WorldWideScience

Sample records for sandra bowman damico

  1. Interview with Sandra Thompson.

    Science.gov (United States)

    Huang, Chiung-chih

    1994-01-01

    Presents an interview of Sandra Thompson on various topics relating to the Chinese language. The interview touches on conversational data on Chinese, the lack of morphological complexity in Mandarin Chinese, and the development of Chinese functionalism. (12 references) (CK)

  2. Kaliningradi biennaal / Sandra Jõgeva

    Index Scriptorium Estoniae

    Jõgeva, Sandra, 1976-

    2008-01-01

    IX rahvusvaheline graafikabiennaal "Kaliningrad-Königsberg 2008" Kaliningradi kunstigaleriis 15. IX-15. XI. Eesti väljapanek (kuraator Eha Komissarov, kujundaja Marko Nautras, osalejad: Jaanika Okk, Kaarel Kütas, Lauri Koppel, Gerda Märtens, Raul Meel, Lembe Ruben, HULA, Villem Jahu, Tiiu Pirsko, Mati Veermets, Sandra Jõgeva) sai ekspositsioonipreemia. Grand prix - Paulis Liepa, I preemia - Olrik Kohlhoff, II - Dominica Sadowska, III - Raffael Rheinsberg, eripreemia - Markus Lampinen

  3. Kaliningradi biennaal / Sandra Jõgeva

    Index Scriptorium Estoniae

    Jõgeva, Sandra, 1976-

    2008-01-01

    IX rahvusvaheline graafikabiennaal "Kaliningrad-Königsberg 2008" Kaliningradi kunstigaleriis 15. IX-15. XI. Eesti väljapanek (kuraator Eha Komissarov, kujundaja Marko Nautras, osalejad: Jaanika Okk, Kaarel Kütas, Lauri Koppel, Gerda Märtens, Raul Meel, Lembe Ruben, HULA, Villem Jahu, Tiiu Pirsko, Mati Veermets, Sandra Jõgeva) sai ekspositsioonipreemia. Grand prix - Paulis Liepa, I preemia - Olrik Kohlhoff, II - Dominica Sadowska, III - Raffael Rheinsberg, eripreemia - Markus Lampinen

  4. Läbipaistva saunaga Austraalias / Sandra Jõgeva

    Index Scriptorium Estoniae

    Jõgeva, Sandra, 1976-

    2010-01-01

    Kunstnike grupp Art Container osales Brisbane'i teatrifestivalil (4.-25. sept. 2010) interaktiivse etenduse ja saunainstallatsiooniga "Kümblejad" (autorid Tanel Saar, Erik Alalooga, Sandra Jõgeva, Janno Bergmann, Hans-Gunter Lock)

  5. Läbipaistva saunaga Austraalias / Sandra Jõgeva

    Index Scriptorium Estoniae

    Jõgeva, Sandra, 1976-

    2010-01-01

    Kunstnike grupp Art Container osales Brisbane'i teatrifestivalil (4.-25. sept. 2010) interaktiivse etenduse ja saunainstallatsiooniga "Kümblejad" (autorid Tanel Saar, Erik Alalooga, Sandra Jõgeva, Janno Bergmann, Hans-Gunter Lock)

  6. Power analysis for multivariate and repeated measurements designs via SPSS: correction and extension of D'Amico, Neilands, and Zambarano (2001).

    Science.gov (United States)

    Osborne, Jason W

    2006-05-01

    D'Amico, Neilands, and Zambarano (2001) published SPSS syntax to perform power analyses for three complex procedures: ANCOVA, MANOVA, and repeated measures ANOVA. Unfortunately, the published SPSS syntax for performing the repeated measures analysis needed some minor revision in order to perform the analysis correctly. This article presents the corrected syntax that will successfully perform the repeated measures analysis and provides some guidance on modifying the syntax to customize the analysis.

  7. Battling Machismo in the Poetry and Prose of Sandra Cisneros.

    Science.gov (United States)

    Breshears, Russell D.

    Sandra Cisneros is giving a voice to farm workers, migrant workers, and Latinos living in the inner cities across the United States in poems and short stories that call attention to gender, class, and race issues that many would prefer to ignore. While her women protagonists challenge destructive "machismo," which takes the form of…

  8. Alytuse biennaal kui kaitsepolügon / Sandra Jõgeva

    Index Scriptorium Estoniae

    Jõgeva, Sandra, 1976-

    2007-01-01

    Leedus Alytuse väikelinnas 20.-26.08.2007 toimunud eksperimentaalkunsti festivalist. II Alytuse biennaali korraldaja Mantas Kazakevicius, osalejad Inglismaalt, Tšehhist, Iirimaalt, Madalmaadest, Lätist, Leedust ja Eestist (Erik Alalooga, Ville Karel Viirelaid ja Sandra Jõgeva)

  9. Ellujäämiskursus / interv. Sandra Jõgeva

    Index Scriptorium Estoniae

    2008-01-01

    Non Grata Kunstikonteineris kuni 17. XI näitus "Dekonstruktsioon/Rekonstruktsioon", Orion Maxtedi ja Tanel Saare workshop'i jäädvustus. Workship'is osalesid performance'i-kunstnikud Beth Greenhalgh, Samuel Hasler, Yoko Ishiguro, maalikunstnik Josephine Wood, helikunstnik Simon Whetham ja Sandra Jõgeva

  10. Alytuse biennaal kui kaitsepolügon / Sandra Jõgeva

    Index Scriptorium Estoniae

    Jõgeva, Sandra, 1976-

    2007-01-01

    Leedus Alytuse väikelinnas 20.-26.08.2007 toimunud eksperimentaalkunsti festivalist. II Alytuse biennaali korraldaja Mantas Kazakevicius, osalejad Inglismaalt, Tšehhist, Iirimaalt, Madalmaadest, Lätist, Leedust ja Eestist (Erik Alalooga, Ville Karel Viirelaid ja Sandra Jõgeva)

  11. Ellujäämiskursus / interv. Sandra Jõgeva

    Index Scriptorium Estoniae

    2008-01-01

    Non Grata Kunstikonteineris kuni 17. XI näitus "Dekonstruktsioon/Rekonstruktsioon", Orion Maxtedi ja Tanel Saare workshop'i jäädvustus. Workship'is osalesid performance'i-kunstnikud Beth Greenhalgh, Samuel Hasler, Yoko Ishiguro, maalikunstnik Josephine Wood, helikunstnik Simon Whetham ja Sandra Jõgeva

  12. 'Miss Frances', 'Miss Gail' and 'Miss Sandra' Crapemyrtles

    Science.gov (United States)

    The Agricultural Research Service, United States Department of Agriculture, announces the release to nurserymen of three new crapemyrtle cultivars named 'Miss Gail', 'Miss Frances', and 'Miss Sandra'. ‘Miss Gail’ resulted from a cross-pollination between ‘Catawba’ as the female parent and ‘Arapaho’ ...

  13. Malle Leisi ja Sandra Jõgeva kontrastvärvides perepilt / Malle Leis, Sandra Jõgeva ; intervjueerinud Tanel Veenre

    Index Scriptorium Estoniae

    Leis, Malle, 1940-

    2010-01-01

    Intervjuu 9. juulil 70. sünnipäeva tähistanud maalikunstniku ja graafiku Malle Leisi ning tema tütre, kunstniku ja kirjaniku Sandra Jõgevaga. Kunstnikud endast, oma ja teineteise loomingust, huvist selle vastu, neid ühendavast, ideede taaskasutamisest, praegusest maalist, sotsiaalsest kunstist jm. Kunstnike eluloolisi andmeid ja andmeid nende loomingulise tegevuse kohta

  14. Malle Leisi ja Sandra Jõgeva kontrastvärvides perepilt / Malle Leis, Sandra Jõgeva ; intervjueerinud Tanel Veenre

    Index Scriptorium Estoniae

    Leis, Malle, 1940-

    2010-01-01

    Intervjuu 9. juulil 70. sünnipäeva tähistanud maalikunstniku ja graafiku Malle Leisi ning tema tütre, kunstniku ja kirjaniku Sandra Jõgevaga. Kunstnikud endast, oma ja teineteise loomingust, huvist selle vastu, neid ühendavast, ideede taaskasutamisest, praegusest maalist, sotsiaalsest kunstist jm. Kunstnike eluloolisi andmeid ja andmeid nende loomingulise tegevuse kohta

  15. Sandy ja Hugh - paar või mitte? / Hugh Grant, Sandra Bullock

    Index Scriptorium Estoniae

    Grant, Hugh, 1960-

    2003-01-01

    Romantilises komöödias "Kaks nädalat armumiseks" ("Two Weeks Notice"), režissöör Marc Lawrence, mängivad kaks kuulsat näitlejat. Staarid oma suhetest : Hugh Grant : "Sandra on geenius"; Sandra Bullock : "Oleme temaga nagu kaksikud!"

  16. Sandy ja Hugh - paar või mitte? / Hugh Grant, Sandra Bullock

    Index Scriptorium Estoniae

    Grant, Hugh, 1960-

    2003-01-01

    Romantilises komöödias "Kaks nädalat armumiseks" ("Two Weeks Notice"), režissöör Marc Lawrence, mängivad kaks kuulsat näitlejat. Staarid oma suhetest : Hugh Grant : "Sandra on geenius"; Sandra Bullock : "Oleme temaga nagu kaksikud!"

  17. Polymeri utoopiline festival meelitab uue maailma kunstnikke / Sandra Jõgeva ; intervjueerinud Mari Peegel

    Index Scriptorium Estoniae

    Jõgeva, Sandra, 1976-

    2011-01-01

    Festivali kava üks koostajaid Sandra Jõgeva 24.-28. augustini 2011 toimuvast kultuuritehase Polymer festivalist ja tähtsamatest esinejatest. Selle aasta festivalil tegeldakse utoopiliste visioonidega

  18. Sandra Pihlak - kõik või mitte midagi / Joanna Hoffmann

    Index Scriptorium Estoniae

    Hoffmann, Joanna

    2016-01-01

    Eesti Kunstiakadeemia vilistlane ja Londoni Püha Martini kunsti- ja disainikolledži (Central Saint Matrins College of Art and Design - CSM) magistrant Sandra Pihlak tekstiilidisaini bakalaureuseõpingutest Eestis ja tulevikumaterjalide eriala magistriõpingutest Londonis

  19. Polymeri utoopiline festival meelitab uue maailma kunstnikke / Sandra Jõgeva ; intervjueerinud Mari Peegel

    Index Scriptorium Estoniae

    Jõgeva, Sandra, 1976-

    2011-01-01

    Festivali kava üks koostajaid Sandra Jõgeva 24.-28. augustini 2011 toimuvast kultuuritehase Polymer festivalist ja tähtsamatest esinejatest. Selle aasta festivalil tegeldakse utoopiliste visioonidega

  20. Bowman-Birk inhibitor affects pathways associated with energy metabolism in Drosophila melanogaster

    Science.gov (United States)

    Bowman-Birk inhibitor (BBI) is toxic when fed to certain insects, including the fruit fly, Drosophila melanogaster. Dietary BBI has been demonstrated to slow growth and increase insect mortality by inhibiting the digestive enzymes trypsin and chymotrypsin, resulting in a reduced supply of amino acid...

  1. Fractal analysis of AFM images of the surface of Bowman's membrane of the human cornea.

    Science.gov (United States)

    Ţălu, Ştefan; Stach, Sebastian; Sueiras, Vivian; Ziebarth, Noël Marysa

    2015-04-01

    The objective of this study is to further investigate the ultrastructural details of the surface of Bowman's membrane of the human cornea, using atomic force microscopy (AFM) images. One representative image acquired of Bowman's membrane of a human cornea was investigated. The three-dimensional (3-D) surface of the sample was imaged using AFM in contact mode, while the sample was completely submerged in optisol solution. Height and deflection images were acquired at multiple scan lengths using the MFP-3D AFM system software (Asylum Research, Santa Barbara, CA), based in IGOR Pro (WaveMetrics, Lake Oswego, OR). A novel approach, based on computational algorithms for fractal analysis of surfaces applied for AFM data, was utilized to analyze the surface structure. The surfaces revealed a fractal structure at the nanometer scale. The fractal dimension, D, provided quantitative values that characterize the scale properties of surface geometry. Detailed characterization of the surface topography was obtained using statistical parameters, in accordance with ISO 25178-2: 2012. Results obtained by fractal analysis confirm the relationship between the value of the fractal dimension and the statistical surface roughness parameters. The surface structure of Bowman's membrane of the human cornea is complex. The analyzed AFM images confirm a fractal nature of the surface, which is not taken into account by classical surface statistical parameters. Surface fractal dimension could be useful in ophthalmology to quantify corneal architectural changes associated with different disease states to further our understanding of disease evolution.

  2. Vabadussamba valmimise tähtaeg kõlgub ohujoonel / Sandra Maasalu

    Index Scriptorium Estoniae

    Maasalu, Sandra

    2008-01-01

    Tallinna linnavalitsus viivitab Vabadussõja võidusambale ehitusloa väljaandmisega. Samba valmimise tähtaeg on ohus. Kommenteerivad Veiko Pärlin ja Taavi Aas. Samal teemal ka lk. 1 "Nägelus pidurdab samba valmimist" ja lk. 2 Sandra Maasalu repliik "Tee eikuhugi"

  3. Nüüd kunst, nüüd tulevik / Sandra Jõgeva

    Index Scriptorium Estoniae

    Jõgeva, Sandra, 1976-

    2008-01-01

    Vilniuse II rahvusvaheline graafikabiennal "Present Time. Now Art Now Future" Vilniuse Kaasaegse Kunsti Keskuses kuni 11. V. Kuraatorid Ignas Kazakevicius ja Jurate Rekeviciute. Eestist osalevad Peeter Allik, Eve Kask ja Sandra Jõgeva. Kuraator Jurate Rekeviciute biennaali alanäitusest "Valmis ajalooks" Gediminase avenüü kaubanduskeskuse galeriis

  4. Nüüd kunst, nüüd tulevik / Sandra Jõgeva

    Index Scriptorium Estoniae

    Jõgeva, Sandra, 1976-

    2008-01-01

    Vilniuse II rahvusvaheline graafikabiennal "Present Time. Now Art Now Future" Vilniuse Kaasaegse Kunsti Keskuses kuni 11. V. Kuraatorid Ignas Kazakevicius ja Jurate Rekeviciute. Eestist osalevad Peeter Allik, Eve Kask ja Sandra Jõgeva. Kuraator Jurate Rekeviciute biennaali alanäitusest "Valmis ajalooks" Gediminase avenüü kaubanduskeskuse galeriis

  5. Environmental assessment of remedial action at the inactive uraniferous lignite processing sites at Belfield and Bowman, North Dakota. [UMTRA Project

    Energy Technology Data Exchange (ETDEWEB)

    Beranich, S.; Berger, N.; Bierley, D.; Bond, T.M.; Burt, C.; Caldwell, J.A.; Dery, V.A.; Dutcher, A.; Glover, W.A.; Heydenburg, R.J.; Larson, N.B.; Lindsey, G.; Longley, J.M.; Millard, J.B.; Miller, M.; Peel, R.C.; Persson-Reeves, C.H.; Titus, F.B.; Wagner, L.

    1989-09-01

    The Uranium Mill Tailings Radiation Control Act of 1978 (UMTRCA), to clean up the Belfield and Bowman, North Dakota, uraniferous lignite processing sites to reduce the potential health impacts associated with the residual radioactive materials remaining at these sites. Remedial action at these sites must be performed in accordance with the US Environmental Protection Agency's (EPA) standards promulgated for the remedial action and with the concurrence of the US Nuclear Regulatory Commission (NRC) and the state of North Dakota. The inactive Belfield uraniferous lignite processing site is one mile southeast of Belfield, North Dakota. The inactive Bowman uraniferous lignite processing site at the former town of Griffin, is seven miles northwest of Bowman, North Dakota and 65 road miles south of Belfield. Lignite ash from the processing operations has contaminated the soils over the entire 10.7-acre designated Belfield site and the entire 12.1-acre designated Bowman site. Dispersion of the ash has contaminated an additional 20.6 acres surrounding the Belfield processing site and an additional 59.2 acres surrounding the Bowman processing site. The proposed remedial action is to relocate the contaminated materials at the Belfield processing site to the Bowman processing/disposal site for codisposal with the Bowman contaminated soils. The environmental impacts assessed in this EA were evaluated for the proposed remedial action and the no action alternative and demonstrate that the proposed action would not significantly affect the quality of the human environment and would be performed in compliance with applicable environmental laws. The no action alternative would not be consistent with the intent of Public Law 95-604 and would not comply with the EPA standards. 48 refs., 10 figs., 7 tabs.

  6. [Epi-Bowman Keratectomy: Clinical Evaluation of a New Method of Surface Ablation].

    Science.gov (United States)

    Taneri, S; Kießler, S; Rost, A; Schultz, T; Elling, M; Dick, B

    2017-02-10

    Purpose A new device for epithelial abrasion before excimer laser surface ablation or corneal cross-linking (CXL) has recently been introduced (Epi-Clear™, Orca Surgical, Kiryat-Shmona, Israel). We have reviewed the literature on the clinical results, potential benefits and drawbacks of this instrument, compared to other methods of epithelial removal. Method Literature search for "Epi-Bowman Keratectomy", "Epi-clear", and "Epikeratome" yielded 1 peer-review publication, 1 non-peer-review publication, 18 posters and presentations at international conferences (European Society of Cataract and Refractive Surgeons [ESCRS] and American Society of Cataract and Refractive Surgery [ASCRS]) on the use of the Epi-Clear™ device before surface ablation, 2 posters on the use of Epi-Clear before corneal crosslinking and 1 presentation on the experimental use of Epi-Clear for removal of a pterygium. Results Comparison of laser ablation after epithelial removal with the Epi-Clear device (Epi-Bowman Keratectomy™, EBK™) to other established methods of surface ablation, i.e. alcohol-assisted PRK or PRK with a metallic scraper, EBK, suggests that the results are generally similar. Pain perception, haze formation, and epithelial healing are reported to be better than with conventional surface ablation methods. Studies evaluating the use of the Epi-Clear device before CXL report that the healing time is significantly reduced and that less pain is perceived. Conclusion The Epi-Clear device seems to be a promising new option for epithelial removal before refractive laser ablation, although a convincing explanation for its potential superiority is still missing. In contrast, when the Epi-Clear device is used before CXL, then the Bowman's layer remains intact; this may provide an adequate explanation for the reported benefits of this application. However, currently available studies are of low level of evidence, so that more prospective randomised trials are needed for a robust

  7. Milnesium minutum and Milnesium sandrae, two new species of Milnesiidae (Tardigrada, Eutardigrada, Apochela).

    Science.gov (United States)

    Pilato, Giovanni; Lisi, Oscar

    2016-01-01

    Two new species of Milnesium are described, Milnesium minutum sp. n. from Sicily and Milnesium sandrae sp. n. from the Hawaiian Archipelago. The body size of Milnesium minutum is the smallest of the known species of the genus. The stylet supports are inserted on the buccal tube at 63-66% of its length and the claws have a [3-3]-[3-3] configuration. Milnesium sandrae has stylet supports inserted on the buccal tube at 58-60.5% of its length, a [3-3]-[3-3] claw configuration, and the percent ratio between the secondary claw and primary claw length on legs I-III (78.6%-85.5%) clearly higher than on legs IV (70.5%-71.4%). With the description of these two new species, the number of species in the genus is increased to 31.

  8. The biochemical and functional food properties of the bowman-birk inhibitor.

    Science.gov (United States)

    Losso, Jack N

    2008-01-01

    The Bowman-Birk inhibitor (BBI) is a small water-soluble protein present in soybean and almost all monocotyledonous and dicotyledonous seeds. The molecular size of BBI ranges from 1,513 Da to about 20,000 Da. BBI is to seeds what alpha(1)-antitrypsin is to humans. Soy-based food products rich in BBI include soybean grits, soymilk, oilcake, soybean isolate, and soybean protein concentrate. BBI is stable within the pH range encountered in most foods, can withstand boiling water temperature for 10 min, resistant to the pH range and proteolytic enzymes of the gastrointestinal tract, bioavailable, and not allergenic. BBI reduces the proteolytic activities of trypsin, chymotrypsin, elastase, cathepsin G, and chymase, serine protease-dependent matrix metalloproteinases, urokinase protein activator, mitogen activated protein kinase, and PI3 kinase, and upregulates connexin 43 (Cx43) expression. Several studies have demonstrated the efficacy of BBI against tumor cells in vitro, animal models, and human phase IIa clinical trials. FDA considers BBI as a drug. In 1999, FDA allowed a health claim on food labels stating that a daily diet containing 25 grams of soy protein, also low in saturated fat and cholesterol, may reduce the risk of heart disease [corrected] This review highlights the biochemical and functional food properties of the Bowman-Birk inhibitor.

  9. Growing location has a pronounced effect on the accumulation of cancer chemopreventive agent Bowman-Birk inhibitor in soybean seeds

    Science.gov (United States)

    Soybeans contain several health promoting compounds including phytosterols, isoflavones, phytic acid, and protease inhibitors. The two abundant protease inhibitors of soybean seeds are the Kunitz trypsin inhibitor and the Bowman-Birk inhibitor (BBI). BBI is a serine protease inhibitor that can inhi...

  10. So-called embryonal hyperplasia of Bowman's capsular epithelium: an immunohistochemical and ultrastructural study.

    Science.gov (United States)

    Ogata, K; Hajikano, H; Sakaguchi, H

    1991-01-01

    The so-called embryonal hyperplasia of Bowman's capsular epithelium (EHBCE) is a rather specific lesion occurring in kidneys of patients maintained on chronic dialysis. It consists of poorly differentiated cells proliferating around sclerosed or obsolescent glomeruli. In this study, immunohistochemical and ultrastructural characterization of EHBCE was performed. The poorly differentiated cells in the lesion exhibited a positive reaction for vimentin and a negative one for cytokeratin (PKK 1) and epithelial membrane antigen. On ultrastructural examination, specialized junctions between adjoining cells, microvilli-like structures on their surfaces, and immature basal folds were observed. These observations suggest that the cells of EHBCE may be associated with the anlage of glomerular epithelium. The background in which neoplasms like renal cell carcinoma or atypical epithelium of cyst wall develop in end-stage kidneys of adult patients on long-term dialysis may cause such a proliferation of poorly differentiated cells in young or paediatric age group patients.

  11. Structural Features and Molecular Evolution of Bowman-Birk Protease Inhibitors and Their Potential Application

    Institute of Scientific and Technical Information of China (English)

    Rui-Feng QI; Zhan-Wu SONG; Cheng-Wu CHI

    2005-01-01

    The Bowman-Birk inhibitors (BBIs) are well-studied serine protease inhibitors that are abundant in dicotyledonous and monocotyledonous plants. BBIs from dicots usually have a molecular weight of 8k and are double-headed with two reactive sites, whereas those from monocots can be divided into two classes, one approximately 8 kDa in size with one reactive site (another reactive site was lost) and the other approximately 16 kDa in size with two reactive sites. The reactive site is located at unique exposed surfaces formed by a disulfide-linked β-sheet loop that is highly conserved, rigid and mostly composed of nine residues. The structural features and molecular evolution of inhibitors are described, focusing on the conserved disulfide bridges. The sunflower trypsin inhibitor-1 (SFTI-1), with 14 amino acid residues, is a recently discovered bicyclic inhibitor, and is the most small and potent naturally occurring Bowman-Birk inhibitor.Recently, BBIs have become a hot topic because of their potential applications. BBIs are now used for defense against pathogens and insects in transgenic plants, which has advantages over using toxic and polluting insecticides. BBIs could also be applied in the prevention of cancer, Dengue fever, and inflammatory and allergic disorders, because of their inhibitory activity with respect to the serine proteases that play a pivotal role in the development and pathogenesis of these diseases. The canonical nine-residue loop of BBIs/STFI-1 provides an ideal template for drug design of specific inhibitors to target their respective proteases.

  12. [Contributions to the chemical study of the essential oil isolated from coriander fruits (Sandra cultivar)].

    Science.gov (United States)

    Trifan, Adriana; Aprotosoaie, Ana Clara; Spac, A; Hăncianu, Monica; Miron, Anca; Stănescu, Ursula

    2011-01-01

    Coriandrum sativum L. (Apiaceae) is a well known herb, native to the Mediterranean region, also intensively cultivated in Romania. The essential oil obtained from Coriandri fructus posseses antimicrobial, antioxidant and anxiolytic effects. Many parameters such as genetic and climatic factors or agronomical practices can influence the yield and composition of the volatile fraction. Plant density is an important factor for the microenvironment in coriander field. In order to study the effect of planting density on the yield of the essential oil and its composition, a bifactorial experiment was carried out on coriander plants (Sandra cultivar). The experiment was performed with three plant densities on the row (0, 15 and 20 cm); the distance between plant rows was 12.5, 25 and 50 cm, respectively. So, it resulted nine experimental variants. The essential oils obtained by hydrodistillation from fruits have been characterized using gas chromatography and mass spectroscopy analysis (GC-MS). The highest yield (7.9866 kg/ha) was obtained for the plants spaced at 20 cm in between and 25 cm row spacing. The highest content of monoterpene alcohols (50.96%) was obtained with 25 cm row spacing and plant spaced at 0 cm on the row. The main components in all oils were monoterpene alcohols (40.75% - 50.96%) and monoterpenes (32.43-38.44%). The essential oil of coriander fruits (Sandra cultivar) does not meet the requirements of the European Pharmacopoeia, especially concerning the content in linalool. Nevertheless, the high content in monoterpene alcohols and monoterpenes recommends the use of the essential oil as immunomodulatory, analgesic and antiinflammatory agent in rheumatology and also as an antibacterial and antiviral agent. Consequently, the changes in yield and composition of the essential oil of Sandra coriander should be assesed during several periods of vegetation in order to conclude on its pharmaceutical quality.

  13. Metabolic activation of phenacetin in rat nasal mucosa: dose-dependent binding to the glands of Bowman

    Energy Technology Data Exchange (ETDEWEB)

    Brittebo, E.B.

    1987-03-01

    The metabolism and binding of the analgetic drug (ring-/sup 3/H)phenacetin in the nasal mucosa were studied in vitro and in vivo in male Sprague-Dawley rats. As shown by whole-body and light microscopic autoradiography there was an irreversible binding of metabolites to the glands of Bowman in the olfactory mucosa after high but not after low doses of (/sup 3/H)phenacetin. In the other tissues, the distribution of radioactivity was not changed when the dose was increased. Autoradiography of (/sup 3/H)-acetaminophen showed no preferential uptake of radioactivity in the olfactory mucosa. At incubation of nasal septa with (/sup 3/H)phenacetin in vitro, a binding of metabolites to the glands of Bowman was observed indicating that the metabolism occurred in situ. In rats, glutathione (GSH) depleted by pretreatment with phorone, there was a binding to the glands of Bowman in the olfactory mucosa also after a trace dose of (/sup 3/H)phenacetin. Addition of GSH decreased the irreversible binding of (/sup 3/H)phenacetin metabolites that occurred in 9000 X g nasal mucosa supernatants incubated with (/sup 3/H)phenacetin. There was a moderate decrease in the level of nonprotein sulfhydryl groups, mainly GSH, in the olfactory mucosa after administration of 100-300 mg/kg phenacetin. Collectively, these data suggest that phenacetin is metabolized and subsequent to GSH depletion, bound preferentially in the glands of Bowman. The data also suggest that in situ metabolic activation and binding of phenacetin in the rat nasal mucosa at high doses may play a role in the pathogenesis of the nasal tumors induced by high doses of phenacetin in the rat.

  14. Environmental assessment of remedial action at the inactive uraniferous lignite ashing sites at Belfield and Bowman, North Dakota

    Energy Technology Data Exchange (ETDEWEB)

    1993-09-01

    The Uranium Mill Tailings Radiation Control Act (UMTRCA) of 1978 authorized the US Department of Energy (DOE) to perform remedial actions at Belfield and Bowman inactive lignite ashing sites in southwestern North Dakota to reduce the potential public health impacts from the residual radioactivity remaining at the sites. The US Environmental Protection Agency (EPA) promulgated standards (40 CFR 192) that contain measures to control the residual radioactive materials and other contaminated materials, and proposed standards to protect the groundwater from further degradation. Remedial action at the Belfield and Bowman sites must be performed in accordance with these standards and with the concurrence of the US Nuclear Regulatory Commission (NRC) and the state of North Dakota. The Belfield and Bowman designated sites were used by Union Carbide and Kerr-McGee, respectively, to process uraniferous lignite in the 1960s. Uranium-rich ash from rotary kiln processing of the lignite was loaded into rail cars and transported to uranium mills in Rifle, Colorado, and Ambrosia Lake, New Mexico, respectively. As a result of the ashing process, there is a total of 158,400 cubic yards (yd{sup 3}) [121,100 cubic meters (m{sup 3})] of radioactive ash-contaminated soils at the two sites. Windblown ash-contaminated soil covers an additional 21 acres (8.5 ha) around the site, which includes grazing land, wetlands, and a wooded habitat.

  15. Bowman-Birk protease inhibitor from the seeds of Vigna unguiculata forms a highly stable dimeric structure.

    Science.gov (United States)

    Rao, K N; Suresh, C G

    2007-10-01

    Different protease inhibitors including Bowman-Birk type (BBI) have been reported from the seeds of Vigna unguiculata. Protease isoinhibitors of double-headed Bowman-Birk type from the seeds of Vigna unguiculata have been purified and characterized. The BBI from Vigna unguiculata (Vu-BBI) has been found to undergo self-association to form very stable dimers and more complex oligomers, by size-exclusion chromatography and SDS-PAGE in the presence of urea. Many BBIs have been reported to undergo self-association to form homodimers or more complex oligomers in solution. Only one dimeric crystal structure of a BBI (pea-BBI) is reported to date. We report the three-dimensional structure of a Vu-BBI determined at 2.5 A resolution. Although, the inhibitor has a monomer fold similar to that found in other known structures of Bowman-Birk protease inhibitors, its quaternary structure is different from that commonly observed in this family. The structural elements responsible for the stability of monomer molecule and dimeric association are discussed. The Vu-BBI may use dimeric or higher quaternary association to maintain the physiological state and to execute its biological function.

  16. Baseline risk assessment of ground water contamination at the inactive uraniferous lignite ashing site near Bowman, North Dakota

    Energy Technology Data Exchange (ETDEWEB)

    1994-11-01

    This baseline risk assessment of ground water contamination at the inactive uraniferous lignite ashing site near Bowman, North Dakota, evaluates the potential impacts to public health or the environment from contaminated ground water at this site. This contamination is a result of the uraniferous lignite ashing process, when coal containing uranium was burned to produce uranium. Potential risk is quantified only for constituents introduced by the processing activities and not for the constituents naturally occurring in background ground water in the site vicinity. Background ground water, separate from any site-related contamination, imposes a percentage of the overall risk from ground water ingestion in the Bowman site vicinity. The US Department of Energy (DOE) Uranium Mill Tailings Remedial Action (UMTRA) Project is developing plans to address soil and ground water contamination at the site. The UMTRA Surface Project involves the determination of the extent of soil contamination and design of an engineered disposal cell for long-term storage of contaminated materials. The UMTRA Ground Water Project evaluates ground water contamination. Based on results from future site monitoring activities as defined in the site observational work plan and results from this risk assessment, the DOE will propose an approach for managing contaminated ground water at the Bowman site.

  17. Radiolabeling and pharmacokinetics of Bowman-Byrk inhibitor from Macrotyloma axillare

    Energy Technology Data Exchange (ETDEWEB)

    Santos, Alexandre Goncalves; Soprani, Juliana; Andrade, Milton Hercules Guerra [Universidade Federal de Ouro Preto, MG (Brazil). Inst. de Ciencias Exatas e Biologicas. Lab. de Enzimologia e Biofisica; Santos, Raquel Gouvea dos [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil). Lab. de Radiobiologia]. E-mail: santosr@cdtn.br

    2007-07-01

    There are several evidences that dietary factors have a tight correlation with different kinds of cancer development. Among the compounds of the diet related with cancer development prevention, we could mention the Bowman-Birk Inhibitors (BBI). We isolated preparations of BBI from Macrotyloma axillare showing high specific inhibitory activities over bovine trypsin and chymotrypsin enzymes, specially the germinated seeds preparation. These inhibitors had their pharmacokinetics parameters determined and compared with soybeans inhibitors parameters, which are by the way, the most studied inhibitors of this class. Macrotyloma axillare inhibitors are widely distributed over mice organs, but they show an important difference in comparison with soybean inhibitor biodistribution, which is a meaning bigger affinity for the stomach. Macrotyloma axillare inhibitors when injected intravenously have a fast distribution, with distribution volumes of approximately four folds the plasmatic volume, but they are eliminated slowly, with plasmatic half-lives between 7 and 15 hours. When applied in isolated intestinal loops of Swiss mice, soybean inhibitors get to almost 50% of bioavailability, while Macrotyloma axillare inhibitors from seeds and cotyledons get to 30 and 40% respectively. Meanwhile, the biggest potency of cotyledons inhibitors of Macrotyloma makes available a bigger activity (approximately nine folds) then soybean inhibitors do. (author)

  18. Selective radioprotection of normal tissues by bowman-birk proteinase inhibitor (BBI) in mice

    Energy Technology Data Exchange (ETDEWEB)

    Dittmann, K.; Toulany, M.; Peter Rodemann, H. [Div. of Radiobiology and Environmental Research, Dept. of Radiation Oncology, Univ. of Tuebingen (Germany); Classen, J.; Heinrich, V. [Dept. of Radiation Oncology, Univ. of Tuebingen (Germany); Milas, L. [Dept. of Experimental Radiation Oncology, The Univ. of Texas, M.D. Anderson Cancer Center, Houston, TX (United States)

    2005-03-01

    Background and purpose: the efficacy of radiotherapy is limited by the response of normal tissues within the radiation field. The application of normal-tissue-specific radioprotectors may improve the therapeutic benefit of radiotherapy. The purpose of the present study was to explore the in vivo normal-tissue radioprotective potential of Bowman-Birk proteinase inhibitor (BBI), which acts as a normal-cell-specific radioprotector in vitro. Material and methods: the leg contracture assay in mice, a model system assessing radiation-induced fibrotic processes, was used. To determine whether BBI acts also as a radioprotector of tumors (i.e., FSA and FSAII), the tumor growth delay assay was used. Results: radiation induced leg contracture in mice with a maximum of about 8 mm at day 150 after irradiation. Treatment of mice with 100 mg/kg BBI before irradiation reduced leg contracture by > 4 mm, by about 50% (p < 0.05, t-test). Doses < 100 mg/kg were ineffective, and doses > 100 mg/kg did not further increase the degree of radioprotection. By contrast, BBI did not induce radioprotection of either TP53-mutated FSA or TP53-normal FSAII tumor xenografts in mice, which argues for normal-tissue-specific effect. Conclusion: BBI acts as a potent selective normal-tissue radioprotector in vitro and in vivo, apparently without protecting tumors, and thus has the potential to improve clinical radiotherapy. (orig.)

