in steel products, such as nails, screws, and...

On-line automatic detection of wood pellets in pneumatically conveyed wood dust flow

Science.gov (United States)

Sun, Duo; Yan, Yong; Carter, Robert M.; Gao, Lingjun; Qian, Xiangchen; Lu, Gang

2014-04-01

This paper presents a piezoelectric transducer based system for on-line automatic detection of wood pellets in wood dust flow in pneumatic conveying pipelines. The piezoelectric transducer senses non-intrusively the collisions between wood pellets and the pipe wall. Wavelet-based denoising is adopted to eliminate environmental noise and recover the collision events. Then the wood pellets are identified by sliding a time window through the denoised signal with a suitable threshold. Experiments were carried out on a laboratory test rig and on an industrial pneumatic conveying pipeline to assess the effectiveness and operability of the system.

Electronic structure and local distortions in epitaxial ScGaN films

International Nuclear Information System (INIS)

Knoll, S M; Zhang, S; Rovezzi, M; Joyce, T B; Moram, M A

2014-01-01

High energy resolution fluorescence-detected x-ray absorption spectroscopy and density functional theory calculations were used to investigate the local bonding and electronic structure of Sc in epitaxial wurtzite-structure Sc x Ga 1−x N films with x ≤ 0.059. Sc atoms are found to substitute for Ga atoms, accompanied by a local distortion involving an increase in the internal lattice parameter u around the Sc atoms. The local bonding and electronic structure at Sc are not affected strongly by the strain state or the defect microstructure of the films. These data are consistent with theoretical predictions regarding the electronic structure of dilute Sc x Ga 1−x N alloys. (paper)

State-of-the-art of the European regulation on wood wastes and wood ashes valorization. Synthesis

International Nuclear Information System (INIS)

Mousseau, S.

2007-01-01

This study has the objective of comparing the regulations of 10 European countries with that of France, in relation to the classification and recycling of wood waste, in particular lightly treated wood, as well as recycling of wood ash. The first part relating to wood waste presents a detailed analysis by country as well as a summary, on the one hand, of the various sectors for recycling waste wood and, on the other, the emission limits for their energy recovery. Generally, there is a distinction between waste covered by the incineration directive, and the others, without any particular category for lightly treated wood. However, recommendations emerge from this that are based essentially on the regulations or guidelines observed in Germany, Austria and the United Kingdom. The second part relating to wood ash also a presents a detailed analysis by country as well as a summary of the various sectors of recycling and limit values for spreading. Ash is generally considered as waste, and is recycled on a case-by case basis. Only Germany and Austria have clearly integrated wood ash in their regulatory framework. Overall this study shows the need for uniform regulation at European level, establishing environment requirements for recycling wood waste and wood ash, in order to encourage development of the use of biomass

Wood Flour Moulding Technology: Implications for Technical ...

African Journals Online (AJOL)

The intent of this article is to demonstrate how wood waste called sawdust or wood flour can be transformed by plastic moulding machine into items of economic value. Wood flour is wood reduced to very fine particle form. It can be waste product from saw mills, wood working plants or produced from selected dry wood by ...

Wood wastes: Uses

International Nuclear Information System (INIS)

Cipro, A.

1993-01-01

The 1,500 industrial firms manufacturing furniture in the Italian Province of Treviso can generate up to 190,000 tonnes of wood wastes annually. In line with the energy conservation-environmental protection measures contained in Italian Law No. 475/88, this paper indicates convenient uses for these wood wastes - as a raw material for fibreboards or as a fuel to be used in the furniture manufacturing plants themselves and in kilns producing lime. Reference is made to the wood wastes gasification/power generation system being developed by ENEA (the Italian Agency for New Technology, Energy and the Environment)

Fire Safety Design of Wood Structures

DEFF Research Database (Denmark)

Hertz, Kristian Dahl

2006-01-01

Lecture Notes on Fire Safety Design of Wood Structures including charring of wood and load bearing capacity of beams, columns, and connections.......Lecture Notes on Fire Safety Design of Wood Structures including charring of wood and load bearing capacity of beams, columns, and connections....

Effects of hydroxyurea treatment for patients with hemoglobin SC disease.

Science.gov (United States)

Luchtman-Jones, Lori; Pressel, Sara; Hilliard, Lee; Brown, R Clark; Smith, Mary G; Thompson, Alexis A; Lee, Margaret T; Rothman, Jennifer; Rogers, Zora R; Owen, William; Imran, Hamayun; Thornburg, Courtney; Kwiatkowski, Janet L; Aygun, Banu; Nelson, Stephen; Roberts, Carla; Gauger, Cynthia; Piccone, Connie; Kalfa, Theodosia; Alvarez, Ofelia; Hassell, Kathryn; Davis, Barry R; Ware, Russell E

2016-02-01

Although hemoglobin SC (HbSC) disease is usually considered less severe than sickle cell anemia (SCA), which includes HbSS and HbS/β(0) -thalassemia genotypes, many patients with HbSC experience severe disease complications, including vaso-occlusive pain, acute chest syndrome, avascular necrosis, retinopathy, and poor quality of life. Fully 20 years after the clinical and laboratory efficacy of hydroxyurea was proven in adult SCA patients, the safety and utility of hydroxyurea treatment for HbSC patients remain unclear. Recent NHLBI evidence-based guidelines highlight this as a critical knowledge gap, noting HbSC accounts for ∼30% of sickle cell patients within the United States. To date, only 5 publications have reported short-term, incomplete, or conflicting laboratory and clinical outcomes of hydroxyurea treatment in a total of 71 adults and children with HbSC. We now report on a cohort of 133 adult and pediatric HbSC patients who received hydroxyurea, typically for recurrent vaso-occlusive pain. Hydroxyurea treatment was associated with a stable hemoglobin concentration; increased fetal hemoglobin (HbF) and mean corpuscular volume (MCV); and reduced white blood cell count (WBC), absolute neutrophil count (ANC), and absolute reticulocyte count (ARC). Reversible cytopenias occurred in 22% of patients, primarily neutropenia and thrombocytopenia. Painful events were reduced with hydroxyurea, more in patients >15 years old. These multicenter data support the safety and potentially salutary effects of hydroxyurea treatment for HbSC disease; however, a multicenter, placebo-controlled, Phase 3 clinical trial is needed to determine if hydroxyurea therapy has efficacy for patients with HbSC disease. © 2015 Wiley Periodicals, Inc.

Design of SC walls and slabs for impulsive loading

Energy Technology Data Exchange (ETDEWEB)

Varma, Amit H. [Purdue Univ., West Lafayette, IN (United States)

2015-11-11

Reinforced concrete (RC) structures have historically been the preferred choice for blast resistant structures because of their mass and the ductility provided by steel reinforcement. Steel-plate composite (SC) walls are a viable alternative to RC for protecting the infrastructure against explosive threats. SC structures consist of two steel faceplates with a plain concrete core between them. The steel faceplates are anchored to the concrete using stud anchors and connected to each other using tie bars. SC structures provide mass from the concrete infill and ductility from the continuous external steel faceplates. This dissertation presents findings and recommendations from experimental and analytical investigations of the performance of SC walls subjected to far-field blast loads.

WOOD BIOMASS FOR ENERGY IN MONTENEGRO

Directory of Open Access Journals (Sweden)

Gradimir Danon

2010-01-01

Full Text Available Wood biomass has got its place in the energy balance of Montenegro. A little more than 6% of the total energy consumption is obtained by burning wood. Along with the appropriate state measures, it is economically and environmentally justified to expect Montenegro to more than double the utilization of the existing renewable energy sources including wood biomass, in the near future. For the purpose of achieving this goal, ‘Commercial Utilisation of the Wood Residue as a Resource for Economic Development in the North of Montenegro' project was carried out in 2007. The results of this project were included in the plan of the necessary interventions of the Government and its Agencies, associations or clusters, non-government organisations and interested enterprises. The plan was made on the basis of the wood residue at disposal and the attitude of individual subjects to produce and/or use solid bio-fuels and consists of a proposal of collection and utilisation of the wood residue for each individual district in the north of Montenegro. The basic factors of sustainability of future commercialisation of the wood residue were: availability of the wood raw material, and thereby the wood residue; the development of wood-based fuel markets, and the size of the profit.

How Technology Can Improve the Efficiency of Excavator-Based Cable Harvesting for Potential Biomass Extraction—A Woody Productivity Resource and Cost Analysis for Ireland

Directory of Open Access Journals (Sweden)

Ger Devlin

2014-12-01

Full Text Available Two cable logging systems were reviewed to compare the efficiency of potential biomass extraction from remote forest sites in Ireland based on productive machine hour (PMH and unit cost of operation (€/m3. Three operational scenarios (SC were analysed where SC I was a three man crew operation (choker setter, the carriage operator and unhooking chokers. SC II was a variation of this with a two man crew operation. SC III was operating radio controlled chokers there was a two man crew (choker setter and carriage operator. The study aims to assess how operations in Ireland perform against previous known cable studies to determine whether the cost of timber extraction on remote forest sites inaccessible for mechanised felling, has a future given the increased demand for wood fibre in Ireland, both from the sawmilling industries and the wood for energy sector. The volume per PMH was recorded at 17.97 for SC I, 15.09 for SC II and 20.58 m3 for SC III. The difference in productivity versus SC III remote controlled chokers is 5.49 m3/PMH for SC II crew and 2.61 m3/PMH for SC I. The decrease in total volume extracted from SCs I and II versus SC III was recorded at 15.69 m3 (15% and 32.97 m3 (36% product respectively. In value terms, the unit cost (€/m3 varied from 6.29 (SC I to 6.43 (SC II to 4.57 (SC III. When looking at the production unit costs of normal wood energy supply chains in Ireland, the figures are similar ranging from 3.17 €/m3 to 8.01 €/m3. The value of the end product of course will always determine which market the eventually goes to but given that cable log wood fibre has been unthinned and unmaintained then the biomass sector may be an ever increasing demand point in the search for increased woody biomass given that the unit costs can be competitive with other wood energy supply chains.

Corrosion of Fasteners in Wood Treated with Newer Wood Preservatives

Science.gov (United States)

Samuel L. Zelinka

2013-01-01

This document compiles recent research findings related to corrosion of metals in preservative treated wood into a single report on corrosion of metals in wood. The research was conducted as part of the Research, Technology and Education portion of the National Historic Covered Bridge Preservation (NHCBP) Program administered by the Federal Highway Administration. The...

LOCAL COLLISION SIMULATION OF AN SC WALL USING ENERGY ABSORBING STEEL

Directory of Open Access Journals (Sweden)

CHUL-HUN CHUNG

2013-08-01

Full Text Available This study evaluates the local damage of a turbine in an auxiliary building of a nuclear power plant due to an external impact by using the LS-DYNA finite element program. The wall of the auxiliary building is SC structure and the material of the SC wall plate is high manganese steel, which has superior ductility and energy absorbance compared to the ordinary steel used for other SC wall plates. The effects of the material of the wall, collision speed, and angle on the magnitude of the local damage were evaluated by local collision analysis. The analysis revealed that the SC wall made of manganese steel had significantly less damage than the SC wall made of ordinary steel. In conclusion, an SC wall made of manganese steel can have higher effective resistance than an SC wall made of ordinary steel against the local collision of an airplane engine or against a turbine impact.

Local Collision Simulation of an SC Wall Using Energy Absorbing Steel

Energy Technology Data Exchange (ETDEWEB)

Chung, Chulhun; Choi, Hyun; Park, Jaegyun [Dankook Univ., Yongin (Korea, Republic of)

2013-08-15

This study evaluates the local damage of a turbine in an auxiliary building of a nuclear power plant due to an external impact by using the LS-DYNA finite element program. The wall of the auxiliary building is SC structure and the material of the SC wall plate is high manganese steel, which has superior ductility and energy absorbance compared to the ordinary steel used for other SC wall plates. The effects of the material of the wall, collision speed, and angle on the magnitude of the local damage were evaluated by local collision analysis. The analysis revealed that the SC wall made of manganese steel had significantly less damage than the SC wall made of ordinary steel. In conclusion, an SC wall made of manganese steel can have higher effective resistance than an SC wall made of ordinary steel against the local collision of an airplane engine or against a turbine impact.

Power generation from waste wood

Energy Technology Data Exchange (ETDEWEB)

Nitsche, H

1980-04-18

Since the energy crisis, power generation from waste wood has become increasingly important. The most profitable way to use waste wood in woodworking plants with an annual production of 100 to 150,000 m/sup 3/ solid measure of wood chips and bark is by combustion and thermal energy recovery. In plants with an annual production of 10,000 m/sup 3/ solid measure of wood chips and bark, electric power generation is a suitable application.

Atomic bonding and mechanical properties of Al-Mg-Zr-Sc alloy

Institute of Scientific and Technical Information of China (English)

高英俊; 班冬梅; 韩永剑; 钟夏平; 刘慧

2004-01-01

The valence electron structures of Al-Mg alloy with minor Sc and Zr were calculated according to the empirical electron theory(EET) in solid. The results show that because of the strong interaction of Al atom with Zr and Sc atom in melting during solidification, the Al3 Sc and Al3 (Sc1-xZrx) particles which act as heterogeneous nuclear are firstly crystallized in alloy to make grains refine. In progress of solidification, the Al-Sc, Al-Zr-Sc segregation regions are formed in solid solution matrix of Al-Mg alloy owing to the strong interaction of Al atom with Zr, Scatoms in bulk of alloy, so in the following homogenization treatment, the finer dispersed Al3 Sc and Al3 (Sc1-x Zrx) second-particles which are coherence with the matrix are precipitated in the segregation region. These finer second particles with the strong Al-Zr, Al-Sc covalent bonds can strengthen the covalent bonds in matrix of the alloy, and also enhance the hardness and strength of Al-Mg alloy. Those finer second-particles precipitated in interface of sub-grains can also strengthen the covalence bonds there, and effectively hinder the interface of sub-grains from migrating and restrain the sub-grains from growing, and cause better thermal stability of Al-Mg alloy.

Conserving RPA and the response of 48Ca

International Nuclear Information System (INIS)

Brand, M.G.E.; Allaart, K.; Dickhoff, W.H.

1988-01-01

The connection between the single-particle self-energy and the corresponding conserving particle-hole (ph) interaction, discussed long ago by Kadanoff and Baym, is employed to study the response of 48 Ca. Second order self-energy contributions are taken into account in the construction of the energy dependent ph interaction. From this perspective it is possible to make contact with other approaches which also aim to incorporate the coupling to 2p2h excitations within the RPA framework. The method is used to study both the discrete low-energy states as well as the giant resonances in both 48 Ca and 48 Sc using a realistic G matrix interaction based on meson exchange. The calculated strength distribution compares favorably with experimental but the strength below 15 MeV is still somewhat too large as compared to experiment for all types of excitations. The quenching of magnetic and Gamow-Teller strength due to 2p2h admixture amounts to about 30%. (orig.)

Status of wood energy applications

International Nuclear Information System (INIS)

Zerbe, J.I.

1991-01-01

In this address, the potential of wood and wood residues to supply future energy needs is examined. In addition, the possible environmental impact of the use of wood fuels on global climate change is discussed. Technologies for the development of new fuels are described

Choosing Wood Burning Appliances

Science.gov (United States)

Information to assist consumers in choosing a wood burning appliance, including types of appliances, the differences between certified and non-certified appliances, and alternative wood heating options.

Bacterial Community Succession in Pine-Wood Decomposition.

Science.gov (United States)

Kielak, Anna M; Scheublin, Tanja R; Mendes, Lucas W; van Veen, Johannes A; Kuramae, Eiko E

2016-01-01

Though bacteria and fungi are common inhabitants of decaying wood, little is known about the relationship between bacterial and fungal community dynamics during natural wood decay. Based on previous studies involving inoculated wood blocks, strong fungal selection on bacteria abundance and community composition was expected to occur during natural wood decay. Here, we focused on bacterial and fungal community compositions in pine wood samples collected from dead trees in different stages of decomposition. We showed that bacterial communities undergo less drastic changes than fungal communities during wood decay. Furthermore, we found that bacterial community assembly was a stochastic process at initial stage of wood decay and became more deterministic in later stages, likely due to environmental factors. Moreover, composition of bacterial communities did not respond to the changes in the major fungal species present in the wood but rather to the stage of decay reflected by the wood density. We concluded that the shifts in the bacterial communities were a result of the changes in wood properties during decomposition and largely independent of the composition of the wood-decaying fungal communities.

Wood power in North Carolina

Energy Technology Data Exchange (ETDEWEB)

Cleland, J.G.; Guessous, L. [Research Triangle Institute, Research Triangle Park, NC (United States)

1993-12-31

North Carolina (NC) is one of the most forested states, and supports a major wood products industry. The NC Department of Natural Resources sponsored a study by Research Triangle Institute to examine new, productive uses of the State`s wood resources, especially electric power generation by co-firing with coal. This paper summarizes our research of the main factors influencing wood power generation opportunities, i.e., (1) electricity demand; (2) initiative and experience of developers; (3) available fuel resources; (4) incentives for alternate fuels; and (5) power plant technology and economics. The results cover NC forests, short rotation woody crops, existing wood energy facilities, electrical power requirements, and environmental regulations/incentives. Quantitative assessments are based on the interests of government agencies, utilities, electric cooperatives, developers and independent power producers, forest products industries, and the general public. Several specific, new opportunities for wood-to-electricity in the State are identified and described. Comparisons are made with nationwide resources and wood energy operations. Preferred approaches in NC are co-generation in existing or modified boilers and in dedicated wood power plants in forest industry regions. Co-firing is mainly an option for supplementing unreliable primary fuel supplies to existing boilers.

The Carbon Impacts of Wood Products

Science.gov (United States)

Richard Bergman; Maureen Puettmann; Adam Taylor; Kenneth E. Skog

2014-01-01

Wood products have many environmental advantages over nonwood alternatives. Documenting and publicizing these merits helps the future competitiveness of wood when climate change impacts are being considered. The manufacture of wood products requires less fossil fuel than nonwood alternative building materials such as concrete, metals, or plastics. By nature, wood is...

The influence of irradiated wood filler on some properties of polypropylene - wood composites

Directory of Open Access Journals (Sweden)

Điporović-Momčilović Milanka

2007-01-01

Full Text Available The problem of compatibility between the wood filler and thermoplastic matrix is of essential importance in composite production. Numerous methods have been developed for increasing this compatibility, which is still representing a challenging objective of composite research throughout the world. The research into these methods is primarily directed towards their efficiency from the viewpoint of the composite performance and their economical acceptability. The latter is of particular importance for the composite production in the developing countries with respect to the shortage of the corresponding funds. With this respect, the utilization of ionizing radiation might have considerable advantages. In this research, the beech wood flour was irradiated by a dose of 10 kGy of 60Co gamma rays for purpose of provoking the changes by the ionizing effect. The effects of ionizing radiation upon the properties of wood particles have been examined by IR spectroscopy and by determination of contents of hydroxyl groups in wood by acetylating as an indirect method. All these methods have been expected to reveal the chemical effects of the applied radiation treatment. The irradiated and the control wood flour were used in order to produce the samples of composite with polypropylene. The polypropylene-wood flour (PP-WF composites were produced with 40% of wood particles having fraction size 0.3 mm. The melt-blended composites were modified with amido-acrylic acid (AMACA as a new coupling agent synthesized for this propose in amount of 6 wt.% (based on wood filler and successively with 0.05 wt.% (based on PP of organic peroxide during mixing step. The composites containing coupling agents showed superior mechanical properties, compared to the untreated one. The highest extent of improvement of tensile was achieved in PP-WFl composites modified with AMACA coupling agent.

Methane from wood

Energy Technology Data Exchange (ETDEWEB)

Schulz, T. F.; Barreto, L.; Kypreos, S.; Stucki, S

2005-07-15

The role of wood-based energy technologies in the Swiss energy system in the long-term is examined using the energy-system Swiss MARKAL model. The Swiss MARKAL model is a 'bottom-up' energy-systems optimization model that allows a detailed representation of energy technologies. The model has been developed as a joint effort between the Energy Economics Group (EEG) at Paul Scherrer Institute PSI) and the University of Geneva and is currently used at PSI-EEG. Using the Swiss MARKAL model, this study examines the conditions under which wood-based energy technologies could play a role in the Swiss energy system, the most attractive pathways for their use and the policy measures that could support them. Given the involvement of PSI in the ECOGAS project, especial emphasis is put on the production of bio-SNG from wood via gasification and methanation of syngas and on hydrothermal gasification of woody biomass. Of specific interest as weIl is the fraction of fuel used in passenger cars that could be produced by locally harvested wood. The report is organized as follows: Section 2 presents a brief description of the MARKAL model. Section 3 describes the results of the base case scenario, which represents a plausible, 'middle-of-the-road' development of the Swiss energy system. Section 4 discusses results illustrating the conditions under which the wood-based methanation technology could become competitive in the Swiss energy market, the role of oil and gas prices, subsidies to methanation technologies and the introduction of a competing technology, namely the wood-based Fischer-Tropsch synthesis. FinaIly, section 5 outlines some conclusions from this analysis. (author)

Methane from wood

International Nuclear Information System (INIS)

Schulz, T. F.; Barreto, L.; Kypreos, S.; Stucki, S.

2005-07-01

The role of wood-based energy technologies in the Swiss energy system in the long-term is examined using the energy-system Swiss MARKAL model. The Swiss MARKAL model is a 'bottom-up' energy-systems optimization model that allows a detailed representation of energy technologies. The model has been developed as a joint effort between the Energy Economics Group (EEG) at Paul Scherrer Institute PSI) and the University of Geneva and is currently used at PSI-EEG. Using the Swiss MARKAL model, this study examines the conditions under which wood-based energy technologies could play a role in the Swiss energy system, the most attractive pathways for their use and the policy measures that could support them. Given the involvement of PSI in the ECOGAS project, especial emphasis is put on the production of bio-SNG from wood via gasification and methanation of syngas and on hydrothermal gasification of woody biomass. Of specific interest as weIl is the fraction of fuel used in passenger cars that could be produced by locally harvested wood. The report is organized as follows: Section 2 presents a brief description of the MARKAL model. Section 3 describes the results of the base case scenario, which represents a plausible, 'middle-of-the-road' development of the Swiss energy system. Section 4 discusses results illustrating the conditions under which the wood-based methanation technology could become competitive in the Swiss energy market, the role of oil and gas prices, subsidies to methanation technologies and the introduction of a competing technology, namely the wood-based Fischer-Tropsch synthesis. FinaIly, section 5 outlines some conclusions from this analysis. (author)

Temperature effects on wood anatomy, wood density, photosynthesis and biomass partitioning of Eucalyptus grandis seedlings.

Science.gov (United States)

Thomas, D S; Montagu, K D; Conroy, J P

2007-02-01

Wood density, a gross measure of wood mass relative to wood volume, is important in our understanding of stem volume growth, carbon sequestration and leaf water supply. Disproportionate changes in the ratio of wood mass to volume may occur at the level of the whole stem or the individual cell. In general, there is a positive relationship between temperature and wood density of eucalypts, although this relationship has broken down in recent years with wood density decreasing as global temperatures have risen. To determine the anatomical causes of the effects of temperature on wood density, Eucalyptus grandis W. Hill ex Maiden seedlings were grown in controlled-environment cabinets at constant temperatures from 10 to 35 degrees C. The 20% increase in wood density of E. grandis seedlings grown at the higher temperatures was variously related to a 40% reduction in lumen area of xylem vessels, a 10% reduction in the lumen area of fiber cells and a 10% increase in fiber cell wall thickness. The changes in cell wall characteristics could be considered analogous to changes in carbon supply. Lumen area of fiber cells declined because of reduced fiber cell expansion and increased fiber cell wall thickening. Fiber cell wall thickness was positively related to canopy CO2 assimilation rate (Ac), which increased 26-fold because of a 24-fold increase in leaf area and a doubling in leaf CO2 assimilation rate from minima at 10 and 35 degrees C to maxima at 25 and 30 degrees C. Increased Ac increased seedling volume, biomass and wood density; but increased wood density was also related to a shift in partitioning of seedling biomass from roots to stems as temperature increased.

Towards a better understanding of long-term wood-chemistry variations in old-growth forests: A case study on ancient Pinus uncinata trees from the Pyrenees.

Science.gov (United States)

Hevia, Andrea; Sánchez-Salguero, Raúl; Camarero, J Julio; Buras, Allan; Sangüesa-Barreda, Gabriel; Galván, J Diego; Gutiérrez, Emilia

2018-06-01

Dendrochemical studies in old forests are still underdeveloped. Old trees growing in remote high-elevation areas far from direct human influence constitute a promising biological proxy for the long-term reconstructions of environmental changes using tree-rings. Furthermore, centennial-long chronologies of multi-elemental chemistry at inter- and intra-annual resolution are scarce. Here, we use a novel non-destructive method by applying Micro X-ray fluorescence (μXRF) to wood samples of old Pinus uncinata trees from two Pyrenean high-elevation forests growing on acidic and basic soils. To disentangle ontogenetic (changes in tree age and diameter) from environmental influences (e.g., climate warming) we compared element patterns in sapwood (SW) and heartwood (HW) during the pre-industrial (1700-1849) and industrial (1850-2008) periods. We quantified tree-ring growth, wood density and relative element concentrations at annual (TRW, tree-ring) to seasonal resolution (EW, earlywood; LW, latewood) and related them to climate variables (temperature and precipitation) and volcanic eruptions in the 18th and 19th centuries. We detected differences for most studied elements between SW and HW along the stem and also between EW and LW within rings. Long-term positive and negative trends were observed for Ca and K, respectively. Cl, P and S showed positive trends during the industrial period. However, differences between sites were also notable. Higher values of Mg, Al, Si and the Ca/Mn ratio were observed at the site with acidic soil. Growing-season temperatures were positively related to growth, maximum wood density and to the concentration of most elements. Peaks in S, Fe, Cl, Zn and Ca were linked to major volcanic eruptions (e.g., Tambora in 1815). Our results reveal the potential of long-term wood-chemistry studies based on the μXRF non-destructive technique to reconstruct environmental changes. Copyright © 2017 Elsevier B.V. All rights reserved.

Microstructure evolution of the 1469 Al–Cu–Li–Sc alloy during homogenization

Energy Technology Data Exchange (ETDEWEB)

Jia, Min, E-mail: jm_lushan@163.com; Zheng, Ziqiao, E-mail: csu1469@163.com; Gong, Zhu, E-mail: start123gz@163.com

2014-11-25

Highlights: • The formation of the W phase (AlCuSc) was found in the 1469 Al-Cu–Li–Sc alloy. • The W phase formed during the homogenization process. • We model the formation process of the W phase. • The formation of the W phase consumes lots of Cu and Sc atoms. - Abstract: The present work aims to clarify the formation of the W phase (AlCuSc) and its formation time in the high Cu content alloy with Sc addition. The microstructure evolution during the two-step homogenization annealing process was investigated in the 1469 Al–Cu–Li–Sc alloy. No evidences of the Al{sub 3}Sc phase and the W phase were found in the solidification structure. The arrays of the W phases were found to form after homogenization. The AlCu phases with traces of Sc that formed during solidification suppose to be the precursor of the W phases, and then transform into the W phases by consuming the Sc atoms that fixed in the supersaturate solid solution. The formation of the W phase inhibits the precipitation of the Al{sub 3}Sc phase. A corresponding model of the W phase formation mechanism is proposed.

Dry etching of MgCaO gate dielectric and passivation layers on GaN

International Nuclear Information System (INIS)

Hlad, M.; Voss, L.; Gila, B.P.; Abernathy, C.R.; Pearton, S.J.; Ren, F.

2006-01-01

MgCaO films grown by rf plasma-assisted molecular beam epitaxy and capped with Sc 2 O 3 are promising candidates as surface passivation layers and gate dielectrics on GaN-based high electron mobility transistors (HEMTs) and metal-oxide semiconductor HEMTs (MOS-HEMTs), respectively. Two different plasma chemistries were examined for etching these thin films on GaN. Inductively coupled plasmas of CH 4 /H 2 /Ar produced etch rates only in the range 20-70 A/min, comparable to the Ar sputter rates under the same conditions. Similarly slow MgCaO etch rates (∼100 A/min) were obtained with Cl 2 /Ar discharges under the same conditions, but GaN showed rates almost an order of magnitude higher. The MgCaO removal rates are limited by the low volatilities of the respective etch products. The CH 4 /H 2 /Ar plasma chemistry produced a selectivity of around 2 for etching the MgCaO with respect to GaN

The central role of wood biology in understanding the durability of wood-coating interactions

Science.gov (United States)

Alex C. Wiedenhoeft

2007-01-01

To design effectively for durability, one must actively and honestly assess the material properties and limitations of each of the components in the design system; wood or wood composite, and the coating. Inasmuch as wood coatings are manufactured to specified tolerances from known materials, we have control of that component of the system. Compared to manmade...

Wood as a home heating fuel

International Nuclear Information System (INIS)

Wood, K.

1991-01-01

This article describes the development of clean-burning technology in three types of wood-burning appliances: catalytic, non-catalytic, and pellet stoves. A recent study by the Washington State Energy Extension Office concluded that in homes that use both electricity and wood, 73 megawatts of electricity/yr were saved by using wood. Since wood-burning stoves can now meet air quality standards, wood could be considered to be a greenhouse-neutral fuel if more trees are planted as they are consumed

Microbial Communities in Sunken Wood Are Structured by Wood-Boring Bivalves and Location in a Submarine Canyon

Science.gov (United States)

Fagervold, Sonja K.; Romano, Chiara; Kalenitchenko, Dimitri; Borowski, Christian; Nunes-Jorge, Amandine; Martin, Daniel; Galand, Pierre E.

2014-01-01

The cornerstones of sunken wood ecosystems are microorganisms involved in cellulose degradation. These can either be free-living microorganisms in the wood matrix or symbiotic bacteria associated with wood-boring bivalves such as emblematic species of Xylophaga, the most common deep-sea woodborer. Here we use experimentally submerged pine wood, placed in and outside the Mediterranean submarine Blanes Canyon, to compare the microbial communities on the wood, in fecal pellets of Xylophaga spp. and associated with the gills of these animals. Analyses based on tag pyrosequencing of the 16S rRNA bacterial gene showed that sunken wood contained three distinct microbial communities. Wood and pellet communities were different from each other suggesting that Xylophaga spp. create new microbial niches by excreting fecal pellets into their burrows. In turn, gills of Xylophaga spp. contain potential bacterial symbionts, as illustrated by the presence of sequences closely related to symbiotic bacteria found in other wood eating marine invertebrates. Finally, we found that sunken wood communities inside the canyon were different and more diverse than the ones outside the canyon. This finding extends to the microbial world the view that submarine canyons are sites of diverse marine life. PMID:24805961

Quasi-elastic transfer and charge-exchange reactions in collisions of 48Ti on 42Ca and 26Mg

International Nuclear Information System (INIS)

Brendel, C.

1985-01-01

At the GSI magnetic spectrometer quasi-elastic transfer and charge-exchange reactions of the system 48 Ti + 42 Ca at incident energies E lab = 240, 300, and 385 MeV and additionally at the higher projectile energy the system 48 Ti + 26 Mg were studied each in the excitation energy range up to E x ≅ 80 MeV. The transition strength was for each particle-hole configuration of the final system calculated by means of the DWBA and subsequently folded with a Breit-Wigner distribution. The localization of the strength of the cross section and the specific structure of the energy spectra were at incident energies between 6 and 8 MeV/amu for all angles well reproduced. By an extension of the core-excitation model to many-stage reactions the charge-exchange reaction 48 Ti + 42 Ca → 48 Sc + 42 Sc could be described as sequential two-stage process. In the two-neutron stripping reaction 48 Ti + 42 Ca → 46 Ti + 44 Ca a surprisingly narrow line with a width of the experimental resolution and an excitation energy of E x = 17.8 MeV was measured at angles smaller than the grazing angle. In the 48 Ti + 26 Mg system the corresponding 46 Ti spectra show also under forward angles structures at excitation energies between 8 and 16 MeV. These lines can be explained as two-neutron states with high spin. (orig./HSI) [de

Application of molecular genetic methods for identification of wood-decaying fungi in wood constructions

Directory of Open Access Journals (Sweden)

Elena Bobeková

2008-01-01

Full Text Available The aim of the paper is to evaluate the utilization of molecular biology methods for detection of wood decaying fungi directly from decomposed wood using a commercial DNA extraction kit developed for soil substrates (PowerSoil™ DNA isolation kit. The experiment based on dry rot fungus (Serpula lacrymans detection from inoculated wooden pieces under laboratory conditions was followed by field detection of wood-decaying fungi from wood structures on building constructions. Fungal DNA was identified using the PCR–based methods including species-specific PCR and sequencing of amplified ITS region of ribosomal DNA.

Development of SC structure modularization in Nuclear Power Plant

Energy Technology Data Exchange (ETDEWEB)

Mun, Taeyoup [Korea Hydro and Nuclear Power Co., Ltd., Seoul (Korea, Republic of)

2008-04-15

New Focus on NPP are Rising Concerns on Global Warming, Potential energy crisis (geo-political), Improved reliability and safety of nuclear power plant, Advent of Generation 3+ NPP technology and Economical Energy Resource. New NPPs are 6 units in Korea and 23 in Asia being built, 32 units being planned in China by 2020 (150 by 2050), 10 units being planned in US by 2020 and IAEA expects $200 billions on NPP construction next 25 years (up to 30% of total world energy). {open_square} SC(Steel Plate Concrete) structure {center_dot} Steel Plate is used as a Structural Element instead of Reinforcing Bars in RC {center_dot} SC structure consists of Steel Plate with Headed Studs. Connected by Tie-bars - The Primary Purpose of Tie-bars is to Stiffen and Hold Together the Plates during Construction Process - Headed Studs are Welded to the Inside of Steel Plate for composite action {open_square} Benefits of SC Structure {center_dot} Shorten Construction Duration for Re bar, Forming and Scaffolding Works {center_dot} Minimize Site Labors {center_dot} Improve the Construction Quality {center_dot} Enable Construction Sites to be kept Clean {open_square} SC Modularization {center_dot} Fit for Modular Construction for Structural Features {center_dot} Fit for Modular Construction for Structural Features {center_dot} Inattentively Effective for Integrated Modules {center_dot} Pre-fabrication, Pre-assembly and Modularization {open_square} Project Overview {center_dot} Project Name: Development of SC structure for Modularization in NPP {center_dot} Project Type: Electric Power Industry R and D (Ministry of Knowledge Economy) {center_dot} Duration: Sep. 2005 {approx} Aug. 2008 (36 Months) {center_dot} Research Team and Scopes - Project Management: Korea Hydro and Nuclear Power Company (KHNP) - Development of Code and Standards for SC Structure: Korea Society of Steel Construction (KSSC) Korea Electric Power Research Institute (KEPRI) - Development of SC Structural Analysis and Design

Analytical electron microscopy of combustion particles: a comparison of vehicle exhaust and residential wood smoke

International Nuclear Information System (INIS)

Kocbach, A.; Johansen, B.V.; Schwarze, P.E.; Namork, E.

2005-01-01

Particulate matter has been associated with a number of adverse health effects. Since combustion particles from vehicle exhaust and wood smoke are common constituents of ambient air, the morphology and elemental composition of particles from these two sources were analysed and compared using single particle analysis. Ambient air particles were collected in locations dominated by vehicle exhaust or residential wood smoke. To verify the source contributions to the ambient air samples, particles were collected directly from the combustion sources. All particulate samples were analysed on carbon extraction replica by transmission electron microscopy (TEM) and X-ray microanalysis (XRMA). The particles were classified into four groups based on morphology and elemental composition. Carbon aggregates were the only particles identified to originate from combustion sources and accounted for more than 88% of the particle numbers in the ambient air samples from both sources. The carbon aggregates were therefore further analysed with respect to morphology and elemental composition on germanium extraction replica. Carbon aggregates from vehicle exhaust were characterised by higher levels of Si and Ca compared to wood smoke aggregates that contained higher levels of K. The S content in aggregates from both sources was probably caused by interaction with gases in the air. Furthermore, the diameters of primary particles from vehicle exhaust were significantly smaller (27±7 nm) than the diameters for wood smoke (38±11 nm). The observed differences in elemental profiles and primary particle diameters for vehicle exhaust and wood smoke may influence the health effects caused by these particles

Wood plastic combination

International Nuclear Information System (INIS)

Cunanan, S.A.; Bonoan, L.S.; Verceluz, F.P.; Azucena, E.A.

1976-03-01

The purpose of this study is to improve the physical and mechaniproperties of local inferior quality wood species by radiation-induced graft polymerization with plastic monomers. The process involves the following: 1) Preparation of sample; 2) Impregnation of sample with the monomers; 3) Irradiation of the impregnated sample with the use of 20,000 curie Co-60 as gamma-source; 4) Drying of irradiated sample to remove the unpolymerized monomer. Experimentation on different wood species were undertaken and the results given. From the results obtained, it can be concluded that the monomers systems MMA, MMA-USP, and styrene-USP are suitable for graft polymerization with the wood species almon, apitong, bagtikan, mayapis, red lauan, and tanguile. This is shown by their maximum conversion value which range from 86% to 96% with the optimum dose range of 1 to 2 Mrads. However, in the application of WPC process, properties that are required in a given wood product must be considered, thus aid in the selection of the monomer system to be used with a particular wood species. Some promising applications of WPC is in the manufacture of picker sticks, shuttles, and bobbins for the textile industry. However, there is a need for a pilot plant scale study so that an economic assessment of the commercial feasibility of this process can be made

FLEXURAL TESTING OF WOOD-CONCRETE COMPOSITE BEAM MADE FROM KAMPER AND BANGKIRAI WOOD

Directory of Open Access Journals (Sweden)

Fengky Satria Yoresta

2015-07-01

Full Text Available Certain wood has a tensile strength that almost equal with steel rebar in reinforced concrete beams. This research aims to understand the capacity and flexural behavior of concrete beams reinforced by wood (wood-concrete composite beam. Two different types of beams based on placement positions of wood layers are proposed in this study. Two kinds of wood used are consisted of Bangkirai (Shorea laevifolia and Kamper (Cinnamomum camphora, meanwhile the concrete mix ratio for all beams is 1 cement : 2 fine aggregates : 3 coarse aggregates. Bending test is conducted by using one-point loading method. The results show that composite beam using Bangkirai wood is stronger than beams using Kamper wood. More thicker wood layer in tensile area will increase the flexural strength of beams. Crack patterns identified could be classified into flexural cracks, shear cracks, and split on wood layer   Beberapa jenis kayu tertentu memiliki kekuatan tarik yang hampir sama dengan tulangan baja pada balok beton bertulang. Penelitian ini bertujuan memahami kapasitas dan perilaku lentur balok beton bertulang yang diperkuat menggunakan kayu (balok komposit beton-kayu. Dua tipe balok yang berbeda berdasarkan posisi penempatan kayu digunakan dalam penelitian ini. Dua jenis kayu yang digunakan adalah kayu Bangkirai (Shorea laevifolia and Kamper (Cinnamomum camphora, sementara itu rasio campuran beton untuk semua balok menggunakan perbandingan 1 semen : 2 agregat halus : 3 agregat kasar. Pengujian lentur dilakukan menggunakan metode one-point loading. Hasil penelitian menunjukkan bahwa balok komposit dengan kayu Bangkirai lebih kuat dibandingkan balok dengan kayu Kamper. Semakin tebal lapisan kayu yang berada di daerah tarik akan meningkatkan kekuatan lentur balok. Pola kerusakan yang teridentifikasi dapat diklasifikasikan menjadi retak lentur, retak geser, dan pecah pada kayu REFERENCES Boen T. (2010. Retrofitting Simple Buildings Damaged by Earthquakes. World Seismic

Lightweight hydrogen-storage material Mg0.65Sc0.35D2 studied with 2H and 2H–{45Sc} MAS NMR exchange spectroscopy

NARCIS (Netherlands)

Srinivasan, S.; Magusin, P.C.M.M.

2011-01-01

Using double-quantum 2H MAS NMR with 45Sc recoupling and Bloch–Siegert compensated 2H–{45Sc} TRAPDOR we have identified the overlapping NMR signals of deuterium with and without scandium neighbors in Mg0.65Sc0.35D2, a candidate lightweight material for hydrogen storage. At room temperature we also

Role of cell death in the propagation of PrP(Sc) in immune cells.