  19. Novel alleles among soybean Bowman-Birk proteinase inhibitor gene families

    Institute of Scientific and Technical Information of China (English)

    WANG YuePing; CHEN XiongTing; QIU LiJuan

    2008-01-01

    Trypsin inhibitors have been found in various animals, plants and microorganisms. There were two types of trypsin inhibitors in soybean including Bowman-Birk protease inhibitors (BBI) and Kunitz in-hibitors (KTI). The different BBI genes from wild soybean (G.soja) and cultivated soybean (G max) formed a multigene family. We constructed a cDNA library of cultivar 'SuiNong 14' seed at the R7 growth stage using the SMART Kit. Seventeen contigs or singletons were highly homologous to soy-bean protease inhibitors. Contigs of 5, 35, 8 and 9 were highly homologous to BBI family members BBI-A1, BBI-A2, BBI-C and BBI-D, respectively. Sequence analyses showed there were novel allelic varia-tions among the 4 BBI members in SuiNong 14. Based on the comparison of soybean seed cDNA li-braries from different developmental stages, it was apparent that the expression of trypsin inhibitors increased during seed development in soybean. Phylogenetic analysis of BBI gene sequences among dicotyledonous and monocotyledonous plants demonstrated that these genes shared a common pro-genitor.

  20. Novel alleles among soybean Bowman-Birk proteinase inhibitor gene families

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    Trypsin inhibitors have been found in various animals, plants and microorganisms.There were two types of trypsin inhibitors in soybean including Bowman-Birk protease inhibitors(BBI) and Kunitz in-hibitors(KTI).The different BBI genes from wild soybean(G.soja) and cultivated soybean(G.max) formed a multigene family.We constructed a cDNA library of cultivar ’SuiNong 14’ seed at the R7 growth stage using the SMART Kit.Seventeen contigs or singletons were highly homologous to soy-bean protease inhibitors.Contigs of 5, 35, 8 and 9 were highly homologous to BBI family members BBI-A1, BBI-A2, BBI-C and BBI-D, respectively.Sequence analyses showed there were novel allelic varia-tions among the 4 BBI members in SuiNong 14.Based on the comparison of soybean seed cDNA li-braries from different developmental stages, it was apparent that the expression of trypsin inhibitors increased during seed development in soybean.Phylogenetic analysis of BBI gene sequences among dicotyledonous and monocotyledonous plants demonstrated that these genes shared a common pro-genitor.

  1. Probing the soybean Bowman-Birk inhibitor using recombinant antibody fragments.

    Science.gov (United States)

    Muzard, Julien; Fields, Conor; O'Mahony, James John; Lee, Gil U

    2012-06-20

    The nutritional and health benefits of soy protein have been extensively studied over recent decades. The Bowman-Birk inhibitor (BBI), derived from soybeans, is a double-headed inhibitor of chymotrypsin and trypsin with anticarcinogenic and anti-inflammatory properties, which have been demonstrated in vitro and in vivo. However, the lack of analytical and purification methodologies complicates its potential for further functional and clinical investigations. This paper reports the construction of anti-BBI antibody fragments based on the principle of protein design. Recombinant antibody (scFv and diabody) molecules targeting soybean BBI were produced and characterized in vitro (K(D)~1.10(-9) M), and the antibody-binding site (epitope) was identified as part of the trypsin-specific reactive loop. Finally, an extremely fast purification strategy for BBI from soybean extracts, based on superparamagnetic particles coated with antibody fragments, was developed. To the best of the authors' knowledge, this is the first report on the design and characterization of recombinant anti-BBI antibodies and their potential application in soybean processing.

  2. Sandra Steingraber: vähiepideemia vastu tuleb võidelda süsteemselt / intervjueerinud Epp Petrone

    Index Scriptorium Estoniae

    Steingraber, Sandra

    2010-01-01

    Vestlus ameerika bioloogi ja ise vähki põdenud Sandra Steingraberiga vähivastasest võitlusest. S. Steingraberil on ilmunud ka mitu raamatut, nendest "Having faith" on tõlgitud ka eesti keelde (Mina olen ookean. Tartu : Petrone Print, 2009)

  3. Sandra Steingraber: vähiepideemia vastu tuleb võidelda süsteemselt / intervjueerinud Epp Petrone

    Index Scriptorium Estoniae

    Steingraber, Sandra

    2010-01-01

    Vestlus ameerika bioloogi ja ise vähki põdenud Sandra Steingraberiga vähivastasest võitlusest. S. Steingraberil on ilmunud ka mitu raamatut, nendest "Having faith" on tõlgitud ka eesti keelde (Mina olen ookean. Tartu : Petrone Print, 2009)

  4. Um passaporte húngaro, de Sandra Kogut: cinema polí­tico e intimidade

    Directory of Open Access Journals (Sweden)

    Consuelo Lins

    2008-11-01

    Full Text Available Um passaporte húngaro, da cineasta e videoartista brasileira Sandra Kogut, é um filme que utiliza diferentes tecnologias para construir uma narrativa em que a diretora está fortemente presente. Trata-se de um filme em que a esfera da vida privada está em primeiro plano, indo ao encontro de uma realidade midiática que esvazia cada vez mais a esfera pública em favor da intimidade. Contudo, diferentemente do que assistimos na televisão, o filme articula de maneira singular experiências pessoais com a história e a memória coletivas, imprimindo deslocamentos importantes tanto em relação í produção midiática quanto ao documentário clássico polí­tico e aos filmes autobiográficos mais correntes. Palavras-chave cinema, documentário, intimidade, memória, polí­tico Abstract A Hungarian Passport, a film by Sandra Kogut, a Brazilian film-maker and video artist, makes use of different technologies in order to construct a narrative in which the director is strongly present. The private life circle is quite evident in the film, conforming to a media reality that progressively does without a public context in favour of the intimate. However, different from what we see on television, this film, in such special manner, articulates personal experiences with collective history and memory, imprinting important displacements both in relation to the mediatic production and the classical political documentary as well as the more common autobiographical films. Key words cinema, documentary, intimacy, memory, politics

  5. Bowman-Birk proteinase inhibitor from Clitoria fairchildiana seeds: Isolation, biochemical properties and insecticidal potential.

    Science.gov (United States)

    Dantzger, Miriam; Vasconcelos, Ilka Maria; Scorsato, Valéria; Aparicio, Ricardo; Marangoni, Sergio; Macedo, Maria Lígia Rodrigues

    2015-10-01

    Herein described is the biochemical characterisation, including in vitro and in vivo assays, for a proteinase inhibitor purified from Clitoria fairchildiana seeds (CFPI). Purification was performed by hydrophobic interaction and gel filtration chromatography. Kinetic studies of the purified inhibitor showed a competitive-type inhibitory activity against bovine trypsin and chymotrypsin, with an inhibition stoichiometry of 1:1 for both enzymes. The inhibition constants against trypsin and chymotrypsin were 3.3 × 10(-10) and 1.5 × 10(-10)M, respectively, displaying a tight binding property. SDS-PAGE showed that CFPI has a single polypeptide chain with an apparent molecular mass of 15 kDa under non-reducing conditions. However, MALDI-TOF analysis demonstrated a molecular mass of 7.973 kDa, suggesting that CFPI is dimeric in solution. The N-terminal sequence of CFPI showed homology with members of the Bowman-Birk inhibitor family. CFPI remained stable to progressive heating for 30 min to each temperature range of 37 up to 100 °C and CD analysis exhibited no changes in spectra at 207 nm after heating at 90 °C and subsequent cooling. Moreover, CFPI was active over a wide pH range (2-10). In contrast, reduction with DTT resulted in a loss of inhibitory activity against trypsin and chymotrypsin. CFPI also exhibited significant inhibitory activity against larval midgut trypsin enzymes from Anagasta kuehniella (76%), Diatraea saccharalis (59%) and Heliothis virescens (49%). Its insecticidal properties were further analysed by bioassays and confirmed by negative impact on A. kuehniella development.

  6. Soybean-derived Bowman-Birk inhibitor inhibits neurotoxicity of LPS-activated macrophages

    Directory of Open Access Journals (Sweden)

    Persidsky Yuri

    2011-02-01

    Full Text Available Abstract Background Lipopolysaccharide (LPS, the major component of the outer membrane of gram-negative bacteria, can activate immune cells including macrophages. Activation of macrophages in the central nervous system (CNS contributes to neuronal injury. Bowman-Birk inhibitor (BBI, a soybean-derived protease inhibitor, has anti-inflammatory properties. In this study, we examined whether BBI has the ability to inhibit LPS-mediated macrophage activation, reducing the release of pro-inflammatory cytokines and subsequent neurotoxicity in primary cortical neural cultures. Methods Mixed cortical neural cultures from rat were used as target cells for testing neurotoxicity induced by LPS-treated macrophage supernatant. Neuronal survival was measured using a cell-based ELISA method for expression of the neuronal marker MAP-2. Intracellular reactive oxygen species (ROS production in macrophages was measured via 2', 7'-dichlorofluorescin diacetate (DCFH2DA oxidation. Cytokine expression was determined by quantitative real-time PCR. Results LPS treatment of macrophages induced expression of proinflammatory cytokines (IL-1β, IL-6 and TNF-α and of ROS. In contrast, BBI pretreatment (1-100 μg/ml of macrophages significantly inhibited LPS-mediated induction of these cytokines and ROS. Further, supernatant from BBI-pretreated and LPS-activated macrophage cultures was found to be less cytotoxic to neurons than that from non-BBI-pretreated and LPS-activated macrophage cultures. BBI, when directly added to the neuronal cultures (1-100 μg/ml, had no protective effect on neurons with or without LPS-activated macrophage supernatant treatment. In addition, BBI (100 μg/ml had no effect on N-methyl-D-aspartic acid (NMDA-mediated neurotoxicity. Conclusions These findings demonstrate that BBI, through its anti-inflammatory properties, protects neurons from neurotoxicity mediated by activated macrophages.

  7. Electrocauterización de la membrana de Bowman para el tratamiento de la queratopatía bullosa dolorosa Electrocauterization of Bowman's membrane for the treatment of painful bullous keratopathy

    Directory of Open Access Journals (Sweden)

    Elizabeth Escalona Leyva

    2002-12-01

    Full Text Available El propósito en este trabajo es evaluar la electrocauterización de la membrana de Bowman como alternativa quirúrgica en el tratamiento de la queratopatía bullosa dolorosa. Se estudiaron 30 ojos de 30 pacientes con diagnóstico de queratopatía bullosa dolorosa que no habían logrado mejoría con los tratamientos habituales. Se tomaron como variables fundamentales la edad, el sexo, la etiología, el tiempo de evolución, la epitelización, las complicaciones y el alivio sintomático, los datos se tabularon de forma manual teniendo en cuenta el universo de pacientes. Predominó la queratopatía bullosa posquirúrgica (afáquicas y pseudofáquicas en el 83,3 % de los pacientes. Las edades más afectadas fueron los mayores de 60 años (63,3 %; no se encontraron diferencias significativas en cuanto al sexo. El tiempo de epitelización fue de 7 a 14 días en el 93,3 % de los pacientes y solo se encontraron complicaciones en el 14 % que no fueron de gravedad. El alivio de los síntomas se produjo en el 66,6 % en la primera semana del posoperatorio. La electrocauterización de la membrana de Bowman constituye un método eficaz, sencillo y con resultados satisfactorios en el tratamiento de la queratopatía bullosa dolorosaThe purpose of this paper is to evaluate the electrocauterization of Bowman's membrane as a surgical alternative in the treatment of painful bullous keratopathy. 30 eyes from 30 patients who were diagnosed painful bullous keratopathy and had not improved with the habitual treatments were studied. Age, sex, ethiology, time of evolution, epithelialization, complications and the symptomatic relief were taken as fundamental variables. Data were manually tabulated, taking into account the number of patients. The psotsurgical bullous keratopathy (aphakic y pseudophakic prevailed in 83.3 % of the patients. The most affected were those over 60 (63.3 %. No significant differences were found in relation to sex. The time of epithelialization

  8. Proyecto de restauración de la Mina Sandra en el T.M. de Manzanera (Teruel)

    OpenAIRE

    BENNETTO PERIS, MATEU

    2015-01-01

    [EN] This project pursues the restoration of the area occupied by the Sandra Mine, located in Manzanera (Teruel). This mine is an open-sky mine or quarry, with high visual and environmental impact. Although currently there are no mining activities, the effect to the soil and the environment remains. After an initial evaluation of the current conditions, the objective will be to remedy the degraded situation by means of soil treatment, native forest plantation and the improvement of hydrologic...

  9. Inducible expression pattern of rice Bowman-Birk inhibitor gene Os WIP1-2 and its protease inhibitory activity

    Institute of Scientific and Technical Information of China (English)

    CHEN Jun; LIU Jing; GUO Lei; QU Lijia; CHEN Zhangliang; GU Hongya

    2004-01-01

    The WIP1-2 gene was cloned from rice. It belongs to the Bowman-Birk inhibitor gene family. Northern blot showed that expression of this gene was induced by wounding and jasmonic acid (JA). It indicates that the OsWIP1 gene plays an important role in the rice defense system. The OsWIP1-2 was cloned into pET28a and expressed in E. Coli. Its expressed product was purified in the form of fusion protein and tested for the inhibitory activities against trypsin and chymotrypsin. It was found that the fusion protein could inhibit chymotrypsin, but not trypsin. It was also found that the His tag at its C-terminal affected its inhibitory activity significantly. The fusion protein with a natural C-terminal had the inhibitory activity, while no inhibitory activity was detected in the fusion protein with a (His)6-tag at its C-terminal. This implies that extra amino acid residues at the C-terminal of OsWIP1-2 may interfere with its correct folding. The inhibitory assay indicated that the members of rice Bowman-Birk inhibitor gene family probably differentiated both in their structure and function.

  10. Identification of a new soybean Kunitz trypsin inhibitor mutation and its effect on Bowman-Birk protease inhibitor content in soybean seed

    Science.gov (United States)

    Soybean seeds possess anti-nutritional compounds which inactivate digestive proteases, principally corresponding to two families: Kunitz Trypsin Inhibitors (KTi) and Bowman-Birk Inhibitors (BBI). High levels of raw soybeans/soybean meal in feed mixtures can cause poor weight gain and pancreatic abno...

  11. Cloning, characterization, expression analysis and inhibition studies of a novel gene encoding Bowman-Birk type protease inhibitor from rice bean

    Science.gov (United States)

    This paper presents the first study describing the isolation, cloning and characterization of a full length gene encoding Bowman-Birk protease inhibitor (RbTI) from rice bean (Vigna umbellata). A full-length protease inhibitor gene with complete open reading frame of 327bp encoding 109 amino acids w...

  12. LA PSICOLOGIA PARAGUAYA REPRESENTADA EN LA PSICOLOGIA DE JAMES O. WHITTAKER Y SANDRA J. WHITTAKER

    Directory of Open Access Journals (Sweden)

    José E. García

    2014-01-01

    Full Text Available En 1987 los psicólogos estadounidenses James O. Whittaker y Sandra J. Whittaker publicaron la cuarta edición de su famoso libro Psicología. Este fue uno de los textos de introducción más conocidos y utilizados en América Latina y a través de él muchos miles de estudiantes aprendieron sus primeros conceptos sobre la psicología. Esta edición estaba preparada especialmente para su utilización con los alumnos de habla castellana e introducía numerosos tópicos relacionados a la psicología latinoamericana. Además incluía menciones específicas a algunos psicólogos de la región y sus contribuciones a la psicología. Uno de ellos era José de Jesús Aguirre, psicólogo y sacerdote jesuita y uno de los pioneros de la psicología profesional en el Paraguay. Aguirre aplicó la teoría del filósofo holandés Gerard Heymans y su colaborador el psiquiatra Enno Dirk Wiersma con las modificaciones que unos años más tarde introdujo el psicólogo francés René Le Senne. El propósito de la investigación era el análisis de los rasgos tipológicos característicos en la población paraguaya. Con ello, Aguirre iniciaba el estudio científico de la personalidad en el Paraguay. Este artículo estudia la importancia que corresponde asignar a la investigación de Aguirre como parte del texto introductorio de Whittaker y Whittaker. Se analizan los fundamentos teóricos de la tipología de Heymans-Wiersma-Le Senne y las adaptaciones realizadas por Aguirre, además de su aplicación a una muestra superior a las setecientas personas. Esta provenía de diversos niveles educativos, tanto secundarios como universitarios. En la parte concluyente se analiza la relevancia de Aguirre y su trabajo en el contexto de la psicología paraguaya y latinoamericana.

  13. Expression and inhibitory activity analysis of a 25-kD Bowman-Birk protease inhibitor in rice

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    Rice Bowman-Birk inhibitors (RBBI), with one (8 kD) or two homologous domains (16 kD), were found to be effective trypsin inhibitors in vitro. In this study, we demonstrate that the 25-kD protein corresponding to the three-domain RBBI indeed exists in rice in planta, and that the RBBIs are regulated by development and wounding. We also found by inhibitory activity assay that the 3:13 disulfide bond, but not the 4:5 disulfide bond, suppresses the trypsin-inhibitory activity, and the D3 domain of RBBI3-1 has no inhibitory activity against trypsin, chymotrypsin, paparin or subtilisin. Mutation analyses showed that conversion from Lys to Leu or Tyr in the N-terminal P1 site in D1 domain did not create chymotrypsin-inhibitory activity, suggesting that the structure of the reactive loop in D1 domain hinder the new inhibitory specificity at P1 site, and the chymotrypsin-inhibitory activity might need the participation of other structures, e.g. 3:13 disulfide bond.

  14. Effects of an anticarcinogenic Bowman-Birk protease inhibitor on purified 20S proteasome and MCF-7 breast cancer cells.

    Directory of Open Access Journals (Sweden)

    Larissa da Costa Souza

    Full Text Available Proteasome inhibitors have been described as an important target for cancer therapy due to their potential to regulate the ubiquitin-proteasome system in the degradation pathway of cellular proteins. Here, we reported the effects of a Bowman-Birk-type protease inhibitor, the Black-eyed pea Trypsin/Chymotrypsin Inhibitor (BTCI, on proteasome 20S in MCF-7 breast cancer cells and on catalytic activity of the purified 20S proteasome from horse erythrocytes, as well as the structural analysis of the BTCI-20S proteasome complex. In vitro experiments and confocal microscopy showed that BTCI readily crosses the membrane of the breast cancer cells and co-localizes with the proteasome in cytoplasm and mainly in nucleus. Indeed, as indicated by dynamic light scattering, BTCI and 20S proteasome form a stable complex at temperatures up to 55°C and at neutral and alkaline pHs. In complexed form, BTCI strongly inhibits the proteolytic chymotrypsin-, trypsin- and caspase-like activities of 20S proteasome, indicated by inhibition constants of 10(-7 M magnitude order. Besides other mechanisms, this feature can be associated with previously reported cytostatic and cytotoxic effects of BTCI in MCF-7 breast cancer cells by means of apoptosis.

  15. Environmental assessment of no remedial action at the inactive uraniferous lignite ashing sites at Belfield and Bowman, North Dakota

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-06-01

    The Belfield and Bowman sites were not included on the original congressional list of processing sites to be designated by the Secretary of Energy. Instead, the sites were nominated for designation by the Dakota Resource Council in a letter to the DOE (September 7, 1979). In a letter to the DOE (September 12, 1979), the state of North Dakota said that it did not believe the sites would qualify as processing sites under the Uranium Mill Tailings Radiation Control Act (UMTRCA) because the activities at the sites involved only the ashing of uraniferous lignite coal and the ash was shipped out of state for actual processing. Nevertheless, on October 11, 1979, the state of North Dakota agreed to the designation of the sites because they met the spirit of the law (reduce public exposure to radiation resulting from past uranium operations). Therefore, these sites were designated by the Secretary of Energy for remedial action. Because of the relatively low health impacts determined for these sites, they were ranked as low priority and scheduled to be included in the final group of sites to be remediated.

  16. Purification and characterization of a Bowman-Birk proteinase inhibitor from the seeds of black gram (Vigna mungo).

    Science.gov (United States)

    Prasad, E R; Dutta-Gupta, A; Padmasree, K

    2010-03-01

    A proteinase inhibitor (BgPI) was purified from black gram, Vigna mungo (cv. TAU-1) seeds by using ammonium sulfate fractionation, followed by ion-exchange, affinity and gel-filtration chromatography. BgPI showed a single band in SDS-PAGE under non-reducing condition with an apparent molecular mass of approximately 8kDa correlating to the peak 8041.5Da in matrix assisted laser desorption ionization time-of-flight (MALDI-TOF) mass spectrum. BgPI existed in different isoinhibitor forms with pI values ranging from 4.3 to 6.0. The internal sequence "SIPPQCHCADIR" of a peak 1453.7 m/z, obtained from MALDI-TOF-TOF showed 100% similarity with Bowman-Birk inhibitor (BBI) family. BgPI exhibited non-competitive-type inhibitory activity against both bovine pancreatic trypsin (K(i) of 309.8nM) and chymotrypsin (K(i) of 10.7muM), however, with a molar ratio of 1:2 with trypsin. BgPI was stable up to a temperature of 80 degrees C and active over a wide pH range between 2 and 12. The temperature-induced conformational changes in secondary structure are reversed when BgPI was cooled from 90 to 25 degrees C. Further, upon reduction with dithiothreitol, BgPI lost both its inhibitory activity as well as secondary structural conformation. Lysine residue(s) present in the reactive site of BgPI play an important role in inhibiting the bovine trypsin activity. The present study provides detailed biochemical characteristic features of a BBI type serine proteinase inhibitor isolated from V. mungo.

  17. A Bowman-Birk protease inhibitor purified, cloned, sequenced and characterized from the seeds of Maclura pomifera (Raf.) Schneid.

    Science.gov (United States)

    Indarte, Martín; Lazza, Cristian M; Assis, Diego; Caffini, Néstor O; Juliano, María A; Avilés, Francesc X; Daura, Xavier; López, Laura M I; Trejo, Sebastián A

    2017-02-01

    A new BBI-type protease inhibitor with remarkable structural characteristics was purified, cloned, and sequenced from seeds of Maclura pomifera , a dicotyledonous plant belonging to the Moraceae family. In this work, we report a Bowman-Birk inhibitor (BBI) isolated, purified, cloned, and characterized from Maclura pomifera seeds (MpBBI), the first of this type from a species belonging to Moraceae family. MpBBI was purified to homogeneity by RP-HPLC, total RNA was extracted from seeds of M. pomifera, and the 3'RACE-PCR method was applied to obtain the cDNA, which was cloned and sequenced. Peptide mass fingerprinting (PMF) analysis showed correspondence between the in silico-translated protein and MpBBI, confirming that it corresponds to a new plant protease inhibitor. The obtained cDNA encoded a polypeptide of 65 residues and possesses 10 cysteine residues, with molecular mass of 7379.27, pI 6.10, and extinction molar coefficient of 9105 M(-1) cm(-1). MpBBI inhibits strongly trypsin with K i in the 10(-10) M range and was stable in a wide array of pH and extreme temperatures. MpBBI comparative modeling was applied to gain insight into its 3D structure and highlighted some distinguishing features: (1) two non-identical loops, (2) loop 1 (CEEESRC) is completely different from any known BBI, and (3) the amount of disulphide bonds is also different from any reported BBI from dicot plants.

  18. Kuninga Kuulutaja : oma esimest kooli ei unusta me kunagi / Sandra Põld, Karl-Ott Juhanson, Elis Rebbas, Aleksander Mjakonkihh...[jt.

    Index Scriptorium Estoniae

    2007-01-01

    Pärnu Kuninga Tänava Põhikooli lõpetajad Sandra Põld, Karl-Ott Juhanson, Elis Rebbas, Aleksander Mjakonkihh, Vegard Kruusla ja Erik Nisu vastavad küsimusele milliste tunnete-mälestustega nad oma esimesest koolist lahkuvad ja millest unistavad? Sisaldab Koolilehe toimetust: Ruth Kaik, Marika Hoolma, Egne Õispuu, Rauno Pella, Kadi Raal, Gritta Käär ja Maarja Põld

  19. Exilio y búsqueda del padre en Fuga en mí menor de Sandra Lorenzano

    Directory of Open Access Journals (Sweden)

    Anamaria González Luna

    2014-06-01

    Full Text Available This paper proposes a literary reading centered on the absence of the father as a narrative and psychological element of Sandra Lorenzano’s novel, Fuga en mí menor. The search for the father as a necessary process to configure one’s identity becomes an interior escape, leading the main character to work out a suspended mourning, which finds expression in art and music. The metaphoric pun in the title itself announces the meaning of the escape as a double movement, musical and interior, and anticipates the structure that revolves around one single theme whose counterpoints are the different voices and linguistic codes used by the author, which put music and photography in the focus. The threads of heteroglossia weave individual and collective memory; the sounds and silences, the lights and shadows, European history during the Second World War and Argentine history during the dictatorship as moments that have forced people into exile. In the novel the classic paradigm of Telemachus takes on the shape of exile with all its meaning of separation and loss, and leads to the discovery of being an orphan as a necessary condition to inherit from the father, that is, inherit the possibility of opening up new meanings to the world, as the only possible way to give meaning to the experience of life, to your own history.

  20. Sandra Cisneros’s The House on Mango Street: (Collective Memory Resonating from “the Barrio”

    Directory of Open Access Journals (Sweden)

    Jelena Nikodinoska

    2014-11-01

    Full Text Available  “The people I wrote about were real, for the most part, from here and there, now and then, but sometimes three real people would be braided together into one made-up person… I cut apart and stitched together events to tailor the story, gave it shape so it had a beginning, middle, and end, because real life stories rarely come to us complete. Emotions, though, can’t be invented, can’t be borrowed. All the emotions my characters feel, good or bad are mine.” (xxiii Although Sandra Cisneros draws on autobiographical elements in The House on Mango Street (1984, her novella does not stand for an autobiography, but it rather represents a collage of events, characters, and places that independently from one another constitute vignettes. These vignettes are not necessarily chronologically related, yet they make up a whole of voices, stories, colors, and movements that once reverberated along Mango Street. Through her (Cisneros’s stories, Esperanza Cordero’s stories, and Esperanza’s neighbors’ stories, Cisneros conveys the Southwestern Latino experience of the big city and the streets, of the barrios that is. Taking my cue from Cisneros’s “The House on Mango Street,” I will try to examine how personal experiences become memories and those memories transcend into stories. Is what comes from experience and memory that makes writing strong, powerful, persuasive, and to a certain extent relatable? Have Cisneros’s memories, reflected in Esperanza’s living experience and language contributed to the Latino’s collective memory of the life in the barrios coupled with racism, poverty and shame? On that note, I shall see how Maurice Halbwachs’s concept of collective memory applies to Cisneros’ story and the Latino experience, where Latinos’ memory is dependent upon the life in the barrio within which the majority were/are situated.

  1. Multigene family for Bowman-Birk type proteinase inhibitors of wild soja and soybean: the presence of two BBI-A genes and pseudogenes.

    Science.gov (United States)

    Deshimaru, Masanobu; Yoshimi, Shingo; Shioi, Seijiro; Terada, Shigeyuki

    2004-06-01

    Genes for Bowman-Birk type protease inhibitors (BBIs) of wild soja (Glycine soja) and soybean (Glycine max) comprise a multigene family. The organization of the genes for wild soja BBIs (wBBIs) was elucidated by an analysis of their cDNAs and the corresponding genomic sequences, and compared with the counterparts in the soybean. The cDNAs encoding three types of wild soja BBIs (wBBI-A, -C, and -D) were cloned. Two subtypes of cDNAs for wBBI-A, designated wBBI-A1 and -A2, were further identified. Similar subtypes (sBBI-A1 and -A2) were also found in the soybean genome. cDNA sequences for wBBIs were highly homologous to those for the respective soybean homologs. Phylogenetic analysis of these cDNAs demonstrated the evolutional proximity between these two leguminae strains.

  2. Cleófilas and La Llorona: Latin Heroines Against Patriarchal Marginalisation in ‘El arroyo de la Llorona’, a Short Story by Sandra Cisneros

    OpenAIRE

    Luis fernando Gómez R

    2012-01-01

    This paper discusses the short story ‘El arroyo de la Llorona’ by female Mexican-American writer Sandra Cisneros. In it the main character, Cleófilas, is subject to social, emotional and economic dependence on her husband, according to the cultural constructs on female identity that are still relevant in Latin-American patriarchal societies. Due to her circumstances of complete marginalisation and domestic violence, Cleófilas chooses to avoid reality, and this avoidance not only costs her men...

  3. Qu'est-ce que le care ? Souci des autres, sensibilité, responsabilité, sous la direction de Pascale Molinier, Sandra Laugier et Patricia Paperman

    OpenAIRE

    Raymond, Gilles

    2010-01-01

    Le livre intitulé « Qu'est-ce que le care ? Souci des autres, sensibilité, responsabilité » rassemble huit contributions d'auteurs différents sous la direction de Pascale Molinier, Sandra Laugier et Patricia Paperman sur l'éthique du care. Il est difficile d'en faire une synthèse. Ce sont comme des voix différentes qui exposent certains points essentiels de cette éthique. Toutes ces voix, dont les auteurs sont des femmes, contestent un ordre moral et social pour en revendiquer un autre. Cette...

  4. Myers Brown, Sandra. Historia, arte y alabanza: la música protestante en la España del siglo XIX

    OpenAIRE

    Plaza-Navas, Miquel Àngel

    2000-01-01

    Dada la escasez de información sobre el tema de la música protestante, es de gran interés poder disponer de reseñas como la aquí incluida. Reseña del libro: Myers Brown, Sandra. "Historia, arte y alabanza: la música protestante en la España del siglo XIX". Madrid: Consejo Evangélico de Madrid. Consejería de Educación y Cultura, 2000.

  5. Sandra Smykalla: Die Bildung der Differenz. Weiterbildung und Beratung im Kontext von Gender Mainstreaming. Wiesbaden: VS Verlag für Sozialwissenschaften 2010.

    Directory of Open Access Journals (Sweden)

    Kristin Rosa Ideler

    2011-12-01

    Full Text Available Die 2010 erschienene Dissertation von Sandra Smykalla gewährt detaillierte Einblicke in die Arbeit von Gendertrainer/-innen im Kontext der Implementierung von Gender Mainstreaming. Zentrale Erkenntnis dieser qualitativen Interviewstudie ist, dass Gendertrainer/-innen neben einer Genderkompetenz über eine Ambivalenzkompetenz verfügen müssen, wollen sie nicht Gefahr laufen, Geschlechterungleichheiten und -stereotypen zu revitalisieren. Überzeugend ist Smykallas Forderung nach der (Re-Politisierung des Feldes genderorientierter Weiterbildung, wofür ihr Rückgriff auf intersektional orientierte Methodiken einen ersten Ansatzpunkt darstellt.Sandra Smykalla’s dissertation, published in 2010, offers detailed insights into the work of gender trainers in the context of the implementation of gender mainstreaming. The main finding of this qualitative interview study is that gender trainers need to have both gender competence and ambivalence competence if they do not want to risk revitalizing gender inequalities and gender stereotypes. Smykalla’s demand for the (re- politicization of the field of gender-oriented training is convincing and her recourse to intersectionally oriented methodologies illustrates a first starting point.

  6. Amet kohustab / Sandra Peetso

    Index Scriptorium Estoniae

    Peetso, Sandra

    2008-01-01

    18.-22. okt. Pärnu teatris Endla toimunud rahvusvahelisest laste- ja noorteteatrite festivalist "NB festival 2008". Pikemalt lavastustest "Võimaluste aed" (Prantsuse teatritrupp Association 16 rue de Plaisance), "Sailor & Pekka" (Rootsi teater TRE), "Misantroop" (VAT-teater), "Maria Bonita" (Taani teater Batida), "Avatud ring" (Leedu teatrilabor Open Circle)

  7. Amet kohustab / Sandra Peetso

    Index Scriptorium Estoniae

    Peetso, Sandra

    2008-01-01

    18.-22. okt. Pärnu teatris Endla toimunud rahvusvahelisest laste- ja noorteteatrite festivalist "NB festival 2008". Pikemalt lavastustest "Võimaluste aed" (Prantsuse teatritrupp Association 16 rue de Plaisance), "Sailor & Pekka" (Rootsi teater TRE), "Misantroop" (VAT-teater), "Maria Bonita" (Taani teater Batida), "Avatud ring" (Leedu teatrilabor Open Circle)

  8. Leningradi aktsioonid / Sandra Jõgeva

    Index Scriptorium Estoniae

    Jõgeva, Sandra, 1976-

    2006-01-01

    Eesti kunstnike väljapanekust "Empty Spaces and their Occupants" 12.-24. augustini 2006 a. toimuval Peterburi Maneezhi 6. rahvusvahelisel eksperimentaalkunsti festivalil, kuraator Maksim Surin. Osalevad Kaido Ole, Merike Estna, Meeland Sepp jt

  9. The cytotoxic effect of Bowman-Birk isoinhibitors, IBB1 and IBBD2, from soybean (Glycine max) on HT29 human colorectal cancer cells is related to their intrinsic ability to inhibit serine proteases

    OpenAIRE

    Clemente, Alfonso; Moreno, F. Javier; Marín-Manzano, M. Carmen; E. Jiménez; Domoney, C.

    2010-01-01

    Bowman-Birk inhibitors (BBI) from soybean and related proteins are naturally occurring protease inhibitors with potential health-promoting properties within the gastrointestinal tract. In this work, we have investigated the effects of soybean BBI proteins on HT29 colon adenocarcinoma cells, compared with non-malignant colonic fibroblast CCD-18Co cells. Two major soybean isoinhibitors, IBB1 and IBBD2, showing considerable amino acid sequence divergence within their inhibitory domains, were pur...

  10. The analysis of Sandra Cisneros' House on Mango Steet based on social criticism of Gloria Anzaldúa's Borderlands: La Frontera

    Directory of Open Access Journals (Sweden)

    Špela Grum

    2015-12-01

    Full Text Available The article deals with the main female characters that appear in Sandra Cisneros' collection of vignettes, House on Mango Street (1991. It sheds light on their lives and motives for their actions, through social criticism of Gloria Anzaldúa and the main points she establishes in her semi-autobiographical collection of essays Borderlands: La Frontera (1999. The topics Anzaldúa addresses give an insight into the Chicano identity, and the struggle of Chicano women in particular. Through her vantage point, I discuss gender roles, the immigrants' search for identity and their quest for a more dignified life, by trying to reconcile the antagonizing forces of the different parts of their identity.

  11. Effects of plant protease inhibitors, oryzacystatin I and soybean Bowman-Birk inhibitor, on the aphid Macrosiphum euphorbiae (Homoptera, Aphididae) and its parasitoid Aphelinus abdominalis (Hymenoptera, Aphelinidae).

    Science.gov (United States)

    Azzouz, H; Cherqui, A; Campan, E D M; Rahbé, Y; Duport, G; Jouanin, L; Kaiser, L; Giordanengo, P

    2005-01-01

    Transgenic plants expressing protease inhibitors (PIs) have emerged in recent years as an alternative strategy for pest control. Beneficial insects such as parasitoids may therefore be exposed to these entomotoxins either via the host or by direct exposure to the plant itself. With the objective of assessing the effects of PIs towards aphid parasitoids, bioassays using soybean Bowman-Birk inhibitor (SbBBI) or oryzacystatin I (OCI) on artificial diet were performed on Macrosiphum euphorbiae-Aphelinus abdominalis system. OCI significantly reduced nymphal survival of the potato aphid M. euphorbiae and prevented aphids from reproducing. This negative effect was much more pronounced than with other aphid species. On the contrary, SbBBI did not affect nymphal viability but significantly altered adult demographic parameters. Enzymatic inhibition assays showed that digestive proteolytic activity of larvae and adults of Aphelinus abdominalis predominantly relies on serine proteases and especially on chymotrypsin-like activity. Immunoassays suggested that OCI bound to aphid proteins and accumulated in aphid tissues, whereas SbBBI remained unbound in the gut. Bioassays using M. euphorbiae reared on artificial diets supplemented with both OCI and SbBBI showed a fitness impairment of Aphelinus abdominalis that developed on intoxicated aphids. However, only SbBBI was detected in parasitoid larvae, while no PI could be detected in adult parasitoids that emerged from PI-intoxicated aphids. The potential impact of PI-expressing plants on aphid parasitoids and their combined efficiency for aphid control are discussed.

  12. Brown Kidney Bean Bowman-Birk Trypsin Inhibitor is Heat and pH Stable and Exhibits Anti-proliferative Activity.

    Science.gov (United States)

    Chan, Yau Sang; Zhang, Yanbo; Ng, Tzi Bun

    2013-02-01

    A trypsin inhibitor with a molecular mass around 17 kDa was purified from the seeds of Phaseolus vulgaris cv. 'brown kidney bean'. The purification protocol involved, in sequence, affinity chromatography on Affi-gel blue gel, ion-exchange chromatography on Q-Sepharose and Mono Q, and gel filtration on Superdex 75. The molecular size and N-terminal amino acid sequence of the trypsin inhibitor resembled leguminous Bowman-Birk protease inhibitors (BBIs), signifying that brown kidney bean trypsin inhibitor is a BBI. Brown kidney bean trypsin inhibitor exhibited pronounced thermostability and pH stability. Its trypsin inhibitory activity was retained at all pH values (0-14) and up to 90 °C. The trypsin inhibitor also inhibited the proliferation of human breast cancer MCF7 cells with an IC(50) of 71.52 μM. On the other hand, it only slightly inhibited proliferation of hepatoma HepG2 and embryonic liver WRL68 cells at a concentration over 110 μM.

  13. Transgenic soybean plants overexpressing O-acetylserine sulfhydrylase accumulate enhanced levels of cysteine and Bowman-Birk protease inhibitor in seeds.

    Science.gov (United States)

    Kim, Won-Seok; Chronis, Demosthenis; Juergens, Matthew; Schroeder, Amy C; Hyun, Seung Won; Jez, Joseph M; Krishnan, Hari B

    2012-01-01

    Soybeans provide an excellent source of protein in animal feed. Soybean protein quality can be enhanced by increasing the concentration of sulfur-containing amino acids. Previous attempts to increase the concentration of sulfur-containing amino acids through the expression of heterologous proteins have met with limited success. Here, we report a successful strategy to increase the cysteine content of soybean seed through the overexpression of a key sulfur assimilatory enzyme. We have generated several transgenic soybean plants that overexpress a cytosolic isoform of O-acetylserine sulfhydrylase (OASS). These transgenic soybean plants exhibit a four- to tenfold increase in OASS activity when compared with non-transformed wild-type. The OASS activity in the transgenic soybeans was significantly higher at all the stages of seed development. Unlike the non-transformed soybean plants, there was no marked decrease in the OASS activity even at later stages of seed development. Overexpression of cytosolic OASS resulted in a 58-74% increase in protein-bound cysteine levels compared with non-transformed wild-type soybean seeds. A 22-32% increase in the free cysteine levels was also observed in transgenic soybeans overexpressing OASS. Furthermore, these transgenic soybean plants showed a marked increase in the accumulation of Bowman-Birk protease inhibitor, a cysteine-rich protein. The overall increase in soybean total cysteine content (both free and protein-bound) satisfies the recommended levels required for the optimal growth of monogastric animals.

  14. In Pompeii and Volterra the Earth Really Trembles: De-Territorialisation, European Art-Cinema, and the Fate of Neorealism in Roberto Rossellini's Journey to ltaly and Luchino Visconti's Sandra

    Directory of Open Access Journals (Sweden)

    Stefano Ciammaroni

    2007-06-01

    Full Text Available Este trabalho se utiliza de dois estudos de caso - Viagem to Italy (1953, de Roberto Rossellini e Sandra (1965, de Luchino Visconti para discutir questões políticas, historiográficas e estéticas [que interferem] no relacionamento entre o neo-realismo como cinema da nação italiana e o "cinema de arte europeu" como uma instituição desnacionalizada.

  15. Cleófilas and La Llorona: Latin Heroines Against Patriarchal Marginalisation in ‘El arroyo de la Llorona’, a Short Story by Sandra Cisneros

    Directory of Open Access Journals (Sweden)

    Luis fernando Gómez R

    2012-08-01

    Full Text Available This paper discusses the short story ‘El arroyo de la Llorona’ by female Mexican-American writer Sandra Cisneros. In it the main character, Cleófilas, is subject to social, emotional and economic dependence on her husband, according to the cultural constructs on female identity that are still relevant in Latin-American patriarchal societies. Due to her circumstances of complete marginalisation and domestic violence, Cleófilas chooses to avoid reality, and this avoidance not only costs her mental well-being,but also annuls her will to make changes to her suffocating life. Oppressed by a patriarchal system,Cleófilas develops an unusual interest in the Llorona legend and, through the remembrance of this myth, these two female figures become symbols of resistance and liberation. In the story, the Llorona ceases to be the denigrated woman tradition has always made her out to be, and becomes the image of a contemporary heroine capable of challenging radical patriarchal norms.

  16. La ‘doppia assenza’: peregrinazioni letterarie tra italia e argentina in clementina Sandra Ammendola, Miguel Ángel García e Laura Pariani

    Directory of Open Access Journals (Sweden)

    Silvia Camilotti

    2015-01-01

    Full Text Available Il presente articolo analizza le sollecitazioni delle identità e il senso di appartenenza di personaggi letterari che hanno vissuto esperienze di migrazione tra Italia e Argentina nei seguenti testi letterari: Il maestro di tango di Miguel Ángel García, Lei che sono io e Ci sono volte, tutte le volte di Clementina Sandra Ammendola e Quando Dio ballava il tangodi Laura Pariani. Tale analisi si realizza a partire dalle chiavi di lettura offerte dal saggio di Abdelmalek Sayad, La Double absence. Des illusions de l'émigré aux souffrances de l'immigré. Questi tre autori condividono l’esperienza biografia, divisa tra Italia e Argentina, che rappresentano a partire dallo strumento letterario. Si analizzano le loro opere comparando i modi a partire dai quali le identità dei personaggi (italiani emigrati in Argentina e argentini in Italia vengono rappresentate, come tali identità sono sollecitate e con quali conseguenze. Il confronto –che richiederà anche una contestualizzazione storica– incrocia le variabili di genere, classe e razza: infatti, al fine di esaminare la nozione di identità e i suoi mutamenti nei contesti migratori, appare necessario considerare come i processi sociali, culturali ed economici influenzano i personaggi.

  17. Potential effects of plant protease inhibitors, oryzacystatin I and soybean Bowman-Birk inhibitor, on the aphid parasitoid Aphidius ervi Haliday (Hymenoptera, Braconidae).

    Science.gov (United States)

    Azzouz, H; Campan, E D M; Cherqui, A; Saguez, J; Couty, A; Jouanin, L; Giordanengo, P; Kaiser, L

    2005-08-01

    Protease inhibitors (PIs) have been shown to cause lethal and sublethal effects on aphids depending on the kind of PI and aphid species. Therefore, these proteins might affect aphid parasitoids directly by inhibiting their digestive proteolysis or indirectly via their development in a less suitable host. In our study, the risk of exposure and the potential effects of soybean Bowman-Birk inhibitor (SbBBI) and oryzacystatin I (OCI) on the aphid endoparasitoid Aphidius ervi were investigated using artificial diet to deliver PIs. Immunoassays showed that both SbBBI and OCI were detected in the honeydew of aphids reared on artificial diet containing these recombinant proteins at 100 microg/mL. However, only SbBBI was detected in parasitoid larvae, while this PI could not be detected in adult parasitoids emerged from PI-intoxicated aphids. Enzymatic inhibition assays showed that digestive proteolytic activity of larvae and adults of A. ervi predominantly relies on serine proteases and especially on chymotrypsin-like activity. Bioassays using SbBBI and OCI on artificial diet were performed. A. ervi that developed on intoxicated aphids had impaired fitness. Thus development and parasitism success of parasitoids exposed to OCI were severely affected. On the contrary, SbBBI only altered significantly female size and sex ratio. Direct exposure to PIs through adult food intake did not affect female's longevity, while SbBBI and OCI (100 microg/mL) induced 69% and 30% inhibition of digestive protease activity, respectively. These studies made it possible to estimate the risk of exposure to plant PIs and the sensitivity of the aphid parasitoid A. ervi to these entomotoxins, by combining immunological, biochemical and biological approaches. First it pointed out that only immature stages are affected by PIs. Secondly, it documented two different modes of effect, according to the nature of the PIs and both host and parasitoid susceptibility. OCI prevented the development of A. ervi

  18. Crystal structure of the Bowman-Birk Inhibitor from Vigna unguiculata seeds in complex with beta-trypsin at 1.55 A resolution and its structural properties in association with proteinases.

    Science.gov (United States)

    Barbosa, João Alexandre R G; Silva, Luciano P; Teles, Rozeni C L; Esteves, Gisele F; Azevedo, Ricardo B; Ventura, Manuel M; de Freitas, Sonia M

    2007-03-01

    The structure of the Bowman-Birk inhibitor from Vigna unguiculata seeds (BTCI) in complex with beta-trypsin was solved and refined at 1.55 A to a crystallographic R(factor) of 0.154 and R(free) of 0.169, and represents the highest resolution for a Bowman-Birk inhibitor structure to date. The BTCI-trypsin interface is stabilized by hydrophobic contacts and hydrogen bonds, involving two waters and a polyethylene glycol molecule. The conformational rigidity of the reactive loop is characteristic of the specificity against trypsin, while hydrophobicity and conformational mobility of the antichymotryptic subdomain confer the self-association tendency, indicated by atomic force microscopy, of BTCI in complex and free form. When BTCI is in binary complexes, no significant differences in inhibition constants for producing a ternary complex with trypsin and chymotrypsin were detected. These results indicate that binary complexes present no conformational change in their reactive site for both enzymes confirming that these sites are structurally independent. The free chymotrypsin observed in the atomic force microscopy assays, when the ternary complex is obtained from BTCI-trypsin binary complex and chymotrypsin, could be related more to the self-association tendency between chymotrypsin molecules and the flexibility of the reactive site for this enzyme than to binding-related conformational changes.

  19. Bowman-Brik胰蛋白酶抑制剂在水稻叶片生长和种子萌发过程中的表达%Expression of Bowman-Birk Trypsin Inhibitor at Different Development Stages in Rice Leaves and Seed Germination

    Institute of Scientific and Technical Information of China (English)

    徐文静; 李莉云; 史佳楠; 李静宜; 巩校东; 刘丽娟; 刘国振

    2012-01-01

    Bowman-Birk胰蛋白酶抑制剂(BBTD是一类富含半胱氨酸的丝氨酸蛋白酶抑制剂,广泛分布于豆科、禾本科和菊科植物中,在蛋白质存储和植物防御中具有重要作用.水稻(Oryza sativa L.ssp.indica) BBTI家族具有13个成员,其中BBTI-9和BBTI-10都为假基因.其余BBTI成员都存在数量不同的保守Bowman-Birk结构域.为了解BBTI的表达信息,本研究主要通过设计多肽序列的方法,制备了11个BBTI的多克隆抗体,利用Western blot技术检测其在叶片生长发育和种子萌发过程中的表达.结果表明BBTI在叶片生长过程中呈现不同的时空特异性表达,BBTI-1、-2、-11、-12和-13伴随叶片生长含量增加,BBTI-5、-6和-8在苗期表达含量高,而BBTI-3、-4、-7在苗早期l em时表达量达到峰值,以修饰或多聚体的形式在叶片生长过程中表达.在种子萌发过程中发现BBTI-8在种子中表达量较高,萌发后2h降到最低,24 h后一条分子量略小的降解带开始表达,其余抗体在种子萌发阶段未发现有明显的变化.本研究还统计了苗期叶片、分蘖期叶片和萌发期的种子的MPSS tags数据,试图比较转录与蛋白质水平对应关系.本研究结果证明,BBTI蛋白质在水稻生长发育过程中存在差异表达,为深入了解其功能提供了重要线索.%Bowman-Birk trypsin inhibitor (BBTI) is a type of cysteine-rich serine protease inhibitors, which is widely distributed in Leguminousaes, Gramineaes and Asteraceaes plants, and it plays an important role in protein storage and plant defense. There are 13 members of BBTI in rice genome, among which BBTI-9 and BBTI-10 are both pseudogenes, while others all include different amounts of Bowmen-Birk domains. To research the expression of BBTI proteins, 11 BBTI specific antibodies were generated mainly by the method of peptide sequence design and synthesis, and the expression patterns at leaf growth and seed germination stages ofnce(Oryza saliva L. Ssp

  20. Cleófilas y La Llorona: heroínas latinas en contra de la marginalización patriarcal en el cuento de Sandra Cisneros “El arroyo de la Llorona”

    OpenAIRE

    Gómez R, Luis Fernando; Universidad Pedagógica Nacional, Bogotá, Colombia

    2013-01-01

    Este artículo discute el cuento “El arroyo de la Llorona” de la escritora Méjico-americana Sandra Cisneros. En él, el personaje principal, Cleófilas, está sujeta a la dependencia social, emocional y económica de su esposo, de acuerdo a constructos culturales sobre la identidad femenina que aún se mantienen en las sociedades patriarcales latinas. Debido a su estado de total marginalización y violencia intrafamiliar, Cleófilas opta por evadir la realidad, y esa evasión no solamente le causa ine...

  1. Hiperplasia embrionária epitelial da cápsula de Bowman pós-diálise crônica simulando nefroblastomatose: relato de caso

    Directory of Open Access Journals (Sweden)

    Noronha Lúcia de

    2002-01-01

    Full Text Available A hiperplasia embrionária epitelial da cápsula de Bowman (HEECB é uma rara alteração pós-diálise de rins em fase final de evolução, com poucas descrições na literatura mundial. Destaca-se a sua importância por simular histologicamente a nefroblastomatose universal, uma entidade pré-neoplásica precursora do tumor de Wilms. Neste artigo, relatamos o caso incomum de um paciente de 12 anos de idade, cujos rins, após 32 meses de terapia dialítica, apresentaram alterações compatíveis com HEECB.

  2. Kuues "Diverse. Universe" / Sandra Jõgeva

    Index Scriptorium Estoniae

    Jõgeva, Sandra, 1976-

    2010-01-01

    Non Grata korraldatud rahvusvaheline performance'i-kunsti festival "Diverse Universe 2010" Pärnu Kunstihallis ja Pärnu Kunstnike Majas 23. ja 24. aprillil. Rühmituste Juurikasvu (Soome), Cnopt (Eesti), Rubensid (Eesti), Ornicart (Prantsusmaa), Zane Matule ja Gatis Vectirānsi (Läti) jt. performance'itest

  3. Kuues "Diverse. Universe" / Sandra Jõgeva

    Index Scriptorium Estoniae

    Jõgeva, Sandra, 1976-

    2010-01-01

    Non Grata korraldatud rahvusvaheline performance'i-kunsti festival "Diverse Universe 2010" Pärnu Kunstihallis ja Pärnu Kunstnike Majas 23. ja 24. aprillil. Rühmituste Juurikasvu (Soome), Cnopt (Eesti), Rubensid (Eesti), Ornicart (Prantsusmaa), Zane Matule ja Gatis Vectirānsi (Läti) jt. performance'itest

  4. Breeds of Empire. The « Invention » of the Horse in Southeast Asia and Southern Africa 1500-1950, Greg Bankoff & Sandra Swart (éds

    Directory of Open Access Journals (Sweden)

    Damien Onillon

    2011-11-01

    Full Text Available Cet ouvrage collectif dirigé par Greg Bankoff et Sandra Swart regroupe neuf contributions, divisées en deux parties, d’historiens spécialisés en histoire environnementale, économique ou sociale et d’une anthropologue. Chacune de ces contributions s’intéresse à l’introduction et à « l’invention » de nouvelles espèces de chevaux en Asie du Sud-Est en général, et particulièrement en Thaïlande, en Indonésie et aux Philippines, mais aussi en Afrique du Sud. Cette introduction s’effectue dans le co...

  5. The cytotoxic effect of Bowman-Birk isoinhibitors, IBB1 and IBBD2, from soybean (Glycine max) on HT29 human colorectal cancer cells is related to their intrinsic ability to inhibit serine proteases.

    Science.gov (United States)

    Clemente, Alfonso; Moreno, Francisco Javier; Marín-Manzano, Maria del Carmen; Jiménez, Elisabeth; Domoney, Claire

    2010-03-01

    Bowman-Birk inhibitors (BBI) from soybean and related proteins are naturally occurring protease inhibitors with potential health-promoting properties within the gastrointestinal tract. In this work, we have investigated the effects of soybean BBI proteins on HT29 colon adenocarcinoma cells, compared with non-malignant colonic fibroblast CCD-18Co cells. Two major soybean isoinhibitors, IBB1 and IBBD2, showing considerable amino acid sequence divergence within their inhibitory domains, were purified in order to examine their functional properties, including their individual effects on the proliferation of HT29 colon cancer cells. IBB1 inhibited both trypsin and chymotrypsin whereas IBBD2 inhibited trypsin only. Despite showing significant differences in their enzyme inhibitory properties, the median inhibitory concentration values determined for IBB1 and IBBD2 on HT29 cell growth were not significantly different (39.9+/-2.3 and 48.3+/-3.5 microM, respectively). The cell cycle distribution pattern of HT29 colon cancer cells was affected by BBI treatment in a dose-dependent manner, with cells becoming blocked in the G0-G1 phase. Chemically inactive soybean BBI had a weak but non-significant effect on the proliferation of HT29 cells. The anti-proliferative properties of BBI isoinhibitors from soybean reveal that both trypsin- and chymotrypsin-like proteases involved in carcinogenesis should be considered as potential targets of BBI-like proteins.

  6. 《认知语言学:内在动力与跨学科互动》介绍%Francisco J. Ruiz de Mendoza Ibá(n)ez & M. Sandra Pe(n)a Cervel(eds.).2005.Cognitive Linguistics: Internal Dynamics and Interdisciplinary Interaction

    Institute of Scientific and Technical Information of China (English)

    张云

    2008-01-01

    1.内容概览《认知语言学:内在动力与跨学科互动》一书由Francisco J.Ruiz de Mendoza Ibánez和M.Sandra Pena Cervel编辑,2005年由Moutonde Gruyter出版公司出版。全书432页,11篇论文,分为四个部分。

  7. Sub-Bowman-Keratomileusis for the treatment of corneal grinding with refractive error after corneal transplantation in clinical observation%前弹力层下激光角膜磨镶术治疗角膜移植术后屈光不正观察

    Institute of Scientific and Technical Information of China (English)

    黄旭; 李定章

    2014-01-01

    目的 探讨应用前弹力层下激光角膜磨镶术(SBK)治疗角膜移植术后屈光不正的疗效.方法 于2011年10月至2012年10月在南昌新视界眼科医院应用前弹力层下激光角膜磨镶术治疗角膜移植术后屈光不正患者17例(17只眼).结果 术后随访期间,全部角膜植片保持透明;术后6个月最佳矫正视力≥术前者16只眼,占总眼数94.1%;而最佳矫正视力下降1行的1只眼,占总眼数的5.9%;未观察到术后最佳矫正视力较术前下降2行以上的病例.结论 应用前弹力层下激光角膜磨镶术治疗角膜移植术后屈光不正是安全有效的方法,可为解决角膜移植术后高度屈光不正问题带来希望.%Objective To explore the application of elasti Sub-Bowman-Keratomileusis refractive error after grinding with treatment of corneal transplantation.Methods Seventeen cases (17 eyes) received Sub-Bowman-Keratomileusis for the treatment of corneal grinding with refractive error after corneal transplantation.Results All the corneal graft remained transparency during the postoperative follow-up period.The postoperative best corrected visual acuity was higher than or equal to 6 months before on 16 eyes,accounted for 97.3% of the total number of eye.The postoperative best corrected vision lost 1 row in 1 eye,accounted for 2.7%,and no 2 rows decreased were seen in all other cases.Conclusions Sub-Bowman-Keratomileusis corneal refractive errors correction after grinding with treatment of corneal transplantation is safe and effective method.It solves the problem of high refractive errors after corneal transplantation.

  8. 边界视角下的希斯内罗丝小说解读%Interpretation of Sandra Cisneros’s Novels from the Perspective of Border Studies

    Institute of Scientific and Technical Information of China (English)

    胡佳

    2014-01-01

    传统的社会学边界研究在文学中逐渐受到关注和运用。由于受地理界线、历史文化及种族差异的影响,墨西哥裔美国文学中的边界书写更为突出。以当代墨西哥裔女作家桑德拉·希斯内罗丝的小说《芒果街上的小屋》和《拉拉的褐色披肩》为例,在细读文本的基础上,以格洛丽亚·安扎尔多瓦的边界研究视角为切入点,分析作品所体现的边界概念及其扩展的比喻意义。边界的不利处境反而成为小说中跨民族空间的移民提高自身及改善他们的跨界生活的催化剂,包容不同身份、寻求和谐的“新混血儿意识”帮助他们跨越边界,迈向更广阔的未来。%In the world of letters,there is a growing interest in the traditional sociological border studies. Due to the influences of geographical border,racial differences,history and culture,border writing is es-pecially prominent in Mexican American literature.Taking Mexican American women writer Sandra Cis-neros’s two novels---The House on Mango Street and Caramelo as the analyzing texts,this article a-dopts Gloria Anzaldúa’s border theory to analyze the border consciousness and its extended significance within the two novels.Instead of acting as an obstacle,the plight of living in borderland turns out to be the catalyst for the self-improvement of the Mexican Americans.The new mestiza consciousness inclu-ding a tolerance of ambiguity and a pursuit of harmony helps them to cross the border and create a promis-ing homeland.

  9. Noorus ei kohusta millekski / Sandra Jõgeva

    Index Scriptorium Estoniae

    Jõgeva, Sandra, 1976-

    2011-01-01

    ELIA korraldatud festivali "Neu/Now Live 2011" näitused Tallinnas Kullo Lastegaleriis ning Arhitektuuri- ja Disainigaleriis 17.-20.11.2011. Lühidalt ka eesti kunstniku Kristi Kongi ja disainer Lauri Hirvesaare töödest

  10. Tavaline üürikorter / Sandra Jõgeva

    Index Scriptorium Estoniae

    Jõgeva, Sandra, 1976-

    2008-01-01

    Näitus "Üürikorter / Apartment for Rent" skulptuuri- ja installatsioonigaleriis Raja kuni 21. III. Kuraator on Berliinis töötav hollandi kunstnik Anneke Eussen, kelle workshop'i raames näituse tööd valmisid. Maigi Magnuse, Rene Reinumäe, Kadri Allekandi, Berit Talpsepa ja Eike Epliku töödest

  11. Lagunenud valitsusega Pakistan vaevleb kriisis / Sandra Maasalu

    Index Scriptorium Estoniae

    Maasalu, Sandra

    2008-01-01

    Ilmunud ka: Postimees : na russkom jazõke 27. aug. 2008, lk. 7. Pakistani valitsuse lagunemisest, kui endine peaminister Navaz Sharif oma parteiga koalitsioonist lahkus. Vt. samas: Pakistani ahistavad separatistid ja majanduse allakäik. Kaart: Pakistan

  12. Tavaline üürikorter / Sandra Jõgeva

    Index Scriptorium Estoniae

    Jõgeva, Sandra, 1976-

    2008-01-01

    Näitus "Üürikorter / Apartment for Rent" skulptuuri- ja installatsioonigaleriis Raja kuni 21. III. Kuraator on Berliinis töötav hollandi kunstnik Anneke Eussen, kelle workshop'i raames näituse tööd valmisid. Maigi Magnuse, Rene Reinumäe, Kadri Allekandi, Berit Talpsepa ja Eike Epliku töödest

  13. Mitmekülgne universum / Sandra Jõgeva

    Index Scriptorium Estoniae

    Jõgeva, Sandra, 1976-

    2008-01-01

    26. V toimunud tegevuskunstifestivali "Diverse Universe 2008" performance''i-konverentsist Pärnus Academia Non Grata majas. Tutvustati kollektiive HorseCow (California, Sacramento), GoGoTrash (Kesselberg), Berliini kunstnikerühmitust Open Space, 500 korea performance'i-kunstnikku koondavat isetekkelist organisatsiooni KOPAS - Korea Performance Art Spirit, ettekandega esines Brightoni kunstnik Orion Maxted

  14. Lagunenud valitsusega Pakistan vaevleb kriisis / Sandra Maasalu

    Index Scriptorium Estoniae

    Maasalu, Sandra

    2008-01-01

    Ilmunud ka: Postimees : na russkom jazõke 27. aug. 2008, lk. 7. Pakistani valitsuse lagunemisest, kui endine peaminister Navaz Sharif oma parteiga koalitsioonist lahkus. Vt. samas: Pakistani ahistavad separatistid ja majanduse allakäik. Kaart: Pakistan

  15. Paraproletariaat ja vilets Valgre / Sandra Jõgeva

    Index Scriptorium Estoniae

    Jõgeva, Sandra, 1976-

    2008-01-01

    Eesti Kunstiakadeemia interdistsiplinaarsete kunstide osakonna ning Pärnu filmi- ja videofestivali alternatiivkino "Le Cinema Extraordinaire" (kuraatorid Erik Alalooga ja Ville-Karel Viirelaid) Tallinnas Nongrata Kunstikonteineris kultuuritehases Polymer 1.-22. II. Minna Hindi autoriõhtu (filmid "Kolm pilti elust ja ajast" ning "Sees või väljas") ja Jaan-Jürgen Klausi filmid "Sinitäheke" (peategelane Erkki Hüva) ning "Erakpoeet Marko Kompus"

  16. Entrevista : Sandra Bessudo Lion (APC-Colombia)

    OpenAIRE

    2013-01-01

    Bióloga Marina del Ecole Pratique de Hautes Etudes Ephe, con Máster en Estudios de Ciencias de la Vida y de la Tierra en Perpignan, Francia. Es buzo profesional con más de 5.000 inmersiones en aguas abiertas, siendo una profesional muy comprometida con la conservación de la biodiversidad marina y con el cuidado del medio ambiente. A partir de enero de 2012 asumió la Dirección General de la Agencia Presidencial de Cooperación Internacional de Colombia (APC-Colombia), entidad gubernamental enca...

  17. Olemise talumatu raskus ja progressiusk / Sandra Jõgeva

    Index Scriptorium Estoniae

    Jõgeva, Sandra, 1976-

    2008-01-01

    Prantsuse kunstniku Orlani näitus "Postidentiteedi strateegiad" Tallinna Kunstihoones, kuraatorid Eugenio Viola ja Reet Varblane. Teosest "Madonna garaazhis". Kunstniku pöördumisest molekulaarbioloogia võimaluste poole

  18. Smells Like Teen Spirit / Sandra Jõgeva

    Index Scriptorium Estoniae

    Jõgeva, Sandra, 1976-

    2009-01-01

    Kuigi on majanduslik langus, tekib praegu juurde loomelinnakuid ja kultuuriruume (Rotermanni loovala, Baltika loomeinkubaator, Telliskivi loomelinnak jne.). Riia kesklinnas olid septembris projekti Survival Kit raames avatud ajutised kunstigaleriid südalinna äripindadel. Autori sõnul on õhus üheksakümnendate hõngu, vanad jõuvahekorrad enam ei kehti, tekib uusi võimalusi

  19. Mitmekülgne universum / Sandra Jõgeva

    Index Scriptorium Estoniae

    Jõgeva, Sandra, 1976-

    2008-01-01

    26. V toimunud tegevuskunstifestivali "Diverse Universe 2008" performance''i-konverentsist Pärnus Academia Non Grata majas. Tutvustati kollektiive HorseCow (California, Sacramento), GoGoTrash (Kesselberg), Berliini kunstnikerühmitust Open Space, 500 korea performance'i-kunstnikku koondavat isetekkelist organisatsiooni KOPAS - Korea Performance Art Spirit, ettekandega esines Brightoni kunstnik Orion Maxted

  20. Olemise talumatu raskus ja progressiusk / Sandra Jõgeva

    Index Scriptorium Estoniae

    Jõgeva, Sandra, 1976-

    2008-01-01

    Prantsuse kunstniku Orlani näitus "Postidentiteedi strateegiad" Tallinna Kunstihoones, kuraatorid Eugenio Viola ja Reet Varblane. Teosest "Madonna garaazhis". Kunstniku pöördumisest molekulaarbioloogia võimaluste poole

  1. Nooremas keskeas klassikute nukuteater / Sandra Jõgeva

    Index Scriptorium Estoniae

    Jõgeva, Sandra, 1976-

    2010-01-01

    Silja Saarepuu ja Villu Plingi näitus "Aknal" Pärnu Kunstihallis 28. veebruarini 2010. Suure osa eksponeeritud loomingust hõlmab nn väikeste inimeste teema. Jasper Zoova ruumiliste maalide näitus "Jass tuli koju" Jazz Cafés Pärnus 3. märtsini 2010

  2. Urmas Põld ehitab Aseri sadamat / Sandra Jalakas

    Index Scriptorium Estoniae

    Jalakas, Sandra

    2004-01-01

    Endise vormelisõitja, ärimees Urmas Põllu karjäärist professionaalse võidusõitjana, tegevusest talle kuuluva autofirma PP Int Grupp eesotsas ning plaanidest rajada Aserisse naftatoodete eksportsadam

  3. Paraproletariaat ja vilets Valgre / Sandra Jõgeva

    Index Scriptorium Estoniae

    Jõgeva, Sandra, 1976-

    2008-01-01

    Eesti Kunstiakadeemia interdistsiplinaarsete kunstide osakonna ning Pärnu filmi- ja videofestivali alternatiivkino "Le Cinema Extraordinaire" (kuraatorid Erik Alalooga ja Ville-Karel Viirelaid) Tallinnas Nongrata Kunstikonteineris kultuuritehases Polymer 1.-22. II. Minna Hindi autoriõhtu (filmid "Kolm pilti elust ja ajast" ning "Sees või väljas") ja Jaan-Jürgen Klausi filmid "Sinitäheke" (peategelane Erkki Hüva) ning "Erakpoeet Marko Kompus"

  4. Smells Like Teen Spirit / Sandra Jõgeva

    Index Scriptorium Estoniae

    Jõgeva, Sandra, 1976-

    2009-01-01

    Kuigi on majanduslik langus, tekib praegu juurde loomelinnakuid ja kultuuriruume (Rotermanni loovala, Baltika loomeinkubaator, Telliskivi loomelinnak jne.). Riia kesklinnas olid septembris projekti Survival Kit raames avatud ajutised kunstigaleriid südalinna äripindadel. Autori sõnul on õhus üheksakümnendate hõngu, vanad jõuvahekorrad enam ei kehti, tekib uusi võimalusi

  5. Nooremas keskeas klassikute nukuteater / Sandra Jõgeva

    Index Scriptorium Estoniae

    Jõgeva, Sandra, 1976-

    2010-01-01

    Silja Saarepuu ja Villu Plingi näitus "Aknal" Pärnu Kunstihallis 28. veebruarini 2010. Suure osa eksponeeritud loomingust hõlmab nn väikeste inimeste teema. Jasper Zoova ruumiliste maalide näitus "Jass tuli koju" Jazz Cafés Pärnus 3. märtsini 2010

  6. Kaasaegne kunst kui ekstreemne meelelahutus / Sandra Jõgeva

    Index Scriptorium Estoniae

    Jõgeva, Sandra, 1976-

    2005-01-01

    Tutvustatakse kümmet kaasaegset kunstirühmitust ja -projekti: USA anonüümne kollektiiv The Yes Men, rahvusvaheline rühmitus The Biotic Pie Bacing Brigade, Hispaania rühmitus Yomango, taani disainerite rühmitus N55, poolaka Krzystof Wodiczko projekt, USA rühmitus Basekamp, Austraalia tegevuskunstniku Stelarc' projekt, USA rühmitus Pink Bloque ja Inglismaa rühmitus My Dads Strip Club

  7. Kaasaegne kunst kui ekstreemne meelelahutus / Sandra Jõgeva

    Index Scriptorium Estoniae

    Jõgeva, Sandra, 1976-

    2005-01-01

    Tutvustatakse kümmet kaasaegset kunstirühmitust ja -projekti: USA anonüümne kollektiiv The Yes Men, rahvusvaheline rühmitus The Biotic Pie Bacing Brigade, Hispaania rühmitus Yomango, taani disainerite rühmitus N55, poolaka Krzystof Wodiczko projekt, USA rühmitus Basekamp, Austraalia tegevuskunstniku Stelarc' projekt, USA rühmitus Pink Bloque ja Inglismaa rühmitus My Dads Strip Club

  8. Interview : Sandra Bessudo Lion (APC-Colombia)

    OpenAIRE

    Bessudo Lion, Sandra

    2013-01-01

    She is a Marine Biologist, graduated from the Ecole Pratique de Hautes Etudes (EPHE), and holds a Master’s in Life and Earth Sciences from Perpignan, France. She is a professional scuba diver with over 5,000 dives in open waters. Ms. Bessudo is a professional strongly committed to the conservation of marine biodiversity and the protection of the environment. In January 2012, she took office as head of the General Directorate, Presidential Agency of International Cooperation, Colombia (APC-Col...

  9. 1409-IJBCS-Article-Sandra Farias+

    African Journals Online (AJOL)

    hp

    After making the opening of the samples, the concentrations of minerals were obtained by Atomic ... functioning of our cells. ... alcoholic and non-alcoholic people from the ... human beings, the same was submitted and .... This ion is essential for neuronal ... number compared with group C. This is .... disorders of the brain.

  10. Noorus ei kohusta millekski / Sandra Jõgeva

    Index Scriptorium Estoniae

    Jõgeva, Sandra, 1976-

    2011-01-01

    ELIA korraldatud festivali "Neu/Now Live 2011" näitused Tallinnas Kullo Lastegaleriis ning Arhitektuuri- ja Disainigaleriis 17.-20.11.2011. Lühidalt ka eesti kunstniku Kristi Kongi ja disainer Lauri Hirvesaare töödest

  11. Sandra ja Liisu on igal etendusel kohal / Sandra Sillaots, Liisu Krass ; interv. Evelin Nõmmik

    Index Scriptorium Estoniae

    Sillaots, Sandra

    2006-01-01

    Kahe sõbranna koostöös kirjutatud näidendit "Sõbrapäev" mängitakse Endla teatri Küüni laval. Mängivad teatri noortestuudio õpilased Enn Keerdi juhendamisel. Näidendi autorid sellest, kuidas näitemäng paberile sai ja lavastusest

  12. Sandra ja Liisu on igal etendusel kohal / Sandra Sillaots, Liisu Krass ; interv. Evelin Nõmmik

    Index Scriptorium Estoniae

    Sillaots, Sandra

    2006-01-01

    Kahe sõbranna koostöös kirjutatud näidendit "Sõbrapäev" mängitakse Endla teatri Küüni laval. Mängivad teatri noortestuudio õpilased Enn Keerdi juhendamisel. Näidendi autorid sellest, kuidas näitemäng paberile sai ja lavastusest

  13. 企业绩效、财务资源与战略风险--对鲍曼悖论及财务资源调节效应的实证分析%Corporate Performance,Financial Resources and Strategic Risk:An Em-pirical Analysis on the Bowman Paradox and the Regulation Effect of Fi-nancial Resources

    Institute of Scientific and Technical Information of China (English)

    潘旵; 周雅倩式

    2015-01-01

    鲍曼悖论———跨企业绩效与战略风险负相关,是战略管理研究领域的经典谜题,自20世纪80年代提出以来引发了众多学者持续的研究和争论。文章选取国内937家民营上市公司作为样本,结合前景理论、行为理论以及资源基础理论,通过构建二次回归模型探讨了跨企业战略风险与绩效之间的关系,以及财务资源配置对二者关系的调节作用。研究结果显示,我国民营上市公司绩效与战略风险之间呈现正U型曲线关系;财务资源配置负向调节绩效与战略风险的相关关系。%Bowman paradox has been a classic puzzle in the field of strategic management. It has caused many scholars continued research and debate since it was put forward in 1980 s. In this paper,We select 937 domestic listed companies as samples,and combined the prospect theory, behavior theory and the Resource based view to examined the relationship between inter-enter-prise strategic risk and performance by constructing a quadratic regression model. The results showed that the performance-risk relationship of the private listing Corporation in China is U shaped;the financial resources is negative to adjust corporate performance-risk relationship.