Science.gov (United States)

Takahashi, Kenichi; Inoshima, Yasuo; Ishiguro, Naotaka

2015-03-01

A number of studies have suggested that macrophages, dendritic cells, and follicular dendritic cells play an important role in the propagation of PrP(Sc). Both accumulation and proteolysis of PrP(Sc) have been demonstrated in peripheral macrophages. Macrophages may act as reservoirs for PrP(Sc) particles if the cells die during transient PrP(Sc) propagation. However, whether cell death plays a role in PrP(Sc) propagation in macrophages remains unclear. In this study, we investigated the possibility of propagation and transmission of PrP(Sc) between dead immune cells and living neural cells. We found that under specific conditions, transient PrP(Sc) propagation occurs in dead cells, indicating that interaction between PrP(C) and PrP(Sc) on plasma membrane lipid rafts might be important for PrP(Sc) propagation. Co-culturing of killed donor PrP(Sc)-infected macrophages with recipient N2a-3 neuroblastoma cells accelerated PrP(Sc) transmission. Our results suggest that cell death may play an important role in PrP(Sc) propagation, whereas transient PrP(Sc) propagation in macrophages has little effect on PrP(Sc) transmission.

CERN Technical Training 2004: New Short Courses (SC) on Microsoft Outlook

CERN Multimedia

Monique Duval

2004-01-01

The CERN Technical Training programme is now proposing a new format for courses on Microsoft Outlook. Three two-hours Short Courses (SC) will cover basic and advanced functionalities of the recommended mail client for email at CERN. Each module can be followed independently. The next scheduled sessions will take place as follows: Outlook (SC I): E-mail. Next session: 22.10.2004 (9h00-11h00) Outlook (SC II): Calendar, Tasks and Notes. Next session: 22.10.2004 (14h00-16h00) Outlook (SC III): Meetings and Delegation. Next session: 9.11.2004 (14h00-16h00) In particular, SC I will cover how to open, create and send email, work with attachments, use stationery, organise mail, and work with the address book, SC II will show how to work with the calendar, tasks and notes, and SC III will cover how to organise and manage meetings, work with meeting requests, share tasks, and use email and calendar delegation. The number of participants to each session is limited to 8. The instructor is English-French bilingual, and...

The case for wood-fuelled heating

International Nuclear Information System (INIS)

Bent, Ewan

2001-01-01

This article looks at the wood heating industry in the UK and examines the heat market and the growth potential in the domestic, public, agricultural and commercial sectors. The current status of wood-fueled heating technology is considered, along with log and chip boilers, and the use of pellet fuel. The economics of wood-fuelled heating, the higher level of utilisation of wood-fuelled heating by utilities in northern European countries compared with the UK, and the barriers to the exploitation of wood fuelled heating are examined

Bacterial community succession in pine-wood decomposition

Directory of Open Access Journals (Sweden)

Anna eKielak

2016-03-01

Full Text Available Though bacteria and fungi are common inhabitants of decaying wood, little is known about the relationship between bacterial and fungal community dynamics during natural wood decay. Based on previous studies involving inoculated wood blocks, strong fungal selection on bacteria abundance and community composition was expected to occur during natural wood decay. Here we focused on bacterial and fungal community compositions in pine wood samples collected from dead trees in different stages of decomposition. We showed that bacterial communities undergo less drastic changes than fungal communities during wood decay. Furthermore, we found that bacterial community assembly was a stochastic process at initial stage of wood decay and became more deterministic in later stages, likely due to environmental factors. Moreover, composition of bacterial communities did not respond to the changes in the major fungal species present in the wood but rather to the stage of decay reflected by the wood density. We concluded that the shifts in the bacterial communities were a result of the changes in wood properties during decomposition and largely independent of the composition of the wood-decaying fungal communities.

Macrophotographic wood atlas of Annonaceae.

NARCIS (Netherlands)

Koek-Noorman, J.; Westra, L.I.T.

2012-01-01

In this article, a general description of the microscopic wood anatomy of Annonaceae is given. We provide a description of the wood anatomical features of the family and of all subfamilies and tribes, all from material in the Utrecht Wood collection. Hand-lens images can be an important help in

The challenge of bonding treated wood

Science.gov (United States)

Charles R. Frihart

2004-01-01

Wood products are quite durable if exposure to moisture is minimized; however, most uses of wood involve considerable exposure to moisture. To preserve the wood, chemicals are used to minimize moisture pickup, to prevent insect attack, and/or to resist microbial growth. The chemicals used as preservatives can interfere with adhesive bonds to wood. Given the many...

FIRE INSURANCE AND WOOD SCHOOL BUILDINGS.

Science.gov (United States)

PURCELL, FRANK X.

A COMPARISON OF FIRE INSURANCE COSTS OF WOOD, MASONRY, STEEL AND CONCRETE STRUCTURES SHOWS FIRE INSURANCE PREMIMUMS ON WOOD STRUCTURES TEND TO BE HIGHER THAN PREMIUMS ON MASONRY, STEEL AND CONCRETE BUILDINGS, HOWEVER, THE INITIAL COST OF THE WOOD BUILDINGS IS LOWER. DATA SHOW THAT THE SAVINGS ACHIEVED IN THE INITIAL COST OF WOOD STRUCTURES OFFSET…

Fireplace and woodstove fine particle emissions from combustion of western Mediterranean wood types

Science.gov (United States)

Alves, Célia; Gonçalves, Cátia; Fernandes, Ana Patrícia; Tarelho, Luís; Pio, Casimiro

2011-08-01

Wood from seven species of trees grown in the Portuguese forest ( Pinus pinaster, Eucalyptus globulus, Quercus suber, Acacia longifolia, Quercus faginea, Olea europea and Quercus ilex rotundifolia), and briquettes produced from forest biomass waste were burned in a fireplace and in a woodstove to determine the chemical composition of fine particle (PM 2.5) emissions. Samples were analysed for organic and elemental carbon (OC/EC), water soluble ions (Na +, NH 4+, K +, Mg 2+, Ca 2+, Cl -, NO 3- and SO 42-) and 67 elements. The PM 2.5 emission factors (g kg - 1 fuel burned, dry basis) were in the ranges 9.9-20.2 and 4.2-16.3, respectively, for the fireplace and the woodstove. Organic carbon contributed to about 50% of the fine particle mass in the emissions from every wood species studied in both burning appliances. The carbonaceous component of PM 2.5 was dominated by organic carbon, accounting for more than 85% of the total carbon (TC): OC/TC ranged from 0.85 to 0.96 (avg. 0.92) for the fireplace and from 0.86 to 0.97 (avg. 0.93) for the woodstove. The water-soluble ions accounted for 0.64 to 11.3% of the PM 2.5 mass emitted from the fireplace, whereas mass fractions between 0.53 and 13.6% were obtained for the woodstove. The golden wattle wood smoke showed a much higher ionic content than the emissions from the other wood types. Trace elements represented 0.4 to 2.5% and 0.2 to 2.2% of the PM 2.5 mass emitted, respectively, from the fireplace and the woodstove, which corresponded to average total emissions of 132 ± 77.3 mg kg - 1 and 93.4 ± 60.8 mg kg - 1 of wood burned. Among these, K, Pb, Al, Mn and Sr were present in all samples. From the emission profiles of the individual experiments, composite wood combustion profiles are suggested with the aid of a cluster analysis.

Emissions from fireplace and woodstove combustion of prevalent Portuguese woods

Science.gov (United States)

Alves, Célia

2010-05-01

P. Fernandes, C. Gonçalves, C.A. Alves, L. Tarelho, F. Mirante, T. Nunes and C. Pio Centre for Environmental and Marine Studies, Department of Environment, University of Aveiro, 3810-193 Aveiro, Portugal In Portugal, it was estimated that around 390000 ton/year of wood is burned in fireplaces, although the chemical characterisation of emission profiles has not yet been performed. Emission inventories and source apportionment, photochemistry and climate change models use values obtained for American or Alpine wood-fuels, uncommon in South Europe. Previous work has suggested that the species of wood used can have a huge influence on the particle emissions. Since the distribution of compounds emitted differs by species and burning conditions and there are many variations among published profiles, it is desirable to obtain specific data at a regional level on the chemical characterisation of wood smoke. A series of source tests was performed to compare the emission profiles from the woodstove combustion to those of fireplaces. Eight types of biomass were burned in the laboratory: seven species of wood grown in Portugal (Pinus pinaster, Eucalyptus globulus, Quercus suber, Acacia longifolia, Quercus faginea, Olea europea, Quercus ilex rotundifolia), and briquettes of biomass residues. The gas sampling was carried out in the exhaust ducts of both combustion systems. The collection of particles (PM2.5) was conducted in the dilution tunnel that was directly coupled to the chimney. Dilution sampling was used to characterise fine particle emissions from the combustion sources because it simulates the rapid cooling and dilution that occurs as exhaust mixes with the atmosphere. During each burning cycle, the concentrations of O2, CO2 and CO, as well as operational parameters (e.g. temperatures, flows, etc.), were automatically monitored. The PM2.5 samples were analysed by a thermal optical technique in order to obtain their organic carbon (OC) and elemental carbon (EC) content

Physical and mechanical properties of bio-composites from wood particles and liquefied wood resin

Science.gov (United States)

Hui Pan; Todd F. Shupe; Chung-Yun Hse

2009-01-01

Compression molded composites were made from wood particles and a liquefied wood/phenol/formaldehyde co-condensed resin. Based on our previous research, a phenol to wood (P/W) ratio of 2/1 was chosen for this study. The two experimental variables selected were: 1) liquefaction temperature (150o and 180oC) and 2) cooking method (atmospheric and sealed). Panels were...

Electrochemical Characterization of Ni/(Sc)YSZ Electrodes

DEFF Research Database (Denmark)

Ramos, Tania; Thydén, Karl Tor Sune; Mogensen, Mogens Bjerg

2010-01-01

Investigations of Ni/(Sc)YSZ cermets for solid oxide cells (SOCs) were performed by electrochemical impedance spectroscopy (EIS), under varying experimental conditions and upon redox cycling, using three different designs of symmetric cells. The deconvolution and fitting of the obtained impedance...... parameters. Initial degradation results for both Ni/ScYSZ and Ni/YSZ based anodes under very high steam content are also reported. ©2010 COPYRIGHT ECS - The Electrochemical Society...

One-Step Partially Purified Lipases (ScLipA and ScLipB from Schizophyllum commune UTARA1 Obtained via Solid State Fermentation and Their Applications

Directory of Open Access Journals (Sweden)

Yew Chee Kam

2017-12-01

Full Text Available Lipases with unique characteristics are of value in industrial applications, especially those targeting cost-effectiveness and less downstream processes. The aims of this research were to: (i optimize the fermentation parameters via solid state fermentation (SSF; and (ii study the performance in hydrolysis and esterification processes of the one-step partially purified Schizophyllum commune UTARA1 lipases. Lipase was produced by cultivating S. commune UTARA1 on sugarcane bagasse (SB with used cooking oil (UCO via SSF and its production was optimized using Design-Expert® 7.0.0. Fractions 30% (ScLipA and 70% (ScLipB which contained high lipase activity were obtained by stepwise (NH42SO4 precipitation. Crude fish oil, coconut oil and butter were used to investigate the lipase hydrolysis capabilities by a free glycerol assay. Results showed that ScLipA has affinities for long, medium and short chain triglycerides, as all the oils investigated were degraded, whereas ScLipB has affinities for long chain triglycerides as it only degrades crude fish oil. During esterification, ScLipA was able to synthesize trilaurin and triacetin. Conversely, ScLipB was specific towards the formation of 2-mono-olein and triacetin. From the results obtained, it was determined that ScLipA and ScLipB are sn-2 regioselective lipases. Hence, the one-step partial purification strategy proved to be feasible for partial purification of S. commune UTARA1 lipases that has potential use in industrial applications.

Ion backscattering and X-ray investigations of violin varnish and wood

International Nuclear Information System (INIS)

Sigurd, D.; Tove, P.A.; Petersson, S.

1980-01-01

The use of Rutherford backscattering (RBS) of ions (i.e. α-particles) and excitation of characteristic X-rays by protons, for determining the elemental composition of the top layers of violin varnish and wood is described. The amount of elements such as C, O, Si, S, Ca, Cu, Fe, Ni, Zn, Pb has been measured, on the varnished and unvarnished sides of wood samples from old instrument makers such as A. Stradivari, G. Guarneri del Gesu, Santo Serafin, C. Tononi etc. Differences in both the shape of the RBS spectra and in the presence of different elements are found and discussed. The use of X-ray excitation by ions (i.e. protons) helps in assessing the presence of the different elements. X-ray investigations can be done with instruments in air while RBS (at least in the presently used form) has to be performed in a vacuum chamber. Apart from offering an aid in determining the materials and procedures which were used in fabricating acoustically excellent instruments, the method could be of value for identifying their authenticity. (orig.)

Ion backscattering and x-ray investigations of violin varnish and wood

Science.gov (United States)

Arne Tove, Per; Sigurd, Dag; Petersson, Sture

1980-01-01

The use of Rutherford backscattering (RBS) of ions (i.e. α-particles) and excitation of characteristic X-rays by protons, for determining the elemental composition of the top layers of violin varnish and wood is described. The amount of elements such as C, O, Si, S, Ca, Cu, Fe, Ni, Zn, Pb has been measured, on the varnished and unvarnished sides of wood samples from old instrument makers such as A. Stradivari, G. Guarneri del Gesu, Santo Serafin, C. Tononi etc. Differences in both the shape of the RBS spectra and in the presence of different elements are found and discussed. The use of X-ray excitation by ions (i.e. protons) helps in assessing the presence of the different elements. X-ray investigations can be done with instruments in air while RBS (at least in the presently used form) has to be performed in a vacuum chamber. Apart from offering an aid in determining the materials and procedures which were used in fabricating acoustically excellent instruments, the method could be of value for identifying their authenticity.

The wood energy in France

International Nuclear Information System (INIS)

Douard, F.; Oremus, Y.; Garsault-Fabbi, A.

2007-01-01

The program law fixing the energy policy (POPE Law of the 13 july 2005) fixes an objective of 50% of growth for the renewable heat. As this renewable heat is today generated by the biomass, it seems necessary to adjust all the efforts on this sector. This document proposes to takes stock on the wood energy in France. It presents the wood fuels, an evaluation of the Wood-Energy Plan decided by the ADEME in 2000, the wood heat networks, and some example of installations. (A.L.B.)

Kampelite, Ba3Mg1.5Sc4(PO4)6(OH)3·4H2O, a new very complex Ba-Sc phosphate mineral from the Kovdor phoscorite-carbonatite complex (Kola Peninsula, Russia)

Science.gov (United States)

Yakovenchuk, Victor N.; Ivanyuk, Gregory Yu.; Pakhomovsky, Yakov A.; Panikorovskii, Taras L.; Britvin, Sergei N.; Krivovichev, Sergey V.; Shilovskikh, Vladimir V.; Bocharov, Vladimir N.

2018-02-01

Kampelite, Ba3Mg1.5Sc4(PO4)6(OH)3·4H2O, is a new Ba-Sc phosphate from the Kovdor phoscorite-carbonatite complex (Kola Peninsula, Russia). It is orthorhombic, Pnma, a = 11.256(1), b = 8.512(1), c = 27.707(4) Å, V = 2654.6(3) Å3 and Z = 4 (from powder diffraction data) or a = 11.2261(9), b = 8.5039(6), c = 27.699(2) Å, V = 2644.3(3) Å3 (from single-crystal diffraction data). The mineral was found in a void within the calcite-magnetite phoscorite (enriched in hydroxylapatite and Sc-rich baddeleyite) inside the axial zone of the Kovdor phoscorite-carbonatite pipe. Kampelite forms radiated aggregates (up to 1.5 mm in diameter) of platy crystals grown on the surfaces of crystals of quintinite-2 H in close association with pyrite, bobierrite and quintinite-3 R. Kampelite is colourless, with a pearly lustre and a white streak. The cleavage is perfect on {001}, the fracture is smooth. Mohs hardness is about 1. In transmitted light, the mineral is colourless without pleochroism or dispersion. Kampelite is biaxial + (pseudouniaxial), α ≈ β = 1.607(2), γ = 1.612(2) (589 nm), and 2 V calc = 0°. The calculated and measured densities are 3.28 and 3.07(3) g·cm-3, respectively. The mean chemical composition determined by electron microprobe is: MgO 4.79, Al2O3 0.45, P2O5 31.66, K2O 0.34, Sc2O3 16.17, Mn2O3 1.62, Fe2O3 1.38, SrO 3.44, and BaO 29.81 wt%. The H2O content estimated from the crystal-structure refinement is 7.12 wt%, giving a total of 96.51 wt%. The empirical formula calculated on the basis of P = 6 apfu (atoms per formula unit) is (Ba2.62Sr0.45K0.10Ca0.06)Σ3.23Mg1.60Mn0.28(Sc3.15Fe3+ 0.23Al0.12)Σ3.50(PO4)6(OH)2.61·4.01H2O. The simplified formula is Ba3Mg1.5Sc4(PO4)6(OH)3·4H2O. The mineral easily dissolves in 10% cold HCl. The strongest X-ray powder-diffraction lines [listed as d in Å ( I) ( hkl)] are as follows: 15.80(100)(001), 13.86(45)(002), 3.184(18)(223), 3.129(19)(026), 2.756(16)(402), 2.688(24)(10 10). The crystal structure of kampelite was

Baculovirus display of single chain antibody (scFv using a novel signal peptide

Directory of Open Access Journals (Sweden)

Gonzalez Gaëlle

2010-11-01

Full Text Available Abstract Background Cells permissive to virus can become refractory to viral replication upon intracellular expression of single chain fragment variable (scFv antibodies directed towards viral structural or regulatory proteins, or virus-coded enzymes. For example, an intrabody derived from MH-SVM33, a monoclonal antibody against a conserved C-terminal epitope of the HIV-1 matrix protein (MAp17, was found to exert an inhibitory effect on HIV-1 replication. Results Two versions of MH-SVM33-derived scFv were constructed in recombinant baculoviruses (BVs and expressed in BV-infected Sf9 cells, N-myristoylation-competent scFvG2/p17 and N-myristoylation-incompetent scFvE2/p17 protein, both carrying a C-terminal HA tag. ScFvG2/p17 expression resulted in an insoluble, membrane-associated protein, whereas scFvE2/p17 was recovered in both soluble and membrane-incorporated forms. When coexpressed with the HIV-1 Pr55Gag precursor, scFvG2/p17 and scFvE2/p17 did not show any detectable negative effect on virus-like particle (VLP assembly and egress, and both failed to be encapsidated in VLP. However, soluble scFvE2/p17 isolated from Sf9 cell lysates was capable of binding to its specific antigen, in the form of a synthetic p17 peptide or as Gag polyprotein-embedded epitope. Significant amounts of scFvE2/p17 were released in the extracellular medium of BV-infected cells in high-molecular weight, pelletable form. This particulate form corresponded to BV particles displaying scFvE2/p17 molecules, inserted into the BV envelope via the scFv N-terminal region. The BV-displayed scFvE2/p17 molecules were found to be immunologically functional, as they reacted with the C-terminal epitope of MAp17. Fusion of the N-terminal 18 amino acid residues from the scFvE2/p17 sequence (N18E2 to another scFv recognizing CD147 (scFv-M6-1B9 conferred the property of BV-display to the resulting chimeric scFv-N18E2/M6. Conclusion Expression of scFvE2/p17 in insect cells using a BV

IEC SC15E: Report on liaison activities of CIGRÉ-SC15

DEFF Research Database (Denmark)

Henriksen, Mogens

2000-01-01

WG’s activities under CIGRÉ SC15:WG 15.01 - Fluid impregnated systems.WG 15.02 - Dielectric Liquids.WG 15.03 - Gas Insulation.WG 15.04 - Outdoor Insulation.WG 15.05 - Capacitors.WG 15.07 - Solid Insulating Materials for Rotating Machines.WG 15/33.08 - Insulation Monitoring and Life Estimation. WG...

An assessment of management practices of wood and wood-related wastes in the urban environment

Energy Technology Data Exchange (ETDEWEB)

NONE

1996-02-01

The US Environmental Protection Agency estimates that yard waste{sup 1} accounts for approximately 16% of the municipal solid waste (MSW) stream (US EPA, 1994). Until recently, specific data and related information on this component of the (MSW) stream has been limited. The purposes of this study, phase two of the three-phase assessment of urban wood waste issues, are to assess and describe current alternatives to landfills for urban wood waste management; provide guidance on the management of urban wood waste to organizations that produce or manage wood waste; and clarify state regulatory and policy positions affecting these organizations. For this study, urban wood waste is defined as solid waste generated by tree and landscape maintenance services (public and private). Urban wood waste includes the following materials: unchipped mixed wood, unchipped logs, and unchipped tops and brush; clearing and grubbing waste; fall leaves and grass clippings; and chips and whole stumps. Construction and demolition debris and consumer-generated yard waste are not included in this study. Generators of urban wood waste include various organizations; municipal, county, and commercial tree care divisions; nurseries, orchards, and golf courses; municipal park and recreation departments; and electric and telephone utility power line maintenance, excavator and land clearance, and landscape organizations. (1) US EPA defines yard waste as ''yard trimmings'' which includes ''grass, leaves and tree brush trimmings from residential, institutional, and commercial sources.''

Complex geometries in wood

DEFF Research Database (Denmark)

Tamke, Martin; Ramsgaard Thomsen, Mette; Riiber Nielsen, Jacob

2009-01-01

The versatility of wood constructions and traditional wood joints for the production of non standard elements was in focus of a design based research. Herein we established a seamless process from digital design to fabrication. A first research phase centered on the development of a robust...... parametric model and a generic design language a later explored the possibilities to construct complex shaped geometries with self registering joints on modern wood crafting machines. The research was carried out as collaboration with industrial partners....

Laser photoelectron spectrometry of Sc- and Y-

International Nuclear Information System (INIS)

Feigerle, C.S.; Herman, Z.; Lineberger, W.C.

1981-01-01

The photoelectron spectra of Sc - and Y - have been obtained in a crossed ion- and laser-beam experiment. Analysis of the Sc - spectrum yields two bound terms of 3d4s 2 4p configuration ( 1 D 0 and 3 D 0 ), with EA(Sc) = 0.189 +- 0.020 eV and an excited-state binding energy of 0.042 +- 0.020 eV. Similarly, the (4d5s 2 5p) 1 D 0 ground state of Y - is bound by 0.308 +- 0.012 eV and a (4d5s 2 5p) 3 D 0 excited term is bound by 0.165 +- 0.025 eV. With the determination of the bound electronic configuration of Sc - as 3d4s 2 4p, the order of filling of electron shells of the first transition series negative ions is found to be 4s 2 ep, 3d4s 2 4p, the order of filling of electron shells of the first transition series negative ions is found to be 4s 2 4p, 3d4s 2 4p, followed by 3dsup(k) 4s 2 (k = 3, 4, ..., 10). (orig.)

Tracing nitrogen accumulation in decaying wood and examining its impact on wood decomposition rate

Science.gov (United States)

Rinne, Katja T.; Rajala, Tiina; Peltoniemi, Krista; Chen, Janet; Smolander, Aino; Mäkipää, Raisa

2016-04-01

Decomposition of dead wood, which is controlled primarily by fungi is important for ecosystem carbon cycle and has potentially a significant role in nitrogen fixation via diazotrophs. Nitrogen content has been found to increase with advancing wood decay in several studies; however, the importance of this increase to decay rate and the sources of external nitrogen remain unclear. Improved knowledge of the temporal dynamics of wood decomposition rate and nitrogen accumulation in wood as well as the drivers of the two processes would be important for carbon and nitrogen models dealing with ecosystem responses to climate change. To tackle these questions we applied several analytical methods on Norway spruce logs from Lapinjärvi, Finland. We incubated wood samples (density classes from I to V, n=49) in different temperatures (from 8.5oC to 41oC, n=7). After a common seven day pre-incubation period at 14.5oC, the bottles were incubated six days in their designated temperature prior to CO2 flux measurements with GC to determine the decomposition rate. N2 fixation was measured with acetylene reduction assay after further 48 hour incubation. In addition, fungal DNA, (MiSeq Illumina) δ15N and N% composition of wood for samples incubated at 14.5oC were determined. Radiocarbon method was applied to obtain age distribution for the density classes. The asymbiotic N2 fixation rate was clearly dependent on the stage of wood decay and increased from stage I to stage IV but was substantially reduced in stage V. CO2 production was highest in the intermediate decay stage (classes II-IV). Both N2 fixation and CO2 production were highly temperature sensitive having optima in temperature 25oC and 31oC, respectively. We calculated the variation of annual levels of respiration and N2 fixation per hectare for the study site, and used the latter data together with the 14C results to determine the amount of N2 accumulated in wood in time. The proportion of total nitrogen in wood

The SC gets ready for visitors

CERN Multimedia

Antonella Del Rosso

2012-01-01

Hall 300, which houses the Synchrocyclotron (SC), CERN’s first accelerator, is getting ready to host a brand-new exhibition. The site will be one of the stops on the new visit itineraries that will be inaugurated for the 2013 CERN Open Day.   The Synchrocyclotron through the years. Just as it did in the late 1950s, when the accelerator was first installed, the gigantic red structure of the Synchrocyclotron's magnet occupies a large part of the 300-square-metre hall. “We have completed the first phase of the project that will give the SC a new lease of life,” says Marco Silari, the project leader and a member of CERN’s Radiation Protection Group. “We have removed all the equipment that was not an integral part of the accelerator. The hall is now ready for the civil-engineering work that will precede the installation of the exhibition.” The SC was witness to a big part of the history of CERN. The accelerator produced ...

Photodegradation of wood and depth profile analysis

International Nuclear Information System (INIS)

Kataoka, Y.

2008-01-01

Photochemical degradation is a key process of the weathering that occurs when wood is exposed outdoors. It is also a major cause of the discoloration of wood in indoor applications. The effects of sunlight on the chemical composition of wood are superficial in nature, but estimates of the depth at which photodegradation occurs in wood vary greatly from 80 microm to as much as 2540 mic rom. Better understanding of the photodegradation of wood through depth profile analysis is desirable because it would allow the development of more effective photo-protective treatments that target the surface layers of wood most susceptible to photodegradation. This paper briefly describes fundamental aspects of photodegradation of wood and reviews progress made in the field of depth profile study on the photodegradation of wood. (author)

Robert Williams Wood: pioneer of invisible light.

Science.gov (United States)

Sharma, Shruti; Sharma, Amit

2016-03-01

The Wood's lamp aids in the diagnosis of multiple infectious, inflammatory and neoplastic dermatologic conditions. Although the Wood's lamp has many applications, which have improved both the diagnosis and management of disease, the man credited for its invention is relatively unknown in medicine. Robert Williams Wood, a prominent physicist of the early 20th century, is credited for the invention of the Wood's lamp. Wood was the father of infrared and ultraviolet photography and made significant contributions to other areas in optics and spectroscopy. Wood's work encompassed the formative years of American Physics; he published over 200 original papers over his lifetime. A few years after the invention of the Wood's lamp for ultraviolet photography, physicians in Europe adopted the Wood's lamp for dermatologic applications. Wood's lamp remains popular in clinics globally, given its ease of use and ability to improve diagnostic precision. © 2016 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

Wood Specific Gravity Variations and Biomass of Central African Tree Species: The Simple Choice of the Outer Wood.

Directory of Open Access Journals (Sweden)

Jean-François Bastin

Full Text Available Wood specific gravity is a key element in tropical forest ecology. It integrates many aspects of tree mechanical properties and functioning and is an important predictor of tree biomass. Wood specific gravity varies widely among and within species and also within individual trees. Notably, contrasted patterns of radial variation of wood specific gravity have been demonstrated and related to regeneration guilds (light demanding vs. shade-bearing. However, although being repeatedly invoked as a potential source of error when estimating the biomass of trees, both intraspecific and radial variations remain little studied. In this study we characterized detailed pith-to-bark wood specific gravity profiles among contrasted species prominently contributing to the biomass of the forest, i.e., the dominant species, and we quantified the consequences of such variations on the biomass.Radial profiles of wood density at 8% moisture content were compiled for 14 dominant species in the Democratic Republic of Congo, adapting a unique 3D X-ray scanning technique at very high spatial resolution on core samples. Mean wood density estimates were validated by water displacement measurements. Wood density profiles were converted to wood specific gravity and linear mixed models were used to decompose the radial variance. Potential errors in biomass estimation were assessed by comparing the biomass estimated from the wood specific gravity measured from pith-to-bark profiles, from global repositories, and from partial information (outer wood or inner wood.Wood specific gravity profiles from pith-to-bark presented positive, neutral and negative trends. Positive trends mainly characterized light-demanding species, increasing up to 1.8 g.cm-3 per meter for Piptadeniastrum africanum, and negative trends characterized shade-bearing species, decreasing up to 1 g.cm-3 per meter for Strombosia pustulata. The linear mixed model showed the greater part of wood specific gravity

Wood Specific Gravity Variations and Biomass of Central African Tree Species: The Simple Choice of the Outer Wood.

Science.gov (United States)

Bastin, Jean-François; Fayolle, Adeline; Tarelkin, Yegor; Van den Bulcke, Jan; de Haulleville, Thales; Mortier, Frederic; Beeckman, Hans; Van Acker, Joris; Serckx, Adeline; Bogaert, Jan; De Cannière, Charles

2015-01-01

Wood specific gravity is a key element in tropical forest ecology. It integrates many aspects of tree mechanical properties and functioning and is an important predictor of tree biomass. Wood specific gravity varies widely among and within species and also within individual trees. Notably, contrasted patterns of radial variation of wood specific gravity have been demonstrated and related to regeneration guilds (light demanding vs. shade-bearing). However, although being repeatedly invoked as a potential source of error when estimating the biomass of trees, both intraspecific and radial variations remain little studied. In this study we characterized detailed pith-to-bark wood specific gravity profiles among contrasted species prominently contributing to the biomass of the forest, i.e., the dominant species, and we quantified the consequences of such variations on the biomass. Radial profiles of wood density at 8% moisture content were compiled for 14 dominant species in the Democratic Republic of Congo, adapting a unique 3D X-ray scanning technique at very high spatial resolution on core samples. Mean wood density estimates were validated by water displacement measurements. Wood density profiles were converted to wood specific gravity and linear mixed models were used to decompose the radial variance. Potential errors in biomass estimation were assessed by comparing the biomass estimated from the wood specific gravity measured from pith-to-bark profiles, from global repositories, and from partial information (outer wood or inner wood). Wood specific gravity profiles from pith-to-bark presented positive, neutral and negative trends. Positive trends mainly characterized light-demanding species, increasing up to 1.8 g.cm-3 per meter for Piptadeniastrum africanum, and negative trends characterized shade-bearing species, decreasing up to 1 g.cm-3 per meter for Strombosia pustulata. The linear mixed model showed the greater part of wood specific gravity variance was

Preservation of forest wood chips

Energy Technology Data Exchange (ETDEWEB)

Kofman, P.D.; Thomsen, I.M.; Ohlsson, C.; Leer, E.; Ravn Schmidt, E.; Soerensen, M.; Knudsen, P.

1999-01-01

As part of the Danish Energy Research Programme on biomass utilisation for energy production (EFP), this project concerns problems connected to the handling and storing of wood chips. In this project, the possibility of preserving wood chips of the Norway Spruce (Picea Abies) is addressed, and the potential improvements by anaerobic storage are tested. Preservation of wood chips aims at reducing dry matter losses from extensive heating during storage and to reduce production of fungal spores. Fungal spores pose a health hazards to workers handling the chips. Further the producers of wood chips are interested in such a method since it would enable them to give a guarantee for the delivery of homogeneous wood chips also during the winter period. Three different types of wood chips were stored airtight and further one of these was stored in accordance with normal practise and use as reference. The results showed that airtight storage had a beneficial impact on the quality of the chips: no redistribution of moisture, low dry matter losses, unfavourable conditions for microbial activity of most fungi, and the promotion of yeasts instead of fungi with airborne spores. Likewise the firing tests showed that no combustion problems, and no increased risk to the environment or to the health of staff is caused by anaerobic storage of wood chips. In all, the tests of the anaerobic storage method of forest wood chips were a success and a large-scale test of the method will be carried out in 1999. (au)

Wood pellets in a power plant - mixed combustion of coal and wood pellets

International Nuclear Information System (INIS)

Nupponen, M.

2001-01-01

The author reviews in his presentation the development of Turku Energia, the organization of the company, the key figures of the company in 2000, as well as the purchase of energy in 2000. He also presents the purchase of basic heat load, the energy production plants of the company, the sales of heat in 2000, the emissions of the plants, and the fuel consumption of the plants in 2000. The operating experiences of the plants are also presented. The experiences gained in Turku Energia on mixed combustion of coal and wood pellets show that the mixing ratios, used at the plants, have no effect on the burning properties of the boiler, and the use of wood pellets with coal reduce the SO 2 and NO x emissions slightly. Simultaneously the CO 2 share of the wood pellets is removed from the emissions calculations. Several positive effects were observed, including the disappearance of the coal smell of the bunker, positive publicity of the utilization of wood pellets, and the subsidies for utilization of indigenous fuels in power generation. The problems seen include the tendency of wood pellets to arc the silos, especially when the pellets include high quantities of dust, and the loading of the trucks and the pneumatic unloading of the trucks break the pellets. Additionally the wood pellets bounce on the conveyor so they drop easily from the conveyor, the screw conveyors designed for conveying grain are too weak and they get stuck easily, and static electricity is easily generated in the plastic pipe used as the discharge pipe for wood pellet (sparkling tendency). This disadvantage has been overcome by using metal net and grounding

Fusion hindrance for 27Al+45Sc and other systems with a positive Q value

International Nuclear Information System (INIS)

Jiang, C. L.; Rehm, K. E.; Esbensen, H.; Back, B. B.; Janssens, R. V. F.; DiGiovine, B.; Greene, J. P.; Henderson, D. J.; Lee, H. Y.; Pardo, R. C.; Seweryniak, D.; Ugalde, C.; Zhu, S.; Collon, P.; Notani, M.; Tang, X. D.; Deibel, C. M.; Figueira, J. M.; Marley, S. T.; Patel, N.

2010-01-01

Fusion evaporation cross sections for the 27 Al+ 45 Sc (Q=9.63 MeV) system are measured down to about 300 nb. Deviations from standard coupled-channels calculations were observed in this system at the lowest energies. The steep fall-off of the fusion cross sections can be reproduced by calculations using a shallow potential model, which was originally developed to explain the hindrance behavior of heavy-ion fusion in medium-mass systems with negative Q values. Comparisons of the hindrance behavior between the present experiment and other systems, for example, 28 Si+ 30 Si (Q=14.3 MeV) and 36 S+ 48 Ca (Q=7.55 MeV) are presented.

Continued growth expected for wood energy despite turbulence of the economic crisis : wood energy markets, 2008-2009

Science.gov (United States)

Rens Hartkamp; Bengt Hillring; Warren Mabee; Olle Olsson; Kenneth Skog; Henry Spelter; Johan Vinterback; Antje Wahl

2009-01-01

The economic crisis has not reduced the demand for wood energy, which is expected to continue to grow. The downturn in sawmill production caused a shortage of raw material supply for wood pellet producers. With decreased demand for pulpwood-quality roundwood for wood and paper products in 2009, some pulpwood is being converted into wood energy. Economies of scale are...

CERN Technical Training 2004: New Short Courses (SC) on Microsoft Outlook

CERN Multimedia

Monique Duval

2004-01-01

The CERN Technical Training programme is now proposing a new format for courses on Microsoft Outlook. Three two-hours Short Courses (SC) will cover basic and advanced functionalities of the recommended mail client for email at CERN. Each module can be followed independently. The next scheduled sessions will take place as follows: Outlook (SC I): E-mail. Next session: 31.8.2004 (9h00-11h00) Outlook (SC II): Calendar, Tasks and Notes. Next session: 31.8.2004 (14h00-16h00) Outlook (SC III): Meetings and Delegation. Next session: 7.9.2004 (14h00-16h00) In particular, SC I will cover how to open, create and send email, work with attachments, use stationery, organise mail, and work with the address book, SC II will show how to work with the calendar, tasks and notes, and SC III will cover how to organise and manage meetings, work with meeting requests, share tasks, and use email and calendar delegation. The number of participants to each session is limited to 8. The instructor is English-French bilingual, and she...

Aldehyde dehydrogenase 1 is a marker for normal and malignant human colonic stem cells (SC) and tracks SC overpopulation during colon tumorigenesis.

Science.gov (United States)

Huang, Emina H; Hynes, Mark J; Zhang, Tao; Ginestier, Christophe; Dontu, Gabriela; Appelman, Henry; Fields, Jeremy Z; Wicha, Max S; Boman, Bruce M

2009-04-15

Although the concept that cancers originate from stem cells (SC) is becoming scientifically accepted, mechanisms by which SC contribute to tumor initiation and progression are largely unknown. For colorectal cancer (CRC), investigation of this problem has been hindered by a paucity of specific markers for identification and isolation of SC from normal and malignant colon. Accordingly, aldehyde dehydrogenase 1 (ALDH1) was investigated as a possible marker for identifying colonic SC and for tracking them during cancer progression. Immunostaining showed that ALDH1(+) cells are sparse and limited to the normal crypt bottom, where SCs reside. During progression from normal epithelium to mutant (APC) epithelium to adenoma, ALDH1(+) cells increased in number and became distributed farther up the crypt. CD133(+) and CD44(+) cells, which are more numerous and broadly distributed in normal crypts, showed similar changes during tumorigenesis. Flow cytometric isolation of cancer cells based on enzymatic activity of ALDH (Aldefluor assay) and implantation of these cells in nonobese diabetic-severe combined immunodeficient mice (a) generated xenograft tumors (Aldefluor(-) cells did not), (b) generated them after implanting as few as 25 cells, and (c) generated them dose dependently. Further isolation of cancer cells using a second marker (CD44(+) or CD133(+) serially) only modestly increased enrichment based on tumor-initiating ability. Thus, ALDH1 seems to be a specific marker for identifying, isolating, and tracking human colonic SC during CRC development. These findings also support our original hypothesis, derived previously from mathematical modeling of crypt dynamics, that progressive colonic SC overpopulation occurs during colon tumorigenesis and drives CRC development.

Wood's lamp illumination (image)

Science.gov (United States)

A Wood's lamp emits ultraviolet light and can be a diagnostic aid in determining if someone has a fungal ... is an infection on the area where the Wood's lamp is illuminating, the area will fluoresce. Normally ...

Robert Wood Johnson Foundation

Science.gov (United States)

Robert Wood Johnson Foundation Search How We Work Our Focus Areas About RWJF Search Menu How We Work Grants ... Learn more For Grantees and Grantseekers The Robert Wood Johnson Foundation funds a wide array of programs ...

Advantages of the use of energy wood

International Nuclear Information System (INIS)

Kaerhae, K.; Aarnio, J.; Maekinen, P.

2000-01-01

According to the Regional Forestry Associations it would be possible to develop the harvesting of energy wood by increasing the use of it. The study was made at the areas of 34 regional forestry associations as an inquiry to the executive managers, as well as the persons responsible for timber trade, harvesting or regional affairs. The inquiries studied the use of energy wood and the user of them at the areas of the associations, as well as the amounts of harvesting and the realization of it. Only a third of the associations have large energy wood consuming plants (using more than 500 m 3 energy wood per year). The closest large energy wood consuming plant was in the average 31 km from the office of the association. The average energy wood use of the plant was 20 000 m 3 /a, the variation being 700 - 200 000 m 3 /a. The energy wood purchase range of the plants varied from few kilometers to hundred kilometers, the average being 47 km. Most of the energy wood was harvested from forest regeneration areas. Some of the energy wood is also harvested from young forest maintenance and thinning areas. The estimated harvesting of energy wood in 1999 was 6300 m 3 . A part of the energy wood is used for heating the farms and other small real estates, and a part is used for heating larger buildings like schools, hospitals, factories. The fees to the associations for purchase of energy wood varied significantly. The range was 2.00 - 11.00 FIM/m 3 . One association charged 300 FIM/parcel, and in one association the price depend on the amount of wood acquired from the lot, the unit price being 0.5 FIM/m 3 . It appeared that the associations estimated the use of energy wood to increase. The level in 1999 was 6300 m 3 and it is estimated to increase to 14 300 m 3 in 2005. The associations estimated that the levels can only be achieved if the stumpage price of energy wood may not be 0.0 FIM. Even a marginal price would lead to an increased harvesting of energy wood. The associations

Optimization of properties of cement-bonded particleboard manufactured from cotton stalk and sawdust containing calcium chloride CaCl2 as an additive

Directory of Open Access Journals (Sweden)

morteza nazerian

2016-06-01

Full Text Available The aim of this study was investigation of hydration behavior and mechanical properties of cement-bonded particleboard manufactured from different ratio of cotton stalk to poplar wood particle, sawdust content and CaCl2 as additive at different weight ratios. At the first, curing time of cement paste containing different amount of additive (CaCl2 and wood and cotton fines was determined. Besides, the effect of additive (CaCl2 content, weight ratio of cotton to poplar wood particles and percentage of sawdust on modulus of rupture (MOR, modulus of elasticity (MOE and internal bonding (IB of cement-bonded particleboard was evaluated by response surface methodology (RSM. In order to optimize the properties of panels, a mathematical model equation (second order plan was done by a computer simulation program. According to results, there is a good coincidence between predicted values and actual values (R2 for MOR, MOE and IB was 0.93, 0.90 and 0.95, respectively. This study showed that the response surface methodology (RSM can be effectively used for modeling of panel properties. Results showed that using weight ratio of cotton to poplar particle 43:57 the MOR, MOE and IB of panels can be reached to maximum values (12.5, 2545 and 0.35 MPa, respectively. Simultaneously, application of 4.5% additive and 9% sawdust at had a positive effect on the properties of the panels.