  14. Avaliação das alterações biomecânicas da córnea antes e após lasik em pacientes míopes e hipermetrópes utilizando Moriá® Sub-Bowman's Keratomileusis (SBK

    Directory of Open Access Journals (Sweden)

    Bruno de Freitas Valbon

    2012-10-01

    Full Text Available OBJETIVO: Avaliar e comparar as alterações biomecânicas da córnea por meio do Ocular Response Analyzer® (ORA Reichert Ophtalmics Instruments, Buffalo, New York, USA antes e após Lasik com Moriá ® Sub Bowman Keratomileusis (SBK One Use Plus (OUP em pacientes míopes e hipermetrópes. MÉTODOS: Foram estudados 33 olhos, sendo 19 olhos míopes e 14 olhos hipermetrópes submetidos à cirurgia refrativa com técnica Lasik com flap fino (100 µ utilizando Moriá SBK OUP. O ORA foi realizado no pré-operatório e 1 mês após a cirurgia para avaliar a biomecânica da córnea. O CH (Corneal Hysteresis, CRF (Corneal Resistance Factor, IOPg (goldmann gold standard, Goldmann correlated intraocular pressure a IOPcc (corneal compensated intraocular pressure e mais 38 variáveis biomecânicas da córnea derivadas do sinal de resposta foram avaliados. O Teste de Kolmogorov-Smirnov foi utilizado para avaliar a distribuição normal. O teste de Wilcoxon foi utilizado para comparar as variáveis antes e após a cirurgia para cada grupo. As diferenças entre as medidas pré e pós-operatórias dos olhos míopes foram comparadas com as diferenças obtidas nos olhos hipermetrópes, utilizando-se o teste de Mann-Whitney. Foi considerado como estatisticamente significante p < 0,05%. RESULTADOS: Houve diferença significativa antes e após Lasik em olhos míopes e hipermetrópes na variável IOPg(Wilcoxon, p <0,05, porém não houve em IOPcc. Somente em olhos míopes houve diferenças significativas em CH e CRF, antes e após Lasik com Moriá SBK OUP, como também 9 parâmetros derivados do ORA Waveform_Sinal Gráfico (aspect1, h1, dive1, path1, p1area1, W11, H11, and w2 path11; Wilcoxon, p <0,05. Em olhos hipermetrópes houve diferenças antes e após Lasik das seguintes variáveis: aspect2, h2, dive2, mslew2 e H21 (Wilcoxon p<0,05.Diferenças nas variáveis IOPg e p1area, antes e após Lasik foram maiores em olhos míopes do que hipermetrópes (Mann-Whitey, p

  15. Parkimistrahvide aegumise küsimuses valitseb segadus / Sandra Maasalu

    Index Scriptorium Estoniae

    Maasalu, Sandra

    2007-01-01

    Justiitsministeerium peab vajalikuks täpsustada seadusi nii, et parkimistrahvi sissenõudmise aeg oleks täpselt määratletud. Kommenteerib justiitsminister Rein Lang. Vt ka: Koorits, Vahur. Röövimine aegub parkimistrahvist varem // Postimees 8. aug. 2007, lk. 3 ; Suik, Andres. Parkimistrahv aegub kiirelt : inimeste suhtes ei saa täita aegunud otsuseid // Postimees 14. aug. 2007, lk. 15

  16. Pärnu kunstnikud tagasi kodus / Sandra Jõgeva

    Index Scriptorium Estoniae

    Jõgeva, Sandra, 1976-

    2011-01-01

    Pärnust pärit kunstnike näitus "Tagasi koju" Pärnu Linnagaleriis 13. augustini 2011. Kuraator Mari Kartau, kunstnikud Kaarel Kurismaa, Mari Kurismaa, Malle Leis, Marco Laimre, Maiu Rõõmus, Flo Kasearu, Elin Kard

  17. New age'i kogupauk Pärnus / Sandra Jõgeva

    Index Scriptorium Estoniae

    Jõgeva, Sandra, 1976-

    2009-01-01

    Andrus Joonase kureeritud kuues Pärnu moodsa kunsti aastanäitus "Me oleme langenud inglid, kes peavad üles tõusma" Pärnu Kunstihallis, avatud kuni 11. jaan. Jasper Zoova joonistuste, installatsioonide ja animafilmide näitus "Reis ma ei tea kuhu" Pärnu Muuseumis, avatud kuni 15. jaan. Ville-Karel Viirelaiu tööde näitus "Metasport" Pärnu Kunstnike Majas, avatud 1. dets. 2008-3. jaan. 2009. Eksponeeritud kollaažid, kaks videot ja valgusinstallatsioon "30 sekundit"

  18. New age'i kogupauk Pärnus / Sandra Jõgeva

    Index Scriptorium Estoniae

    Jõgeva, Sandra, 1976-

    2009-01-01

    Andrus Joonase kureeritud kuues Pärnu moodsa kunsti aastanäitus "Me oleme langenud inglid, kes peavad üles tõusma" Pärnu Kunstihallis, avatud kuni 11. jaan. Jasper Zoova joonistuste, installatsioonide ja animafilmide näitus "Reis ma ei tea kuhu" Pärnu Muuseumis, avatud kuni 15. jaan. Ville-Karel Viirelaiu tööde näitus "Metasport" Pärnu Kunstnike Majas, avatud 1. dets. 2008-3. jaan. 2009. Eksponeeritud kollaažid, kaks videot ja valgusinstallatsioon "30 sekundit"

  19. Magistritiitli kui teaduskraadi aeg saab ümber / Sandra Maasalu

    Index Scriptorium Estoniae

    Maasalu, Sandra

    2009-01-01

    Üleminek Bologna süsteemile kõrghariduses suleb 4+2 magistriõppekavad. Tallinna Ülikooli õppeosakonna juhataja Imbi Teiteri sõnul oli neil viimane võimalus teadusmagistritööd kaitsta tänavu 1. septembril. Samal kuupäeval sulges vanad õppekavad ka Tallinna Tehnikaülikool. Tartu Ülikoolis on viimaseks kaitsmiskuupäevaks 31. august ja Eesti Maaülikoolil 2011. aasta lõpp

  20. Development of the sandra antenna for airborne satellite communication

    NARCIS (Netherlands)

    Verpoorte, J.; Schippers, H.; Jorna, P.; Hulzinga, A.; Roeloffzen, C.G.H.; Marpaung, D.A.I.; Sanadgol, B.; Baggen, R.; Wang, Qin; Noharet, B.; Beeker, W.; Leinse, A.; Heideman, R.G.

    2011-01-01

    Novel avionics communication systems are required for increasing flight safety and operational integrity, for optimizing economy of operations and for enhancing passenger services. One of the key technologies to be developed is an antenna system that will provide broadband connectivity within aircra

  1. Sandra Witte: Zouber. Hamburg: Verlag Dr. Kovač 2007

    Directory of Open Access Journals (Sweden)

    Andrea Sieber

    2009-03-01

    Full Text Available Die Freiburger Dissertation widmet sich dem Faszinosum Magie am Beispiel der höfischen Literatur des 12. und 13. Jahrhunderts. Im Zentrum steht die deskriptive Analyse von Magiedarstellungen auf der Handlungsebene fiktionaler Texte, wobei ein besonderes Augenmerk auf Geschlechterdifferenzen magiekundiger Figuren liegt. Vorab werden mögliche Schnittflächen zu zeitgenössischen Diskursen in den Bereichen Religion, Wissenschaft und Heilkunde konturiert und diese um Skizzen zu ausgewählten nichtfiktionalen Quellen ergänzt. Leider verschenkt die mediävistische Studie durch ihren überwiegend nacherzählenden Duktus das in der Magie-Thematik inhärente gender-theoretische und kulturwissenschaftliche Potential.This Freiburger dissertation approaches fascination with magic using the example of the courtly literature of the 12th and 13th centuries. Central to the study is the descriptive analysis of representations of magic at the plot level of fictional texts, whereby specific attention is paid to gender differences of those figures skilled in magic. Possible intersections with contemporary discourses in the areas of religion, science, and medical science are outlined at the outset. These are expanded with sketches of select non-fictional sources. Unfortunately, because of its tendency to uncritically re-narrate the texts, the medieval study passes up on the gender-theoretical and cultural studies oriented potential inherent to the theme of magic.

  2. VizieR Online Data Catalog: Kepler δ Sct stars amplitude modulation (Bowman+, 2016)

    Science.gov (United States)

    Bowman, D. M.; Kurtz, D. W.; Breger, M.; Murphy, S. J.; Holdsworth, D. L.

    2016-06-01

    We searched for amplitude modulation of pulsation modes in δ Sct stars observed by the Kepler Space Telescope. The number of pulsation modes out of a maximum of twelve that have constant amplitudes and variable amplitudes are given in the columns NoMod and AMod, respectively, along with stellar parameters from Huber et al. (2014, Cat. J/ApJS/211/2). Table 1 is the full version for all 983 δ Sct stars the abridged version of the paper. (1 data file).

  3. Oligomerization states of Bowman-Birk inhibitor by atomic force microscopy and computational approaches.

    Science.gov (United States)

    Silva, Luciano P; Azevedo, Ricardo B; Morais, Paulo C; Ventura, Manuel M; Freitas, Sonia M

    2005-11-15

    Several methods have been applied to study protein-protein interaction from structural and thermodynamic point of view. The present study reveals that atomic force microscopy (AFM), molecular modeling, and docking approaches represent alternative methods offering new strategy to investigate structural aspects in oligomerization process of proteinase inhibitors. The topography of the black-eyed pea trypsin/chymotrypsin inhibitor (BTCI) was recorded by AFM and compared with computational rigid-bodies docking approaches. Multimeric states of BTCI identified from AFM analysis showed globular-ellipsoidal shapes. Monomers, dimers, trimers, and hexamers were the most prominent molecular arrays observed in AFM images as evaluated by molecular volume calculations and corroborated by in silico docking and theoretical approaches. We therefore propose that BTCI adopts stable and well-packed self-assembled states in monomer-dimer-trimer-hexamer equilibrium. Although there are no correlation between specificity and packing efficiency among proteinases and proteinase inhibitors, the AFM and docked BTCI analyses suggest that these assemblies may exist in situ to play their potential function in oligomerization process.

  4. Janez Jansha. Euroopa oivik tõrjub solgiämbreid / Sandra Maasalu

    Index Scriptorium Estoniae

    Maasalu, Sandra

    2008-01-01

    2004. a. paremtsentristliku Demokraatliku Partei juhina valimistel võitnud Janez Jansha on populaarsust kaotamas ning peatsed valimised ei tõota ennustuste põhjal erilist edu. Dissidendist kõvakäemeheks. Korruptsioonisüüdistused seoses Soome relvafirma tehinguga

  5. Vive Tolli, Andy Warholi põlvkonnast / Vive Tolli ; interv. Sandra Jõgeva

    Index Scriptorium Estoniae

    Tolli, Vive, 1928-

    1998-01-01

    Sel aastal Wiiralti preemia saanud V. Tolli eesti graafika tasemest, Eesti Kunstiakadeemia graafikakateedri seisust, haridusest, mis seal saab, eesti praegusest raamatukujundusest, liikumisest suurema lihtsuse suunas oma loomingus jm.

  6. Sõrve 2008 / Nicholas Wurm, Steven Buchert, Mai Buchert, Sandra Buchert...[jt.

    Index Scriptorium Estoniae

    2008-01-01

    lapsed ja lapsevanemad Austraaliast meenutavad oma viibimist Sõrve lastelaagris: This is a story of a family from Sõrve; Nicholas Wurm - Age 9 (Adelaide); Alan and Debbie Mikkor (Melbourne); Jesse Mikkor's point of view: Age 8; Lauren Mikkor's point of view: Age 13

  7. Vive Tolli, Andy Warholi põlvkonnast / Vive Tolli ; interv. Sandra Jõgeva

    Index Scriptorium Estoniae

    Tolli, Vive, 1928-

    1998-01-01

    Sel aastal Wiiralti preemia saanud V. Tolli eesti graafika tasemest, Eesti Kunstiakadeemia graafikakateedri seisust, haridusest, mis seal saab, eesti praegusest raamatukujundusest, liikumisest suurema lihtsuse suunas oma loomingus jm.

  8. Vikergallup : eesti kirjandus 2010 / Peeter Helme, Sandra Jõgeva, Mihkel Kaevats ... [jt.

    Index Scriptorium Estoniae

    2011-01-01

    24 arvustaja vastus küsimusele, milline oli 2010. aasta parim uudisteos ja debüüt. Parima uudisteosena nimetati enim Kalju Kruusa luulekogu "Tühhja", Ene Mihkelsoni luulekogu "Torn" ning Lauri Sommeri proosaraamatut "Kolm yksiklast". Parimaks debüüdiks peeti Siim Nurkliku näidendit "Kas ma olen nüüd elus".

  9. Andres Elbingu gängstaräpp avas Polymeris ajutise alternatiivkino / Sandra Jõgeva

    Index Scriptorium Estoniae

    Jõgeva, Sandra, 1976-

    2008-01-01

    1.-22. veebruarini 2008 toimub Tallinnas Nongrata Kunstikonteineris Kultuuritehases Polymer Eesti Kunstiakadeemia interdistsiplinaarsete kunstide kateedri ja Pärnu filmi- ja videofestivali korraldatav alternatiivkino "La Cinema Extraordinaire"

  10. Thatcheri tütar avalikustas Raudse Leedi nõdrameelsuse / Sandra Maasalu

    Index Scriptorium Estoniae

    Maasalu, Sandra

    2008-01-01

    Ilmunud ka: Postimees : na russkom jazõke 26. aug. 2008, lk. 9. Suurbritannia endise peaministri Margaret Thatcheri tütar Carol Thatcher kirjutab peatselt ilmuvas mälestusteraamatus oma ema dementsusest

  11. Dynamics beetween 'old' and 'new' ethnicities and multiple identities in Sandra Cisneros' Caramelo

    Directory of Open Access Journals (Sweden)

    Branka Kalogjera

    2007-12-01

    Full Text Available The paper takes Candra Cisneros'  epic semi-biographical novel Caramelo asa literary insight into dynamics  between generations  within  a single ethnic (Chicano  community,  and compares  it against classics  of the genre in its shifting  definition  of one's  ethnic identity;  here the postmodern approach of entwining fiction and fact and awarding them equallegitimacy mirrors the possibility of embracing multiple identities, as exemplified by the novel's protagonist.

  12. Sõrve 2008 / Nicholas Wurm, Steven Buchert, Mai Buchert, Sandra Buchert...[jt.

    Index Scriptorium Estoniae

    2008-01-01

    lapsed ja lapsevanemad Austraaliast meenutavad oma viibimist Sõrve lastelaagris: This is a story of a family from Sõrve; Nicholas Wurm - Age 9 (Adelaide); Alan and Debbie Mikkor (Melbourne); Jesse Mikkor's point of view: Age 8; Lauren Mikkor's point of view: Age 13

  13. Haiglavoodisse sattunud patsiendid küsivad internetti / Nils Niitra, Sandra Maasalu

    Index Scriptorium Estoniae

    Niitra, Nils, 1975-

    2006-01-01

    Vt. ka Tartu Postimees 16. juuni, lk. 1 ; Postimees : na russkom jazõke 19. juuni, lk. 9. Pärnu haiglas saavad kõik patsiendid, kel tervis lubab, palatis sülearvutiga traadita internetti kasutada. Tartu ja Tallinna haiglates levib WiFi esialgu tagasihoidlikumalt - kui üldse, siis ainult osas ruumidest

  14. Haiglavoodisse sattunud patsiendid küsivad internetti / Nils Niitra, Sandra Maasalu

    Index Scriptorium Estoniae

    Niitra, Nils, 1975-

    2006-01-01

    Vt. ka Tartu Postimees 16. juuni, lk. 1 ; Postimees : na russkom jazõke 19. juuni, lk. 9. Pärnu haiglas saavad kõik patsiendid, kel tervis lubab, palatis sülearvutiga traadita internetti kasutada. Tartu ja Tallinna haiglates levib WiFi esialgu tagasihoidlikumalt - kui üldse, siis ainult osas ruumidest

  15. Janez Jansha. Euroopa oivik tõrjub solgiämbreid / Sandra Maasalu

    Index Scriptorium Estoniae

    Maasalu, Sandra

    2008-01-01

    2004. a. paremtsentristliku Demokraatliku Partei juhina valimistel võitnud Janez Jansha on populaarsust kaotamas ning peatsed valimised ei tõota ennustuste põhjal erilist edu. Dissidendist kõvakäemeheks. Korruptsioonisüüdistused seoses Soome relvafirma tehinguga

  16. Austraalia eeskuju paneks tudengid kooli eest võrdselt maksma / Sandra Maasalu, Priit Rajalo

    Index Scriptorium Estoniae

    Maasalu, Sandra

    2007-01-01

    OECD raportis Eestile soovitatud süsteemis maksaksid kõik üliõpilased oma osa õppemaksust ise kinni ja saaksid valitsuselt toetust. Küsimusele, kas oleks õiglasem, kui kõik tudengid maksaksid õpingute eest, vastavad Tartu Ülikooli rektor Alar Karis, Tallinna Ülikooli rektor Rein Raud, Audentese rektori kohusetäitja Peeter Müürsepp, kaitseminister Jaak Aaviksoo ja Eesti Üliõpilaskondade Liidu juhatuse esimees Eimar Veldre. Tallinna Ülikooli tudengid Grete Sõõrumaa ning Karl Kallastu on ühel meelel, et Eesti praegune süsteem on ebavõrdne

  17. Andres Elbingu gängstaräpp avas Polymeris ajutise alternatiivkino / Sandra Jõgeva

    Index Scriptorium Estoniae

    Jõgeva, Sandra, 1976-

    2008-01-01

    1.-22. veebruarini 2008 toimub Tallinnas Nongrata Kunstikonteineris Kultuuritehases Polymer Eesti Kunstiakadeemia interdistsiplinaarsete kunstide kateedri ja Pärnu filmi- ja videofestivali korraldatav alternatiivkino "La Cinema Extraordinaire"

  18. Üliõpilasesindajad võtsid vastu resolutsiooni välistudengite kaitseks / Sandra Saar

    Index Scriptorium Estoniae

    Saar, Sandra

    2016-01-01

    Eesti Üliõpilaskondade Liidu eestvedamisel toimunud Balti- ja Põhjamaade üliõpilaste kohtumisest, kus võeti vastu otsus äärmuste osas kelle tegevuse tõttu on ohustatud rahvusvaheliste üliõpilaste heaolu

  19. Rezension zu: Sandra Witte: Zouber. Hamburg: Verlag Dr. Kovač 2007

    Directory of Open Access Journals (Sweden)

    Andrea Sieber

    2009-03-01

    Full Text Available Die Freiburger Dissertation widmet sich dem Faszinosum Magie am Beispiel der höfischen Literatur des 12. und 13. Jahrhunderts. Im Zentrum steht die deskriptive Analyse von Magiedarstellungen auf der Handlungsebene fiktionaler Texte, wobei ein besonderes Augenmerk auf Geschlechterdifferenzen magiekundiger Figuren liegt. Vorab werden mögliche Schnittflächen zu zeitgenössischen Diskursen in den Bereichen Religion, Wissenschaft und Heilkunde konturiert und diese um Skizzen zu ausgewählten nichtfiktionalen Quellen ergänzt. Leider verschenkt die mediävistische Studie durch ihren überwiegend nacherzählenden Duktus das in der Magie-Thematik inhärente gender-theoretische und kulturwissenschaftliche Potential.

  20. Bowman-Birk Protease Inhibitor from Vigna unguiculata Seeds Enhances the Action of Bradykinin-Related Peptides

    Directory of Open Access Journals (Sweden)

    Alice da Cunha M. Álvares

    2014-10-01

    Full Text Available The hydrolysis of bradykinin (Bk by different classes of proteases in plasma and tissues leads to a decrease in its half-life. Here, Bk actions on smooth muscle and in vivo cardiovascular assays in association with a protease inhibitor, Black eyed-pea trypsin and chymotrypsin inhibitor (BTCI and also under the effect of trypsin and chymotrypsin were evaluated. Two synthetic Bk-related peptides, Bk1 and Bk2, were used to investigate the importance of additional C-terminal amino acid residues on serine protease activity. BTCI forms complexes with Bk and analogues at pH 5.0, 7.4 and 9.0, presenting binding constants ranging from 103 to 104 M−1. Formation of BTCI-Bk complexes is probably driven by hydrophobic forces, coupled with slight conformational changes in BTCI. In vitro assays using guinea pig (Cavia porcellus ileum showed that Bk retains the ability to induce smooth muscle contraction in the presence of BTCI. Moreover, no alteration in the inhibitory activity of BTCI in complex with Bk and analogous was observed. When the BTCI and BTCI-Bk complexes were tested in vivo, a decrease of vascular resistance and consequent hypotension and potentiating renal and aortic vasodilatation induced by Bk and Bk2 infusions was observed. These results indicate that BTCI-Bk complexes may be a reliable strategy to act as a carrier and protective approach for Bk-related peptides against plasma serine proteases cleavage, leading to an increase in their half-life. These findings also indicate that BTCI could remain stable in some tissues to inhibit chymotrypsin or trypsin-like enzymes that cleave and inactivate bradykinin in situ.

  1. Bowman-Birk protease inhibitor from Vigna unguiculata seeds enhances the action of bradykinin-related peptides.

    Science.gov (United States)

    da Cunha Morales Álvares, Alice; Schwartz, Elisabeth Ferroni; Amaral, Nathalia Oda; Trindade, Neidiane Rosa; Pedrino, Gustavo Rodrigues; Silva, Luciano Paulino; de Freitas, Sonia Maria

    2014-10-30

    The hydrolysis of bradykinin (Bk) by different classes of proteases in plasma and tissues leads to a decrease in its half-life. Here, Bk actions on smooth muscle and in vivo cardiovascular assays in association with a protease inhibitor, Black eyed-pea trypsin and chymotrypsin inhibitor (BTCI) and also under the effect of trypsin and chymotrypsin were evaluated. Two synthetic Bk-related peptides, Bk1 and Bk2, were used to investigate the importance of additional C-terminal amino acid residues on serine protease activity. BTCI forms complexes with Bk and analogues at pH 5.0, 7.4 and 9.0, presenting binding constants ranging from 103 to 104 M-1. Formation of BTCI-Bk complexes is probably driven by hydrophobic forces, coupled with slight conformational changes in BTCI. In vitro assays using guinea pig (Cavia porcellus) ileum showed that Bk retains the ability to induce smooth muscle contraction in the presence of BTCI. Moreover, no alteration in the inhibitory activity of BTCI in complex with Bk and analogous was observed. When the BTCI and BTCI-Bk complexes were tested in vivo, a decrease of vascular resistance and consequent hypotension and potentiating renal and aortic vasodilatation induced by Bk and Bk2 infusions was observed. These results indicate that BTCI-Bk complexes may be a reliable strategy to act as a carrier and protective approach for Bk-related peptides against plasma serine proteases cleavage, leading to an increase in their half-life. These findings also indicate that BTCI could remain stable in some tissues to inhibit chymotrypsin or trypsin-like enzymes that cleave and inactivate bradykinin in situ.

  2. Reservoir characterization of the Ordovician Red River Formation in southwest Williston Basin Bowman County, ND and Harding County, SD

    Energy Technology Data Exchange (ETDEWEB)

    Sippel, M.A.; Luff, K.D.; Hendricks, M.L.; Eby, D.E.

    1998-07-01

    This topical report is a compilation of characterizations by different disciplines of the Red River Formation in the southwest portion of the Williston Basin and the oil reservoirs which it contains in an area which straddles the state line between North Dakota and South Dakota. Goals of the report are to increase understanding of the reservoir rocks, oil-in-place, heterogeneity, and methods for improved recovery. The report is divided by discipline into five major sections: (1) geology, (2) petrography-petrophysical, (3) engineering, (4) case studies and (5) geophysical. Interwoven in these sections are results from demonstration wells which were drilled or selected for special testing to evaluate important concepts for field development and enhanced recovery. The Red River study area has been successfully explored with two-dimensional (2D) seismic. Improved reservoir characterization utilizing 3-dimensional (3D) and has been investigated for identification of structural and stratigraphic reservoir compartments. These seismic characterization tools are integrated with geological and engineering studies. Targeted drilling from predictions using 3D seismic for porosity development were successful in developing significant reserves at close distances to old wells. Short-lateral and horizontal drilling technologies were tested for improved completion efficiency. Lateral completions should improve economics for both primary and secondary recovery where low permeability is a problem and higher density drilling is limited by drilling cost. Low water injectivity and widely spaced wells have restricted the application of waterflooding in the past. Water injection tests were performed in both a vertical and a horizontal well. Data from these tests were used to predict long-term injection and oil recovery.

  3. Kunstikonteiner on avatud kõigile headele ideedele / Tanel Saar, Sandra Jõgeva ; interv. R[eet] V[arblane

    Index Scriptorium Estoniae

    Saar, Tanel

    2007-01-01

    Polymeri kultuuritehases Tallinnas (Ülase 16 / Madara 22) tegutsevast Academia Non Grata filiaalist ja alternatiivgaleriist Nongrata Kunstikonteiner. Näitustest, tulevikuplaanidest. Avanäituseks oli "Uus laine. 21. sajandi kunst", juuni lõpuni on avatud rahvusvahelise performance'ifestivali "Diverse Universe III" avanäitus "Aderlassenplatz" ja "Uus laine. II valik: tegevuskunst"

  4. Patricia Paperman, Sandra Laugier, éds., Le souci des autres. Éthique et politique du care

    OpenAIRE

    Bosselut, Clémence

    2007-01-01

    Le titre de cet ouvrage est une proposition de traduction du terme anglais « care », généralement traduit en français par « soin », « sollicitude » ou « souci ». Le concept, polysémique, recouvre à la fois les champs de la souffrance et de l'assistance et a connu depuis le début des années 1980 une bonne fortune dans le champ académique anglo-saxon, alors que l'accueil en France était plus mesuré voir inexistant. Le livre fondateur de Carol Gilligan (In a Different Voice) sert de base de disc...

  5. Vormiriietus teeb koolilapse shikiks ja paneb väärikalt käituma / Sandra Maasalu

    Index Scriptorium Estoniae

    Maasalu, Sandra

    2008-01-01

    Eesti koolides kantavatest koolivormidest. Pikemalt Katrin Kivi disainitud Tallinna Saksa gümnaasiumi koolivormist ja Tallinna Arte gümnaasiumi koolivormist. Katrin Kivi ja Peeter Kreitzbergi kommentaarid. 8 ill.

  6. Õpetajate-õpilaste interaktsioon ja sisuloome suhtlusportaalides : õpetajate arvamused ja kogemused / Sandra Räim, Andra Siibak

    Index Scriptorium Estoniae

    Räim, Sandra

    2014-01-01

    Keskkooliõpetajatega läbi viidud intervjuude tulemused viitavad veebisisu loomega kaasnevatele põlvkondlikele erinevustele ning avavad õpetajate-õpilaste probleeme suhtlusportaali auditooriumi tajumisel

  7. Normative climates of parenthood across Europe: judging voluntay childlessness and working parents / Veronique Eicher, Richard A. Settersten, Sandra Penic ...[jt.

    Index Scriptorium Estoniae

    2016-01-01

    Artiklis käsitletakse ühiskonna normatiivse kliima mõju indiviidi hoiakutele kahe ebatraditsioonilise soorolli (vabatahtlik lastetus ja töötamine täistööajaga ajal, mil lapsed on väiksed) puhul, aluseks 21 riigi (sh Eesti) Euroopa sotsiaaluuringu andmed

  8. Normative climates of parenthood across Europe: judging voluntay childlessness and working parents / Veronique Eicher, Richard A. Settersten, Sandra Penic ...[jt.

    Index Scriptorium Estoniae

    2016-01-01

    Artiklis käsitletakse ühiskonna normatiivse kliima mõju indiviidi hoiakutele kahe ebatraditsioonilise soorolli (vabatahtlik lastetus ja töötamine täistööajaga ajal, mil lapsed on väiksed) puhul, aluseks 21 riigi (sh Eesti) Euroopa sotsiaaluuringu andmed

  9. Õpetajate-õpilaste interaktsioon ja sisuloome suhtlusportaalides : õpetajate arvamused ja kogemused / Sandra Räim, Andra Siibak

    Index Scriptorium Estoniae

    Räim, Sandra

    2014-01-01

    Keskkooliõpetajatega läbi viidud intervjuude tulemused viitavad veebisisu loomega kaasnevatele põlvkondlikele erinevustele ning avavad õpetajate-õpilaste probleeme suhtlusportaali auditooriumi tajumisel

  10. Kunstikonteiner on avatud kõigile headele ideedele / Tanel Saar, Sandra Jõgeva ; interv. R[eet] V[arblane

    Index Scriptorium Estoniae

    Saar, Tanel

    2007-01-01

    Polymeri kultuuritehases Tallinnas (Ülase 16 / Madara 22) tegutsevast Academia Non Grata filiaalist ja alternatiivgaleriist Nongrata Kunstikonteiner. Näitustest, tulevikuplaanidest. Avanäituseks oli "Uus laine. 21. sajandi kunst", juuni lõpuni on avatud rahvusvahelise performance'ifestivali "Diverse Universe III" avanäitus "Aderlassenplatz" ja "Uus laine. II valik: tegevuskunst"

  11. Vormiriietus teeb koolilapse shikiks ja paneb väärikalt käituma / Sandra Maasalu

    Index Scriptorium Estoniae

    Maasalu, Sandra

    2008-01-01

    Eesti koolides kantavatest koolivormidest. Pikemalt Katrin Kivi disainitud Tallinna Saksa gümnaasiumi koolivormist ja Tallinna Arte gümnaasiumi koolivormist. Katrin Kivi ja Peeter Kreitzbergi kommentaarid. 8 ill.

  12. 75 FR 6226 - Data Collection Available for Public Comments and Recommendations

    Science.gov (United States)

    2010-02-08

    ... enhance the quality of the collection, to Sandra Johnston, Program Analyst, Office of Financial Assistance... CONTACT: Sandra Johnston, Office of Financial Assistance, 202-205-7528, ] sandra.johnston@sba.gov ....

  13. Definição do "eu" nos romances Alegria Breve, Para Sempre, Até ao fim e Cartas a Sandra de Vergílio Ferreira

    OpenAIRE

    Coimbra Martos, Ana Catarina

    2016-01-01

    Tesis doctoral inédita leída en la Universidad Autónoma de Madrid, Facultad de Filosofía y Letras, Departamento de Lingüística, Lenguas Modernas, Lógica y Filosofía de la Ciencia, Teoría de la Literatura y Literatura Comparada. Fecha de lectura: 18-01-2016 O romance de Vergílio Ferreira reflete as preocupações do século XX: o ser. Tenta encontrar o significado da sua existência. Tudo se questiona. Há uma interrogação constante do protagonista. É um narrar recordações e um fazer de reflexõe...

  14. Aktiivne eutanaasia : poolt või vastu? : [bakalaureusetöö] / Sandra Kallas ; Tartu Ülikool, õigusteaduskond ; juhendaja: Silvia Kaugia

    Index Scriptorium Estoniae

    Kallas, Sandra, 1987-

    2010-01-01

    Eutannasia mõistest ja liikidest, aktiivse eutanaasia õiguslikest ja eetilistest küsimustest, eutanaasiast teistes riikides (Holland, Belgia, Jaapan), eutanaasia seadustamise võimalikkusest Eestis

  15. Aktiivne eutanaasia : poolt või vastu? : [bakalaureusetöö] / Sandra Kallas ; Tartu Ülikool, õigusteaduskond ; juhendaja: Silvia Kaugia

    Index Scriptorium Estoniae

    Kallas, Sandra, 1987-

    2010-01-01

    Eutannasia mõistest ja liikidest, aktiivse eutanaasia õiguslikest ja eetilistest küsimustest, eutanaasiast teistes riikides (Holland, Belgia, Jaapan), eutanaasia seadustamise võimalikkusest Eestis

  16. Eudora Welty as Photographer, Photographs by Eudora Welty, Edited by Pearl Amelia McHaney with contributions by Sandra S. Phillips and Deborah Willis, UP of Mississippi, 2009

    OpenAIRE

    Louis Mazzari

    2010-01-01

    Eudora Welty as Photographer is part of a growing appreciation for her achievements as an artist in two fields, rather than an admired writer who also took pictures. It is a new collection whose forty-three prints from the mid- and late-1930s, and critical essays written for this volume, advocate for Welty as an important photographer whose work can stand alongside Dorothea Lange, Walker Evans, and other New-Deal documentary artists.These photos selected by Welty scholar Pearl McHaney, editor...

  17. Eudora Welty as Photographer, Photographs by Eudora Welty, Edited by Pearl Amelia McHaney with contributions by Sandra S. Phillips and Deborah Willis, UP of Mississippi, 2009

    Directory of Open Access Journals (Sweden)

    Louis Mazzari

    2010-01-01

    Full Text Available Eudora Welty as Photographer is part of a growing appreciation for her achievements as an artist in two fields, rather than an admired writer who also took pictures. It is a new collection whose forty-three prints from the mid- and late-1930s, and critical essays written for this volume, advocate for Welty as an important photographer whose work can stand alongside Dorothea Lange, Walker Evans, and other New-Deal documentary artists.These photos selected by Welty scholar Pearl McHaney, editor...

  18. Sandra Gayol. Honor y duelo en la Argentina moderna : Buenos Aires, Siglo Veintiuno Editores, 2008, 284 p.

    OpenAIRE

    García Saggio, Juan Pablo

    2009-01-01

    Arraigado en la historia cultural, este trabajo intenta comprender la racionalidad de la práctica del duelo, poniendo la cultura como centro y no como epifenómeno. La autora, por lo tanto, propone mirar la retórica del honor y la practica del duelo desde el punto de vista de la significación cultural en medio de un proceso histórico en "ebullición". Es por ello que, como nos dice, "la reputación, las formas de defenderla, los valores que de ella emanan, sus dimensiones simbólicas, y los compo...

  19. Women's Work Is Never Done: Resolving Gender Inequalities in Education. Book Review of "Gendered Education: Sociological Reflections on Women, Teaching and Feminism," by Sandra Acker.

    Science.gov (United States)

    Symbaluk, Diane G.

    1995-01-01

    Reviews a book that examines women's progress in education during the last 30 years. The book emphasizes the continuity of women's inferior status as students and academics despite advances since the second wave of feminism during the 1960s, describes teacher career structures in England and Wales, and examines women's conflicting role…

  20. Piitsaskandaal : miks näituselised peksa said? / Katrin Pauts

    Index Scriptorium Estoniae

    Pauts, Katrin, 1977-

    2007-01-01

    Sandra Jõgeva sado-maso performance'ist "Kadalipp" näituse "Kehaturg" avamisel Tallinna Kunstihoones. Kommenteerib Sandra Jõgeva. Endisest ameerika pornostaarist, praegu performance'i kunstnik, Annie Sprinklest

  1. "Loomakari" kui uue ühiskonnakorralduse näide / Ernest Truely ; tõlkinud Ulla Juske

    Index Scriptorium Estoniae

    Truely, Ernest

    2009-01-01

    Sandra Jõgeva kuraatoriprojektist "Loomakari" Tallinna Kunstihoones, avatud 12. aprillini. Kujundaja Tanel Saar. Sandra Jõgeva, Tanel Saare, Anthony Faroux' (Inglismaa), Jenni Juulia Wallinheimo (Soome) ja Kjetil Kauslandi (Norra) töödest

  2. Piitsaskandaal : miks näituselised peksa said? / Katrin Pauts

    Index Scriptorium Estoniae

    Pauts, Katrin, 1977-

    2007-01-01

    Sandra Jõgeva sado-maso performance'ist "Kadalipp" näituse "Kehaturg" avamisel Tallinna Kunstihoones. Kommenteerib Sandra Jõgeva. Endisest ameerika pornostaarist, praegu performance'i kunstnik, Annie Sprinklest

  3. Palliative nursing: improving end-of-life care Shaun Kinghorn Palliative nursing: improving end-of-life care and Sandra Gaines Baillière Tindall £25.99 292pp 9780702028168 0702028169 [Formula: see text].

    Science.gov (United States)

    2009-09-23

    AS THE editors suggest, this book is 'written by nurses, for nurses'. Although there is a chapter on pain control, the book does not intend to provide a 'recipe' for symptom management, but an overview of significant issues pertaining to palliative nursing: communication, psychosocial dimensions and ethics. There is also a chapter on selecting the best evidence in application to practice.

  4. Clinical efficacy of a GnRH-agonist implant containing 4.7 mg deslorelin, Suprelorin, regarding suppression of reproductive function in tomcats. Sandra.Pesch@vetmed.uni-giessen.de.

    Science.gov (United States)

    Goericke-Pesch, Sandra; Georgiev, Plamen; Antonov, Anton; Albouy, Maxime; Wehrend, Axel

    2011-03-15

    The aim of the present study was to test for the efficacy of a slow release GnRH-agonist implant (4.7 mg deslorelin, Suprelorin) in the male cat. Ten toms were implanted sc in the neck. Changes in testosterone (T) secretion, testicular size, body weight and behaviour (mounting, mating, urine marking) were monitored. T concentrations were significantly decreased (P < 0.0001) to basal levels (< 0.1 ng/mL) in 5 of 10 cats after 4 weeks and in all but one tom after 11 weeks (T < 0.1 ng/mL). In this respective tom only partial downregulation with T-values from 0.2 to 0.1 ng/mL was achieved until week 27. In weeks 28 and 32, T concentrations were below 0.1 ng/mL. Compared to pretreatment values, testicular volume was significantly decreased by about 60% in week 12 and about 73% after 36 weeks (P < 0.001). Penile spines disappeared 9.4 ± 1.0 weeks after treatment. Food intake was significantly increased during treatment period (P < 0.001). In all tomcats libido, mating behaviour and urine marking were significantly reduced (P < 0.0001) after an initial stimulation. In one tom, mating an oestrous queen on day 20 after implant administration resulted in pregnancy. Mating of another tom that had T-values between 0.1 and < 0.1 ng/mL since day 24 in week 8 revealed the presence of spermatozoa; however, this mating did not result in pregnancy. Subcutaneous implant administration was well tolerated by all tomcats without sedation or anaesthesia and no treatment related negative effects were observed. These results demonstrate the clinical efficacy of the 4.7 mg deslorelin implants (Suprelorin) in the tom inducing all castration related effects.

  5. VIDEIRA, Sandra Lúcia; COSTA, Pierre Alves; FAJARDO, Sérgio. (org. Geografia Econômica: (re leituras contemporâneas. Rio de Janeiro: Letra Capital, 2011. 193 p.

    Directory of Open Access Journals (Sweden)

    Maria Terezinha Serafim Gomes

    2012-04-01

    Full Text Available O livro aqui apresentado “Geografia Econômica: (re leituras contemporâneas” é uma coletânea com 9 capítulos, reunindo pesquisadores das regiões Sul, Sudeste e Centro-Oeste do Brasil, que se debruçam sobre a temática da Geografia Econômica. No prefácio, os organizadores apresentam ao leitor a riqueza de temas relacionados à Geografia Econômica abordados no livro, a saber: América do Sul, economia mundial, crise energética, indústria do petróleo, tradings agroindústrias, cooperativas, informação, internacionalização do capital, empresas internacionais, capital estrangeiro, dinâmica econômica, logística e reestruturação produtiva.

  6. Sandra Patricia Rodríguez Ávila. Sujeción, corrección y disciplina: pedagogía social de masas en Santa Fe de Bogotá 1780-1821

    Directory of Open Access Journals (Sweden)

    Juan Carlos Villamizar

    2008-01-01

    Full Text Available El libro ganador del vii Premio Nacional de Educación Francisca Radke, versión 2005-2006, se compone de una introducción y tres capítulos, en los que la autora se ocupa de las prácticas de sujeción, corrección y disciplina a finales del siglo xviii y comienzos del xix, en que la administración colonial llegó a su fin en América. Los dos primeros capítulos abordan la problemática de la pobreza y las propuestas de cómo tratarla. El tercer capítulo se ocupa de la pedagogía social de masas y de la asistencia, enseñanza y corrección de pobres, mendigos, vagos y malentretenidos en Santa Fe de Bogotá entre 1780 y 1820. A diferencia de los dos primeros capítulos, este último está construido estrictamente con fuentes primarias.

  7. GenBank blastn search result: AK106176 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK106176 001-208-C08 AY641412.1 Hordeum vulgare subsp. vulgare retrotransposon Sandra... Hv receptor-kinase-like pseudogene, complete cds; and retrotransposons Sandra6 and Sandra7, complete sequence.|PLN PLN 9e-23 Plus Plus ...

  8. GenBank blastn search result: AK064061 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK064061 001-125-F10 AY641412.1 Hordeum vulgare subsp. vulgare retrotransposon Sandra... Hv receptor-kinase-like pseudogene, complete cds; and retrotransposons Sandra6 and Sandra7, complete sequence.|PLN PLN 3e-21 Plus Minus ...

  9. GenBank blastn search result: AK289108 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK289108 J090096M08 AY641412.1 AY641412 Hordeum vulgare subsp. vulgare retrotransposon Sandra...enes and Hv receptor-kinase-like pseudogene, complete cds; and retrotransposons Sandra6 and Sandra7, complete sequence. PLN 4e-38 1 -1 ...

  10. GenBank blastn search result: AK061903 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK061903 001-041-H07 AY641412.1 Hordeum vulgare subsp. vulgare retrotransposon Sandra... Hv receptor-kinase-like pseudogene, complete cds; and retrotransposons Sandra6 and Sandra7, complete sequence.|PLN PLN 4e-15 Plus Plus ...

  11. Product annotations: AK289108 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK289108 J090096M08 BLASTN AY641412.1 PLN AY641412 Hordeum vulgare subsp. vulgare retrotransposon Sandra...in (USP1) genes and Hv receptor-kinase-like pseudogene, complete cds; and retrotransposons Sandra6 and Sandra7, complete sequence. 4e-38 ...

  12. GenBank blastx search result: AK107152 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK107152 002-124-E04 AY641412.1 Hordeum vulgare subsp. vulgare retrotransposon Sandra... Hv receptor-kinase-like pseudogene, complete cds; and retrotransposons Sandra6 and Sandra7, complete sequence.|PLN PLN 1e-24 +3 ...

  13. GenBank blastx search result: AK060078 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK060078 006-306-C04 AY641412.1 Hordeum vulgare subsp. vulgare retrotransposon Sandra... Hv receptor-kinase-like pseudogene, complete cds; and retrotransposons Sandra6 and Sandra7, complete sequence.|PLN PLN 8e-21 +2 ...

  14. GenBank blastx search result: AK061903 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK061903 001-041-H07 AY641412.1 Hordeum vulgare subsp. vulgare retrotransposon Sandra... Hv receptor-kinase-like pseudogene, complete cds; and retrotransposons Sandra6 and Sandra7, complete sequence.|PLN PLN 3e-84 +1 ...

  15. GenBank blastn search result: AK065547 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK065547 J013034E09 AY641412.1 Hordeum vulgare subsp. vulgare retrotransposon Sandra...Hv receptor-kinase-like pseudogene, complete cds; and retrotransposons Sandra6 and Sandra7, complete sequence.|PLN PLN 5e-15 Plus Plus ...

  16. GenBank blastx search result: AK106176 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK106176 001-208-C08 AY641412.1 Hordeum vulgare subsp. vulgare retrotransposon Sandra... Hv receptor-kinase-like pseudogene, complete cds; and retrotransposons Sandra6 and Sandra7, complete sequence.|PLN PLN 2e-81 +1 ...

  17. GenBank blastx search result: AK062958 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK062958 001-109-D03 AY641412.1 Hordeum vulgare subsp. vulgare retrotransposon Sandra... Hv receptor-kinase-like pseudogene, complete cds; and retrotransposons Sandra6 and Sandra7, complete sequence.|PLN PLN 1e-14 +2 ...

  18. GenBank blastn search result: AK073356 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK073356 J033028K22 AY641412.1 Hordeum vulgare subsp. vulgare retrotransposon Sandra...Hv receptor-kinase-like pseudogene, complete cds; and retrotransposons Sandra6 and Sandra7, complete sequence.|PLN PLN 4e-21 Plus Minus ...

  19. Main: 1D6R [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1D6R 大豆 Soybean Glycine max (L.) Merrill Bowman-Birk Type Proteinase Inhibitor Precursor Glycine Ma...x Molecule: Trypsinogen; Chain: A; Fragment: Cationic Precursor; Molecule: Bowman-Birk Prote...inase Inhibitor Precursor; Chain: I Hydrolase 3.4.21.4 (Bowman-Birk Proteinase Inhibitor Precursor) J.Koepke...r Crystal Structure Of Cancer Chemopreventive Bowman-Birk Inhibitor In Ternary Complex With Bovine Trypsin A... 477 2000 Protease Inhibitor, Serine Protease, Bowman-Birk Inhibitor SWS:TRY1_BOV

  20. Body mass index and prostate cancer severity: do obese men harbor more aggressive disease on prostate biopsy?

    Science.gov (United States)

    Chamie, Karim; Oberfoell, Stephanie; Kwan, Lorna; Labo, Jessica; Wei, John T; Litwin, Mark S

    2013-05-01

    To examine the association of obesity with the prebiopsy prostate-specific antigen (PSA), Gleason score, clinical stage, and D'Amico tumor risk in 2 independent cohorts of men with prostate cancer. We retrospectively reviewed the medical records of men with biopsy-proven prostate cancer from California's Improving Access, Counseling and Treatment for Californians with Prostate Cancer program and from a random sample of men treated at the University of Michigan. We performed multivariate analyses to examine the relationship of body mass index (BMI) with the prebiopsy PSA level, Gleason score, clinical stage, and D'Amico tumor risk, while controlling for demographics. The mean age was 61.5 years, and the median prebiopsy PSA level was 6.7 ng/mL. Greater than 70% of men were at least overweight. On univariate analysis, the BMI was not associated with prebiopsy PSA levels, Gleason score, or D'Amico tumor risk. On multivariate analysis, we found no association between BMI and log-transformed PSA, Gleason score, clinical T stage, or D'Amico risk. Advancing age was associated with a greater risk of a higher prebiopsy PSA level, Gleason score, and D'Amico tumor risk. Obese men with prostate cancer were no more likely to have a higher prebiopsy PSA level, Gleason score, clinical T stage, or D'Amico risk than those of normal weight. Although we do not know whether the BMI affected the prebiopsy PSA values in those without a diagnosis of prostate cancer, our findings suggest that the BMI does not affect the interpretation of the prebiopsy PSA levels in those with cancer. Copyright © 2013 Elsevier Inc. All rights reserved.

  1. Main: 1K9B [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1K9B 大豆 Soybean Glycine max (L.) Merrill Bowman-Birk Type Proteinase Inhibitor Precursor Glycine Ma...x Molecule: Bowman-Birk Type Proteinase Inhibitor; Chain: A; Synonym: Bbi; Other_details: Fr....O.Essen, G.Wenzl, Y.M.Kim, P.Flecker Crystal Structure Of The Bifunctional Soybean Bowma...n-Birk Inhibitor At 0.28 Nm Resolution. Structural Peculiarities In A Folded Protein Conformation Eu...877; Prot_inh_BBI.|Pfam; PF00228; Bowman-Birk_leg; 2.|SMART; SM00269; BowB; 1.|PROSITE; PS00281; BOWMAN_BIRK

  2. Naiste kolmevõistlus : Briti leedid valimisheitluses

    Index Scriptorium Estoniae

    2005-01-01

    Suurbritannia kolme suurema partei liidri - toor Michael Howardi, leiborist Tony Blairi ja sotsiaaldemokraat Charles Kennedy - naiste - Sandra Howardi, Cherie Blairi ja Sarah Kennedy - rollist meeste peaministriks kandideerimise valimiskampaanias

  3. 75 FR 29727 - Federal Advisory Committee; Military Leadership Diversity Commission (MLDC)

    Science.gov (United States)

    2010-05-27

    ... Diversity and EO Programs, ] Lockheed Martin Sandra Evers-Manly, Vice President for Corporate Social Responsibility, Northrop Grumman Decision brief for diversity leadership and training Deliberation of...

  4. Homme kell 13 algab Von Krahli teatris...

    Index Scriptorium Estoniae

    2005-01-01

    III rahvusvaheline video ja performance'i festival "Inport 2005", mille on kokku pannud Gert Hatsukov. Loetletud aktsioonide autorid (Eesti: Sandra Jõgeva, Yellow Wolfman [Andrus Joonas], Andres Tenusaar)

  5. College Students in an Experimental Study Took Longer to Achieve Comprehension when Instant Messaging while Reading. A Review of: Bowman, L. L., Levine, L. E., Waite, B. M., & Gendron, M. (2010. Can students really multitask? An experimental study of instant messaging while reading. Computers & Education, 54, 927-931.

    Directory of Open Access Journals (Sweden)

    Megan von Isenburg

    2010-09-01

    Full Text Available Objective – To examine the effects of multitasking while doing school work. The experiment specifically measured total time spent reading a simulated textbook passage and tested comprehension in students who received instant messages before reading, while reading, or not at all.Design – Experimental design in which one group of students read an online text while receiving and responding to instant messages. Comparison groups either received instant messages (IMs prior to reading the text passage or did not receive any IMs during the task.Setting – General psychology department at Central Connecticut State University, United States.Subjects – Eighty-nine college students enrolled in general psychology courses. The participants included 43 women and 46 men and were between 17 and 46 years old. Most students were full time students (91%, most were European / White (74% and in their first (46% or second (33% year of college. Participants’ academic majors represented all the schools in the university.Methods – Researchers created a simulated environment in which a passage from a psychology textbook was displayed on five consecutive screens. For the experimental group, an IM appeared on each of the five screens preceded by an alert sound. Messages were written to reflect the types of questions students might ask each other when they first meet, such as “What do you like to do in your spare time?”Subjects were randomized to three situations: receiving IMs before reading, receiving IMs during reading, or not receiving any IMs. Subjects were told that they would either receive IMs before reading, while reading, or not at all. Messages received during reading appeared one per screen after a specified time spent on each page (after 17, 15, 29, 20 and 26 seconds, respectively. Students could take as long as necessary to read the passage and to respond to IMs.After reading the passage, students were given a multiple choice test with 25 questions to determine reading comprehension and retention. Students also completed a demographic questionnaire to measure their typical instant messaging behaviour, including the amount of time they spend each week instant messaging, how often IM software is on when their computer is on, and how often IM software is on when they are studying. Both of these activities took place on the same computers used for the reading experiment.Students were additionally asked to comment on the clarity of instructions, the representativeness of the task to their typical IM experiences, and the interest and similarity to normal coursework of the reading itself. These questions were asked on paper rather than on the computer.Software recorded the lengths of time each student spent in reading the passage, reading and responding to IMs, and answering the online questions. For those students who received IMs during reading, the time spent from receipt of each IM to each response was subtracted from the total reading time.Main Results – There were no differences in test performance between the three groups. Statistically significant differences were found in the amount of time that students took to complete the reading: students who instant messaged during reading took significantly longer to read the online text than those students who instant messaged before reading and those who did not IM, even when time spent receiving and responding to IMs was subtracted from the totals. Students who instant messaged before reading took the least amount of time in the exercise. Further statistical analysis revealed no significant differences in the time spent instant messaging between the two IM groups.Responses to the demographic questions indicate that students spend a mean 7.5 hours instant messaging per week, that 67% of students have IM software on “sometimes,” “often,” or “very often” while the computer is on and 62% of the time while studying. Analysis indicated that none of the IM use variables were correlated with test performance or reading time and that there were no significant differences between the experimental groups according to prior IM use.Responses from the 77 students who answered the questions about the experiment itself are also included, though not all of these students answered each question. Seventy students (99% agreed or strongly agreed that instructions were clear. Seventy-one percent of the 52 students that received IMs agreed or strongly agreed that they were realistic, and 75% agreed or strongly agreed that they responded to IMs in a typical manner. Sixty-two students (82% agreed or strongly agreed that the text was similar to those assigned for actual coursework, and 39 students (51% agreed or strongly agreed that the passage was interesting. Students commented on the authenticity of the experiment in free text responses such as, “I responded how I would have to anyone,” and “they were questions that anyone I don’t know might ask.”Conclusion – This experimental study suggests that students who IM while reading will perform as well but take longer to complete the task than those who do not IM while reading or those students who IM before reading.

  6. Online Career and Technical Education in the Community College

    Science.gov (United States)

    Garza Mitchell, Regina L.

    2017-01-01

    Very little empirical research has been conducted about online career and technical education (CTE). Despite the continuing enrollment growth in online education (Lokken, 2016) and the national emphasis on CTE as a means of boosting the economy (D'Amico, Morgan, Katsinas, & Friedel, 2014), relatively little is understood about the scope and…

  7. 76 FR 55233 - Standard Instrument Approach Procedures, and Takeoff Minimums and Obstacle Departure Procedures...

    Science.gov (United States)

    2011-09-07

    ... (GPS) RWY 2, Amdt 2 Billings, MT, Billings Logan Intl, RNAV (GPS) RWY 25, Orig-B Bowman, ND, Bowman... Procedures (44 FR 11034; February 26, 1979); and (3) does not warrant preparation of a regulatory evaluation....-Blacker, Takeoff Minimums and Obstacle DP, Amdt 6 Miles City, MT, Frank Wiley Field, NDB RWY 4, Amdt...

  8. The Role of Grandparents in Young Children's Lives

    Science.gov (United States)

    Bowman, Barbara T.

    2012-01-01

    Barbara T. Bowman, MA, the Irving B. Harris Professor of Child Development at Erikson Institute, discusses the important roles that grandparents play in the lives of their grandchildren. Dr. Bowman offers suggestion for how to approach the grandparenting role, including setting boundaries, maintaining open communication, and valuing the…

  9. Reference: 604 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 604 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u17478634i Schwarte Sandra...phoglycolate phosphatase, PGLP1, in Arabidopsis. 3 1580-6 17478634 2007 Jul Plant physiology Bauwe Hermann|Schwarte Sandra

  10. Casualty Evacuation in the Contemporary Operating Environment

    Science.gov (United States)

    2007-11-02

    Made Ridiculously Simple, 2001. 52 Ibid. See also Gerard J. Tortora and Sandra Reynolds, Principles of Anatomy and Physiology, 9th Edition John Wiley...Landmark Thucydides, New York: The Free Press, 1996. Tortora , Gerard J. and Reynolds, Sandra. Principles of Anatomy and Physiology, 9th Edition New York

  11. Orienting Oneself to Research. Review of "Alternative Paradigms in Environmental Education Research," edited by Rick Mrazek; "The Paradigm Dialog," edited by Egon G. Guba; and "Experience, Research, Social Change: Methods from the Margins," by Sandra Kirby and Kate McKenna.

    Science.gov (United States)

    Henderson, Bob

    1995-01-01

    Reviews three books that encourage practioners to be researchers of their own practice. Discusses absolutist and relativist approaches to research by examining assumptions related to questions the research generates. Recommends unification of practitioner and researcher roles through a dialectic, critical, reflective orientation that strives for…

  12. The Majority of Library Clients Still Use Person-to-Person Interaction When Asking Reference Questions. A review of: De Groote, Sandra L. “Questions Asked at the Virtual and Physical Health Sciences Reference Desk: How Do They Compare and What Do They Tell Us?” Medical Reference Services Quarterly 24.2 (Summer 2005: 11-23.

    Directory of Open Access Journals (Sweden)

    Suzanne Pamela Lewis

    2006-03-01

    Full Text Available Objective - To identify similarities and difference in the questions asked at the virtual and physical refernece desks of a helath scienmces library, in order to better undertand user needs and highlight areas for service improvement. Also to retrospectively analyze reference statistics collected over the previous six years. Design - Use study; retrospective study of reference statistics for the period July 1997 to June 2003; literature review. Setting - Large academic helath sciences library in the United States. Subjects - All questions asked at the reference and information desks, plus questions submitted to the University-wide virtual reference service and answered by a health sciences librarian, over a period of one month. The questions were asked by faculty, staff, students and members of the public. Methods - A literature review was carried out to examine the types of information/reference questions typically asked in health sciences libraries both before and after the mass introduction of remote end-user searching of online resources and the establishment of virtual reference services. Next, the reference statistics collected at the University of Illinois at Chicage (UIC Library of the Health Sciences between July 1997 and June 2003 were examined. For most of this period a digital reference service was offered using a listserv address to which patrons would submit email queries. Beginning in March 2003, a formal virtual reference service (chat and email was provided using commercial software. Finally, data was gathered on questions answered by a health sciences librarians, and clients who asked the question, at either the physical or cirtual reference desk, during the month of November 2003 at the UIC Library of the Health Sciences. Library staff completed an online survey form for each question, and if a client asked more than one question, each question was coded individually. Data included: status of client using the service (faculty/staff. undergarduate student, graduate student, non0UIC, unknown; mode of submission (email, chat, phone, in person; and type of question asked (directional, ready reference, in-depth/mediated, instructional, technical, accounts/status and other. In subsequent analysis, the original seven types of questions were further broken down into 19 categories. Main results - It was not possible to undertake a meta-analysis or systematic review of the studies identified in the literature review because of differences in time frames, settings and the categories used to code reference questions. However the following trends emerged: directional questions accounted for between 30 and 35% of questions asked at both the physical and virtual reference desks; the remainder of questions were generally about known item searched, library policies and services, research, dadabase use and quick reference. The statistics collected at UIC Library of the Health Sciences over the period July 1997 to June 2003 were analyzed. Coded reference questions fell into one of four categories; ready reference, in-depth reference, mediated searched and digital reference. There was a noticeable drop in the number of reference questions received in 1999/2000 which reflects trends reported in some of the studies identified in the literature review. The number of mediated searches decreased from 154 in 1997-98 to 4 in 2002/2003, but the number of digital reference questions increased from 0 to 508 in the same period. Statistics were collected over the month of November 2003 for 939 questions asked at the reference and information desks which included: 38 email; 48 chat; 156 phone; and 697 in person. The major findings were as follows: - appoximately 55% of questions were reference questions (33.5% ready reference, 9.7% in-depth/mediated, 9.7% instructional; 30% were directional; and 10% were technical; it is not stated what the remaining 5% of questions were; - library clients who asked the questions comprised graduate students (26%, faculty (24%, undergraduate students (24% and non-UIC patrons (22%; - all groups were most likely to ask their reference questions in person; - graduate students were the largest group of email reference (34%, undergraduates were the largest group to use chat (35% and faculty/staff were the largest group to use the telephone (39%; - 28% of the questions were answered from the library's staff's general knowledge of the library; 22% using the online catalogue or electronic journals list; 22% by referrning the patron to, or using an online database or resource; 13% by referring the patron to another department in the library (such as circulation; 7% by consulting another individual; and 5% by using print resources. Conclusion - The results of the three parts of this study - literature review, study of 1997-2003 statistics, and in-depth collection of statistics for November 2003 - are difficult to compare with each other. However, the general trend emerging from the results is that some kinds of questions asked by health sciences library clients have remained very much the same regardless of the rise of remote end-user searching and the mode of transmission of the questions. These include questions about library policies and services, journal and book holdings, database searching and instructional support. Questions about citation verification and consumer health appear to be decreasing while technical questions and questions about accessing remote databases and online journals are increasing. The majority of reference questions are still asked in person.

  13. Mixed H2/H Infinity Optimization with Multiple H Infinity Constraints

    Science.gov (United States)

    1994-06-01

    gracias. A mn linda esposa, Sandra, y a mi adorable hijo Julito, los amo. Dedicated to my wife Sandra and my son Julito. Dedicado a nWl esposa Sandra y a...mi hijo Julio. Julio C. Uilauri !i Table of Contents Page Preface ii List of Figures vi List of Tables x Notation xi Abstract xiv I. Introduction 1-1...A, det(I - MA) =0) unless no Ae A makes I - MA singular, in which case g,,(M)-). Clearly, irA (M) depends on the block structure as well as the matrix

  14. The Millennial Generation in High Reliability Organizations (HRO)

    Science.gov (United States)

    2014-02-13

    purpose, and provide a culture of safety within the organization. 17 Endnotes 1 Sandra L. Colby and Jennifer M. Ortman “The Baby Boom ...Department of Commerce Economics and Statistics Administration, U.S. Census Bureau. 2 Sandra L. Colby and Jennifer M. Ortman “The Baby Boom Cohort in the...Jan 2016. 4 Sandra L. Colby and Jennifer M. Ortman “The Baby Boom Cohort in the United States: 2012 to 2060” Issued May 2014, P25-1141, Current

  15. 76 FR 58277 - Performance Review Board Members

    Science.gov (United States)

    2011-09-20

    .... Nelson, Dawn M. O'Connell, Robert F. Owens Jr., Jennifer L. Parker, Aida M. Perez, Cheri M. Rice...: Barbara Bowman, Christine Branche, Michael Gottesman, Anne Haddix, Steven Musser, Jan Nicholson,...

  16. Research and Theory

    African Journals Online (AJOL)

    Test

    African Safety Promotion Journal, Vol. 7, No. 2, 2009 ... African researchers in the field of injury prevention (see Bowman, Stevens, Seedat, &. Snyman .... an additional skills set within the public health sector, is expensive and labour intensive,.

  17. 78 FR 57397 - Over-the-Counter Ophthalmic Drug Products-Emergency Use Eyewash Products; Announcement of Public...

    Science.gov (United States)

    2013-09-18

    ... Acanthamoeba, bacteria, or fungi)? For example, FDA is aware of published reports of Acanthamoeba having... Document for Acanthamoeba,'' 2003. 2. Bowman, E. K., A. A. Vass, R. Mackowski, et al., ``Quantitation...

  18. Solid Pseudopapillary Neoplasm of the Pancreas

    African Journals Online (AJOL)

    present two cases in young female patients. Both tumours were surgically ... cases was consistent with solid pseudopapillary neoplasm. .... study and literature review. BMJ Case Rep. 2012 ... Orlando CA, Bowman RL, Loose JH. Multicentric ...

  19. Boosted regression tree, table, and figure data

    Science.gov (United States)

    Spreadsheets are included here to support the manuscript Boosted Regression Tree Models to Explain Watershed Nutrient Concentrations and Biological Condition. This dataset is associated with the following publication:Golden , H., C. Lane , A. Prues, and E. D'Amico. Boosted Regression Tree Models to Explain Watershed Nutrient Concentrations and Biological Condition. JAWRA. American Water Resources Association, Middleburg, VA, USA, 52(5): 1251-1274, (2016).

  20. A typical band-shaped calcific keratopathy with keratocyte changes.

    Science.gov (United States)

    Dark, A J; Proctor, J

    1982-05-01

    The clinical features of a patient with atypical band keratopathy are described. Histochemical and electron probe analyses indicate that the granular deposits in Bowman's layer contain calcium and phosphate. An unusual feature in this patient was the presence of severe keratocyte degeneration; its possible role in the pathogenesis of this condition is discussed. Exfoliation of the calcified Bowman's layer appears to have been the basis for severe attacks of recurrent ocular pain.

  1. Proof-of-Concept Part Task Trainer for Close Air Support Procedures

    Science.gov (United States)

    2016-06-01

    using only their hands (Salamin et al. 2006). The analysis of study results collected through the questionnaires suggested that first-person...examined in the light of helping the users build mental models. Bowman et al. suggest that virtual environments could be used to help with education ...Bowman et al. 1999). In that article, the authors discuss the importance of direct experience and how it relates to education . They comment that

  2. Enabling Robust C2 Systems through Evolvable Human-in-the-Loop Data Fusion

    Science.gov (United States)

    2009-06-01

    JDL Data Fusion Model). Similarly, others have recommended improvements to data fusion to incorporate better mechanisms for supporting analyst...Algorithm. Llinas, J., Bowman, C., Rogova, G., Steinberg, A., Waltz, E., & White, F. (2004). Revisiting the JDL Data Fusion Model II. In Proceedings of...Demands. Ergonomics, 49(7), 688-705. Steinberg, A., Bowman, C., & White, F. (1998). Revisions to the JDL Data Fusion Model. In Proceedings of Joint

  3. Elu, armastan sind... ikka ja jälle / Teet Veispak

    Index Scriptorium Estoniae

    Veispak, Teet, 1955-

    2007-01-01

    Eesti Kunstnike Liidu aastanäitus "Elamise kunst" Tallinna Kunstihoones ja G-galeriis, kuraator Katrin Pere. Eksponeeritakse Jüri Ojaveri, Tiiu Kirsipuu, Jaak Soansi, Sandra Jõgeva, Erki Kasemetsa jt. töid

  4. 75 FR 68714 - Final Flood Elevation Determinations

    Science.gov (United States)

    2010-11-09

    ... Docket No.: FEMA-B-1069 Arroyo Hermanos At the confluence with +6448 City of Las Vegas. Gallinas Creek... Domestic Assistance No. 97.022, ``Flood Insurance.'') Dated: October 29, 2010. Sandra K. Knight, Deputy...

  5. Kolmapäeval kroonitakse Raekoja platsil Lucia

    Index Scriptorium Estoniae

    2006-01-01

    Püha Lucia ehk luutsinapäeval kroonitakse heade jõulude kehastaja ja soojuse ning valguse tooja Lucia. Krooni valmistas Rootsi suursaatkonna algatatud konkursi võitja Sandra Savelli Eesti Kunstiakdeemiast

  6. 76 FR 59664 - Membership of the Defense Contract Audit Agency Senior Executive Service Performance Review Boards

    Science.gov (United States)

    2011-09-27

    ... Service (SES) performance appraisals and make recommendations to the Director, DCAA, regarding final... this notice. FOR FURTHER INFORMATION CONTACT: Sandra L. Burrell, Chief, Human Resources Management... of the Secretary Membership of the Defense Contract Audit Agency Senior Executive Service...

  7. 75 FR 57906 - Membership of the Defense Contract Audit Agency Senior Executive Service Performance Review Boards

    Science.gov (United States)

    2010-09-23

    ... appraisals and make recommendations to the Director, DCAA, regarding final performance ratings and... INFORMATION CONTACT: Sandra L. Burrell, Chief, Human Resources Management Division, Defense Contract Audit... of the Secretary Membership of the Defense Contract Audit Agency Senior Executive Service...

  8. Под сенью комиксов в цвету /Николай Караев

    Index Scriptorium Estoniae

    Караев, Николай, 1978-

    2010-01-01

    Eesti I Koomiksibiennaal Kultuuritehase Polymer Kunstikonteineris Tallinnas alates 16. aprillist. Kuraatorid on Elisabeth Salmin ja Sandra Jõgeva. Esitletakse kollektiivselt loodud kunstnikuraamatut "Comic Magazine", toimub kirjanduslike kohtumiste seeria "Üks hullem kui teine" koomiksieri

  9. Plaadid / Immo Mihkelson

    Index Scriptorium Estoniae

    Mihkelson, Immo, 1959-

    2002-01-01

    Uutest plaatidest Mike Oldfield "Collection", Compay Segundo "Duets", Sandra "Wheel Of Time", "Spirit Of Africa", Paddy's "Irish Folk", Edwin Collins "Doctor Syntax", Doors "Live in Hollywood", Sonic Youth "Murray Street"

  10. Десятка самых прибыльных актеров / Кая Коовит

    Index Scriptorium Estoniae

    Коовит, Кая, 1968-

    2010-01-01

    10 kõige enam teenivat Hollywoodi näitlejat (Quigley Publishing' andmeil) on Denzel Washington, Shia LaBeouf, Brad Pitt, Meryl Streep, Tom Hanks, Robert Downey jr., George Clooney, Matt Damon, Johnny Depp ja Sandra Bullock

  11. Veri, glamuur ja jänesed kirstus / Ave Randviir

    Index Scriptorium Estoniae

    Randviir, Ave, 1981-

    2006-01-01

    Näitus "Leave like a Lady" Draakoni galeriis, autorid Sandra Jõgeva & Kristin Kalamees, "Paradiis" Hobusepea galeriis, autor Marianne Männi ja "Väikeloomade surnuaed" HOP galeriis, autorid Ester Faiman ja Argo Männik

  12. 19. IX avati muusikaakadeemia kohvikgaleriis maalinäitus "Ylimaal 2"

    Index Scriptorium Estoniae

    2001-01-01

    Allan Tõnissoo kureeritud näitusel osalevad Alice Kask, Kristin Kalamees, Hermes Sarapuu, Lauri Haavel, Mihkel Kleis, Andres Lõo, August Künnapu, Björn Koop, Frank, Avangard (Sandra Jõgeva & Margus Tamm), Mart Reino, Allan Tõnissoo

  13. Молодые таланты выступят в KUMU / Ксения Репсон

    Index Scriptorium Estoniae

    Репсон, Ксения

    2009-01-01

    23. ja 24. jaan. esietendatakse Kumu auditooriumis kaht tantsulavastust - Jaan Ulsti "Tehniline dialoog" ja Kati Juuriku "Sula jagu". Esimeses lavastuses tantsivad Sandra Palm ja Irina Krotova, teises Kati Juurik ja Mihkel Ilus. Muusika autor Märt-Matis Lill

  14. Vetshera estonskogo iskusstva / Ruta Pels

    Index Scriptorium Estoniae

    Pels, Ruta, 1960-

    2001-01-01

    Eesti kunsti õhtutest Suurbritannia saadiku residentsis Tallinnnas, partneriks La Galerie Passage. Iga kuu muutuvas kunstikollektsioonis olevatest eesti kunstnike töödest (Rein Tammik, Malle Leis, Sandra Jõgeva jt.)