Inoculation Expedition of Agar wood

International Nuclear Information System (INIS)

Peng, C.S.; Mohd Fajri Osman; Rusli Zakaria

2015-01-01

Inoculation expedition of agar wood is a main field works for researcher in Nuclear Malaysia to prove the real inoculation of agar wood in real jungle. These expeditions was conducted fourth times in the jungles of Malaysia including Gunung Tebu in Terengganu, Murum in Belaga, Sarawak, Kampung Timbang in Kota Belud, Sabah and Nuclear Malaysia itself. This expedition starts from preparation of samples and equipment, transportation into the jungle, searching and recognition of agar wood and lastly, inoculation of the agar wood. Safety aspects precedence set out in the preparation and implementation of this expedition. (author)

Polymorphous GdScO3 as high permittivity dielectric

International Nuclear Information System (INIS)

Schäfer, A.; Rahmanizadeh, K.; Bihlmayer, G.; Luysberg, M.; Wendt, F.; Besmehn, A.; Fox, A.

2015-01-01

Four different polymorphs of GdScO 3 are assessed theoretically and experimentally with respect to their suitability as a dielectric. The calculations carried out by density functional theory reveal lattice constants, band gaps and the energies of formation of three crystal phases. Experimentally all three crystal phases and the amorphous phase can be realized as thin films by pulsed laser deposition using various growth templates. Their respective crystal structures are confirmed by X-ray diffraction and transmission electron microscopy reflecting the calculated lattice constants. X-ray photoelectron spectroscopy unveils the band gaps of the different polymorphs of GdScO 3 which are above 5 eV for all films demonstrating good insulating properties. From capacitance voltage measurements, high permittivities of up to 27 for hexagonal GdScO 3 are deduced. - Highlights: • Different epitaxial polymorph phases of GdScO 3 were grown by pulsed laser deposition. • The cubic phase of GdScO 3 is reported for the first time. • All phases are proven to be useful for the use in silicon based and III–V based microelectronic devices.

Piezoelectric coefficients and spontaneous polarization of ScAlN

International Nuclear Information System (INIS)

Caro, Miguel A; Laurila, Tomi; Zhang, Siyuan; Moram, Michelle A; Riekkinen, Tommi; Ylilammi, Markku; Molarius, Jyrki; Lopez-Acevedo, Olga

2015-01-01

We present a computational study of spontaneous polarization and piezoelectricity in Sc x Al 1−x N alloys in the compositional range from x = 0 to x = 0.5, obtained in the context of density functional theory and the Berry-phase theory of electric polarization using large periodic supercells. We report composition-dependent values of piezoelectric coefficients e ij , piezoelectric moduli d ij and elastic constants C ij . The theoretical findings are complemented with experimental measurement of e 33 for a series of sputtered ScAlN films carried out with a piezoelectric resonator. The rapid increase with Sc content of the piezoelectric response reported in previous studies is confirmed for the available data. A detailed description of the full methodology required to calculate the piezoelectric properties of ScAlN, with application to other complex alloys, is presented. In particular, we find that the large amount of internal strain present in ScAlN and its intricate relation with electric polarization make configurational sampling and the use of large supercells at different compositions necessary in order to accurately derive the piezoelectric response of the material. (paper)

The SC15 protein of Schizophyllum commune mediates formation of aerial hyphae and attachment in the absence of the SC3 hydrophobin

NARCIS (Netherlands)

Lugones, L G; de Jong, J F; de Vries, O M H; Jalving, R; Dijksterhuis, J; Wösten, H A B

Disruption of the SC3 gene in the basidiomycete Schizophyllum commune affected not only formation of aerial hyphae but also attachment to hydrophobic surfaces. However, these processes were not completely abolished, indicating involvement of other molecules. We here show that the SC15 protein

Characterisation of wood combustion ashes

DEFF Research Database (Denmark)

Maresca, Alberto

The combustion of wood chips and wood pellets for the production of renewable energy in Denmark increased from 5.7 PJ to 16 PJ during the period 2000-2015, and further increases are expected to occur within the coming years. In 2012, about 22,300 tonnes of wood ashes were generated in Denmark....... Currently, these ashes are mainly landfilled, despite Danish legislation allowing their application onto forest and agricultural soils for fertilising and/or liming purposes. During this PhD work, 16 wood ash samples generated at ten different Danish combustion plants were collected and characterised...... for their composition and leaching properties. Despite the relatively large variations in the contents of nutrients and trace metals, the overall levels were comparable to typical ranges reported in the literature for other wood combustion ashes, as well as with regards to leaching. In general, the composition...

FRACTIONAL RECRYSTALLIZATION KINETICS IN DIRECTLY COLD ROLLED Al-Mg, Al-Mg-Sc AND Al-Mg-Sc-Zr ALLOY

Directory of Open Access Journals (Sweden)

M. S. Kaiser

2014-12-01

Full Text Available The evaluation of texture as a function of recrystallization has been characterized for directly cold rolled Al-6Mg, Al-6Mg-0.4Sc and Al-6Mg-0.4Sc-0.2Zr alloys. Samples were annealed isothermally at 400 °C for 1 to 240 minutes to allow recrystallization. Recrystallization kinetics of the alloys is analyzed from the micro-hardness variation. Isothermally annealed samples of aluminum alloys were also studied using JMAK type analysis to see if there exists any correlation between the methods. Recrystallization fraction behavior between two methods the scandium added alloys show the higher variation due to precipitation hardening and higher recrystallization behavior. The scandium and zirconium as a combined shows the more variation due to formation of Al3(Sc, Zr precipitate. From the microstructure it is also observed that the base Al-Mg alloy attained almost fully re-crystallized state after annealing at 400 °C for 60 minutes

Wood for the trees

Directory of Open Access Journals (Sweden)

Rob Garbutt

2013-10-01

Full Text Available Our paper focuses on the materiality, cultural history and cultural relations of selected artworks in the exhibition Wood for the trees (Lismore Regional Gallery, New South Wales, Australia, 10 June – 17 July 2011. The title of the exhibition, intentionally misreading the aphorism “Can’t see the wood for the trees”, by reading the wood for the resource rather than the collective wood[s], implies conservation, preservation, and the need for sustaining the originating resource. These ideas have particular resonance on the NSW far north coast, a region once rich in rainforest. While the Indigenous population had sustainable practices of forest and land management, the colonists deployed felling and harvesting in order to convert the value of the local, abundant rainforest trees into high-value timber. By the late twentieth century, however, a new wave of settlers launched a protest movements against the proposed logging of remnant rainforest at Terania Creek and elsewhere in the region. Wood for the trees, curated by Gallery Director Brett Adlington, plays on this dynamic relationship between wood, trees and people. We discuss the way selected artworks give expression to the themes or concepts of productive labour, nature and culture, conservation and sustainability, and memory. The artworks include Watjinbuy Marrawilil’s (1980 Carved ancestral figure ceremonial pole, Elizabeth Stops’ (2009/10 Explorations into colonisation, Hossein Valamanesh’s (2008 Memory stick, and AñA Wojak’s (2008 Unread book (in a forgotten language. Our art writing on the works, a practice informed by Bal (2002, Muecke (2008 and Papastergiadis (2004, becomes a conversation between the works and the themes or concepts. As a form of material excess of the most productive kind (Grosz, 2008, p. 7, art seeds a response to that which is in the air waiting to be said of the past, present and future.

EFFECTS OF BURN RATE, WOOD SPECIES, MOISTURE CONTENT AND WEIGHT OF WOOD LOADED ON WOODSTOVE EMISSIONS

Science.gov (United States)

The report gives results of tests of four woodstove operating parameters (burn rate, wood moisture, wood load, and wood species) at two levels each using a half factorial experimental test design to determine statistically significant effects on the emission components CO, CO2, p...

Detection of wood failure by image processing method: influence of algorithm, adhesive and wood species

Science.gov (United States)

Lanying Lin; Sheng He; Feng Fu; Xiping Wang

2015-01-01

Wood failure percentage (WFP) is an important index for evaluating the bond strength of plywood. Currently, the method used for detecting WFP is visual inspection, which lacks efficiency. In order to improve it, image processing methods are applied to wood failure detection. The present study used thresholding and K-means clustering algorithms in wood failure detection...

Energy wood procurement in connection with conventional wood procurement; Energiapuun hankinnan organisointi muun puunhankinnan yhteydessae - PUUT02

Energy Technology Data Exchange (ETDEWEB)

Maekinen, P. [Finnish Forest Research Institute, Vantaa (Finland)

2001-07-01

The research consisted of two sub-projects. The present role of forestry associations in procurement of energy wood was investigated in the first sub- project. The possibilities and willingness of them to increase the energy wood procurement were also studied. The role of forest machine and forestry service entrepreneurs in procurement of energy wood was investigated in the second sub-project. The effects of energy wood procurement on the operation of the forest machine companies in general were also studied in this sub-project. The sub-project three studied the requirements of the customer companies for the energy wood suppliers. All the material of the sub-projects was collected by personal inquiries. According to the executive directors of the forestry associations the role of the forestry associations in energy wood procurement varied between a by-stander and active participant. Active forestry associations announced the companies for stands available for cutting. They told also that they directed the harvesting to correct sites and deliver stems at the roadside. The role of the forestry association was emphasised especially when the associations on the basis of a letter of attorney carried out the timber trade. It was estimated that in the near future the operation of forest machine entrepreneurs in harvesting of energy wood would increase significantly. From the employment and turnover point of view the role of harvesting of energy wood was not seen as a significant matter. On the other hand, that harvesting of energy wood impede the harvesting of commercial timber was seen as a more significant matter. In the future the end-users of energy wood would like to have more competition in the energy wood markets. However, the energy wood suppliers were desired to be relative large so that the reliability of deliveries could be ensured. Simultaneously as the end-users wanted to decrease the price of forest chips, the machine entrepreneurs estimated the price to

Strength loss in decayed wood

Science.gov (United States)

Rebecca E. Ibach; Patricia K. Lebow

2014-01-01

Wood is a durable engineering material when used in an appropriate manner, but it is susceptible to biological decay when a log, sawn product, or final product is not stored, handled, or designed properly. Even before the biological decay of wood becomes visually apparent, the decay can cause the wood to become structurally unsound. The progression of decay to that...

Wood thermoplastic composites

Science.gov (United States)

Daniel F. Caulfield; Craig Clemons; Rodney E. Jacobson; Roger M. Rowell

2005-01-01

The term “wood-plastic composites” refers to any number of composites that contain wood (of any form) and either thermoset or thermoplastic polymers. Thermosets or thermoset polymers are plastics that, once cured, cannot be remelted by heating. These include cured resins, such as epoxies and phenolics, plastics with which the forest products industry is most familiar (...

Effect of Alternative Wood Species and First Thinning Wood on Oriented Strand Board Performance

Directory of Open Access Journals (Sweden)

Fabiane Salles Ferro

2018-01-01

Full Text Available This study aimed to evaluate the feasibility of using and influence of alternative wood species such as Cambará, Paricá, Pinus, and wood from first thinning operations on oriented strand board (OSB physical and mechanical properties. Besides that, an alternative resin, castor oil-based polyurethane, was used to bond the particles, due to the better environmental performance when compared to other resins commonly used worldwide in OSB production. Physical properties such as the moisture content, thickness swelling, and water absorption, both after 2 and 24 hours of water immersion, and mechanical properties such as the modulus of elasticity and resistance in static bending, in major and minor axes, and internal bonding were investigated. All tests were performed according to European code EN 300:2006. Results showed the influence of wood species on physical and mechanical properties. Panels made with higher density woods such as Cambará presented better physical performance, while those made with lower density woods such as Pinus presented better mechanical properties. Besides that, strand particle geometry was also influenced on all physical and mechanical properties investigated. Therefore, the feasibility of using alternative species and wood from first thinning and with castor oil-based polyurethane resin in OSB production was verified.

Creep properties and precipitate evolution in Al-Li alloys microalloyed with Sc and Yb

Energy Technology Data Exchange (ETDEWEB)

Krug, Matthew E. [Department of Materials Science and Engineering, Northwestern University, 2220 Campus Drive, Evanston, IL 60208 (United States); Seidman, David N. [Department of Materials Science and Engineering, Northwestern University, 2220 Campus Drive, Evanston, IL 60208 (United States); Northwestern Center for Atom Probe Tomography, Northwestern University, 2220 Campus Drive, Evanston, IL 60208 (United States); Dunand, David C., E-mail: dunand@northwestern.edu [Department of Materials Science and Engineering, Northwestern University, 2220 Campus Drive, Evanston, IL 60208 (United States)

2012-07-30

Highlights: Black-Right-Pointing-Pointer We examine the creep behavior of Al-alloys with Li and rare earth element additions. Black-Right-Pointing-Pointer These alloys exhibit threshold stresses below which no measurable creep occurs. Black-Right-Pointing-Pointer Larger precipitate size and lattice parameter mismatch increase creep resistance. Black-Right-Pointing-Pointer A simple parameter describes the threshold stress behavior in ternary Al-Sc-X alloys. Black-Right-Pointing-Pointer The findings are explained by a recent model of dislocation-precipitate interactions. - Abstract: A dilute Al-Sc alloy (Al-0.12 Sc, at.%, Al-Sc), its counterpart with a Li addition (Al-2.9 Li-0.11 Sc, at.%, Al-Li-Sc), as well as a quaternary alloy (Al-5.53 Li-0.048 Sc-0.009 Yb, at.%, Al-Li-Sc-Yb) were isothermally aged at 325 Degree-Sign C, and in some cases isochronally aged to 450 Degree-Sign C. As the {alpha} Prime -Al{sub 3}(Li,Sc) and Al{sub 3}(Li,Sc,Yb) precipitates, with L1{sub 2} structure, coarsen in the two Li-containing alloys, their Li and Yb concentrations decrease and their Sc concentration increases. A significant interfacial excess of Li also segregates at the {alpha}-Al matrix/{alpha} Prime -Al{sub 3}Sc(Li,Sc,Yb) precipitate interface: 5.99 {+-} 0.05 atoms nm{sup -2} in Al-Li-Sc and 13.2 {+-} 0.4 atoms nm{sup -2} in Al-Li-Sc-Yb after aging isochronally to 450 Degree-Sign C. During compression creep at 300 Degree-Sign C, the aged alloys exhibit threshold stresses between 8 and 22 MPa. A recent threshold stress model based on elastic interactions between dislocations and precipitates predicts correctly that Li additions in the Al-Li-Sc alloy reduce the threshold stress, while Yb in the Al-Li-Sc-Yb alloy increases it. The model is also in agreement with the threshold stresses of all Al-Sc-X alloys published to date.

The environmental assessment of the wood combustion

International Nuclear Information System (INIS)

Dinca, Cristian; Badea, Adrian; Apostol, Tiberiu

2007-01-01

In this paper, the authors analysed the emissions from residential boilers burning wood logs, bark pellets, wood briquettes and wood pellets. Three boilers, selected with respect to age, design, connection to heat storage tank, and type of biofuel, were included in the study. The emissions captured comprised carbon monoxide (CO), carbon dioxide (CO 2 ), oxygen (O 2 ), total organic carbons (TOC), nitrogen oxides (NO x ), polycyclic aromatic hydrocarbons (PAC) and 33 volatile organic compounds (VOC). We have used the Life Cycle Inventory method in order to identify the main stressors generated by the wood combustion stage. In this purpose, we have analysed one type of old boiler, one type of modern boiler and a multi-fuel boiler, which can burn wood logs, bark pellets, wood briquettes and wood pellets. In this article, we selected only the wood combustion stage because it is the most important according to the emissions produced. (authors)

Wood-energy - The sector get worried

International Nuclear Information System (INIS)

Mary, Olivier; Signoret, Stephane; Bohlinger, Philippe; Guilhem, Jean; De Santis, Audrey; Sredojevic, Alexandre; Defaye, Serge; Maindrault, Marc

2017-01-01

Wood energy is, today and certainly also tomorrow, one of the most important renewable energies in France. However, the wood-energy sector seems to slow down as hydrocarbon prices stay extremely low. This document presents 8 articles, describing the context and the characteristics of this evolution, plus some examples of developments in France. The themes of the articles are: the activity of the wood-energy sector should be reinforced to meet the objectives of the French energy multi-year plan; The 2035 prospective of the wood yield in the French forest will meet the future demand, however this evaluation does not take into consideration the effects of the climatic change; the conversion to biomass of the 'Fort de l'Est' (near Paris) heating system (equipped with a boiling fluidized bed boiler) has enabled the heat network to beat the 50 pc share of renewable energy; wood-energy professionals use the 'quality' lever to challenge their fossil fuel competitors; the city of Orleans is now equipped with an innovative biomass cogeneration plant; the example of wood waste valorization in a French sawmill; the French ONF (Forest Administration) Wood-Energy actor has just inaugurated its largest biomass dryer, in order to develop the domestic market for wood as a fuel; analysis of the technical and economical feasibility of using wood to generate electric power or replacing electric space heating by heat network

The laser microprobe mass analyser for determining partitioning of minor and trace elements among intimately associated macerals: an example from the Swallow Wood coal bed, Yorkshire, UK

Science.gov (United States)

Lyons, P.C.; Morelli, J.J.; Hercules, D.M.; Lineman, D.; Thompson-Rizer, C. L.; Dulong, F.T.