  15. Десятка самых прибыльных актеров / Кая Коовит

    Index Scriptorium Estoniae

    Коовит, Кая, 1968-

    2010-01-01

    10 kõige enam teenivat Hollywoodi näitlejat (Quigley Publishing' andmeil) on Denzel Washington, Shia LaBeouf, Brad Pitt, Meryl Streep, Tom Hanks, Robert Downey jr., George Clooney, Matt Damon, Johnny Depp ja Sandra Bullock

  16. Молодые таланты выступят в KUMU / Ксения Репсон

    Index Scriptorium Estoniae

    Репсон, Ксения

    2009-01-01

    23. ja 24. jaan. esietendatakse Kumu auditooriumis kaht tantsulavastust - Jaan Ulsti "Tehniline dialoog" ja Kati Juuriku "Sula jagu". Esimeses lavastuses tantsivad Sandra Palm ja Irina Krotova, teises Kati Juurik ja Mihkel Ilus. Muusika autor Märt-Matis Lill

  17. Eesti koomiks ja I Eesti koomiksibiennaal / Toomas Verrev

    Index Scriptorium Estoniae

    Verrev, Toomas, 1979-

    2010-01-01

    I Eesti Koomiksibiennaal Kultuuritehase Polymer Kunstikonteineris Tallinnas 16. aprillist 23. maini. Kuraatorid Elisabeth Salmin ja Sandra Jõgeva. Esitleti Ed Labetski ja Ago Visaki koomiksit "Kalevipoeg" ning Elisabeth Salmini koomiksikogumikku "Simulant ja teised"

  18. Environmental Assessment: 2005 Base Realignment and Closure Seymour Johnson Air Force Base Goldsboro, North Carolina

    Science.gov (United States)

    2007-07-01

    jloridanus), gray squirrel (Sciurus carolinensis), black rat snake (Elaphe obsoleta), indigo bunting (Passerina cyanea), common yellowthroat (Geothlypis...Wayne County Board of Adjustment- Allan D. Pedersen • Community Child Protection Team- Sandra Head • Wayne County Economic Development Commission- Dr

  19. Pink Pungi näitusel valgub veri linale / Raimu Hanson

    Index Scriptorium Estoniae

    Hanson, Raimu, 1957-

    2006-01-01

    Kunstirühmituse Pink Punk (Sandra Jõgeva, Kristin Kalamees, Aino Ingrid Sepp, Kaarel Sammet) näitusest Y-galeriis. Lähemalt videoinstallatsioonist "Must turg" ja ruumiinstallatsioonist "Elulähedane kogemus"

  20. Uus aeg ja uus kunst ulatavad Pärnus terekäe / Siram

    Index Scriptorium Estoniae

    Siram, pseud., 1968-

    2010-01-01

    Näitus "New Age" Pärnu Kunstnike majas 23. aprillini 2010, kuraator Sandra Jõgeva. Lähemalt Maigi Magnuse kineetilisest skulptuurist "Ema mängib surnut", ameerika kunstniku Meghan Van Alstyne tööst "Uskujad"

  1. Animaalne antimagnetism / Mari Laaniste

    Index Scriptorium Estoniae

    Laaniste, Mari, 1977-

    2009-01-01

    Rahvusvaheline grupinäitus "Loomakari" Tallinna Kunstihoones kuni 12. aprillini. Kuraator Sandra Jõgeva, kujundaja Tanel Saar. Lühidalt Jenni Juulia Wallinheimo, Kjetil Kauslandi ja Loore Emilie Raavi töödest

  2. Plaadid / Immo Mihkelson

    Index Scriptorium Estoniae

    Mihkelson, Immo, 1959-

    2002-01-01

    Uutest plaatidest Mike Oldfield "Collection", Compay Segundo "Duets", Sandra "Wheel Of Time", "Spirit Of Africa", Paddy's "Irish Folk", Edwin Collins "Doctor Syntax", Doors "Live in Hollywood", Sonic Youth "Murray Street"

  3. Eesti koomiks ja I Eesti koomiksibiennaal / Toomas Verrev

    Index Scriptorium Estoniae

    Verrev, Toomas, 1979-

    2010-01-01

    I Eesti Koomiksibiennaal Kultuuritehase Polymer Kunstikonteineris Tallinnas 16. aprillist 23. maini. Kuraatorid Elisabeth Salmin ja Sandra Jõgeva. Esitleti Ed Labetski ja Ago Visaki koomiksit "Kalevipoeg" ning Elisabeth Salmini koomiksikogumikku "Simulant ja teised"

  4. Под сенью комиксов в цвету /Николай Караев

    Index Scriptorium Estoniae

    Караев, Николай, 1978-

    2010-01-01

    Eesti I Koomiksibiennaal Kultuuritehase Polymer Kunstikonteineris Tallinnas alates 16. aprillist. Kuraatorid on Elisabeth Salmin ja Sandra Jõgeva. Esitletakse kollektiivselt loodud kunstnikuraamatut "Comic Magazine", toimub kirjanduslike kohtumiste seeria "Üks hullem kui teine" koomiksieri

  5. Vetshera estonskogo iskusstva / Ruta Pels

    Index Scriptorium Estoniae

    Pels, Ruta, 1960-

    2001-01-01

    Eesti kunsti õhtutest Suurbritannia saadiku residentsis Tallinnnas, partneriks La Galerie Passage. Iga kuu muutuvas kunstikollektsioonis olevatest eesti kunstnike töödest (Rein Tammik, Malle Leis, Sandra Jõgeva jt.)

  6. Pink Pungi näitusel valgub veri linale / Raimu Hanson

    Index Scriptorium Estoniae

    Hanson, Raimu, 1957-

    2006-01-01

    Kunstirühmituse Pink Punk (Sandra Jõgeva, Kristin Kalamees, Aino Ingrid Sepp, Kaarel Sammet) näitusest Y-galeriis. Lähemalt videoinstallatsioonist "Must turg" ja ruumiinstallatsioonist "Elulähedane kogemus"

  7. Body Image, Relationships and Sexuality After Amputation

    Science.gov (United States)

    Body Image, Relationships and Sexuality after Amputation Original article by Sandra Houston, PhD First Step - Volume 4, 2005 Translated into plain language by Helen Osborne of Health Literacy Consulting ...

  8. Kinship and Beyond: The Genealogical Model Reconsidered

    Directory of Open Access Journals (Sweden)

    Ryan Schram

    2010-08-01

    Full Text Available Review of Kinship and Beyond: The Genealogical Model Reconsidered. Sandra Bamford and James Leach, eds. 2009. Berghahn Books, New York. 292 pp., 21 illustrations, bibliography, index. $95.00 (hardback. ISBN 9781845454227.

  9. Local Security, Policing, and Counterinsurgency: Lessons from Iraq

    Science.gov (United States)

    2010-06-17

    wisdom of my advisor, Dr. Paul Melshen. I would also like to thank Dr. Robert Antis and Colonel James Dickens , USA, who taught me so much about strategy...Eagleburger, Vernon Jordan, Edwin Meese III, Sandra Day O’Connor, Leon Panetta, William Perry, Charles Robb, and Alan Simpson, The Iraq Study Group...Edwin Meese III, Sandra Day O’Connor, Leon Panetta, William Perry, Charles Robb, and Alan Simpson. The Iraq Study Group Report. Washington, DC

  10. Persistence of Serogroup C Antibody Responses Following Quadrivalent Meningococcal Conjugate Vaccination in United States Military Personnel

    Science.gov (United States)

    2014-05-14

    6. AUTHORS Manisha Patel, Sandra Romero- Steiner , Michael P. Broderick, Cynthia G. Thomas, Brian D. Plikaytis, Daniel S. Schmidt, Scott E. Johnson ...States Military Personnel Manisha Patel Sandra Romero- Steiner Andrea S. Milton Michael P. Broderick George M. Carlone Cynthia G. Thomas Thomas...A. Clark Brian D. Plikaytis Nancy E. Messonnier Daniel S. Schmidt Amanda C. Cohn Scott E. Johnson Dennis J. Faix Report No. 13-07 The

  11. FY08 DRMRP Clinical Trial: Strengthening Pathways to PTSD Recovery Using Systems-Level Intervention

    Science.gov (United States)

    2015-09-01

    Coordinators: Sandra Bozik-Lyman (Fort Bragg), Tahlia Bragg (Fort Carson), Alison Campbell (Fort Stewart), Emily Clark (JBLM), Jessie Gallaher (Fort Stewart...Sandra Bozik-Lyman (Fort Bragg), Tahlia Bragg (Fort Carson), Alison Campbell (Fort Stewart), Emily Clark (JBLM), Jessie Gallaher (Fort Stewart...18 16. Dobscha SK, Corson K, Perrin NA, Hanson GC, Leibowitz RQ, Doak MN, Dickinson KC, Sullivan MD, Gerrity MS: Collaborative care for chronic

  12. Glomerulocystic kidney in a domestic dog.

    Science.gov (United States)

    Takahashi, M; Morita, T; Sawada, M; Uemura, T; Haruna, A; Shimada, A

    2005-01-01

    Glomerulocystic kidney was diagnosed in a 5-year-old female Shiba dog, which died from chronic renal failure with convulsions, vomiting and diarrhoea. Haematological examination revealed non-regenerating anaemia, azotaemia and high serum creatinine. Grossly, both kidneys were mildly atrophic with multiple small cysts in the cortex. Histopathological examination revealed marked dilatation of Bowman's space, often with glomerular atrophy or loss, and mild interstitial fibrosis. Bowman's basement membranes (BMs) were tortuous and thickened, with patchy calcification. Glomerulo-tubular junctions in the urinary pole side of the kidneys had a stenotic appearance associated with thickening of Bowman's BMs and calcification. Focal interstitial fibrosis around the glomerulo-tubular junction was also found. Continuity with the proximal tubule was evident in cystic glomeruli. Ultrastructurally, marked thickening of Bowman's BMs with many granular deposits in the urinary pole side was observed. The findings indicate that glomerular cystic changes may have developed as a consequence of glomerulo-tubular junctional stenosis due to thickened Bowman's BMs and focal periglomerular fibrosis in the urinary pole side of the kidneys.

  13. In vivo laser confocal microscopy findings of a cornea with osteogenesis imperfecta

    Directory of Open Access Journals (Sweden)

    Kobayashi A

    2014-02-01

    Full Text Available Akira Kobayashi, Tomomi Higashide, Hideaki Yokogawa, Natsuko Yamazaki, Toshinori Masaki, Kazuhisa Sugiyama Department of Ophthalmology, Kanazawa University Graduate School of Medical Science, Kanazawa, Japan Objective: To report the in vivo laser confocal microscopy findings of a cornea with osteogenesis imperfecta (OI with special attention to the abnormality of Bowman's layer and sub-Bowman's fibrous structures (K-structures. Patients and methods: Two patients (67-year-old male and his 26-year-old son with OI type I were included in this study. Slit lamp biomicroscopic and in vivo laser confocal microscopic examinations were performed for both patients. Central corneal thickness and central endothelial cell density were also measured. Results: Although the corneas looked clear with normal endothelial density for both eyes in both patients, they were quite thin (386 µm oculus dexter (OD (the right eye and 384 µm oculus sinister (OS (the left eye in the father and 430 µm OD and 425 µm OS in the son. In both patients, slit lamp biomicroscopic and in vivo laser confocal microscopic examination showed similar results. Anterior corneal mosaics produced by rubbing the eyelid under fluorescein were completely absent in both eyes. In vivo laser confocal microscopy revealed an absent or atrophic Bowman's layer; a trace of a presumed Bowman's layer and/or basement membrane was barely visible with high intensity. Additionally, K-structures were completely absent in both eyes. Conclusion: The absence of K-structures and fluorescein anterior corneal mosaics strongly suggested an abnormality of Bowman's layer in these OI patients. Keywords: osteogenesis imperfecta, K-structure, confocal microscopy, Bowman's layer

  14. Stereocontrolled Introduction of the Quaternary Stereogenic Centre in Lyngbyatoxin A

    DEFF Research Database (Denmark)

    Tønder, Janne Ejrnæs; Tanner, David Ackland

    , a methodology developed by Jung et al(1). For model studies, the requisite vinyl epoxides were obtained by Sharpless asymmetric epoxidation of the corresponding allylic alcohols, followed by a TPAP oxidation and a Wittig reaction. It was observed that the choice of protective group on the indole nitrogen in had...... was the desired aldehyde resulting from vinyl migration. The aldehyde functionality then serves as a convenient “handle” for further elaboration. 1) Jung, M. E.; D'Amico, D. C. J. Am. Chem. Soc. 1995, 117, 7379-7388....

  15. Main: 1BBI [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BBI 大豆 Soybean Glycine max (L.) Merrill Bowman-Birk Type Proteinase Inhibitor Precursor Glycine Ma...x Trypsin/Chymotrypsin Bowman-Birk Inhibitor (Nmr, Minimized Average Structure) Serine Prote...ase Inhibitor M.H.Werner, D.E.Wemmer M.H.Werner, D.E.Wemmer Three-Dimensional Structure Of Soybean Trypsin(Slash)Chymotrypsin Bowma... 1D6R; X-ray; I=45-102.|PDB; 1K9B; X-ray; A=45-102.|PDB; 2BBI; NMR; @=40-110.|InterPro; IPR000877; Prot_inh_

  16. Main: 1C2A [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1C2A 大麦 Barley Hordeum vulgare l. Bowman-Birk Type Trypsin Inhibitor. Hordeum Vulgare Molecule: Bowma..., J.Y.Lee, S.W.Suh H.K.Song, Y.S.Kim, J.K.Yang, J.Moon, J.Y.Lee, S.W.Suh Crystal Structure Of A 16 Kda Double-Headed Bowma...B; 1C2A; X-ray; A=4-122.|InterPro; IPR000877; Prot_inh_BBI.|Pfam; PF00228; Bowman-Birk_leg; 4.|SMART; SM0026

  17. 心里一直有对方

    Institute of Scientific and Technical Information of China (English)

    GOLDEN VILLAGE PICTURES

    2007-01-01

    好莱坞参考了韩国爱情片《时越爱》,翻拍出《THE LAKE HOUSE》,打出帅哥美女牌,并以 KEANU REEVES 和 SANDRA BULLOCK 自《SPEED》后,阔别12年再度合作为卖点之一。咪咪告诉你,KEANU REEVES 和 SANDRA BULLOCK 如何重新激出火花,如何看待凄美的爱情。

  18. Establishment of a Center for Development of Chemical Sensors for Explosives at University of Puerto Rico-Mayaguez

    Science.gov (United States)

    2011-02-08

    Marcos Barreto 0.10 Alejandro Blanco 1.00 Nelson Granda 0.20 Pedro Fierro 0.50 Yleana Colon 1.00 Indira Jerez 1.00 Maik Irrazabal 1.00 Celia...supported PERCENT SUPPORTEDNAME Migdalia Hidalgo Santiago Sujeily Soto Medina Nancy Soto Acevedo Juan Santa Roman Jeylisse Castaner De Choudens Rosa I...degrees NAME Oliva M. Primera-Pedrozo Leonardo Pacheco-Londoño Alejandro Blanco Bibiana Baez-Angarita Sandra N. Correa-Torres Lewis Gomez Sandra Peña

  19. EDITORIAL Teoria do documentário ---> Marcius Freire, Manuela Penafria DOSSIER TEMÁTICO Novos territórios do documentário ---> Arlindo Machado Perspectivas da análise narrativa no cinema: por uma abordagem da narrativa no filme documentário ---> Sandra Straccialano Coelho Fotografía y realidad: notas para una fenomenología del cine documental ---> Rubén Dittus Retórica e pragmática do documentário: a experiência de realização cinematográfica compartilhada do projeto Vídeo nas Aldeias

    Directory of Open Access Journals (Sweden)

    Juliano José de Araújo Juliano José de Araújo Juliano José de Araújo

    2011-12-01

    Full Text Available The article examines the experience of shared filmmaking (preparation,shooting and editing of the Brazilian Project Video in the Villages from the analysis ofthree documentaries directed by indigenous filmmakers. It analyzes the rhetoric choices ofthe documentaries, as the mise en scène, the first person narration and the voice-over etc.,according to their rhetoric and pragmatic dimensions, as defined by Plantinga (1997.

  20. Integrative approach to pre-operative determination of clinically significant prostate cancer

    Directory of Open Access Journals (Sweden)

    Shatylko T.V.

    2015-09-01

    Full Text Available Aim: improvement of early diagnostics of prostate cancer by developing a technique, which makes possible to predict its clinical significance in outpatient setting before initiation of invasive procedures. Material and Methods. Clinical data of 398 patients who underwent transrectal prostate biopsy in 2012-2014 in SSMU S. R. Mirotvortsev Clinical Hospital, was used to build an artificial neural network, while its output allowed to determine whether the tumour corresponds to Epstein criteria and which D'Amico risk group it belongs to. Internal validation was performed on 80 patients, who underwent prostate biopsy in September 2014 — December 2014. Sensitivity, specificity, positive and negative predictive value of artificial neural network were calculated. Results. Accuracy of predicting adenocarcinoma presence in biopsy specimen was 93,75%; accuracy of predicting whether the cancer meets active surveillance criteria was 90%. Accuracy of predicting T stage (T1c, T2a, T2b, T2cwas 57,1%. Prediction of D'Amico risk group was accurate in 70% of cases; for low-risk cancer accuracy was 81,2%. Conclusion. Artificial neural networks may be responsible for prostate cancer risk stratification and determination of its clinical significance prior to biopsy.

  1. PPARGC1A and ADIPOQ polymorphisms are associated with aggressive prostate cancer in Mexican-Mestizo men with overweight or obesity.

    Science.gov (United States)

    Canto, Patricia; Granados, Jesús Benítez; Feria-Bernal, Guillermo; Coral-Vázquez, Ramón Mauricio; García-García, Eduardo; Tejeda, María Elena; Tapia, André; Rojano-Mejía, David; Méndez, Juan Pablo

    2017-07-04

    Obesity constitutes a risk factor for the development of aggressive forms of prostate cancer. It has been proposed, that prostate cancer has a genetic predisposition and that PPARGC1A and ADIPOQ polymorphisms play a role in the development of this condition. To analyse the association of two PPARGC1A and ADIPOQ polymorphisms as well as their haplotypes, with the development of aggressive prostate cancer in Mexican-Mestizo men with overweight or obesity. Two hundred fifty seven men with prostate cancer of Mexican-Mestizo origin were included. Body mass index (BMI) was determined and the degree of prostate cancer aggressiveness by the D'Amico classification. DNA was obtained. Rs7665116 and rs2970870 of PPARGC1A, and rs266729 and rs1501299 of ADIPOQ were studied by real-time PCR allelic discrimination. Pairwise linkage disequilibrium, between single nucleotide polymorphisms was calculated and haplotype analysis was performed. A higher-risk (D'Amico classification) was observed in 21.8% of patients. An association of cancer aggressiveness with rs2970870 of PPARGC1A, and rs501299 of ADIPOQ, as well as with one haplotype of ADIPOQ was documented. This is the first study regarding the relationship of PPARGC1A and ADIPOQ polymorphisms, and the aggressiveness of prostate cancer in men with overweight or obesity.

  2. Anatomic features of the cetacean globe.

    Science.gov (United States)

    Miller, Sarah; Samuelson, Don; Dubielzig, Richard

    2013-07-01

    To provide measurements of globe dimensions and describe morphological characteristics of the cetacean globe with an emphasis on Bowman's layer and encapsulated sensory corpuscles (ESC) for available cetacean species. Cetacean globes housed at the Comparative Ocular Pathology Laboratory of Wisconsin from various odontocete and two mysticete species. Measurements were taken from formalin fixed globes and images of formalin fixed globes with embedded rulers. Histological sections of globes were used to count ESC and measure Bowman's layer. The horizontal diameter of the globe was longer than the vertical diameter. The posterior sclera was thick, causing the internal axial length (and therefore the optical axis) to be shorter than the vertical diameter. The cornea was composed of an epithelium, Bowman's layer, collagenous stroma, thin Descemet's membrane and endothelial layer. Bowman's layer was present in all specimens except one Kogia breviceps. The thickness was variable, with the acellular layer thickest in Tursiops truncatus and thinnest in Kogia sp. The iris was well vascularized and muscled while the ciliary body lacked musculature, but retained vasculature. Single and clustered ESC were found in the anterior uvea, sclera surrounding the anterior uvea, trabecular meshwork, or some combination of these locations. They were often regionally grouped and varied from 0 to 21. There were three species where no ESC were found, L. borealis, D. capensis, and S. bredanensis, but the presence of these corpuscles cannot be ruled as only one section of the globe was analyzed. © 2013 American College of Veterinary Ophthalmologists.

  3. Glomerular matrix: synthesis, turnover and role in mesangial expansion

    DEFF Research Database (Denmark)

    Couchman, J R; Beavan, L A; McCarthy, K J

    1994-01-01

    The extracellular matrix has an integral role in development, homeostasis and pathology of the glomerulus. Three spatially distinct matrices are present in the glomerulus: the mesangium, and basement membranes of the capillary loops and Bowman's capsule. Each is dominated by basement membrane com...

  4. Performance Moderated Functions Server’s (PMFserv) Military Utility: A Model and Discussion

    Science.gov (United States)

    2009-05-01

    like to thank Troy Kelley, Laurel Allender, Liz Bowman, Luci Salvi, and Don Headley for their thoughtful comments on earlier versions of this report...Occupational Specialty (MOS). The selected MOS that was modeled was that of a Robotics NCO. Although the Robotics NCO ( Jensen , Tasoluk, Sanders, Marshall

  5. [Simple keratectomy in band-shaped degeneration of the cornea (author's transl)].

    Science.gov (United States)

    Kenyeres, P

    1980-01-01

    In a case of band-shaped keratopathy chemical solution of the opacity failed but it proved easy to remove Bowman's membrane by grasping it with a forceps and pulling it off. As a result the cornea became clear and vision improved up to 6/7ths.

  6. Social and Emotional Foundations for Early Learning: A Conceptual Model for Intervention

    Science.gov (United States)

    Hemmeter, Mary Louise; Ostrosky, Michaelene; Fox, Lise

    2006-01-01

    Over the last several years, there has been an increased focus on school readiness and supporting children during the preschool years to learn the skills they need to be successful in elementary school and beyond (Bowman, Donovan, Burns, et al., 2000; Shonkoff & Phillips, 2000). The capacity to develop positive social relationships, to concentrate…

  7. ADHESIVE INTESTINAL OBSTRUCTION

    African Journals Online (AJOL)

    2006-06-01

    Jun 1, 2006 ... Request for reprints to: Dr. R.T. Kuremu, Moi University Medical School, ... the outcome of treatment; and to determine the factors affecting the overall management of ..... Miller G., Bowman J., Shier I. and Gordon P.H. Natural.

  8. Editorial. Introduction to the regional assessments: Climate change, wildfire, and forest ecosystem services in the USA

    Science.gov (United States)

    Monique E. Rocca; Chelcy Ford Miniat; Robert J. Mitchell

    2014-01-01

    Fires have influenced and shaped vegetation ever since the climate evolved to provide both ignition sources and oxygen (Bowman et al., 2009). Fire has been one of the most frequent and impactful disturbances to ecosystems globally, and thus one of the major regulators of forest composition, function and dynamics (Spurr and Barnes, 1973 and Bond and Keeley, 2005). Any...

  9. Spelaeomysis cochinensis, a new mysid (Crustacea: Mysidacea) from a prawn culture field in Cochin, India

    Digital Repository Service at National Institute of Oceanography (India)

    Panampunnayil, S.U.; Viswakumar, M.

    to S. servatus Fage (1925) known from Zanzibar and S. cardisomae Bowman (1973) known from Mexico in many of its characters, notably in having separate eye- plates with visual elements and in the apical arma- ture of the telson. But S. cochinensis...

  10. Watermarks within the Middle Eastern Manuscript Collection of the Baillieu Library

    Science.gov (United States)

    Lewincamp, Sophie

    2012-01-01

    The University of Melbourne's Middle Eastern Manuscript collection housed at the Baillieu Library was acquired by Professor John Bowman in the 1950s as part of a teaching collection to promote greater learning of Middle Eastern culture and civilisation (Pryde 2007, 3). The collection is a rare example within Australia and represents many different…

  11. Reading: Birth to Age 5 = La Lectura: Desde El Nacimiento Hasta Los 5 Anos

    Science.gov (United States)

    Learning Point Associates / North Central Regional Educational Laboratory (NCREL), 2005

    2005-01-01

    Besides a change in the expectations of parents, other shifts are occurring in society that impact the youngest children (Bowman, Donovan, & Burns, 2000): (1) More women are in the workforce than ever before, which means more children are in child care or preschool; (2) There is increasing evidence of, and conviction from educators, that preschool…

  12. An Analysis of Naval Officer Accession Programs

    Science.gov (United States)

    2008-03-01

    Academic achievement and job performance. The American Economic Review, Vol 65 (3). Retrieved January 27, 20006 from the JSTOR database . Wise, D. A... JSTOR database . 99 INITIAL DISTRIBUTION LIST 1. Defense Technical Information Center Ft. Belvoir, Virginia 2. Dudley Knox Library...micro-level database with which to explore the effects of college selectivity on job performance (Bowman and Mehay, 2002). Large civilian

  13. 77 FR 65234 - Notice of Intention To Cancel Registrations of Certain Investment Advisers Pursuant to the...

    Science.gov (United States)

    2012-10-25

    ...-END FUND ADVISORS INC. 801-68833 COAST WEALTH MANAGEMENT, INC. 801-68548 CONCORD ATLANTIC, INC. 801... MANAGEMENT 801-61272 SOVEREIGN INTERNATIONAL ASSET MANAGEMENT, INC. 801-70589 SOVEREIGN PRIVATE WEALTH, INC... MANAGEMENT 801-71729 BOLI FUND MANAGEMENT, LLC 801-14429 BOWMAN FINANCIAL MANAGEMENT CO INC 801-72221...

  14. Healthy Hearts (A Cup of Health with CDC)

    Centers for Disease Control (CDC) Podcasts

    2014-10-02

    Heart disease is among the leading causes of death worldwide. Combined with stroke, it accounts for one in three deaths. Improving heart health could save millions of lives each year. In this podcast, Dr. Barbara Bowman discusses ways to prevent heart problems.  Created: 10/2/2014 by MMWR.   Date Released: 10/2/2014.

  15. Metabolic syndrome in newly diagnosed type 2 diabetes mellitus ...

    African Journals Online (AJOL)

    2012-02-02

    Feb 2, 2012 ... Equal number of males and females (11 each) had low HDL--C (P = 0.603). Conclusion: The .... pressure (DBP), and additionally body mass index (BMI). ..... Association of Adiposity, Cardiorespiratory, Fitness and Exercise, Practice ... Mokdad AH, Ford ES, Bowman BA, Dietz WH, Vinicor F, Bales VS, et al.

  16. Molecular Mechanisms of Metastasis Suppression in Human Breast Cancer

    Science.gov (United States)

    2000-07-01

    and breast carcinoma metastasis, Wake Forest University Cancer Center, July 28 Molecular mechanisms controlling melanoma and breast carcinoma...Bowman Show, August 17 Molecular regulation of melanoma and breast carcinoma metastasis, Wake Forest University Cancer Center, July 28 Molecular...Institute, April 20, Pathology ofNeoplasia Cumberland Unit, American Cancer Society, April 19; Breast Cancer Research Ministerio de Sanidad y

  17. Main: 1F7S [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available .M.Nodelman, U.Lindberg, N.H.Chua, C.E.Schutt G.D.Bowman, I.M.Nodelman, Y.Hong, N.H.Chu...a, U.Lindberg, C.E.Schutt A Comparative Structural Analysis Of The Adf/Cofilin Family Proteins: Struct

  18. New Flu Virus in Pigs Exhibited at Fairs in Ohio

    Centers for Disease Control (CDC) Podcasts

    2013-05-21

    Dr. Andrew Bowman, a graduate research assistant in the Department of Veterinary Preventive Medicine at The Ohio State University, discusses his study about flu virus in pigs at agricultural fairs.  Created: 5/21/2013 by National Center for Emerging and Zoonotic Infectious Diseases (NCEZID).   Date Released: 5/23/2013.

  19. 78 FR 76394 - Qualification of Drivers; Exemption Applications; Vision

    Science.gov (United States)

    2013-12-17

    ...: Christina L. Anhock Thomas R. Anthony Brian Ashbaugh Eric Betsuie Eric P. Carr Adrian L. Johnson Bradford... Bennett John D. Bowman Don Gray Bruce Gumtow Gary S. Judds Timothy M. Leonard Thomas A. Martin, III Rodney.... Basista Thomas J. Bruce, Jr. Barry Foster Donald M. Gieseke Marco J. Gonzalez Rogelio Leyva Martin...

  20. Balancing Consistency and Flexibility in Student Training Entitlements: Research Overview

    Science.gov (United States)

    Bowman, Kaye; McKenna, Suzy; Griffin, Tabatha

    2016-01-01

    This research overview summarizes the work undertaken by Kaye Bowman and Suzy McKenna in exploring jurisdictional approaches to the implementation of student entitlements to vocational skills training, a key reform initiative in the National Partnership Agreement on Skills Reform (NPASR) of 2012-16. The overview is a condensed summary of three…

  1. The Production and Evolution of Atomic Oxygen in the Afterglow of Streamer Discharge in Atmospheric Pressure Fuel/Air Mixtures

    Science.gov (United States)

    2013-07-02

    OH where the C3H7 radical can be formed in two isomeric configurations with total rate coefficient k ~ 3 x 1011 cm3 s-1 at T = 1500 K [14, 18]. At...in air and air/fuel nanosecond pulse dillcharges by two photon laser induced fluorescence Proc. Combust. lnst. 32 929 -36 [10] Bowman S, Adamovich

  2. Attentional episodes in visual perception

    NARCIS (Netherlands)

    Wyble, Brad; Potter, Mary C.; Bowman, Howard; Nieuwenstein, Mark

    2011-01-01

    Is one's temporal perception of the world truly as seamless as it appears? This article presents a computationally motivated theory suggesting that visual attention samples information from temporal episodes (episodic simultaneous type/serial token model; Wyble, Bowman, & Nieuwenstein, 2009). Breaks

  3. Disease: H01007 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available lar papillary neoplasms of neuroectodermal origin, accounting for less than 1% of all intracranial tumors and 2-4% of pediatric...905-9 (2012) PMID:21970783 (description) Ogiwara H, Dipatri AJ, Alden TD, Bowman RM, Tomita T Choroid plexus tumors in pediatric

  4. Implication of Culture: User Roles in Information Fusion for Enhanced Situational Understanding

    Science.gov (United States)

    2009-07-01

    IF community has rallied behind the Data Fusion Information Group (DFIG) process model (that replaces the JDL model) with its revisions and...Llinas, C. Bowman, G. Rogova, A. Steinberg, E. Waltz, & F. White, “Revisiting the JDL Data Fusion Model II”, Fusion2004. [39] M. L. Davidson

  5. A Situation Analysis Toolbox for Course of Action Evaluation

    Science.gov (United States)

    2011-06-01

    This follows a standard intuition about levels 2 and 3 of the standard JDL Information Fusion model where, according to Steinberg and Bowman [4...Revisions to the JDL data fusion model. In D. L. Hall and J. Llinas, editors, Handbook of Multisensor Data Fusion, The Electrical Engineering and Applied

  6. Fire behavior and effects: Principles for archaeologists [Chapter 2

    Science.gov (United States)

    Kevin C. Ryan; Cassandra Koerner

    2012-01-01

    Fire is a natural component of earth's ecosystems. Fire has impacted most landscapes of the Americas, having left evidence of its passing in trees, soils, fossils, and cultural artifacts (Andreae 1991; Benton and Reardon 2006; Biswell 1989; Bowman and others 2009; Boyd and others 2005; Cochrane and others 1999; DeBano and others 1998; Jurney and others 2004;...

  7. Proceedings: Annual Foreign Language Conference at New York University (33rd, November 4, 1967).

    Science.gov (United States)

    Stais, James, Ed.

    The theme of this conference, "New Directions in Foreign Language Teaching," is introduced by Theodore Buebener and is expanded in the five papers comprising this volume. The papers included are "New Directions in the Teaching of Foreign Languages--An Evaluation" by Peter M. Boyd-Bowman, "An Appraisal of Audio-Lingualism in Historical Perspective"…

  8. Muusika / Aimar Ventsel

    Index Scriptorium Estoniae

    Ventsel, Aimar, 1970-

    2005-01-01

    Uutest heliplaatidest "Sandra Sillamaa", "The Concretes", The Juan Maclean "Less Than Human", Joni Mitchell "Songs Of A Prairie Girl", Pedegree "Growing Apart", Shelton San "EP", The Five Corners Quintet "Chasin' The Jazz Gone By", "The Story of Popular Black Music", Foo Fighters "In Your Honor", A "Teen Dance Ordinance"

  9. "In graafika" + PNP = futurism / Siram

    Index Scriptorium Estoniae

    Siram, pseud., 1968-

    2011-01-01

    8. jaan.-l avati Pärnus rahvusvaheline "In graafika" festival ja Pärnu nüüdismuusika päevad "Futurism". Kunstinäitustest, pikemalt Albert Gulgi, Raul Meele ning Marian Kivila, Sandra Vellevoogi ja Ville-Karel Viirelaiu väljapanekutest, Taje Trossi installatsioonist "Eksperimentaalne instrumentaarium"

  10. 76 FR 7839 - Notice of Commission and Commission Staff Attendance at ISO/RTO Council and Regional State...

    Science.gov (United States)

    2011-02-11

    ... Energy Regulatory Commission Notice of Commission and Commission Staff Attendance at ISO/RTO Council and... of the Commission and Commission staff may attend the following ISO/RTO Council and Regional State..., RTO/ISO Performance Metrics. For more information, contact Sandra Waldstein, Office of...

  11. Eclectica, Eclectica - taas kord kunst ja muusika / Mart Niineste

    Index Scriptorium Estoniae

    Niineste, Mart, 1983-

    2009-01-01

    1.-6. septembrini Tartus toimuvast avangardkultuuri festivalist "Eclectica 2009". Y- galeriis Sandra Jõgeva kureeritud näitusel "New Age" on välja pandud Teet Raudsepa ja Liisi Eelmaa videodokumentalistikat ning Kristin Kalamehe ja inglise kunstniku Josephine Woodi videoinstallatsioone. Festivali raames toimuvatest kontsertidest. Esitletakse Vladimir Kozlovi dokumentaalfilmi "Rokkmonoloog" vene muusikust Juri Morozovist

  12. Homme kell 13 avatakse Y-galerii hoovis linnafestivali "Eclectica" raames...

    Index Scriptorium Estoniae

    2004-01-01

    Performance'ikunsti ja kunstipärase rokkmuusika ühisfestival "In/Out". Esinevad Tartu Popi & Roki Instituut, Maris Palgi, Eva Orav, Kaie Luik, Maia Möller, Trikotaaž, Enn Tegova, Ruumi Trummid, Fashist Lendas Üle ja Avangard (Sandra Jõgeva & Margus Tamm). Festival päädib Erkki Hüva LP "Varjust rambini" esitlusega

  13. Aid for the Visually Impaired

    Science.gov (United States)

    1989-01-01

    Viewstar is a video system that magnifies and focuses words so partially sighted people can read or type from printed or written copy. Invented by Dr. Leonard Weinstein, a Langley engineer, the device enables Sandra Raven, Weinstein's stepdaughter, who is legally blind, to work as a clerk typist. Weinstein has also developed other magnification systems for individual needs.

  14. Сенат Франции празднует двадцатилетие Балтийского пути / Наталья Семёнова

    Index Scriptorium Estoniae

    Семёнова, Наталья

    2009-01-01

    Prantsusmaa senatis tähistati Balti keti aastapäeva. Vastavast seminarist võtsid osa ka Mart Laar, Ene Ergma, Sandra Kalniete, Vytautas Landsbergis, Gundars Daudze, Vygaudas Ušackas, Irena Degutiene ja Denis Badre. Mart Laari vastus küsimusele Eesti-Vene suhetest

  15. Managerial Performance Issues. Symposium 24. [AHRD Conference, 2001].

    Science.gov (United States)

    2001

    This document contains three papers on managerial performance issues. "Managerial Skill Requirements: Evidence from the Scottish Visitor Attraction Industry" (Sandra Watson, Martin McCracken) presents the findings from an exploratory study of those skills that managers in the Scottish visitor attraction sector considered most important…

  16. Bone Marrow Microenvironmental Control of Prostate Cancer Skeletal Localization

    Science.gov (United States)

    2011-05-01

    1 Jinhui Liao,1 Janice E. Berry,1 Xin Li,1 Amy J. Koh,1 Megan N. Michalski,1 Matthew R. Eber,1 Fabiana N. Soki,1 W. David Sadler,1 Sudha Sud,2 Sandra...cancer metastases. Mol Cell Endocrinol 2009; 310: 71-81. 5. Roodman GD. Mechanisms of bone metastasis. N Engl J Med 2004; 350: 1655-64. 6. Shiozawa

  17. Kristin Kalamees : kunstnik peab rääkima keeles, mida mõistab publik / Eda Post

    Index Scriptorium Estoniae

    Post, Eda, 1983-

    2005-01-01

    Eesti Kunstiakadeemias graafika bakalaureuseõppe ja interdistsiplinaarsete kunstide magistriõppe lõpetanud Kristin Kalamehe (27) tegevusest. Tema isikunäitusest "Mehed" Tallinna Linnagaleriis. Kunstnike ühenduse Pink Punk (Sandra Jõgeva, Margus Tamm ja Kristin Kalamees) ettevõtmisi

  18. Viin! / Karen Jagodin

    Index Scriptorium Estoniae

    Jagodin, Karen, 1982-

    2006-01-01

    Näitused austria kaasaegsest arhitektuurist Eesti Arhitektuurimuuseumis kuni 21. V: "Viin: linnaehitus ja uusim arhitektuur" suures saalis (kuraator Leopold Dungl), kaasneb kataloog; "Elamuehitus Viinis: arhitektuur igaühele" galeriil (näituse idee: Wolfgang Förster, Dietmar Steiner, Alexandra Viehhauser, kuraator A. Viehhauser, kujundus - Span-Arhitektid: Matias del Campo, Sandra Manninger, Sebastian Michalski)

  19. A Critique on Mockingbird Don't Sing

    Institute of Scientific and Technical Information of China (English)

    黄雪珍

    2016-01-01

    This movie is based on actual events. Firstly, this paper gives a brief introduction of movie, and then uses the method of comparison and takes examples to analyze the linguistic and behavioral development of Katie. Finally, we can make a conclusion that Katie can acquire language if Sandra et al keep helping her.

  20. Common STAT3 variants are not associated with obesity or insulin resistance in female twins

    NARCIS (Netherlands)

    Jamshidi, Yalda; Kyriakou, Theodosios; Gooljar, Sakina B.; Collins, Laura J.; Lane, Carl A.; Snieder, Harold; Wang, Xiaoling; Spector, Tim D.; O'Dell, Sandra D.

    2007-01-01

    JAMSHIDI, YALDA, THEODOSIOS KYRIAKOU, SAKINA B. GOOLJAR, LAURA J. COLLINS, CARL A. LANE, HAROLD SNIEDER, XIAOLING WANG, TIM D. SPECTOR, AND SANDRA D. O'DELL. Common STAT3 variants are not associated with obesity or insulin resistance in female twins. Obesity. 2007; 15:1634-1639. In animal models, ST

  1. Eclectica, Eclectica - taas kord kunst ja muusika / Mart Niineste

    Index Scriptorium Estoniae

    Niineste, Mart, 1983-

    2009-01-01

    1.-6. septembrini Tartus toimuvast avangardkultuuri festivalist "Eclectica 2009". Y- galeriis Sandra Jõgeva kureeritud näitusel "New Age" on välja pandud Teet Raudsepa ja Liisi Eelmaa videodokumentalistikat ning Kristin Kalamehe ja inglise kunstniku Josephine Woodi videoinstallatsioone. Festivali raames toimuvatest kontsertidest. Esitletakse Vladimir Kozlovi dokumentaalfilmi "Rokkmonoloog" vene muusikust Juri Morozovist

  2. Contra viento y marea

    Directory of Open Access Journals (Sweden)

    Luis Fernando Carrasco Zaldua

    2016-08-01

    Full Text Available La carrera de la modernidad. Construcción de la carrera décima, Bogotá (1945-1960. Carlos Niño Murcia y Sandra Reina Mendoza. Instituto Distrital de Patrimonio Cultural, Bogotá, 2014, 280 págs., il.

  3. Shari’a Compliant Finance: The Overlooked Element for Developing an Effective Financial System in Afghanistan

    Science.gov (United States)

    2012-06-08

    Nora Bensahel, Derek Eaton, S. Jamie Gayton , Brooke Steams Lawson, Jeffrey Martini, John L. Nasir, Sandra Reyna, Michelle Parker, Jerry M. Sollinger...Islamic _Finance_ Outlook _2010.pdf, (accessed 23 August 2011). Crane, Keith, Olga Oliker, Nora Bensahel, Derek Eaton, S. Jamie Gayton , Brooke Steams

  4. 78 FR 10246 - Data Collection Available for Public Comments and Recommendations

    Science.gov (United States)

    2013-02-13

    ....gov , 202-205-7528, sandra.johnston@sba.gov , Curtis B. Rich, Management Analyst, 202-205- 7030, curtis.rich@sba.gov ; SUPPLEMENTARY INFORMATION: Small Business Administration (SBA) regulations require....washington@sba.gov .; Curtis B. Rich, Management Analyst, 202- 205-7030, curtis.rich@sba.gov ....

  5. The Average Expectable Environment Is Not Good Enough: A Response to Scarr.

    Science.gov (United States)

    Baumrind, Diana

    1993-01-01

    Takes the position, contrary to that of Sandra Scarr, that the details of socialization patterns are crucial to an understanding of normal and deviant development. Research is cited to support the argument that better than adequate parenting optimizes the development of both normal and vulnerable children and that parents' belief in their own…

  6. Finding the Joy of Language in Authentic Wordplay

    Science.gov (United States)

    Whitaker, Sandra

    2008-01-01

    Within the walls of their classroom, high school teacher Sandra Whitaker and students take on the challenge of language acquisition. They play with morphemes and etymologies and examine how authors craft meaning. Whitaker observes that it is possible for students to "learn more words than teachers can teach directly."

  7. Supreme Court Biographies as a Classroom Resource

    Science.gov (United States)

    Ryan, John Paul

    2009-01-01

    In this article, the author goes beyond Supreme Court decisions to investigate the upbringing and personalities of three Supreme Court justices who left their mark on history: Oliver Wendell Holmes, Jr., Thurgood Marshall, and Sandra Day O'Connor. His interviews with their biographers, G. Edward White for Oliver Wendell Holmes Jr., Juan Williams…

  8. Children as Consumers: Advertising and Marketing

    Science.gov (United States)

    Calvert, Sandra L.

    2008-01-01

    Marketing and advertising support the U.S. economy by promoting the sale of goods and services to consumers, both adults and children. Sandra Calvert addresses product marketing to children and shows that although marketers have targeted children for decades, two recent trends have increased their interest in child consumers. First, both the…

  9. 78 FR 14808 - Notice of Regulatory Waiver Requests Granted for the Fourth Quarter of Calendar Year 2012

    Science.gov (United States)

    2013-03-07

    ... collateralize the tax exempt bonds issued to finance the construction of the project and to pay off a portion of the tax-exempt bonds that strictly relate to capital advance eligible costs. Contact: Catherine M...), in accordance with the Single Audit Act and OMB Circular A-133. Granted By: Sandra B....

  10. Leaving Mango Street: Speech, Action and the Construction of Narrative in Britton's Spectator Stance

    Science.gov (United States)

    Crawford-Garrett, Katherine

    2009-01-01

    This paper attempts to unite "The House on Mango Street" by Sandra Cisneros with the participant and spectator theories of James Britton and D. W. Harding in the hopes that such a union will provide new insights into each. In particular, this article explores how the speech acts of Esperanza, the novel's protagonist, are indicative of a shifting…

  11. Saving Mango Street

    Science.gov (United States)

    Van Winkle, Katie

    2012-01-01

    The author first learned about cultural diversity and racial justice in Mr. Sanderson's middle school English class. They read a book called "The House on Mango Street" by Sandra Cisneros and learned about a different culture, but also about a community with striking similarities to their own. The main character in the novel, Esperanza,…

  12. Mango Street and Malnourished Readers: Politics and Realities in an "At-Risk" Middle School

    Science.gov (United States)

    Sullivan, M. Alayne

    2007-01-01

    This article presents results of a literature-response study conducted with at-risk middle school students of Latino, African American, and Caucasian backgrounds. The study was guided by an assumption of students' ability to read and coherently assimilate elements of "The House on Mango Street," by Sandra Cisneros (1984). Although centered in…

  13. The Average Expectable Environment Is Not Good Enough: A Response to Scarr.

    Science.gov (United States)

    Baumrind, Diana

    1993-01-01

    Takes the position, contrary to that of Sandra Scarr, that the details of socialization patterns are crucial to an understanding of normal and deviant development. Research is cited to support the argument that better than adequate parenting optimizes the development of both normal and vulnerable children and that parents' belief in their own…

  14. "Writing Will Keep You Free": Allusions to and Recreations of the Fairy Tale Heroine in "The House on Mango Street"

    Science.gov (United States)

    Wissman, Kelly

    2007-01-01

    This article explores how Sandra Cisneros alludes to and recasts popular fairy tales in "The House on Mango Street" to reveal their troubled legacy in the lives of many women in the novel. Drawing upon Latina feminist theory and Cisneros's autobiographical writing, this article posits that the main character Esperanza's alternative "happily ever…

  15. Elipsometría aplicada al estudio de nanopartículas metálicas embebidas en una matriz semiconductora /

    OpenAIRE

    Montiel González, Zeuz sustentante.

    2012-01-01

     tesis que para obtener el grado de Doctor en Ciencias e Ingeniería de Materiales, presenta Zeuz Montiel González ; asesor Sandra Elizabeth Rodil PosadaIX, 106 páginas : diagramasDoctorado en Ciencias e Ingeniería de Materiales UNAM, Instituto de Investigaciones en Materiales, 2012

  16. Endla teatri noortestuudio õpilased katsetavad näitlejaametit / Sabina Sägi

    Index Scriptorium Estoniae

    Sägi, Sabina

    2006-01-01

    Pärnu Endla teatris esietendub 25. veebr. noortestuudio tükk "Sõbrapäev" (autorid Liisu Krass ja Sandra Sillaots). Sel puhul vesteldakse noorte näitlejatega, Koidula gümnaasiumi õpilaste Hendrik Elsteini, Otti Eylandti ja Helen Ojametsaga

  17. WebDocumentary - cityanimals.dk

    DEFF Research Database (Denmark)

    Møhl, Perle

    2013-01-01

    An interactive WebDocumentary in 27 vignettes, about humans and other animals in Copenhagen (interspecies anthropology), created by Perle Møhl and her students on the 2013 courses in Visual Anthropology in Practice, with contributions from Sandra Lori Petersen's students in radio/sound....

  18. Celiac Family Health Education Video Series

    Medline Plus

    Full Text Available ... administrators, support staff, innovators, teachers, patients and families, all working together to make the impossible possible. ” - Sandra ... Rights Terms of Use Public Policy © 2005-2017 All Rights Reserved Facebook Twitter YouTube LinkedIn Google+ Instagram ...

  19. Uued filmid sarjast "Eesti lood"

    Index Scriptorium Estoniae

    2008-01-01

    Novembris ja detsembris on ETV ekraanil uued dokumentaalfilmid sarjast "Eesti lood" - "Professionaalne amatöör" (I. Kangro film Jaan-Jürgen Klausist), "Sõjamäng" (M. Arjukese film Ilmar Raagi osalemisest Erna retkel), "Ars longa" (M. Lillaku film kunstnik Sandra Jõgevast)

  20. Tartu ja Tallinna boheemkond ning lotovõitjad : Valitud palu dokumentaalfilmide sarjast "Eesti lood" / Olev Remsu

    Index Scriptorium Estoniae

    Remsu, Olev, 1947-

    2009-01-01

    ETVs näidatud dokumentaalfilmidest sarjas "Eesti lood" - Indrek Kangro film Jaan-Jürgen Klausist "Professionaalne amatöör" (eetris 3. XII 2008), Margit Lillaku film kunstnik Sandra Jõgevast "Ars longa" (eetris 29. X 2008), Eva-Katariina Taimre "Jackpot" lotovõitjatest (eetris 19. XI 2008)

  1. Defense Intelligence Agency: 50 Years Committed to Excellence in Defense of the Nation

    Science.gov (United States)

    2011-01-01

    to the September 11th terrorist attacks on the Pentagon. Rosa Chapa , Sandra Foster, Robert Hymel, Shelley Marshall, Patricia Mickley, Charles...the Nation MASTER SERGEANT WILLIAM W. BULTMEIER, USA, (RET) Defense Attaché Offi ce, Niamey 23 December 2000 ROSA M. CHAPA Offi ce of the Comptroller

  2. Reviews of recent publications

    OpenAIRE

    various authors

    1993-01-01

    Gilbert, Sandra M. and Sagan Gubar. Blindspots of an Old Dream of Equality: Liberal Feminism as Exclusionary Practice in No Man's Land

  3. AERA Vocational Education Special Interest Group Proceedings (San Diego, California, April 13-17, 1998).

    Science.gov (United States)

    Jackman, Diane H., Ed.

    This document contains six research papers: "Articulation Practices among Secondary and Postsecondary Vocational-Technical Education Programs" (Bob R. Stewart, Sandra Eckert-Stewart); "What Message Are We Sending to Counselors about Their Role in Tech Prep?" (Paula Puckett); "From School-to-Work: Secretaries' and Machinists' Representations of…

  4. Zolotopia: A New Classic for Design

    Science.gov (United States)

    Payne, Janet

    2007-01-01

    While working on a graphic design job at FAO Schwartz, entrepreneurs Sandra Higashi and Byron Glaser recognized a need for something new in toys. The result was the birth of Zolo, an innovative, interactive toy, designed and produced by Higashi and Glaser and distributed by the Museum of Modern Art (MoMA) in New York. The initial idea for Zolo…

  5. Akvarell, akvarell...

    Index Scriptorium Estoniae

    2004-01-01

    28. VIII Kastellaanimajas avatud akvarellinäitusel osalevad Sandra Jõgeva, Malle Leis, Mall Mets, Tiiu Pallo-Vaik, Mall Paris, Anatoli Strahhov, Vjatsheslav Semerikov, Toomas Rein, Mari Roosvalt ja Milvi Torim. Eesti Kunstimuuseumi kogudest on eksponeeritud Lydia Mei ja Paul Liivaku hilisjuugendlikus ja uusasjalikus stiilis 1930. aastate akvarelle

  6. Sinimustvalge junn... no mis kunst see ka on?! / Janno Zõbin ; interv. Janno Zõbin

    Index Scriptorium Estoniae

    Zõbin, Janno

    2003-01-01

    Kunstnikud Krista Rambak (24), Sandra Jõgeva (26) ja Kristin Kalamees (24) avasid moodsa kunsti seletamiseks kunstitelefoni, millele helistades on 24 tundi ööpäevas võimalik küsida nõu kunstiküsimustes. Projekti kaasosaline ja flaieri kujundaja Margus Tamm

  7. Tudengite hea esinemine Willem C. Vis'i nimelisel harjutuskohtuvõistlusel

    Index Scriptorium Estoniae

    2013-01-01

    XX Willem C. Vis’i nimelise rahvusvahelise kaubandusõiguse harjutuskohtuvõistlusel Viinis saavutas Tartu Ülikooli õigusteaduskonna võistkond (Kristina Promet, Jaana Lints, Edgar-Kaj Velbri ja Sandra-Kristin Noot) 290 ülikooli seast 84. koha

  8. Retraction of Hard, Lozano, and Tversky (2006)

    Science.gov (United States)

    Hard, B. M.; Lozano, S. C.; Tversky, B.

    2008-01-01

    Reports a retraction of "Hierarchical encoding of behavior: Translating perception into action" by Bridgette Martin Hard, Sandra C. Lozano and Barbara Tversky (Journal of Experimental Psychology: General, 2006[Nov], Vol 135[4], 588-608). All authors retract this article. Co-author Tversky and co-author Hard believe that the research results cannot…

  9. 27. XI esitles Kanuti gildi saalis Mooste avatud ateljee MOKS video-, heli- ja tegevuskunstiprogrammi "Põhi silmab kagu"...

    Index Scriptorium Estoniae

    2003-01-01

    Esinesid MOKSiga seotud kunstnikud ja rühmitused: John Grzinich, OPA: Slobodanka Stevceska, Denis Saraginovski (Obsessive Possessive Aggression, Makedoonia), Kaarel Vulla, Irene Roos, Jane Remm, OMP: maalikunstnikud Maris Palgi, Eva Orav ja ajakirjanik Maia Möller, Pink Punk: Kristin Kalamees, Margus Tamm, Sandra Jõgeva

  10. Affirmative Action on the Docket. Commentary

    Science.gov (United States)

    Chambers, Crystal

    2012-01-01

    In signing off the majority opinion in "Grutter v. Bollinger," Justice Sandra Day O'Connor opined, "That 25 years from now, the use of racial preferences will no longer be necessary to further the interest approved today" (2003, p. 342). The Supreme Court's acceptance of "Fisher v. University of Texas," however, may signal an end to affirmative…

  11. 77 FR 63254 - Petition for Rulemaking Submitted by C-10 Research and Education Foundation, Inc.

    Science.gov (United States)

    2012-10-16

    ...) received a petition for rulemaking (PRM) dated November 24, 2008, filed by Ms. Sandra Gavutis, Executive... NRC and assigned Docket No. PRM-72-6. The petitioner requests that the NRC amend its regulations... inform the public of the Commission's decision for these two requests. The docket for this PRM...

  12. Hullumeelsus : peatage maailm, tahan maha minna / Maria Juur

    Index Scriptorium Estoniae

    Juur, Maria

    2008-01-01

    EKA fotomagistrantide näitus "Hullumeelsus" Eesti Kaasaegse Kunsti Muuseumis 18.06-13.07.2008. Kunstnikud: Vincent Chevillon, Liina Guiter, Laura Kuusk, Helen Melesk, Marge Monko, Berit Teeäär, Tanja Muravskaja, Anna-Stina Treumund, Sandra Urvak, Reimo Võsa-Tangsoo. Kuraator Denes Farkas

  13. El tamaño del daño

    Directory of Open Access Journals (Sweden)

    José Eduardo Rueda Enciso

    2000-01-01

    Full Text Available Chajeradó, el río de la caña flecha partida. Luz Marcela Duque, Iván Darío Espinosa, Afda Cecilia Gálvez, Diego Herrera y Sandra María Turbay. Premios Nacionales Colcultura 1996, Colcultura, Bogotá, 1997, 477 págs.

  14. Dirty Fighting: How to Counter Total Warfare Mentality

    Science.gov (United States)

    2015-06-12

    DIRTY FIGHTING: HOW TO COUNTER TOTAL WARFARE MENTALITY A thesis presented to the Faculty of the U.S. Army Command and...to Counter Total Warfare Mentality Approved by: , Thesis Committee Chair LTC Sandra J. Sanchez, MBA , Member Marlyn R. Pierce...

  15. Exhibition

    CERN Multimedia

    Staff Association

    2016-01-01

    COLORATION Sandra Duchêne From September 5 to 16, 2016 CERN Meyrin, Main Building La recherche de l’Universel. Après tout ! C’est de l’Amour ! What else to say ? …La couleur, l’ENERGIE de la vie…

  16. A Coordinated Approach to Raising the Socio-Economic Status of Latinos in California.

    Science.gov (United States)

    Lopez, Elias, Ed.; Puddefoot, Ginny, Ed.; Gandara, Patricia, Ed.

    This report presents a collection of papers that focuses on a coordinated approach to raising the socioeconomic status of Hispanic Americans living in California. After presenting "The Need for a Coordinated Approach," the papers are: "Preschool Access" (Theresa Garcia, Sandra Gutierrez, and Giovanna Stark); "K-12…

  17. 78 FR 52517 - Membership of the Performance Review Board

    Science.gov (United States)

    2013-08-23

    ... McGrath, Elizabeth Baker, James McKenzie, Donald Baker, Timothy Middleton, Allen Bennett, David... Haendel, Dan Reheuser, Michael Hollis, Caryn Richardson, Sandra Janicki Jr, Frederick Rivera, Alfred Knight, Edna Rockey, Maryann Knodell, James Sayre, Richard Koffsky, Paul Schleien, Steven Kosak,...

  18. INVESTIGATION OF SERUM MICROCYSTIN CONCENTRATIONS AMONG DIALYSIS PATIENTS, BRAZIL, 1996

    Science.gov (United States)

    Investigation of Serum Microcystin Concentrations Among Dialysis Patients, Brazil, 1996Elizabeth D. Hilborn 1, Wayne W. Carmichael 2, Sandra M.F.O. Azevedo 31- USEPA/ORD/NHEERL, Research Triangle Park, NC2- Wright State University, Dayton, OH3- Federal Univers...

  19. Fungal treatment of lignocellulosic biomass

    NARCIS (Netherlands)

    Kuijk, van S.J.A.

    2016-01-01

    Summary PhD thesis Sandra J.A. van Kuijk Carbohydrates in plant cell walls are highly fermentable and could be used as a source for ruminant nutrition or biofuel production. The presence of lignin in cell walls hampers the utilization of these carbohydrates and should thus be

  20. Seks-market ili rabstvo? / Ilja Sundelevitsh

    Index Scriptorium Estoniae

    Sundelevitsh, Ilja

    2007-01-01

    Rahvusvaheline kunstinäitus "Kehaturg" Tallinna Kunstihoones. Kuraator Reet Varblane. Teemaks prostitutsioon. Sandra Jõgeva ava-performance'ist, Shula Kesheti ja Tatjana Antoshina töödest ning pseudonüümi Foxy Haze (Liina Siib?) all esineva eesti videokunstniku uurimus-videost. Värvilised illustratsioonid

  1. Los recuerdos del profesor Góez

    Directory of Open Access Journals (Sweden)

    Ovidio Delgado Mahecha

    2014-03-01

    Full Text Available Álbum fotográfico. Expedición Bolinder-Góez, 1935. Nicolás Naranjo, Carolina Maldonado y Sandra Turbay (prólogo y notas Fondo Editorial Universidad Eafit, Medellín, 2012, 112 págs., 105 fotografías.

  2. Modelos de ejecución experta como recursos instruccionales en la enseñanza de la comprensión de lectura en inglés para estudiantes universitarios /

    OpenAIRE

    García Jurado Velarde, Raquel Guadalupe sustentante.

    2009-01-01

     tesis que para obtener el grado de Doctor en Psicología, presenta Raquel Guadalupe García Jurado Velarde ; asesor Sandra Castañeda Figueiras. 163, [79] páginas : ilustraciones. Doctorado en Psicología UNAM, Facultad de Psicología, 2009

  3. Incorporating Feminist Standpoint Theory

    DEFF Research Database (Denmark)

    Ahlström, Kristoffer

    2005-01-01

    As has been noted by Alvin Goldman, there are some very interesting similarities between his Veritistic Social Epistemology (VSE) and Sandra Harding’s Feminist Standpoint Theory (FST). In the present paper, it is argued that these similarities are so significant as to motivate an incorporation...

  4. Microbial ecology at the International Space Station : the use of rapid and easy molecular methods for the quantitative detection of bacteria

    NARCIS (Netherlands)

    van Tongeren, Sandra P.

    2011-01-01

    Bij lange, bemande ruimtemissies, bijvoorbeeld naar Mars, kan gevaar schuilen in de kleinste hoekjes. Dat blijkt uit het promotieonderzoek van Sandra van Tongeren. Zij stelt onder meer vast dat al bij kortdurende ruimtemissies opmerkelijke veranderingen optreden in de hoeveelheden en soorten micro-o

  5. Kaitstud magistritööd, 1. juuni 2012

    Index Scriptorium Estoniae

    2013-01-01

    Oma töid kaitsesid Claudio Julio Rodriguez Higuera, Davi William Ferreira Gomes, Karlina Vaivade, Mohamed Gamal Abdelmeged Elmaayergy, Sigita Tamošauskaite, Eduardo Chávez Herrera, Tyler James Bennett, Felipe Cuervo Restrepo, Julia Popova, Anastasiia Sidielnik, Thomas Mark Boyle, Mirjam Männik, Sandra Preiman, Tamara Stojanovic

  6. Neoliberalism and the Battle over Ethnic Studies in Arizona

    Science.gov (United States)

    Soto, Sandra K.; Joseph, Miranda

    2010-01-01

    On May 14, 2010, Sandra K. Soto was the faculty convocation speaker for the University of Arizona College of Social and Behavioral Sciences. To a significant extent, she congratulated the parents and graduates and flattered the graduates by crediting them with having learned both skills and information, and urging graduates to make use of their…

  7. Area Handbook Series: Finland: A Country Study

    Science.gov (United States)

    1988-12-01

    Peggy Pixley. David P. Cabitto, who was assisted by Sandra K. Cotugno and Kimberly A. Lord, provided invaluable graphics support. Stan- ley M. Sciora...Right Wing in Finland (Rus- sian and East European Series, 22.). Bloomington: Indiana University Press, 1962. Runeberg, Carl Michael. Finlands Historia

  8. Viin! / Karen Jagodin

    Index Scriptorium Estoniae

    Jagodin, Karen, 1982-

    2006-01-01

    Näitused austria kaasaegsest arhitektuurist Eesti Arhitektuurimuuseumis kuni 21. V: "Viin: linnaehitus ja uusim arhitektuur" suures saalis (kuraator Leopold Dungl), kaasneb kataloog; "Elamuehitus Viinis: arhitektuur igaühele" galeriil (näituse idee: Wolfgang Förster, Dietmar Steiner, Alexandra Viehhauser, kuraator A. Viehhauser, kujundus - Span-Arhitektid: Matias del Campo, Sandra Manninger, Sebastian Michalski)

  9. Fiftieth Anniversary at the summit : neither fear of heights nor the cold succeeded in cooling the ardour of four brave climbers from CERN who celebrated CERN's 50th Anniversary at the summit of Mount Kilimanjaro (5,895 metres).

    CERN Multimedia

    2005-01-01

    On the way back from the summit, Miguel Cerqueira Bastos (AB/PO), David Collados Polidura (IT/GM), Sandra Sequeira Tavares (PH/CMI) and Daniel Cano Ott (n_TOF) raised the official CERN Jubilee flag at 4750 metres altitude.

  10. Biopolítica, Gobierno y Salud Pública. Miradas para un diagnóstico diferencial, de Tuillang Yuing y Rodrigo Karmy

    Directory of Open Access Journals (Sweden)

    Adán Salinas Araya

    2015-05-01

    Full Text Available Tuillang Yuing y Rodrigo Karmy (editores.Participan: Rodrigo Karmy, Philippe Monti, Mariela Cecilia Ávila, Tuillang Yuing, Miguel Kotow, Jimena Carrasco, Sandra Caponi,  Luis David Castiel, Yuri Carvajal, Jorge Gaete.Escuela de Salud Pública- Ocho Libros EdicionesOctubre 2014, 206 pp.ISBN: 978-956-335-213-9

  11. Seks-market ili rabstvo? / Ilja Sundelevitsh

    Index Scriptorium Estoniae

    Sundelevitsh, Ilja

    2007-01-01

    Rahvusvaheline kunstinäitus "Kehaturg" Tallinna Kunstihoones. Kuraator Reet Varblane. Teemaks prostitutsioon. Sandra Jõgeva ava-performance'ist, Shula Kesheti ja Tatjana Antoshina töödest ning pseudonüümi Foxy Haze (Liina Siib?) all esineva eesti videokunstniku uurimus-videost. Värvilised illustratsioonid

  12. "Woman Hollering Creek" a Traves de la Musica: Articulating Mexicanidad to Pochismo

    Science.gov (United States)

    French, Lydia A.

    2011-01-01

    This essay intervenes in contemporary scholarship on Sandra Cisneros's "Woman Hollering Creek" (1991) by examining the canciones she uses as epigraphs and their relationship to the multiple nationalisms that Chicana/os actively negotiate. I argue that Cisneros's decision to include powerfully nationalist Mexican cancion traditions…

  13. Common STAT3 variants are not associated with obesity or insulin resistance in female twins

    NARCIS (Netherlands)

    Jamshidi, Yalda; Kyriakou, Theodosios; Gooljar, Sakina B.; Collins, Laura J.; Lane, Carl A.; Snieder, Harold; Wang, Xiaoling; Spector, Tim D.; O'Dell, Sandra D.

    JAMSHIDI, YALDA, THEODOSIOS KYRIAKOU, SAKINA B. GOOLJAR, LAURA J. COLLINS, CARL A. LANE, HAROLD SNIEDER, XIAOLING WANG, TIM D. SPECTOR, AND SANDRA D. O'DELL. Common STAT3 variants are not associated with obesity or insulin resistance in female twins. Obesity. 2007; 15:1634-1639. In animal models,

  14. Сенат Франции празднует двадцатилетие Балтийского пути / Наталья Семёнова

    Index Scriptorium Estoniae

    Семёнова, Наталья

    2009-01-01

    Prantsusmaa senatis tähistati Balti keti aastapäeva. Vastavast seminarist võtsid osa ka Mart Laar, Ene Ergma, Sandra Kalniete, Vytautas Landsbergis, Gundars Daudze, Vygaudas Ušackas, Irena Degutiene ja Denis Badre. Mart Laari vastus küsimusele Eesti-Vene suhetest

  15. Hullumeelsus : peatage maailm, tahan maha minna / Maria Juur

    Index Scriptorium Estoniae

    Juur, Maria

    2008-01-01

    EKA fotomagistrantide näitus "Hullumeelsus" Eesti Kaasaegse Kunsti Muuseumis 18.06-13.07.2008. Kunstnikud: Vincent Chevillon, Liina Guiter, Laura Kuusk, Helen Melesk, Marge Monko, Berit Teeäär, Tanja Muravskaja, Anna-Stina Treumund, Sandra Urvak, Reimo Võsa-Tangsoo. Kuraator Denes Farkas

  16. Poliitiline sõnum ja igapäevaelu / Grete Nootre

    Index Scriptorium Estoniae

    Nootre, Grete

    2006-01-01

    56. Berliini filmifestivali auhinnasaajad - Jasmila Zhbavici film "Grbavica", Michael Winterbottom ja Mat Whitecross filmi eest "Teekond Guatanamosse" ("The Road to Guantanamo"), Pernille Fischer Christensen filmi "Seep" eest ja Jafar Panahi filmi "Suluseis" eest. Parimad näitlejad olid Sandra Hüller ja Moritz Bleibtreu

  17. Vse galerei otdanõ fotografii / Ilja Sundelevitsh

    Index Scriptorium Estoniae

    Sundelevitsh, Ilja

    2002-01-01

    Muljeid fotonäitustelt Tallinnas: Sandra Jõgeva ja Margus Tamme fotolavastused Linnagaleriis, Eleonore de Montesquiou tööd Kunstihoone galeriis, soome fotograafide Markku Lötjöneni ja Iris Simoni (?) "Pulp Fiction" Kiek in de Kökis, 21 eesti fotograafi Vaalas, Margot Kase "Taevased ja maised aiad" Kastellaanimaja galeriis

  18. Biopolítica, Gobierno y Salud Pública. Miradas para un diagnóstico diferencial de Tuillang Yuing y Rodrigo Karmy

    OpenAIRE

    Adán Salinas Araya

    2015-01-01

    Tuillang Yuing y Rodrigo Karmy (editores).Participan: Rodrigo Karmy, Philippe Monti, Mariela Cecilia Ávila, Tuillang Yuing, Miguel Kotow, Jimena Carrasco, Sandra Caponi,  Luis David Castiel, Yuri Carvajal, Jorge Gaete.Escuela de Salud Pública- Ocho Libros EdicionesOctubre 2014, 206 pp.ISBN: 978-956-335-213-9

  19. Eesti harrastusfilm võitis esikoha

    Index Scriptorium Estoniae

    2007-01-01

    Tallinna V rahvusvahelise amatöörfilmide festivali peaauhind jagunes nelja filmi vahel, millest üks oli Eesti "Elevanti nägema" (tegijad Sandra Dürdorth, Maureen Apel, Kalev Saar, Leon Shamis). Teised võitjad olid Austria (2 filmi) ja Soome

  20. Valgussähvatused saalipimedusest / Katrin Rajasaare

    Index Scriptorium Estoniae

    Rajasaare, Katrin

    2002-01-01

    6. Pimedate Ööde Festivali filmidest : "Puur" ("La Cage"), režissöör Alain Raoust : Prantsusmaa 2002, "Kuuvalgel" ("Kuutamolla"), režissöör Aku Louhimies : Soome 2001, "Kaunis Martha" ("Bella Martha"), režissöör Sandra Nettelbeck : Saksamaa 2001

  1. WebDocumentary - cityanimals.dk

    DEFF Research Database (Denmark)

    Møhl, Perle

    2013-01-01

    An interactive WebDocumentary in 27 vignettes, about humans and other animals in Copenhagen (interspecies anthropology), created by Perle Møhl and her students on the 2013 courses in Visual Anthropology in Practice, with contributions from Sandra Lori Petersen's students in radio/sound....

  2. Tiit Land: Anname panuse Alzheimeri tõve võimalikuks raviks / Kristel Toom

    Index Scriptorium Estoniae

    Toom, Kristel

    2008-01-01

    Tallinna Ülikooli Matemaatika ja Loodusteaduste Instituudis töötab uurimisrühm, kelle huvi on seotud organismis toimuva raua ainevahetuse ning selle häirete tagajärjel ilmnevate haiguslike protsessidega, mille hulka kuulub ka Alzheimeri tõbi. Teadusprojekte juhivad Tiit Land ja Sandra Zetterström Fernaeus

  3. 27. V kell 16 avatakse Niguliste kirikus...

    Index Scriptorium Estoniae

    2002-01-01

    EKA interdistsiplinaarsete kunstide eriala magistritööde näitus "Nagu aamen kirikus". Eksponeeritud Kristin Kalamehe lühimängufilm "Igavene tuli", Mirja-Mari Smidti video ja maaliseeria "Kaaluta olek", Allan Tõnissoo videoskulptuur "Kristus", Avangardi (Sandra Jõgeva, Margus Tamm) fotoseeria ja video "Sõda ja rahu". Avamisel Avangardi performance

  4. Tiit Land: Anname panuse Alzheimeri tõve võimalikuks raviks / Kristel Toom

    Index Scriptorium Estoniae

    Toom, Kristel

    2008-01-01

    Tallinna Ülikooli Matemaatika ja Loodusteaduste Instituudis töötab uurimisrühm, kelle huvi on seotud organismis toimuva raua ainevahetuse ning selle häirete tagajärjel ilmnevate haiguslike protsessidega, mille hulka kuulub ka Alzheimeri tõbi. Teadusprojekte juhivad Tiit Land ja Sandra Zetterström Fernaeus

  5. "Woman Hollering Creek" a Traves de la Musica: Articulating Mexicanidad to Pochismo

    Science.gov (United States)

    French, Lydia A.

    2011-01-01

    This essay intervenes in contemporary scholarship on Sandra Cisneros's "Woman Hollering Creek" (1991) by examining the canciones she uses as epigraphs and their relationship to the multiple nationalisms that Chicana/os actively negotiate. I argue that Cisneros's decision to include powerfully nationalist Mexican cancion traditions…

  6. STS-112 M.S. Magnus suits up for launch

    Science.gov (United States)

    2002-01-01

    KENNEDY SPACE CENTER, FLA. --STS-112 Mission Specialist Sandra Magnus dons her space helmet for a final fit check in preparation for her launch to the International Space Station aboard Atlantis. Launch is scheduled for Oct. 2 between 2 and 6 p.m. EDT.