1990-01-01

A study of the elemental composition of intimately associated coal macerals in the English Swallow Wood coal bed was conducted using a laser microprobe mass analyser, and indicated a similar trace and minor elemental chemistry in the vitrinite and cutinite and a different elemental signature in the fusinite. Three to six sites were analysed within each maceral during the study by laser micro mass spectrometry (LAMMS). Al, Ba, Ca, Cl, Cr, Dy, F, Fe, Ga, K, Li, Mg, Na, S, Si, Sr, Ti, V, and Y were detected by LAMMS in all three macerals but not necessarily at each site analysed. The signal intensities of major isotopic peaks were normalized to the signal intensity of the m z 85 peak (C7H) to determine the relative minor- and trace-element concentrations among the three dominant macerals. The vitrinite and the cutinite were depleted in Ba, Ca, Dy, Li, Mg, Sr, and Y relative to their concentrations observed in the fusinite. The cutinite was distinguished over vitrinite by less Ti, V, Cr and Ca, and K Ca $ ??1 (relative signal intensities). The fusinite, relative to the cutinite and vitrinite, was relatively depleted in Cr, Sc, Ti, and V. The fusinite, as compared with both the cutinite and vitrinite, was relatively enriched in Ba, Ca, Dy, Li, Mg, Sr, and Y, and also showed the most intense m z 64, 65, 66 signals (possibly S2+, HS2+, H2S2+, respectively). The LAMMS data indicate a common source for most elements and selective loss from the maceral precursors in the peat or entrapment of certain elements as mineral matter, most likely during the peat stage or during early diagenesis. The relatively high amounts of Ba, Ca, Dy, Li, Mg, Sr, and Y in the fusinite are consistent with micron and submicron mineral-matter inclusions such as carbonates and Ca-Al phosphates (probably crandallite group minerals). Mineralogical data on the whole coal, the LAMMS chemistry of the vitrinite and cutinite, and scanning electron microscopy/energy dispersive X-ray analysis (SEM/EDAX) of

Coal and wood fuel for electricity production: An environmentally sound solution for waste and demolition wood

Energy Technology Data Exchange (ETDEWEB)

Penninks, F.W.M. [EPON, Zwolle (Netherlands)

1997-12-31

Waste wood from primary wood processing and demolition presents both a problem and a potential. If disposed in landfills, it consumes large volumes and decays, producing CH{sub 4}, CO{sub 2} and other greenhouse gases. As an energy source used in a coal fired power plant it reduces the consumption of fossil fuels reducing the greenhouse effect significantly. Additional advantages are a reduction of the ash volume and the SO{sub 2} and NO{sub x} emissions. The waste wood requires collection, storage, processing and burning. This paper describes a unique project which is carried out in the Netherlands at EPON`s Gelderland Power Plant (635 MW{sub e}) where 60 000 tonnes of waste and demolition wood will be used annually. Special emphasis is given to the processing of the powdered wood fuel. Therefore, most waste and demolition wood can be converted from an environmental liability to an environmental and economic asset. (author)

Coal and wood fuel for electricity production: An environmentally sound solution for waste and demolition wood

Energy Technology Data Exchange (ETDEWEB)

Penninks, F W.M. [EPON, Zwolle (Netherlands)

1998-12-31

Waste wood from primary wood processing and demolition presents both a problem and a potential. If disposed in landfills, it consumes large volumes and decays, producing CH{sub 4}, CO{sub 2} and other greenhouse gases. As an energy source used in a coal fired power plant it reduces the consumption of fossil fuels reducing the greenhouse effect significantly. Additional advantages are a reduction of the ash volume and the SO{sub 2} and NO{sub x} emissions. The waste wood requires collection, storage, processing and burning. This paper describes a unique project which is carried out in the Netherlands at EPON`s Gelderland Power Plant (635 MW{sub e}) where 60 000 tonnes of waste and demolition wood will be used annually. Special emphasis is given to the processing of the powdered wood fuel. Therefore, most waste and demolition wood can be converted from an environmental liability to an environmental and economic asset. (author)

Mineralogy of Non-Silicified Fossil Wood

Directory of Open Access Journals (Sweden)

George E. Mustoe

2018-03-01

Full Text Available The best-known and most-studied petrified wood specimens are those that are mineralized with polymorphs of silica: opal-A, opal-C, chalcedony, and quartz. Less familiar are fossil woods preserved with non-silica minerals. This report reviews discoveries of woods mineralized with calcium carbonate, calcium phosphate, various iron and copper minerals, manganese oxide, fluorite, barite, natrolite, and smectite clay. Regardless of composition, the processes of mineralization involve the same factors: availability of dissolved elements, pH, Eh, and burial temperature. Permeability of the wood and anatomical features also plays important roles in determining mineralization. When precipitation occurs in several episodes, fossil wood may have complex mineralogy.

Local Impact Simulation of SC Wall Structures using Aircraft Engine Projectile

International Nuclear Information System (INIS)

Chung, Chulhun; Lee, Jungwhee; Lee, Hanjoo; Jung, Raeyoung; Hyun, Changhun

2013-01-01

SC wall structure developed for nuclear power plant buildings consists of plain concrete and two steel plates on both surface of the concrete, while RC structure consists of re bar and concrete. SC structure has higher scabbing resistance than RC structure due to the action of steel plate on the rear side of impact. Therefore SC structure is known as more effective structure from the viewpoint of aircraft crash than RC structure. However, most of the recent researches and experiments about local impact damage deal with RC structures, and the effect of re bar and steel plate is not considered reasonably. Although Walter et al. and Make-work et al. suggested a formula for evaluating perforation depth of steel plate covered RC walls, most of the previous researches about SC structure are focused on perforation and scabbing due to the impact of hard projectile, rather than soft projectile such as an aircraft. In this research a soft projectile, i. e. aircraft engine, is utilized for impact simulation of RC and SC walls. To evaluate local damage of SC wall structures, parametric study with the variables of wall thickness and steel ratio of the cover plate is performed, and the results are compared with those of RC structures. Since scabbing was prevented by the steel plates, penetration mode of damage was observed in SC walls while scabbing damage was occurred in RC walls. It is confirmed that the rear steel plate not only contains concrete debris, but also reduces the internal damage of the concrete walls. Penetration depth of SC walls did not largely vary due to the increasing steel ratio, and similar results to RC walls were observed when the wall thickness is larger than a certain value since the impact resistance of SC wall is mainly governed by the thickness of concrete part. Therefore, it is expected that similar level of impact resistance to RC structure can be produced with the minimum thickness of steel plates of SC structure. According to these results, SC

Recycling of wood products. Final report of the preliminary study project partly financed by the Finnish Wood Research Oy; Puutuotteiden kierraetys. Finnish Wood Research Oy:n osarahoittaman esiselvityshankkeen loppuraportti

Energy Technology Data Exchange (ETDEWEB)

Pirhonen, I.; Heraejaervi, H.; Saukkola, P.; Raety, T.; Verkasalo, E., Email: henrik.herajarvi@metla.fi

2011-07-01

The objective of this preliminary study was to clarify the present state of recycling of wood in Finland and Europe. In the work the control measures of recycling were examined. In Finland there will be a total amount of 850 000 tons of waste wood per year. Of this amount 670 000 tons is from construction and demolishing of buildings. Burning the wood to energy is technically and economically the most reasonable use of waste wood in Finland and in several other European countries where there is a long heating season. A lot of work has been done to find new ways of utilization. The objective of the European Union to increase the use of renewable natural resources in the energy production creates an additional demand to all kinds of wood, including waste wood. The waste legislation of Finland and EU is directing to recycling, not restricting it. Furthermore, the systems to try to create markets for products containing recycled materials are under development. In the future it is expected that the legislation is tightening and the burning of waste wood is no longer calculated as acceptable recycling. Other ways to utilize wood waste should then already be developed. Furthermore, the development and introduction of new recycling methods are of important significance also when marketing wood and wood products. The recycling should be taken into consideration already at the planning stage of the building

Surface characterization of weathered wood-plastic composites produced from modified wood flour

Science.gov (United States)

James S. Fabiyi; Armando G. McDonald; Nicole M. Stark

2007-01-01

The effects of weathering on the surface properties of wood-plastic composites (WPC) were examined. High-density polyethylene (HDPE) based WPCs made from modified wood flour (untreated, extractives free, and holocellulose (delignified) fibers) were subjected to accelerated (xenon-arc) weathering. Colorimetry and Fourier-transform infrared spectroscopy were employed to...

Discover the benefits of residential wood heating

International Nuclear Information System (INIS)

2003-01-01

This publication described how residential wood-heating systems are being used to reduce energy costs and increase home comfort. Biomass energy refers to all forms are renewable energy that is derived from plant materials. The source of fuel may include sawmills, woodworking shops, forest operations and farms. The combustion of biomass is also considered to be carbon dioxide neutral, and is not considered to be a major producer of greenhouse gases (GHG) linked to global climate change. Wood burning does, however, release air pollutants, particularly if they are incompletely burned. Incomplete combustion of wood results in dense smoke consisting of toxic gases. Natural Resources Canada helped create new safety standards and the development of the Wood Energy Technical Training Program to ensure that all types of wood-burning appliances are installed correctly and safely to reduce the risk of fire and for effective wood heating. In Canada, more than 3 million families heat with wood as a primary or secondary heating source in homes and cottages. Wood heating offers security from energy price fluctuations and electrical power failures. This paper described the benefits of fireplace inserts that can transform old fireplaces into modern heating systems. It also demonstrated how an add-on wood furnace can be installed next to oil furnaces to convert an oil-only heating system to a wood-oil combination system, thereby saving thousands of dollars in heating costs. Wood pellet stoves are another wood burning option. The fuel for the stoves is produced from dried, finely ground wood waste that is compressed into hard pellets that are loaded into a hopper. The stove can run automatically for up to 24 hours. New high-efficiency advanced fireplaces also offer an alternative heating system that can reduce heating costs while preserving Canada's limited supply of fossil fuels such as oil and gas. 13 figs

Quantifying arthropod contributions to wood decay

Science.gov (United States)

Michael Ulyshen; Terry Wagner

2013-01-01

Termites carry large amounts of soil into dead wood, and this behaviour complicates efforts to measure their contributions to wood decay. A novel method for isolating termite soil by burning the wood is described, and some preliminary results are presented.

Chapter 6: Above Ground Deterioration of Wood and Wood-Based Materials

Science.gov (United States)

Grant Kirker; Jerrold Winandy

2014-01-01

Wood as a material has unique properties that make it ideal for above ground exposure in a wide range of structural and non-strucutral applications. However, no material is without limitations. Wood is a bio-polymer which is subject to degradative processes, both abiotic and biotic. This chapter is a general summary of the abiotic and biotic factors that impact service...

Effects of Wood Roughness, Light Pigments, and Water Repellent on the Color Stability of Painted Spruce Subjected to Natural and Accelerated Weathering

Directory of Open Access Journals (Sweden)

Ladislav Reinprecht

2015-09-01

Full Text Available This study examined the color stability of painted Norway spruce (Picea abies samples subjected to natural and accelerated weathering, using Duncan’s tests and correlation analyses. The following effects were studied: (1 the different initial roughness of the wood; (2 use of transparent or lightly-pigmented top-coat layers; and (3 the presence of the final water-repellent layer. Natural weathering at a 45° slope in an industrial zone lasted 104 weeks, whereas accelerated weathering in Xenotest with 0.55 W/m2 UV irradiation at 340 nm and sprayed water lasted 12 weeks. The color stability of painted spruce, measured in a CIE-L*a*b* system, was not, in the majority of cases, significantly affected by the initial roughness of the wood, the type of top-coat (WoodCare UV or PerlColor layer, or presence of the final water repellent (AquaStop layer. The light pine or larch pigments in the top-coat layers had positive color stabilizing effects. In their presence, the darkening (-L* and total color differences (E* of the painted samples dropped ca. 2.5 times during exterior weathering and ca. 5 times during Xenotest weathering. Samples painted with transparent coatings turned a reddish shade (+a* during the Xenotest, while those exposed to the exterior absorbed dirt and became more blue (-b*.

X-ray initiated polymerization of wood impregnants

Energy Technology Data Exchange (ETDEWEB)

Cleland, Marshall R.; Galloway, Richard A. [IBA Industrial, Inc., Edgewood, NY (United States); Berejka, Anthony J. [Ionicorp, Huntington, NY 11743 (United States)], E-mail: berejka@msn.com; Montoney, Daniel [Strathmore Products, Syracuse, NY (United States); Driscoll, Mark; Smith, Leonard; Scott Larsen, L. [State University of New York, SUNY-ESF, Syracuse, NY (United States)

2009-07-15

X-rays, derived from a high energy, high-current electron beam (EB), initiated in-situ polymerization of a unique class of monomers that were found to penetrate the cell walls of wood. X-rays initiated an auto-catalytic acrylic polymerization and penetrated through thick pieces of wood. The final cured product having the polymerizate, a polymer, both in the wood cell lumens and in the cell walls is called wood impregnated with a wood-polymer penetrant (WPP). The controlled lower dose rate of X-rays overcame disproportionation encountered when using higher dose-rate electron beam initiation. With X-rays, the in-situ polymerization took place in one exposure of modest dose. With EB, multiple passes were needed to avoid excessive heat build-up and monomer volatilization. Having entered the cell walls of the wood and then being polymerized within the cell walls, these radiation-cured unique monomers imparted outstanding dimensional stability upon exposure of the impregnated wood to humidity cycling. The preferred monomer system was also chemically modified prior to impregnation with agents that would remain in the wood and prevent the growth of fungi and other microbials. This technique differs from historic uses of monomers that merely filled the lumens of the wood (historic wood-polymer composites), which are only suitable for indoor use. The WPP impregnated wood that was either X-ray cured or EB cured demonstrated enhanced structural properties, dimensional stability, and decay resistance.

X-ray initiated polymerization of wood impregnants

International Nuclear Information System (INIS)

Cleland, Marshall R.; Galloway, Richard A.; Berejka, Anthony J.; Montoney, Daniel; Driscoll, Mark; Smith, Leonard; Scott Larsen, L.

2009-01-01

X-rays, derived from a high energy, high-current electron beam (EB), initiated in-situ polymerization of a unique class of monomers that were found to penetrate the cell walls of wood. X-rays initiated an auto-catalytic acrylic polymerization and penetrated through thick pieces of wood. The final cured product having the polymerizate, a polymer, both in the wood cell lumens and in the cell walls is called wood impregnated with a wood-polymer penetrant (WPP). The controlled lower dose rate of X-rays overcame disproportionation encountered when using higher dose-rate electron beam initiation. With X-rays, the in-situ polymerization took place in one exposure of modest dose. With EB, multiple passes were needed to avoid excessive heat build-up and monomer volatilization. Having entered the cell walls of the wood and then being polymerized within the cell walls, these radiation-cured unique monomers imparted outstanding dimensional stability upon exposure of the impregnated wood to humidity cycling. The preferred monomer system was also chemically modified prior to impregnation with agents that would remain in the wood and prevent the growth of fungi and other microbials. This technique differs from historic uses of monomers that merely filled the lumens of the wood (historic wood-polymer composites), which are only suitable for indoor use. The WPP impregnated wood that was either X-ray cured or EB cured demonstrated enhanced structural properties, dimensional stability, and decay resistance.

On Erdos–Wood's conjecture

Indian Academy of Sciences (India)

In this article, we prove that infinite number of integers satsify Erdős–Woods conjecture. Moreover, it follows that the number of natural numbers ≤ satisfies Erdős–Woods conjecture with = 2 is at least /(log ) for some positive constant > 2.

The economic potential of wood pellet production from alternative, low-value wood sources in the southeast of the US

NARCIS (Netherlands)

Hoefnagels, Ric; Junginger, Martin; Faaij, Andre

2014-01-01

The global demand for wood pellets used for energy purposes is growing. Therefore, increased amounts of wood pellets are produced from primary forestry products, such as pulp wood. The present analysis demonstrates that substantial amounts of alternative, low-value wood resources are available that

Users guide for WoodCite, a product cost quotation tool for wood component manufacturers [computer program

Science.gov (United States)

Jeff Palmer; Adrienn Andersch; Jan Wiedenbeck; Urs. Buehlmann

2014-01-01

WoodCite is a Microsoft® Access-based application that allows wood component manufacturers to develop product price quotations for their current and potential customers. The application was developed by the U.S. Forest Service and Virginia Polytechnic Institute and State University, in cooperation with the Wood Components Manufacturers Association.

Wood energy x 2 - Scenario for the development of wood energy use in Switzerland

International Nuclear Information System (INIS)

2004-01-01

This study for the Swiss Agency for the Environment, Forests and Landscapes (SAEFL) and the Swiss wood-energy association (Holzenergie Schweiz) presents the results of a scenario-study that examined if, and under what conditions, doubling the use of wood energy in Switzerland could help reach carbon dioxide reduction targets. Two scenarios are presented that are based on high and low rates of growth for the number of automatic wood-chipping or pellets-fired installations. For both scenarios, figures are presented on the amount of wood used and the heating energy generated. The political and financial prerequisites for the scenarios are discussed and other boundary conditions are defined. The report draws conclusions from the study of the two scenarios and summarises the political action deemed necessary

Implementation of new technologies in wood industry and their effect in wood products quality

OpenAIRE

ELVA ÇAUSHI; PANDELI MARKU

2014-01-01

There are about 300 companies producing furniture and about 250 small and medium enterprises (SME) producing sawn timber, which operate in the field of wood industry in Albania. This wood industry production is being challenged by the increasing demand in the domestic market, ranging from kitchen furniture to office and schools furniture, bedroom furniture, doors, windows, and saw timber in different dimensions. The production from the wood industry can fulfill about 80% of the domestic mark...

Gadolinium scandium germanide, Gd2Sc3Ge4

Directory of Open Access Journals (Sweden)

Sumohan Misra

2009-04-01

Full Text Available Gd2Sc3Ge4 adopts the orthorhombic Pu5Rh4-type structure. The crystal structure contains six sites in the asymmetric unit: two sites are statistically occupied by rare-earth atoms with Gd:Sc ratios of 0.967 (4:0.033 (4 and 0.031 (3:0.969 (3, one site (.m. symmetry is occupied by Sc atoms, and three distinct sites (two of which with .m. symmetry are occupied by Ge atoms. The rare-earth atoms form two-dimensional slabs with Ge atoms occupying the trigonal-prismatic voids.

Refraction and absorption of microwaves in wood

International Nuclear Information System (INIS)

Ziherl, Saša; Bajc, Jurij; Čepič, Mojca

2013-01-01

A demonstration experiment for physics students showing the dependence of the refractive index and absorption coefficient of wood on the direction of microwaves is presented. Wood and microwaves enable study of anisotropic properties, which are typically found in crystals. Wood is used as the persuasive representative of uniaxial anisotropic materials due to its visible structure and its consequent anisotropic properties. Wood can be cut in a general direction and wooden plates a few centimetres thick with well-defined fibre orientation are easily prepared. Microwaves are used because wood is transparent for microwaves and their centimetre-scale wavelength is comparable to the wood structure. (paper)

Wood for fuel

Energy Technology Data Exchange (ETDEWEB)

Beaton, D

1986-01-01

Growing wood for energy could contribute three million tonnes of coal equivalent per year by the end of the century. Research programmes in the UK involved with energy forestry are reported. Three systems of wood energy, modified conventional forestry, single stem timber cropping and short rotation coppicing are being investigated. The short rotation coppicing requires inputs similar to those of agricultural crops and the machinery geared towards agricultural operations is compatible with it. Single stem forestry has a medium rotation period of 20 years. The production of coppice wood fuels is discussed in further detail for different parts of the UK with recommendations for species selection and adaption of existing farming practices. A coppice willow harvester has been developed for harvesting during November - February. Weed control and fertilizer application are also briefly mentioned.

The Swedish wood fuel market

International Nuclear Information System (INIS)

Hillring, Bengt

1999-01-01

In Sweden, wood fuels are traditionally used in the Swedish forest products industry and for heating of single-family houses. More recently they are also become established as an energy source for district heating and electricity production. Energy policy, especially the energy taxation system, has favoured wood fuels and other biofuels, mainly for environmental reasons. There is now an established commercial market for wood fuels in the district heating sector, which amounts to 45 PJ and is growing 20 per cent annually. Price levels have been stable in current prices for a decade, mainly because of good access to wood fuels. Price levels are dominated by production costs on a market that is largely governed by the buyer. It is expected that the use of wood fuels will increased in Sweden in the future, which will push a further development of this section on the market and bring about technological changes in the area. (Author)

Fatigue Damage in Wood

DEFF Research Database (Denmark)

Clorius, Christian Odin; Pedersen, Martin Bo Uhre; Hoffmeyer, Preben

1996-01-01

An investigation of fatigue failure in wood subjected to load cycles in compression parallel to grain is presented. Fatigue failure is found to depend both on the total time under load and on the number of cycles.Recent accelerated fatigue research on wood is reviewed, and a discrepancy between...... to 10 Hz are used. The number of cycles to failure is found to be a poor measure of the fatigue performance of wood. Creep, maximum strain, stiffness and work are monitored throughout the fatigue tests. Accumulated creep is suggested identified with damage and a correlation between stiffness reduction...

Wood and Sediment Dynamics in River Corridors

Science.gov (United States)

Wohl, E.; Scott, D.

2015-12-01

Large wood along rivers influences entrainment, transport, and storage of mineral sediment and particulate organic matter. We review how wood alters sediment dynamics and explore patterns among volumes of instream wood, sediment storage, and residual pools for dispersed pieces of wood, logjams, and beaver dams. We hypothesized that: volume of sediment per unit area of channel stored in association with wood is inversely proportional to drainage area; the form of sediment storage changes downstream; sediment storage correlates most strongly with wood load; and volume of sediment stored behind beaver dams correlates with pond area. Lack of data from larger drainage areas limits tests of these hypotheses, but analyses suggest a negative correlation between sediment volume and drainage area and a positive correlation between wood and sediment volume. The form of sediment storage in relation to wood changes downstream, with wedges of sediment upstream from jammed steps most prevalent in small, steep channels and more dispersed sediment storage in lower gradient channels. Use of a published relation between sediment volume, channel width, and gradient predicted about half of the variation in sediment stored upstream from jammed steps. Sediment volume correlates well with beaver pond area. Historically more abundant instream wood and beaver populations likely equated to greater sediment storage within river corridors. This review of the existing literature on wood and sediment dynamics highlights the lack of studies on larger rivers.

Management alternatives of energy wood thinning stands

International Nuclear Information System (INIS)

Heikkilae, Jani; Siren, Matti; Aeijaelae, Olli

2007-01-01

Energy wood thinning has become a feasible treatment alternative of young stands in Finland. Energy wood thinnings have been carried out mainly in stands where precommercial thinning has been neglected and the harvesting conditions for industrial wood thinning are difficult. Despite of its positive effects on harvesting costs and on renewable energy potential, whole-tree harvesting has been constantly criticized for causing growth loss. In this paper, the profitability of energy wood thinning was studied in 20 Scots pine-dominated stands where energy wood thinning was carried out. The growth of the stands after thinning was predicted with the help of Motti-stand simulator. Entire rotation time of the stands was simulated with different management alternatives. The intensity of first thinning and recovery level of logging residues varied between alternatives. In order to attain acceptable harvesting conditions, industrial wood thinning had to be delayed. The effect of energy wood thinning on subsequent stem wood growth was almost the same as in conventional thinning. Whole-tree harvesting for energy proved to be profitable alternative if the stumpage price is around 3EUR m -3 , the interest rate is 3% or 5% and the removal of pulpwood is less than 20 m 3 ha -1 . If the harvestable pulpwood yield is over 20 m 3 ha -1 , integrated harvesting of industrial and energy wood or delayed industrial wood harvesting becomes more profitable. (author)

Impregnating Systems for Producing Wood-Plastic Composite Materials and Resinified Woods by Radiochemical Means

International Nuclear Information System (INIS)

Laizier, J.; Laroche, R.; Marchand, J.

1969-01-01

The effect of the nature of the components in the impregnation mixture on the characteristics of wood-plastic combinations has been studied in the case of beech by applying a wide variety of compositions. In particular, the effect of water (in the impregnator, and in the form of moisture in the wood) on the characteristics of the products obtained has been determined. It has been shown that, in place of the conventional method for preparing resinified woods (using a ternary monomer-solvent-water mixture), it is possible to use a method involving comonomers, which obviate the need to dry the wood after treatment. The evaluation of the results obtained is based on the value of the impregnation rate and on the modifications in microscopic structure; these emphasize the differences between the types of filler and enable comparisons to be drawn with the dimensional stabilities observed. Measurements of variations in dimensions and the recurrence of moisture have made it possible to establish a classification based on the types of monomer used and the operating conditions. It is shown that a whole range of products is obtained, the properties of which differ widely and are comparatively easily adaptable to the purpose specified. These properties illustrate clearly the differences and characteristics of resinified woods as opposed to conventional wood-plastic materials. (author) [fr

NorWood: a gene expression resource for evo-devo studies of conifer wood development.

Science.gov (United States)

Jokipii-Lukkari, Soile; Sundell, David; Nilsson, Ove; Hvidsten, Torgeir R; Street, Nathaniel R; Tuominen, Hannele

2017-10-01

The secondary xylem of conifers is composed mainly of tracheids that differ anatomically and chemically from angiosperm xylem cells. There is currently no high-spatial-resolution data available profiling gene expression during wood formation for any coniferous species, which limits insight into tracheid development. RNA-sequencing data from replicated, high-spatial-resolution section series throughout the cambial and woody tissues of Picea abies were used to generate the NorWood.conGenIE.org web resource, which facilitates exploration of the associated gene expression profiles and co-expression networks. Integration within PlantGenIE.org enabled a comparative regulomics analysis, revealing divergent co-expression networks between P. abies and the two angiosperm species Arabidopsis thaliana and Populus tremula for the secondary cell wall (SCW) master regulator NAC Class IIB transcription factors. The SCW cellulose synthase genes (CesAs) were located in the neighbourhoods of the NAC factors in A. thaliana and P. tremula, but not in P. abies. The NorWood co-expression network enabled identification of potential SCW CesA regulators in P. abies. The NorWood web resource represents a powerful community tool for generating evo-devo insights into the divergence of wood formation between angiosperms and gymnosperms and for advancing understanding of the regulation of wood development in P. abies. © 2017 The Authors. New Phytologist © 2017 New Phytologist Trust.

Identification of Four Wood Species by an Electronic Nose and by LIBS

Directory of Open Access Journals (Sweden)

Juliana R. Cordeiro

2012-01-01

Full Text Available This paper presents two complementary methods capable of identifying four wood species (Cedrela fissilis, Ocotea porosa, Hymenolobium petraeum, and Aspidosperma subincanum both by their volatile organic compounds and by the presence of 10 chemical elements: Al, B, Ca, Mg, Zn, Cu, Mn, Fe, Na, and Si. The volatile compounds were detected by an electronic nose formed by an array of three different conductive polymer gas sensors. The elemental determination was made by laser-induced breakdown spectrometry (LIBS. The emissions measured were treated by principal component analysis (PCA. Leave-one-out analysis showed a rate of hits of 100%.

Manufacturing methods and magnetic characteristics of magnetic wood

International Nuclear Information System (INIS)

Oka, H.; Hojo, A.; Osada, H.; Namizaki, Y.; Taniuchi, H.

2004-01-01

The relationship between wood construction and DC magnetic characteristics for three types of magnetic wood was experimentally investigated. The results show that the magnetic characteristics of each type of magnetic wood are dependent on the magnetic materials, the density of the magnetic material and the construction of the wood. Furthermore, it was determined that the relationship between the fiber direction and the magnetic path direction of the magnetic wood influenced the wood's magnetic characteristics

Monitor of SC beam profiles

CERN Document Server

CERN PhotoLab

1977-01-01

A high-resolution secondary emission grid for the measurement of SC beam profiles. Modern techniques of metal-ceramic bonding, developed for micro-electronics, have been used in its construction. (See Annual Report 1977 p. 105 Fig. 12.)

Performance Analysis of OFDM 60GHz System and SC-FDE 60GHz System

Directory of Open Access Journals (Sweden)

Han Xueyan

2016-01-01

Full Text Available In this paper, the performance of 60GHz wireless communication system with SC and OFDM is studied, the models of OFDM 60GHz system and SC 60GHz frequency domain equalization (SC-FDE system are established, and the bit error rate (BER performance of OFDM 60GHz system and SC-FDE 60GHz system in 802.15.3c channels is compared. The simulation results show that SC-FDE 60GHz system has a slight advantage over OFDM system in line-of-sight (LOS channels, while OFDM 60GHz system has a slight advantage over SC-FDE system in non-line-of-sight (NLOS channels. For 60GHz system, OFDM 60GHz system has a slight advantage over SC-FDE system in overcoming multipath fading, but the performance of both is close whether in the LOS or NLOS case.

Assessment and management of dead-wood habitat

Science.gov (United States)

Hagar, Joan

2007-01-01

The Bureau of Land Management (BLM) is in the process of revising its resource management plans for six districts in western and southern Oregon as the result of the settlement of a lawsuit brought by the American Forest Resource Council. A range of management alternatives is being considered and evaluated including at least one that will minimize reserves on O&C lands. In order to develop the bases for evaluating management alternatives, the agency needs to derive a reasonable range of objectives for key issues and resources. Dead-wood habitat for wildlife has been identified as a key resource for which decision-making tools and techniques need to be refined and clarified. Under the Northwest Forest Plan, reserves were to play an important role in providing habitat for species associated with dead wood (U.S. Department of Agriculture Forest Service and U.S. Department of the Interior Bureau of Land Management, 1994). Thus, the BLM needs to: 1) address the question of how dead wood will be provided if reserves are not included as a management strategy in the revised Resource Management Plan, and 2) be able to evaluate the effects of alternative land management approaches. Dead wood has become an increasingly important conservation issue in managed forests, as awareness of its function in providing wildlife habitat and in basic ecological processes has dramatically increased over the last several decades (Laudenslayer et al., 2002). A major concern of forest managers is providing dead wood habitat for terrestrial wildlife. Wildlife in Pacific Northwest forests have evolved with disturbances that create large amounts of dead wood; so, it is not surprising that many species are closely associated with standing (snags) or down, dead wood. In general, the occurrence or abundance of one-quarter to one-third of forest-dwelling vertebrate wildlife species, is strongly associated with availability of suitable dead-wood habitat (Bunnell et al., 1999; Rose et al., 2001). In

Radiation processing of wood-plastic composites

International Nuclear Information System (INIS)

Czvikovszky, T.

1992-01-01

There are three main types of radiation-processed composite material derived from plastics and fibrous natural polymers. The first are the monomer-impregnated, radiation-treated wood-plastic composites (WPC). They became a commercial success in the early 1970s. More recently, work has focused on improving the WPCs by creating in them interpenetrating network (IPN) systems by the use of appropriate multifunctional oligomers and monomers. The main kinetic features of radiation-initiated chain polymerization remain applicable even in impregnated wood. The second type are the plastics filled or reinforced with dispersed wood fiber or other cellulosics (WFRP). In their case, radiation processing offers a new opportunity to apply radiation-reactive adhesion promoters between wood or cellulosic fibers and the thermoplastic matrices. The third type are the laminar composites made by electron beam coating of wood-based agglomerate sheets and boards. This chapter reviews the industrial applications and the radiation processing of the three types of the wood-plastic composites and indicates future trends. (orig.)

Gallium-containing Heusler phases ScRh{sub 2}Ga, ScPd{sub 2}Ga, TmRh{sub 2}Ga and LuRh{sub 2}Ga. Magnetic and solid state NMR-spectroscopic characterization

Energy Technology Data Exchange (ETDEWEB)

Heletta, Lukas; Seidel, Stefan; Poettgen, Rainer [Muenster Univ. (Germany). Inst. fuer Anorganische und Analytische Chemie; Benndorf, Christopher [Leipzig Univ. (Germany). Inst. fuer Mineralogie, Kristallographie und Materialwissenschaften; Eckert, Hellmut [Muenster Univ. (Germany). Inst. fuer Physikalische Chemie; Sao Paulo Univ., Sao Carlos (Brazil). Inst. of Physics

2017-10-01

The gallium-containing Heusler phases ScRh{sub 2}Ga, ScPd{sub 2}Ga, TmRh{sub 2}Ga and LuRh{sub 2}Ga have been synthesized by arc-melting of the elements followed by different annealing sequences to improve phase purity. The samples have been studied by powder X-ray diffraction. The structures of Lu{sub 0.97}Rh{sub 2}Ga{sub 1.03} (Fm3m, a=632.94(5) pm, wR2=0.0590, 46 F{sup 2} values, seven variables) and Sc{sub 0.88}Rh{sub 2}Ga{sub 1.12} (a=618.91(4) pm, wR2=0.0284, 44 F{sup 2} values, six variables) have been refined from single crystal X-ray diffractometer data. Both gallides show structural disorder through Lu/Ga and Sc/Ga mixing. Temperature dependent magnetic susceptibility measurements showed Pauli paramagnetism for ScRh{sub 2}Ga, ScPd{sub 2}Ga, and LuRh{sub 2}Ga and Curie-Weiss paramagnetism for TmRh{sub 2}Ga. {sup 45}Sc and {sup 71}Ga solid state MAS NMR spectroscopic investigations of the Sc containing compounds confirmed the site mixing effects typically observed for Heusler phases. The data indicate that the effect of mixed Sc/Ga occupancy is significantly stronger in ScRh{sub 2}Ga than in ScPd{sub 2}Ga.

Long term durability of wood-plastic composites made with chemically modified wood

Science.gov (United States)

Rebecca E. Ibach; Craig M. Clemons

2017-01-01

Wood-plastic composites (WPCs) have slower moisture sorption than solid wood, but over time moisture can impact the strength, stiffness, and decay of the composite. These changes will become increasingly important if WPCs are used in more challenging environments such as in ground-contact applications. There are several options for mitigating the moisture sorption of...

Simulated long-term effects of varying tree retention on wood production, dead wood and carbon stock changes.

Science.gov (United States)

Santaniello, Francesca; Djupström, Line B; Ranius, Thomas; Weslien, Jan; Rudolphi, Jörgen; Sonesson, Johan

2017-10-01

Boreal forests are an important source of timber and pulp wood, but provide also other products and services. Utilizing a simulation program and field data from a tree retention experiment in a Scots pine forest in central Sweden, we simulated the consequences during the following 100 years of various levels of retention on production of merchantable wood, dead wood input (as a proxy for biodiversity), and carbon stock changes. At the stand level, wood production decreased with increased retention levels, while dead wood input and carbon stock increased. We also compared 12 scenarios representing a land sharing/land sparing gradient. In each scenario, a constant volume of wood was harvested with a specific level of retention in a 100-ha landscape. The area not needed to reach the defined volume was set-aside during a 100-year rotation period, leading to decreasing area of set-asides with increasing level of retention across the 12 scenarios. Dead wood input was positively affected by the level of tree retention whereas the average carbon stock decreased slightly with increasing level of tree retention. The scenarios will probably vary in how they favor species preferring different substrates. Therefore, we conclude that a larger variation of landscape-level conservation strategies, also including active creation of dead wood, may be an attractive complement to the existing management. Copyright © 2017 Elsevier Ltd. All rights reserved.

PEMODELAN KONDUKTIVITAS ION DALAM STRUKTUR Li2Sc3(PO43 (Modeling Ionic Conductivity in Li2Sc3(PO43 Structure

Directory of Open Access Journals (Sweden)

Akram La Kilo

2011-11-01

Full Text Available ABSTRAK Fasa Li2Sc3(PO43 merupakan material konduktor superionik yang dapat diaplikasikan sebagai baterai yang dapat diisi ulang (rechargeable. Ion Li+ dalam struktur Li2Sc3(PO4 dapat mengalami migrasi dari posisi terisi ke posisi kosong. Penelitian ini telah memodelkan migrasi ion Li+ dalam struktur Li2Sc3(PO4 dengan menggunakan metode bond valence sum (BVS. Metode ini dapat memprediksi bilangan oksidasi suatu atom berdasarkan jarak dengan atom-atom tetangga. Source code berbasis BVS yang digunakan adalah JUMPITER yang mensimulasi efek gaya listrik eksternal yang bertindak pada ion litium sehingga nilai BVS litium dapat dipetakan terhadap jarak. Hasil simulasi menunjukkan bahwa konduksi ion Li+ dapat terjadi pada arah [010], [101], dan [120]. Namun, lintasan konduksi ion Li+ lebih mudah terjadi pada arah [120] atau bidang ab dengan nilai maksimum BVS adalah 0,982. ABSTRACT g-phase of Li2Sc3(PO43 is a lithium super ionic conductor which can be applied as a rechargeable lithium battery. Lithium ions of g-Li2Sc3(PO43 can migrate from occupied site to vacant site. In this research, simulation of Li+ ions migration in the structure of g-Li2Sc3(PO43 carried out using bond valence sum (BVS to predict the oxidation state of Li+ion based on the distance of the ion to neighboring atoms. BVS-based code used JUMPITER to simulate the effect of external electrical force acting on the lithium ions to produce the lithium BVS value which can be mapped to the distance. The simulation results shows that Li+ ion conduction can be occurred on [010], [101], and [120] directions. However, the Li ion conduction pathway occur more easily in the direction of [120] or ab plane with the BVS maximum value is 0.982.

Understanding cation ordering and oxygen vacancy site preference in Ba3CaNb2O9 from first-principles

Science.gov (United States)

Ding, Hepeng; Virkar, Anil; Liu, Feng

2014-03-01

We investigate the physical mechanism underlying the formation of the B-site cation ordering and the oxygen vacancy site selection in Ba3CaNb2O9 using density functional theory calculations. We found that either cation site exchange or oxygen vacancy formation induces negligible lattice strain. This implies that the ionic radius plays an insignificant role in governing these two processes. Furthermore, the electrostatic interactions are found dominant in the ordering of mixed valence species on one or more sites, the ionic bond strength is identified as the dominant force in governing both the 1:2 B-site cation ordering along the direction and the oxygen vacancy site preference in Ba3CaNb2O9. Specifically, the cation ordering can be rationalized by the increased mixing bonding energy of the Ca-O-Nb bonds over the Ca-O-Ca and Nb-O-Nb bonds, i.e., 1/2(Ca-O-Ca + Nb-O-Nb) Grant Number DE-SC0001061 as a flow through from the University of South Carolina.

File list: Unc.PSC.50.AllAg.EpiSC [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available Unc.PSC.50.AllAg.EpiSC mm9 Unclassified Pluripotent stem cell EpiSC SRX1074917,SRX1...074905,SRX1074908 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.PSC.50.AllAg.EpiSC.bed ...

File list: Unc.PSC.05.AllAg.EpiSC [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available Unc.PSC.05.AllAg.EpiSC mm9 Unclassified Pluripotent stem cell EpiSC SRX1074917,SRX1...074908,SRX1074905 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.PSC.05.AllAg.EpiSC.bed ...

File list: Unc.PSC.20.AllAg.EpiSC [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available Unc.PSC.20.AllAg.EpiSC mm9 Unclassified Pluripotent stem cell EpiSC SRX1074917,SRX1...074908,SRX1074905 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.PSC.20.AllAg.EpiSC.bed ...

Substitution potentials of recycled HDPE and wood particles from post-consumer packaging waste in Wood-Plastic Composites.

Science.gov (United States)

Sommerhuber, Philipp F; Welling, Johannes; Krause, Andreas

2015-12-01

The market share of Wood-Plastic Composites (WPC) is small but expected to grow sharply in Europe. This raises some concerns about suitable wood particles needed in the wood-based panels industry in Europe. Concerns are stimulated by the competition between the promotion of wooden products through the European Bioeconomy Strategy and wood as an energy carrier through the Renewable Energy Directive. Cascade use of resources and valorisation of waste are potential strategies to overcome resource scarcity. Under experimental design conditions, WPC made from post-consumer recycled wood and plastic (HDPE) were compared to WPC made from virgin resources. Wood content in the polymer matrix was raised in two steps from 0% to 30% and 60%. Mechanical and physical properties and colour differences were characterized. The feasibility of using cascaded resources for WPC is discussed. Results indicate the technical and economic feasibility of using recycled HDPE from packaging waste for WPC. Based on technical properties, 30% recycled wood content for WPC is feasible, but economic and political barriers of efficient cascading of biomass need to be overcome. Copyright © 2015 Elsevier Ltd. All rights reserved.

Mechanical Behaviour of the Wood Masonry

Directory of Open Access Journals (Sweden)

Fazia FOUCHAL

2011-09-01

Full Text Available In this paper we study the walls wood masonry behaviour. First, we propose a regulatory validation of the walls wood masonry behaviour subjected to vertical and horizontal loads according to Eurocode 5. Then we present the numerical application on the wall wood supported two floors level.

Use of nanofillers in wood coatings

DEFF Research Database (Denmark)

Nikolic, Miroslav; Lawther, John Mark; Sanadi, Anand Ramesh

2015-01-01

Wood has been used for thousands of years and remains an important material in the construction industry, most often protected with coatings. Development of nanotechnology allows further improvements or new performance properties to be achieved in wood coatings. Increased UV protection...... with nanometal oxides that allow wood texture to remain seen and higher resilience to scratch and abrasion with use of different nanoparticle shapes are some of the applications that are reviewed here. A variety of possible applications together with a high level of improvements, alongside commercial factors...... like a low level of loading, have already established nanoparticles in some areas of wood coatings. This article is a comprehensive scientific review of the published work in the use of nanofillers in wood coatings....

Moisture relations and physical properties of wood

Science.gov (United States)

Samuel V. Glass; Samuel L. Zelinka

2010-01-01

Wood, like many natural materials, is hygroscopic; it takes on moisture from the surrounding environment. Moisture exchange between wood and air depends on the relative humidity and temperature of the air and the current amount of water in the wood. This moisture relationship has an important influence on wood properties and performance. Many of the challenges of using...

Adhesives for Achieving Durable Bonds with Acetylated Wood

Science.gov (United States)

Charles Frihart; Rishawn Brandon; James Beecher; Rebecca Ibach

2017-01-01

Acetylation of wood imparts moisture durability, decay resistance, and dimensional stability to wood; however, making durable adhesive bonds with acetylated wood can be more difficult than with unmodified wood. The usual explanation is that the acetylated surface has fewer hydroxyl groups, resulting in a harder-to-wet surface and in fewer hydrogen bonds between wood...

Comparative study on liquefaction of creosote and chromated copper arsenate (CCA)-treated wood and untreated southern pine wood: effects of acid catalyst content, liquefaction time, temperature, and phenol to wood ratio

Science.gov (United States)

Hui Pan; Chung-Yun Hse; Todd F. Shupe

2009-01-01

Creosote- and chromated copper arsenate (CCA)-treated wood waste and untreated southern pine wood were liquefied with phenol and sulfuric acid. The effects of sulfuric acid content, liquefaction time, liquefaction temperature, and phenol to wood ratio on liquefaction rate (i.e., wood residue content) were investigated and analyzed by analysis of variance (...

Method of stabilizing wood

International Nuclear Information System (INIS)

Pesek, M.; Jarkovsky, J.

1973-01-01

Wood is impregnated with a mixture of a vinyl or an allyl monomer (20 - 90 wt. %) and unsaturated polyester resins. The impregnated wood is then exposed to ionizing radiation at doses of 0.1 to 20 Mrad at a temperature of 60 to 180 degC. (B.S.)

Switzerland's largest wood-pellet factory in Balsthal

International Nuclear Information System (INIS)

Stohler, F.

2004-01-01

This article describes how a small Swiss electricity utility has broken out of its traditional role in power generation and the distribution of electricity and gone into the production of wood pellets. The pellets, which are made from waste wood (sawdust) available from wood processing companies, are produced on a large scale in one of Europe's largest pellets production facilities. The boom in the use of wood pellets for heating purposes is discussed. The article discusses this unusual approach for a Swiss power utility, which also operates a wood-fired power station and is even involved in an incineration plant for household wastes. The markets being aimed for in Switzerland and in Europe are described, including modern low-energy-consumption housing projects. A further project is described that is to use waste wood available from a large wood processing facility planned in the utility's own region

Preparation and applications of wood-polyester composites

International Nuclear Information System (INIS)

Czvikovszky, T.

1982-01-01

Optimum processing parameters were searched for the pilot-scale production of wood-polyester composites by irradiation of resin-impregnated wood material. The radiation initiation of the following systems were examined in wood and without wood matrix: methyl methacrylate, mixture of styrene and acrylonitryle, and their combination with unsaturated polyester. In the most cases the over-all rate of the complete polymerization process in wood matrix is proportional to the square root of the initiation rate. The parameters of the radiation technology of wood-polyester composites have been determined, using 260 TBq (7 kCi) 60 Co radiation source. A pilot plant has been constructed using an underwater irradiation system of 1.85 PBq (50 kCi) 60 Co. The successful production rate of 200 kg wood-polyester composite per day, as well as the application tests have demonstrated the technical feasibility of this new structural material. (author)

Phase relationship in AL-Cu-Sc alloys at 450-500 deg C

International Nuclear Information System (INIS)

Kharakterova, M.L.

1991-01-01

Al-Cu-Sc alloys containing up to 40% Cu and up to 6% Sc at 450 deg C and 500 deg C are studied using light microscopy, X-ray-spectral microanalysis, X-ray diffraction analysis, scanning electron microscopy, measurement of microhardness and electric resistance. It is determined, that in equilibrium with aluminium solid solution under the given temperature ther are Al 3 Sc, CuAl 2 phases of the respective binary systems and W (ScCu 6.6-4 Al 5.4-8 ) ternary phase. Isothermal cross sections of Al-Cu-Sc system at 450 and 500 deg C are plotted. Microhardness of equilibrium phases is measured. Combined solubility of copper and scandium in aluminium is determined

Effect of Sc addition on microstructure and mechanical properties of 1460 alloy

Directory of Open Access Journals (Sweden)

Juan Ma

2014-02-01

Full Text Available The effect of minor addition of Sc on microstructure, age hardening behavior, tensile properties and fracture morphology of 1460 alloy have been studied. It is found that Sc content increase from 0.11 wt% to 0.22 wt% is favorable for grain refinement in as-cast alloy but results in a coarsening of Cu-rich particles. The alloy with 0.11 wt% Sc exhibits enhanced mechanical properties and age hardening effect. Transmission electron microscopy (TEM investigations on the alloy with 0.11 wt% Sc have suggested that a large amount of Al3(Sc, Zr particles precipitated at the earlier aging may inhibit recrystallization effectively.

RESISTANCE TO THE ATTACK OF DRY-WOOD TERMITES (Cryptotermes brevis) OF SIX WOOD SPECIES

OpenAIRE

Fabrício Gomes Gonçalves; José Tarcísio da Silva Oliveira

2006-01-01

The dry wood termites are one of the largest causes of damages in wood used in Brazil. This work analyzed the attackof the Cryptotermes brevis in six commercials wood species in the north of the Rio de Janeiro and south of the Espírito Santo. The testobserved the number of holes, the percentage of died individuals and the damage of the pieces. When compared to the Pinus sp(reference), the species with less susceptibility to the attack were Cedrela fissilis, Cariocar brasiliense and Goupia gla...

Chapter 02: Basic wood biology—Anatomy for identification

Science.gov (United States)

Alex Wiedenhoeft

2011-01-01

Before the topics of using a hand lens, preparing wood for observation, and understanding the characters used in wood identification can be tackled, a general introduction to the biology of wood must be undertaken. The woods in commercial trade in Central America come almost exclusively from trees, so the discussion of wood biology is restricted to trees here, though...

Wood for sound.

Science.gov (United States)

Wegst, Ulrike G K

2006-10-01

The unique mechanical and acoustical properties of wood and its aesthetic appeal still make it the material of choice for musical instruments and the interior of concert halls. Worldwide, several hundred wood species are available for making wind, string, or percussion instruments. Over generations, first by trial and error and more recently by scientific approach, the most appropriate species were found for each instrument and application. Using material property charts on which acoustic properties such as the speed of sound, the characteristic impedance, the sound radiation coefficient, and the loss coefficient are plotted against one another for woods. We analyze and explain why spruce is the preferred choice for soundboards, why tropical species are favored for xylophone bars and woodwind instruments, why violinists still prefer pernambuco over other species as a bow material, and why hornbeam and birch are used in piano actions.

Moisture measurement in wood, wood-based materials and building materials - a literature review

International Nuclear Information System (INIS)

Kober, A.; Mehlhorn, L.; Plinke, B.

1989-10-01

Methods of moisture measurement in solid substances, especially on wood, wood-based materials and building materials were examined and evaluated according to the literature available. The question was which methods of examining the moisture distribution in building elements at climate loading offer the best accuracy and spatial resolution as well as which methods are the most appropriate at present and in future for the solution of measurement problems in the wood and wood-based industry. The most common methods are electric measurement methods which are utilizing either the moisture-depending conductivity or the dielectric constant or the reflectivity of the material for infrared radiation but they offer only a limited accuracy. The same is valid for the rarely used microwave methods or X-ray and NMR tomography. Simple electric methods will further on play an important role in the industrial process measuring technique. For the examination of building elements, methods using nuclear radiation still offer possibilities for a further development. (orig.) With 207 refs., 13 figs [de

Mathematical models of some geomagnetic storms with SC

International Nuclear Information System (INIS)

Ivanova, P.K.

1990-01-01

Regressive equations for H horizontal component of three geomagnetic storms with Sc:0.1.03.82, 24.01.74 and 23.03.69 -are calculated using step-by-step regression analysis. These equations relate H with parameters of solar wind and interplanetary magnetic field. Nonlinear, square, logarithmic and trigonometric dependences are considered, as well. Most essential parameters, which contribute mostly into Sc, are determined from multiplicity (46 factors) of independent parameters

Radiation protection Group (SC/RP) desperately seeking...

CERN Document Server

A. Hervé, Y. Donjoux / SC

2006-01-01

We are trying to trace two transit permits (passavants), which constitute the customs clearance documentation for two 'AD6'portable radiation detectors. The two permits (No. 1308 and No. 1309) were sent in the same internal mail envelope towards the middle of March 2006 but never reached their final destination. After weeks of searching in vain, we are now appealing for your help. If you have these two permits in your possession, please get in touch with us. Many thanks in advance. A.HERVE - SC/RP- ( 163168 / 70927) Y.DONJOUX - SC/RP - (160105 / 73171)

[Roberts-SC phocomelia syndrome].

Science.gov (United States)

Musfeld, D A; Bühler, E M; Heinzl, S

2001-01-01

The Roberts-SC phocomelia syndrome is a rare autosomal recessive inherited disorder clinically manifested by tetraphocomelia, pre- and postnatal growth retardation, and craniofacial abnormalities (skull, eyes, lip, and palate), accompanied at times by centromer puffing and splitting, renal abnormalities, heart defect, clitoral or penile enlargement, and bilateral corneal opacities. Mental retardation is common in surviving patients.

Model of Dees and Rotco for the 600 MeV SC

CERN Multimedia

CERN PhotoLab

1978-01-01

The accelerating frequency of the 600 MeV Synchro-Cyclotron (SC) was modulated by the varying capacity of a rotating condenser ("Rotco", the most delicate component of the SC). A 1/5-scale model, dating from the design-period of the SC, was used to study improvements to the SC RF-system, and also the acceleration of ions, first Helium and, at the time of this picture, Carbon. In the middle of the picture is the case containing the Dees. To the left, at the wide end of the cone, a rotco. Reinhold Hohbach is busy with measurements. See also 7805235 (Annual Report 1978, p.110).

Respiratory symptoms and lung function in relation to wood dust and monoterpene exposure in the wood pellet industry.

Science.gov (United States)

Löfstedt, Håkan; Hagström, Katja; Bryngelsson, Ing-Liss; Holmström, Mats; Rask-Andersen, Anna

2017-06-01

Wood pellets are used as a source of renewable energy for heating purposes. Common exposures are wood dust and monoterpenes, which are known to be hazardous for the airways. The purpose of this study was to study the effect of occupational exposure on respiratory health in wood pellet workers. Thirty-nine men working with wood pellet production at six plants were investigated with a questionnaire, medical examination, allergy screening, spirometry, and nasal peak expiratory flow (nasal PEF). Exposure to wood dust and monoterpenes was measured. The wood pellet workers reported a higher frequency of nasal symptoms, dry cough, and asthma medication compared to controls from the general population. There were no differences in nasal PEF between work and leisure time. A lower lung function than expected (vital capacity [VC], 95%; forced vital capacity in 1 second [FEV 1 ], 96% of predicted) was noted, but no changes were noted during shifts. There was no correlation between lung function and years working in pellet production. Personal measurements of wood dust at work showed high concentrations (0.16-19 mg/m 3 ), and exposure peaks when performing certain work tasks. Levels of monoterpenes were low (0.64-28 mg/m 3 ). There was no association between exposure and acute lung function effects. In this study of wood pellet workers, high levels of wood dust were observed, and that may have influenced the airways negatively as the study group reported upper airway symptoms and dry cough more frequently than expected. The wood pellet workers had both a lower VC and FEV 1 than expected. No cross-shift changes were found.

First coil for the SC

CERN Multimedia

CERN PhotoLab

1955-01-01

The coils for the SC magnet were stored in the large hangar of the Cointrin Airport (to make sure that they would be available before snow and ice would block the roads and canals from Belgium, where they were built).

Bioremediation of treated wood with fungi

Science.gov (United States)

Barbara L. Illman; Vina W. Yang

2006-01-01

The authors have developed technologies for fungal bioremediation of waste wood treated with oilborne or metal-based preservatives. The technologies are based on specially formulated inoculum of wood-decay fungi, obtained through strain selection to obtain preservative-tolerant fungi. This waste management approach provides a product with reduced wood volume and the...

Some peculiarities of ScFe2 and ScNi2 interaction with ammonia in the presence of NH4Cl

International Nuclear Information System (INIS)

Shilkin, S.P.; Fokin, V.N.; Fokina, Eh.Eh.; Tarasov, B.P.; Korobkov, I.I.

2000-01-01

Interaction of ScFe 2 and ScNi 2 intermetallic compounds with ammonia in the presence of NH 4 Cl (10 mass % from intermetallide introduced in reaction) as an activator of the process in initial ammonia pressure 0.6-0.8 MPa is investigated. Possibility of preparation of crystalline intermetallide hydrides and amorphous products in highly dispersed state at different temperature are shown. It is established that intermetallides decompose in ammonia medium at ≥ 450 Deg C [ru

Weathering methods for preservative treated wood and their applicability for fire retarded wood

NARCIS (Netherlands)

Voss, A.

1999-01-01

preservative treated wood. The aim of the presentation is to inform you about current testing methods and to discuss their applicability to test fire retarded wood in outdoor use. Assuming that fire retardants will only be used in out of ground contact, only those methods are mentioned, which fit

Theoretical study of stability and superconductivity of ScHn (n =4 -8 ) at high pressure

Science.gov (United States)

Qian, Shifeng; Sheng, Xiaowei; Yan, Xiaozhen; Chen, Yangmei; Song, Bo

2017-09-01

The synthesis of hydrogen sulfides, with the potential of high-temperature superconductivity, was recently proposed at high Tc = 203 K. It motivated us to employ an ab initio approach for the predictions of crystal structures to find the stable scandium hydrides. In addition to the earlier predicted three stoichiometries of ScH, ScH2, and ScH3, we identify three other metallic stoichiometries of ScH4, ScH6, and ScH8, which show superconductivity at significantly higher temperatures. The phases of ScH4 and ScH6, whose stability does not require extremely high pressures (ZPE), are primarily ionic compounds containing exotic quasimolecular H2 arrangements. The present electron-phonon calculations revealed the superconductive potential of ScH4 and ScH6 with estimated Tc of 98 K and 129 K at 200 GPa and 130 GPa, respectively. The superconductivity of ScHn stems from the large electron-phonon coupling associated with the wagging, bending, and intermediate-frequency modes attributed mainly to the hydrogen atoms.

Wood Export and Deposition Dynamics in Mountain Watersheds

Science.gov (United States)

Senter, Anne Elizabeth

Wood dynamics that store, transport, break down, and ultimately export wood pieces through watershed networks are key elements of stream complexity and ecosystem health. Efforts to quantify wood processes are advancing rapidly as technological innovations in field data collection, remotely sensed data acquisition, and data analyses become increasingly sophisticated. The ability to extend the temporal and spatial scales of wood data acquisition has been particularly useful to the investigations presented herein. The primary contributions of this dissertation are focused on two aspects of wood dynamics: watershed-scale wood export processes as identified using the depositional environment of a mountain reservoir, and wood deposition mechanisms in a bedrock-dominated mountain river. Three chapters present this work: In Chapter 1, continuous video monitoring of wood in transport revealed seasonal and diurnal hydrologic cycle influences on the variable rates at which wood transports. This effort supports the efficacy of utilizing continuous data collection methods for wood transport studies. Annual wood export data were collected via field efforts and aerial image analyses from New Bullards Bar Reservoir on the North Yuba River, Sierra Nevada, California. Examination of data revealed linkages between decadal-scale climatic patterns, large flood events, and episodic wood export quantities. A watershed-specific relation between wood export quantities and annual peak discharge contributes to the notion that peak discharge is a primary control on wood export, and yielded prediction of annual wood export quantities where no data were available. Linkages between seasonality, climatic components, and hydrologic events that exert variable control on watershed scale wood responses are presented as a functional framework. An accompanying conceptual model supports the framework presumption that wood responses are influenced by seasonal variations in Mediterranean-montane climate

Methods for production of UNK SC-dipoles magnetic measurements

International Nuclear Information System (INIS)

Smirnov, N.L.

1991-01-01

Many SC-dipoles for UNK will require from the chosen magnetic measurement methods high accuracy and efficiency. The brief of using methods, their possibilities and analysis of their errors are given. The measurements results for a full-scale model of SC-dipole SPDM1 are presented. 5 refs.; 4 figs.; 4 tabs

Wood quality changes caused by mineral fertilization

Directory of Open Access Journals (Sweden)

Carlos Roberto Sette Jr

2014-06-01

Full Text Available The diverse and important use of wood from fast growth eucalyptus plantations requires the analysis of the effect of mineral fertilizers on wood quality. The objective of this study was to evaluate the anatomical characteristics and wood density from Eucalyptus grandis trees (3 m x 2 m spacing fertilized with potassium and sodium (at planting, 6 th and 12th month. Fifteen (15 6 years old eucalyptus trees were selected (5 trees/treatment, cut and wood samples at DBH (1,3 m were taken for anatomical characteristics (fiber and vessels and wood density analysis. Results showed that eucalyptus trees treated with mineral fertilizers did not show significant alteration in average wood density, with radial profile model common to all three treatments, characterized by a values increase in the region next to the pith, toward to bark. Mineral fertilization influenced wood anatomical characteristics: treatment with sodium was characterized by thinner walls and lumen larger diameter; in treatment with potassium, larger vessels were detected.

Study of the hyperfine magnetic field at Ta181 site in the Heusler Co2 Sc Sn, Co2 Sc Ga and Co2 Hf Sn alloys

International Nuclear Information System (INIS)

Attili, R.N.

1992-01-01

The hyperfine magnetic fields acting on 181 Ta nuclei at the Sc and Hf sites have been measured in Heusler alloys Co 2 Sc Sn and Co 2 Sc Ga and Co 2 Hf Sn using the Time Differential Perturbed γ-γ Angular Correlation (TDPAC) technique. The measurements were carried out using an automatic spectrometer consisting of two Ba F 2 detectors and the conventional electronics. The magnitude of hyperfine magnetic field at 181 Ta was measured for all the alloys. The signs of the were determined in the cases of Co 2 Sc Sn and Co 2 Hf Sn alloys by performing the Perturbed Angular Correlation measurements with an external polarizing magnetic field of ≅ 5 k Gauss. The hyperfine magnetic fields obtained are -187,6± 3,3 and 90,0 ± 2,1 kOe measured at 77 K for Co 2 Sc Sn and Co 2 Sc Ga alloys respectively, and -342,4 ± 10,1 kOe measured at the room temperature for Co 2 Hf Sn alloy. These results are discussed and compared with the hyperfine magnetic field systematics in Co-based Heusler alloy. (author)

Still rethinking the value of high wood density.

Science.gov (United States)

Larjavaara, Markku; Muller-Landau, Helene C

2012-01-01

In a previous paper, we questioned the traditional interpretation of the advantages and disadvantages of high wood density (Functional Ecology 24: 701-705). Niklas and Spatz (American Journal of Botany 97: 1587-1594) challenged the biomechanical relevance of studying properties of dry wood, including dry wood density, and stated that we erred in our claims regarding scaling. We first present the full derivation of our previous claims regarding scaling. We then examine how the fresh modulus of rupture and the elastic modulus scale with dry wood density and compare these scaling relationships with those for dry mechanical properties, using almost exactly the same data set analyzed by Niklas and Spatz. The derivation shows that given our assumptions that the modulus of rupture and elastic modulus are both proportional to wood density, the resistance to bending is inversely proportional to wood density and strength is inversely proportional with the square root of wood density, exactly as we previously claimed. The analyses show that the elastic modulus of fresh wood scales proportionally with wood density (exponent 1.05, 95% CI 0.90-1.11) but that the modulus of rupture of fresh wood does not, scaling instead with the 1.25 power of wood density (CI 1.18-1.31). The deviation from proportional scaling for modulus of rupture is so small that our central conclusion remains correct: for a given construction cost, trees with lower wood density have higher strength and higher resistance to bending.

Level densities and γ strength functions in light Sc and Ti isotopes

International Nuclear Information System (INIS)

Burger, A.; Larsen, A.C.; Syed, N.U.H.; Guttormsen, M.; Nyhus, H.; Siem, S.; Harissopulos, S.; Konstantinopoulos, T.; Lagoyannis, A.; Perdidakis, G.; Spyrou, A.; Kmiecik, M.; Mazurek, K.; Krticka, M.; Loennroth, T.; Norby, M.; Voinov, A.

2010-01-01

We present preliminary results from a measurement of nuclear level densities and the γ-ray strength of light Sc (Sc 43 , Sc 45 ) and Ti (Ti 44 , Ti 45 and Ti 46 ) isotopes using the Oslo Method. The article begins with a presentation of the experimental setup. (authors)

CO2 abatement potential of wood utilisation. Wood as an energy carrier

International Nuclear Information System (INIS)

Wegener, G.; Fruehwald, A.

1994-01-01

Forests as ecosystems not only supply the raw material wood but also exert an influence on soils, water resources and many other ecological factors; provide animals with a habitat; and offer as humans a place for recreation. Recently, forests and wood have become of interest to human civilisation from yet another aspect: they constitute a carbon storage. This means that forestry and the forest industries can help moderate the increase of atmospheric CO 2 concentrations, which is essentially the result of energetic utilisation of fossil fuels and considered the decisive factor underlying the greenhouse effect. Besides constituting a carbon storage, forests hold an additional CO 2 abatement potential which can be realised by continuous utilisation of wood. (orig./EF) [de