  7. Race, Income, and College in 25 Years: Evaluating Justice O'Connor's Conjecture. Center for Studies in Higher Education, Research & Occasional Paper Series: CSHE.19.06

    Science.gov (United States)

    Krueger, Alan; Rothstein, Jesse; Turner, Sarah

    2006-01-01

    In Grutter v. Bollinger (2003), Justice Sandra Day O'Connor conjectured that in 25 years affirmative action in college admissions will be unnecessary. We project the test score distribution of black and white college applicants 25 years from now, focusing on the role of black-white family income gaps. Economic progress alone is unlikely to narrow…

  8. Figurative Language Represented in Art

    Science.gov (United States)

    Wallach, Michele

    2009-01-01

    In the test-driven society in which teachers teach, many art teachers are encouraged to create interdisciplinary units that fuse art with reading and writing. In this article, the author presents a unit which fosters appreciation of Sandra Cisneros' writing and encourages students to portray her words in their own three-dimensional designs.…

  9. A Continuation of the Dialogue on Issues in Counseling in the Postmodern Era.

    Science.gov (United States)

    Ellis, Albert

    2000-01-01

    This is a continuation of the dialogue among Albert Ellis, Jeffrey T. Guterman, Earl Ginter, Sandra A. Rigazio-DiGilio, Allen E. Ivey, and Don C. Locke that has been appearing in the Journal of Mental Health Counseling on ethical issues of counseling in the postmodern era. Specifically addresses the ethical, constructivist, multicultural, and…

  10. 短文二则

    Institute of Scientific and Technical Information of China (English)

    郭玉芝

    2011-01-01

    Sandra Cisneros was born in Chicago in 1954 in a Mexican American family. As the only girl in a family of seven children, she often felt like she had "seven fathers", because her six brothers, as well as her father, tried to control her. Feeling shy and unimportant ,

  11. NG Kunstikonteiner alustab kirjandusega

    Index Scriptorium Estoniae

    2008-01-01

    Kunstnik Sandra Jõgeva korraldab Tallinnas kultuuritehases Polymer alternatiivgaleriis Non Grata Kunstikonteiner kirjanduslike kohtumiste seeria "Üks hullem kui teine". Kirjandusüritused ei ole mõeldud ainult oma ala insider'itele. 17. juulil esinevad Armin Kõomägi teemal "Kirjandus ja äri", Andrus Elbing "Vangla sinus eneses" jt. Vt. ka Looming, 2008, nr. 8, lk. 1271

  12. Globaalne konteiner, järjekorranumbriga 8 / Maarin Mürk

    Index Scriptorium Estoniae

    Mürk, Maarin

    2009-01-01

    Kunstikonteineri rahvusvaheline kunsti- ja performance'iüritus "Global Container 8" 27. augustil kultuuritehases Polymer. Justin Tyler Tate'i, Auseklis/Usinsi ja Sandra Jõgeva esinemisest. Tom Russotti ja Ernest Truely ürituse kohta valminud dokumentaalist. Simon B. Haefele vestlusringist teemal "Kunsti võim"

  13. Tudengite hea esinemine Willem C. Vis'i nimelisel harjutuskohtuvõistlusel

    Index Scriptorium Estoniae

    2013-01-01

    XX Willem C. Vis’i nimelise rahvusvahelise kaubandusõiguse harjutuskohtuvõistlusel Viinis saavutas Tartu Ülikooli õigusteaduskonna võistkond (Kristina Promet, Jaana Lints, Edgar-Kaj Velbri ja Sandra-Kristin Noot) 290 ülikooli seast 84. koha

  14. Microbial ecology at the International Space Station : the use of rapid and easy molecular methods for the quantitative detection of bacteria

    NARCIS (Netherlands)

    van Tongeren, Sandra P.

    2011-01-01

    Bij lange, bemande ruimtemissies, bijvoorbeeld naar Mars, kan gevaar schuilen in de kleinste hoekjes. Dat blijkt uit het promotieonderzoek van Sandra van Tongeren. Zij stelt onder meer vast dat al bij kortdurende ruimtemissies opmerkelijke veranderingen optreden in de hoeveelheden en soorten

  15. Female Role Models: Implications for Leadership.

    Science.gov (United States)

    Daniels, Roberta R.

    1995-01-01

    The lives of six prominent female leaders (Sandra Day O'Connor, Maya Angelou, Wilma Mankiller, Hillary Rodham Clinton, Elizabeth Dole, and Mary Kay Ash) are summarized. Similarities are noted and questions and activities provided to encourage discussion by teachers and students. (DB)

  16. The Struggle for Self-Identity-Analysis on The House on Mango Street

    Institute of Scientific and Technical Information of China (English)

    张静

    2014-01-01

    Sandra Cisneros is a distinguished Chicano and Latina writer whose novel entitled The House on Mango Street focuses on identity construction. The paper will interpret Esperanza’s struggle for self-identity in the process of her growth both physi⁃cally and psychologically.

  17. A New Old Age Home

    Institute of Scientific and Technical Information of China (English)

    吴伟

    2004-01-01

    @@ Sandra: I just read an artiele in today's newspaper that said there's going to be an old age home built in town. David: I think theyre just terrible. I don't know why anybody would put their parents in one of those.

  18. Vse galerei otdanõ fotografii / Ilja Sundelevitsh

    Index Scriptorium Estoniae

    Sundelevitsh, Ilja

    2002-01-01

    Muljeid fotonäitustelt Tallinnas: Sandra Jõgeva ja Margus Tamme fotolavastused Linnagaleriis, Eleonore de Montesquiou tööd Kunstihoone galeriis, soome fotograafide Markku Lötjöneni ja Iris Simoni (?) "Pulp Fiction" Kiek in de Kökis, 21 eesti fotograafi Vaalas, Margot Kase "Taevased ja maised aiad" Kastellaanimaja galeriis

  19. Introducing Bruner: A Guide for Practitioners and Students in Early Years Education

    Science.gov (United States)

    Smidt, Sandra

    2011-01-01

    Sandra Smidt takes the reader on a journey through the key concepts of Jerome Bruner, a significant figure in the field of early education whose work has spanned almost a century. His wide-ranging and innovative principles of early learning and teaching are unpicked here using everyday language and the links between his ideas and those of other…

  20. Science.gov (United States)

    1995-10-25

    Freemason Douglas Beattie (above) failed to become council chair at last week's meeting. He was defeated by 14 votes to nine by Pat Hughes. Sandra James was elected vice-chair and Jim McAllister was elected unopposed as honorary treasurer of the college.

  1. Kunst viib saunakultuuri maakera kuklapoolele

    Index Scriptorium Estoniae

    2010-01-01

    Kultuuritehases Polymer tegutsev Art Container tutvustab Austraalias Brisbane'i festivalil eesti saunakultuuri. Eksponeeritakse arhitektuurilist installatsiooni (kasutatud akendest ehitatud läbipaistev saun) ja esitatakse interaktiivset performance'it "Kümblejad". Töö autorid on Erik Alalooga, Tanel Saar, Sandra Jõgeva, Janno Bergmann, Hans-Gunter Lock

  2. Globaalne konteiner, järjekorranumbriga 8 / Maarin Mürk

    Index Scriptorium Estoniae

    Mürk, Maarin

    2009-01-01

    Kunstikonteineri rahvusvaheline kunsti- ja performance'iüritus "Global Container 8" 27. augustil kultuuritehases Polymer. Justin Tyler Tate'i, Auseklis/Usinsi ja Sandra Jõgeva esinemisest. Tom Russotti ja Ernest Truely ürituse kohta valminud dokumentaalist. Simon B. Haefele vestlusringist teemal "Kunsti võim"

  3. NG Kunstikonteiner alustab kirjandusega

    Index Scriptorium Estoniae

    2008-01-01

    Kunstnik Sandra Jõgeva korraldab Tallinnas kultuuritehases Polymer alternatiivgaleriis Non Grata Kunstikonteiner kirjanduslike kohtumiste seeria "Üks hullem kui teine". Kirjandusüritused ei ole mõeldud ainult oma ala insider'itele. 17. juulil esinevad Armin Kõomägi teemal "Kirjandus ja äri", Andrus Elbing "Vangla sinus eneses" jt. Vt. ka Looming, 2008, nr. 8, lk. 1271

  4. :Lessons for practitioners in Nigeria

    African Journals Online (AJOL)

    TNHJOURNALPH

    Page 2. Risk Assessment in the Prevention of Cardiovascular Disease- Sandra N Ofori, Osaretin ... identifying his/her risk factors, some of which ... derived from middle class white Americans in ... status), diabetes, and current smoking status. ... the substitution of BMI for cholesterol in the .... The cut-point for intervention is.

  5. "In graafika" + PNP = futurism / Siram

    Index Scriptorium Estoniae

    Siram, pseud., 1968-

    2011-01-01

    8. jaan.-l avati Pärnus rahvusvaheline "In graafika" festival ja Pärnu nüüdismuusika päevad "Futurism". Kunstinäitustest, pikemalt Albert Gulgi, Raul Meele ning Marian Kivila, Sandra Vellevoogi ja Ville-Karel Viirelaiu väljapanekutest, Taje Trossi installatsioonist "Eksperimentaalne instrumentaarium"

  6. 78 FR 72095 - Announcement of Funding Awards for Fiscal Year 2013 Research Partnerships Program

    Science.gov (United States)

    2013-12-02

    ... Grant Amount Region I 1. Middlebury College, ``High Cost of Lending in Rural America and the Great.... Grant Award: $100,000. Region III 5. Urban Institute, ``Mining MTO: Housing Assistance Leavers and... Housing on Young Children.'' Dr. Sandra Newman, Principal Investigator, 615 North Wolfe Street,...

  7. Valgussähvatused saalipimedusest / Katrin Rajasaare

    Index Scriptorium Estoniae

    Rajasaare, Katrin

    2002-01-01

    6. Pimedate Ööde Festivali filmidest : "Puur" ("La Cage"), režissöör Alain Raoust : Prantsusmaa 2002, "Kuuvalgel" ("Kuutamolla"), režissöör Aku Louhimies : Soome 2001, "Kaunis Martha" ("Bella Martha"), režissöör Sandra Nettelbeck : Saksamaa 2001

  8. An Analysis of Proposed Alternatives to the Defense Technical Information Center’s Announcement Products and Services

    Science.gov (United States)

    1985-10-01

    from NTIS," Library Journal , CX, No. 1 (1985): 29. "National Library of Medicine Offers Subsets of MEDLINE," Online Review, VIII, No. 6 (1984...Sandra Young - Defense Nuclear Agency - 25 Jan 85 -41- BIBLIOGRAPHY "Data tiles on floppies coming soon from NT1S." Library Journal , CX, No. 1 (1985

  9. Muusika / Aimar Ventsel

    Index Scriptorium Estoniae

    Ventsel, Aimar, 1970-

    2005-01-01

    Uutest heliplaatidest "Sandra Sillamaa", "The Concretes", The Juan Maclean "Less Than Human", Joni Mitchell "Songs Of A Prairie Girl", Pedegree "Growing Apart", Shelton San "EP", The Five Corners Quintet "Chasin' The Jazz Gone By", "The Story of Popular Black Music", Foo Fighters "In Your Honor", A "Teen Dance Ordinance"

  10. Outplacement--who needs it?

    Science.gov (United States)

    Naiman, S

    1990-01-01

    In this article, Sandra Naiman writes from the employer's point of view on why and how outplacement counseling should be provided to the terminated employee. She also describes what services should be provided and how to choose the right outplacement firm.

  11. Kunst viib saunakultuuri maakera kuklapoolele

    Index Scriptorium Estoniae

    2010-01-01

    Kultuuritehases Polymer tegutsev Art Container tutvustab Austraalias Brisbane'i festivalil eesti saunakultuuri. Eksponeeritakse arhitektuurilist installatsiooni (kasutatud akendest ehitatud läbipaistev saun) ja esitatakse interaktiivset performance'it "Kümblejad". Töö autorid on Erik Alalooga, Tanel Saar, Sandra Jõgeva, Janno Bergmann, Hans-Gunter Lock

  12. Proceedings of the Annual Meeting of the Association for Education in Journalism and Mass Communication (80th, Chicago, Illinois, July 30-August 2, 1997): Mass Communication and Society.

    Science.gov (United States)

    Association for Education in Journalism and Mass Communication.

    The Mass Communication and Society section of the Proceedings contains the following 11 papers: "A Cynical Press: Coverage of the 1996 Presidential Campaign" (Sandra H. Dickson, Cynthia Hill, Cara Pilson, and Suzanne Hanners); "JMC Faculty Divided: Majority Finds Dozen Uses for Research" (Fred Fedler, Maria Cristina Santana,…

  13. Poliitiline sõnum ja igapäevaelu / Grete Nootre

    Index Scriptorium Estoniae

    Nootre, Grete

    2006-01-01

    56. Berliini filmifestivali auhinnasaajad - Jasmila Zhbavici film "Grbavica", Michael Winterbottom ja Mat Whitecross filmi eest "Teekond Guatanamosse" ("The Road to Guantanamo"), Pernille Fischer Christensen filmi "Seep" eest ja Jafar Panahi filmi "Suluseis" eest. Parimad näitlejad olid Sandra Hüller ja Moritz Bleibtreu

  14. Kolga koolis andsid tunde hiinlased / Ülle Tamm

    Index Scriptorium Estoniae

    Tamm, Ülle

    2016-01-01

    Tallinna Ülikooli Konfutsiuse Instituudi neli õppejõudu - Zhuoya Wu, Xiuping Huang, Sandra Sainio ja Kristiina Kraft viisid Kolga koolis toimunud Hiina päeval läbi töötubasid ja loenguid hiina keelest ja kultuurist

  15. Hotelli Radisson SAS mantra : jah, ma saan! / Kai Vare

    Index Scriptorium Estoniae

    Vare, Kai, 1968-

    2004-01-01

    Radisson SAS hotell Tallinnas on kliendirahulolu-uuringute järgi keti hotellide seas esimeste hulgas. Hotelli direktor Kaido Ojaperv ja müügijuht Ann-Kai Tõrs Radisson SAS-i standarditest, kliendi sajaprotsendilise rahulolu tagamise põhimõtetest, personali valikust, koolitusest. Kommenteerib Sandra Dimitrovich

  16. 27. XI esitles Kanuti gildi saalis Mooste avatud ateljee MOKS video-, heli- ja tegevuskunstiprogrammi "Põhi silmab kagu"...

    Index Scriptorium Estoniae

    2003-01-01

    Esinesid MOKSiga seotud kunstnikud ja rühmitused: John Grzinich, OPA: Slobodanka Stevceska, Denis Saraginovski (Obsessive Possessive Aggression, Makedoonia), Kaarel Vulla, Irene Roos, Jane Remm, OMP: maalikunstnikud Maris Palgi, Eva Orav ja ajakirjanik Maia Möller, Pink Punk: Kristin Kalamees, Margus Tamm, Sandra Jõgeva

  17. Introducing Bruner: A Guide for Practitioners and Students in Early Years Education

    Science.gov (United States)

    Smidt, Sandra

    2011-01-01

    Sandra Smidt takes the reader on a journey through the key concepts of Jerome Bruner, a significant figure in the field of early education whose work has spanned almost a century. His wide-ranging and innovative principles of early learning and teaching are unpicked here using everyday language and the links between his ideas and those of other…

  18. Fungal treatment of lignocellulosic biomass

    NARCIS (Netherlands)

    Kuijk, van S.J.A.

    2016-01-01

    Summary PhD thesis Sandra J.A. van Kuijk Carbohydrates in plant cell walls are highly fermentable and could be used as a source for ruminant nutrition or biofuel production. The presence of lignin in cell walls hampers the utilization of these carbohydrates and should thus be remove

  19. Kaitstud magistritööd, 1. juuni 2012

    Index Scriptorium Estoniae

    2013-01-01

    Oma töid kaitsesid Claudio Julio Rodriguez Higuera, Davi William Ferreira Gomes, Karlina Vaivade, Mohamed Gamal Abdelmeged Elmaayergy, Sigita Tamošauskaite, Eduardo Chávez Herrera, Tyler James Bennett, Felipe Cuervo Restrepo, Julia Popova, Anastasiia Sidielnik, Thomas Mark Boyle, Mirjam Männik, Sandra Preiman, Tamara Stojanovic

  20. 75 FR 16894 - Advisory Committee on International Economic Policy; Notice of Open Meeting

    Science.gov (United States)

    2010-04-02

    .... Government ID , U.S. military ID , passport , or drivers license ), date of birth, and citizenship to Sherry... Nancy Smith- Nissley, Office of Economic Policy Analysis and Public Diplomacy, Bureau of Economic.... Sandra E. Clark, Office Director, Office of Economic Policy Analysis and Public Diplomacy, U.S...

  1. Supreme Court Roundup

    Science.gov (United States)

    Williams, Charles F.

    2005-01-01

    Reactions to the retirement of Justice Sandra Day O'Connor and debate over the president's replacement nomination, Judge John Roberts, Jr., of the D.C. Circuit, dominated this summer's Supreme Court recess. Subsequently, after Chief Justice William H. Rehnquist's death on September 3, 2005, President Bush nominated Roberts for the chief justice…

  2. Female Role Models: Implications for Leadership.

    Science.gov (United States)

    Daniels, Roberta R.

    1995-01-01

    The lives of six prominent female leaders (Sandra Day O'Connor, Maya Angelou, Wilma Mankiller, Hillary Rodham Clinton, Elizabeth Dole, and Mary Kay Ash) are summarized. Similarities are noted and questions and activities provided to encourage discussion by teachers and students. (DB)

  3. Test plan for evaluation of plasma melter technology for vitrification of high-sodium content low-level radioactive liquid wastes

    Energy Technology Data Exchange (ETDEWEB)

    McLaughlin, D.F.; Lahoda, E.J.; Gass, W.R.; D`Amico, N. [ed.

    1994-10-20

    This document provides a test plan for the conduct of plasma arc vitrification testing by a vendor in support of the Hanford Tank Waste Remediation System (TWRS) Low-Level Waste (LLW) Vitrification Program. The vendor providing this test plan and conducting the work detailed within it [one of seven selected for glass melter testing under Purchase Order MMI-SVV-384212] is the Westinghouse Science and Technology Center (WSTC) in Pittsburgh, PA. WSTC authors of the test plan are D. F. McLaughlin, E. J. Lahoda, W. R. Gass, and N. D`Amico. The WSTC Program Manager for this test is D. F. McLaughlin. This test plan is for Phase I activities described in the above Purchase Order. Test conduct includes melting of glass frit with Hanford LLW Double-Shell Slurry Feed waste simulant in a plasma arc fired furnace.

  4. Vibrational mode assignment of finite temperature infrared spectra using the AMOEBA polarizable force field.

    Science.gov (United States)

    Thaunay, Florian; Dognon, Jean-Pierre; Ohanessian, Gilles; Clavaguéra, Carine

    2015-10-21

    The calculation of infrared spectra by molecular dynamics simulations based on the AMOEBA polarizable force field has recently been demonstrated [Semrouni et al., J. Chem. Theory Comput., 2014, 10, 3190]. While this approach allows access to temperature and anharmonicity effects, band assignment requires additional tools, which we describe in this paper. The Driven Molecular Dynamics approach, originally developed by Bowman, Kaledin et al. [Bowman et al. J. Chem. Phys., 2003, 119, 646, Kaledin et al. J. Chem. Phys., 2004, 121, 5646] has been adapted and associated with AMOEBA. Its advantages and limitations are described. The IR spectrum of the Ac-Phe-Ala-NH2 model peptide is analyzed in detail. In addition to differentiation of conformations by reproducing frequency shifts due to non-covalent interactions, DMD allows visualizing the temperature-dependent vibrational modes.

  5. Volt-ampere characteristics of a nitrogen DC plasma arc with anode melting

    Institute of Scientific and Technical Information of China (English)

    Zhao Peng; Ni Guo-Hua; Meng Yue-Dong; Nagatsu Masaaki

    2013-01-01

    The characteristics of a nitrogen arc using a graphite cathode and a melting anode in a pilot-scale plasma furnace are investigated.The voltage is examined as a function of current and apparent plasma length.The voltage increases non-linearly with the increase of apparent plasma length,with the current fixed.The experimental data so obtained are compared with the predictions of the Bowman model for the electric arc,and with numerical simulations as well.The level of agreement between the experimental data at the melting anode and the numerical predictions confirms the suitability of the proposed the Bowman model.These characteristics are relevant to the engineering design and evaluation of a DC plasma furnace and reactor for the treatment of hazardous fly ash waste.

  6. Acanthamoeba castellanii: morphological analysis of the interaction with human cornea.

    Science.gov (United States)

    Omaña-Molina, Maritza; González-Robles, Arturo; Salazar-Villatoro, Lizbeth Iliana; Cristóbal-Ramos, Ana Ruth; González-Lázaro, Mónica; Salinas-Moreno, Edmundo; Méndez-Cruz, Rene; Sánchez-Cornejo, Manuel; De la Torre-González, Enrique; Martínez-Palomo, Adolfo

    2010-09-01

    The present study demonstrates that when Acanthamoeba castellanii trophozoites are co-cultivated with isolated human corneas, the amoeba can be invasive and cause damage to the intact corneal epithelium without the requirement of previous corneal abrasion. After adhesion, A. castellanii trophozoites migrate between cells forming bumps on the corneal cell layers and reaching Bowman s membrane in 3h, although no evidence of cell damage was observed until the phagocytic process was detected. Likewise, conditioned medium produced damage to the corneal cells that was proportional to the time of incubation, but this cytophatic effect involved only the most superficial layer of the human cornea and was not enough to explain amoebic invasion of Bowman s membrane. As a result of our observations, we suggest that the mechanical action of the trophozoites and phagocytosis of corneal cells during the process of corneal invasion are more important than previously suggested.

  7. Two-year follow-up of self-examination therapy for generalized anxiety disorder.

    Science.gov (United States)

    Floyd, Mark; McKendree-Smith, Nancy; Bailey, Elaine; Stump, Jamie; Scogin, Forrest; Bowman, Daniel

    2002-01-01

    This study examined the stability of treatment gains after receiving self-examination therapy (SET) [Bowman, D. (1995). Innovations in clinical practice: a source book. Professional Resource Press.] for generalized anxiety disorder. A 2-year follow-up of 16 participants from Bowman, Scogin, Floyd, Patton, and Gist [J. Counsel. Psychol. 44 (1997) 267] was conducted by comparing pre- and post-treatment measures with follow-up measures from the Hamilton Anxiety Rating Scale-Revised (HARS-R), the State-Trait Anxiety Inventory (STAI), and the SET quiz. Results indicated treatment gains from baseline to the 2-year follow-up period were maintained on all measures, and there was not a significant decline from post-treatment to follow-up on the HARS-R and STAI. These results suggest that SET for treatment of generalized anxiety disorder (GAD) may be effective in both the immediate and long-term reduction of GAD symptoms.

  8. Moment series for the coefficient of variation in Weibull sampling

    Energy Technology Data Exchange (ETDEWEB)

    Bowman, K.O.; Shenton, L.R.

    1981-01-01

    For the 2-parameter Weibull distribution function F(t) = 1 - exp(-t/b)/sup c/, t > 0, with c and b positive, a moment estimator c* for c is the solution of the equationGAMMA(1 + 2/c*)/GAMMA/sup 2/ (1 + 1/c*) = 1 + v*/sup 2/ where v* is the coefficient of variation in the form ..sqrt..m/sub 2//m/sub 1/', m/sub 1/' being the sample mean, m/sub 2/ the sample second central moment (it is trivial in the present context to replace m/sub 2/ by the variance). One approach to the moments of c* (Bowman and Shenton, 1981) is to set-up moment series for the scale-free v*. The series are apparently divergent and summation algorithms are essential; we consider methods due to Levin (1973) and one, introduced ourselves (Bowman and Shenton, 1976).

  9. Are Preexisting Retinal and Central Nervous System-Related Comorbidities Risk Factors for Complications Following Robotic-Assisted Laparoscopic Prostatectomy?

    Directory of Open Access Journals (Sweden)

    David Chalmers

    2015-08-01

    Full Text Available ABSTRACTPurpose:To assess whether retinal and central nervous system (CNS comorbidities are risk factors for complications following robotic assisted laparoscopic prostatectomy (RALP.Materials and Methods:A retrospective review of our RALP database identified 1868 patients who underwent RALP by a single surgeon between December 10, 2003-March 14, 2014. We hypothesized that patients with preexisting retinal or CNS comorbidities were at a greater risk of suffering retinal and CNS complications following RALP. Perioperative complications and risk of recurrence were graded using the Clavien and D'Amico systems, respectively.Results:40 (2.1% patients had retinal or CNS-related comorbidities, of which 15 had a history of retinal surgery and 24 had a history of cerebrovascular accident, aneurysm and/or neurosurgery. One additional patient had a history of both retinal and CNS events.Patients with retinal or CNS comorbidities were significantly older, had elevated PSA levels and CCI (Charlson Comorbidity Index scores than the control group. Blood loss, length of stay, surgical duration, BMI, diagnostic Gleason score and T-stage were not statistically different between groups.No retinal or CNS complications occurred in either group. The distribution of patients between D'Amico risk categories was not statistically different between the groups. There was also no difference in the incidence of total complications between the groups.Conclusions:RALP-associated retinal and CNS complications are rare. While our RALP database is large, the cohort of patients with retinal or CNS-related comorbidities was relatively small. Our dataset suggests retinal and CNS pathology presents no greater risk of suffering from perioperative complications following RALP.

  10. Hypertonic/Hyperoncotic Resuscitation from Shock: Reduced Volume Requirement and Lower Intracranial Pressure

    Science.gov (United States)

    1989-10-01

    Volume 15, No. 4 ABSTRACTS OF PAPERS 433 INTRACRANIAL PRESSURE FOLLOWING RESUSCITATION FROM HEMORRHAGIC SHOCK John H. Whitley, Donald S. Prough, Michael ...SHOCK: COMPARISON OF FLUIDS John M. Whitley, PhD, Michael A. Olympio, MD, Donald S. Prough, MD Department of Anesthesia, Bowman Gray School of Medicine...fluid infused within the range of sodium and colloid concentrations examined in this study. In contrast, Gunnar et al.7’ 2 and Ducey et al.,8

  11. Regeneration and Remodeling of Composite Materials

    Science.gov (United States)

    2015-08-27

    binary image (Figure 21a and 21b), overlaying a 30x30 cell grid (cell size ~200 µm x 200 µm, Figure 21c), and calculating cell concentrations of each...2011) 3536–3544. doi:10.1557/JMR.2001.0485. [64] J.A. Carioscia, H. Lu, J.W. Stanbury, C.N. Bowman, Thiol-ene oligomers as dental restorative materials

  12. KDAC8 with High Basal Velocity Is Not Activated by N-Acetylthioureas

    Science.gov (United States)

    2016-01-08

    proteins via a conserved mechanism.[1–3] This cycle of acetylation and deacetylation has been linked to many biological processes , including development...our standard method. To determine if this lack of activation was independent of our enzyme purification process , we performed the same experiments with...Identify Endogenous Substrates of “Histone” Deacetylase 8. ACS Chem Biol. 2014; 2014: 2210–2216. doi: 10.1021/cb500492r 21. Decroos C, Bowman CM, Moser J

  13. Guide to Rebuilding Governance in Stability Operations: A Role for the Military?

    Science.gov (United States)

    2009-06-01

    of Peace, Special Report No. 107, July 2003. Heinemann-Gruder, Andreas , and Igor Grebenschikov. “Security Governance by Internationals: The Case of...Bowman. “Police Reform Programs: Links to Post-Conflict Reconstruction and Social Stability in Violent and Fragile States.” In Cornwallis XI: Analysis...In Cornwallis XI: Analysis for Civil-Military Transitions, David Davis, Alexander Woodcock, and George Rose, eds., Clementsport, Nova Scotia

  14. Today@NPS / July 2016

    OpenAIRE

    NPS Public Affairs Office

    2016-01-01

    Today@NPS showcases some of the speakers, conferences, experiments, lectures and other events that take place at the Naval Postgraduate School Contents: July 1, 2016: NPS Leadership Share Life Primers with Summer STEM Interns; July 5, 2016: Summer Quarter Welcomes Largest Incoming Class of the Year; July 6, 2016: NSAM Welcomes New Students With MWR Leisure Fair; July 7, 2016: Bowman Scholars Make the Rapid Transition to Graduate Studies; July 8, 2016: NPS Legal Details the Basics of Protec...

  15. Exploring Social Meaning in Online Bilingual Text through Social Network Analysis

    Science.gov (United States)

    2015-09-01

    Text through Social Network Analysis by Elizabeth K Bowman, Heather Roy, Sue Kase, and Michelle Vanni Computational and Information Sciences...September 2014 4. TITLE AND SUBTITLE Exploring Social Meaning in Online Bilingual Text through Social Network Analysis 5a. CONTRACT NUMBER 5b...Networks 27 5. Automated Text Analytics for Social Network and Sociolinguistic Analysis 29 5.1 GATE 29 5.2 Contour 32 5.2.1 Contour Activity

  16. On the Mitigation of Solar Index Variability for High Precision Orbit Determination in Low Earth Orbit

    Science.gov (United States)

    2016-09-16

    Orbit Covariance Estimation and ANalysis (OCEAN) high precision orbit deter- mination tool in order to determine the suitability of each model for...Covariance Estimation and ANalysis (OCEAN) software was used to preform high precision orbit estimations. OCEAN is a highly configurable, database...lowest RMS position difference for each time span is highlighted in bold text . The Jacchia-Bowman 2008 models are labeled as JB08, the NRLMSISE-00

  17. Articulated Total Body Model Enhancements. Volume 3. Programmer’s Guide

    Science.gov (United States)

    1988-02-01

    BY U INDEX OF NTAB ARRAY. FRCDFL C DERIVATIVE, FUNCTION OR INTEGRAL IS EVALUATED AS N =0,1 OR 2. FRCDFL C ETAB (N) - INDEX TO TAB ARRAY FOR REAL DATA...6. Leetch, B.D., Bowman, W.L., "Articulated Total Body (AmB) VIEW Program Software Report," Report Nos. AMRL-TR-81-111, Vols 1 & 2, June * 1983 (NTIS

  18. Exploring Longitudinal Risk-return Relationships

    DEFF Research Database (Denmark)

    Andersen, Torben J.; Bettis, Richard A.

    2015-01-01

    We study a longitudinal fit model of adaptation and its association with the longitudinal risk-return relationship. The model allows the firm to adjust its position in response to partial learning about a changing environment characterized by two path-dependent processes—a random walk...... can lead to the inverse longitudinal risk-return relationships observed empirically. We discuss this apparent paradox and the possible resolution between mindless and conscious behavior as plausible causes of the longitudinal Bowman Paradox....

  19. On continuity of homomorphisms between topological Clifford semigroups

    Directory of Open Access Journals (Sweden)

    I. Pastukhova

    2014-07-01

    Full Text Available Generalizing an old result of Bowman we prove that a homomorphism $f:X\\to Y$ between topological Clifford semigroups is continuous if the idempotent band $E_X=\\{x\\in X:xx=x\\}$ of $X$ is a $V$-semilattice;the topological Clifford semigroup $Y$ is ditopological;the restriction $f|E_X$ is continuous;for each subgroup $H\\subset X$ the restriction $f|H$ is continuous.

  20. Toxicologic and Analytical Studies with T-2 and Related Trichothecene Mycotoxins

    Science.gov (United States)

    1984-09-01

    D. T. Bowman. Aflatoxin, zearalenone, and deoxynivalenl in 1981 grain sorg•.um at harvest. J Food Saftey . (Submitted for publication). Beasley, V. R...no food . On the morning of the treatment, the animals are anesthetized with halothane via a face mask and intubated. The endotracheal tube is secured...Raven Press, pp. 214-215. Bamburg, J. R., Strong, F. M., Smalley, E. B. (1969). Toxins from moldy cere- als. J. Ar. Food Chem. 17:443-450. Beasley, V

  1. Atlas: A Facility for High Energy Density Physics Research at Los Alamos National Laboratory

    Science.gov (United States)

    1995-07-01

    LOS ALAMOS NATIONAL LABORATORY W. M. Parsons, W. A. Reass, J. ~-Griego, D. W. Bowman...C. Thompson, R. F. Gribble, J. S. Shlachter, C. A. Ekdahl, P. D. Goldstone, and S.M. Younger Los Alamos National Laboratory Los Alamos, NM. 87545...Atlas A Facility For High Energy Density Physics Research At Los Alamos National Laboratory 5a. CONTRACT NUMBER 5b. GRANT NUMBER 5c. PROGRAM

  2. Achieving "Fairness" in Data Fusion Performance Evaluation Development

    Science.gov (United States)

    2006-04-30

    Performance Evaluation Development 5b. GRANT NUMBER F49620-03-1-0037 5c. PROGRAM ELEMENT NUMBER 6. AUTHOR(S) 5d. PROJECT NUMBER Dr. James Llinas 5e...Evaluation Methods for Network Centric Data-Fusion Capable Tactical Platforms Kedar Sambhoos, Satyaki Ghosh Dastidar, James Llinas Christopher Bowman...were based settings were as follows: 8. ensor ID: Sensor matix wer based 1. Targets: 6 targets upon entity class confusion matrix per sensor mode. 2

  3. Optimal experimental design strategies for detecting hormesis

    OpenAIRE

    2010-01-01

    Hormesis is a widely observed phenomenon in many branches of life sciences ranging from toxicology studies to agronomy with obvious public health and risk assessment implications. We address optimal experimental design strategies for determining the presence of hormesis in a controlled environment using the recently proposed Hunt-Bowman model. We propose alternative models that have an implicit hormetic threshold, discuss their advantages over current models, construct and study properties of...

  4. The Medical Geology revolution——The evolution of an IUGS initiative

    Institute of Scientific and Technical Information of China (English)

    Olle Selinus; Robert B.Finkelman; Jose A.Centeno

    2007-01-01

    @@ Introduction In December 2003 Episodes published an article entitled"Medical Geology:New Relevance in the Earth Sciences"by Bowman,Bobrowski,and Selinus.This paper was iust one early example of the interest and excitement sparked by this emerging field of medical geology-the impacts of geologic materials and geologic processes on animal and human health.Medical geology attempts to bring together geoscientists and biomedical/public health researchers to address a range of environmental health problems.

  5. Multi-Entity Bayesian Networks Learning in Predictive Situation Awareness

    Science.gov (United States)

    2013-06-01

    Traditional fusion systems focus on lower levels of the JDL hierarchy, leaving higher-level fusion and situation awareness largely to unaided human...decision making. Traditional fusion systems focus on lower levels of the JDL hierarchy, leaving higher-level fusion and situation awareness largely to...Llinas, J., Bowman, C., Rogova, G., & Steinberg, A. (2004). Revisiting the JDL data fusion model II. In: Proc. of the 7th Int. Conf. on Information Fusion

  6. Main: 1PI2 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1PI2 大豆 Soybean Glycine max (L.) Merrill Bowman-Birk Type Proteinase Inhibitor D-Ii...0 1992 EMBL; M20733; AAA33954.1; -.|PIR; S07941; S07941.|PDB; 1PI2; X-ray; @=18-81.|InterPro; IPR000877; Pro...gth: 83 AA, Molecular weight: 9468 Da MCILSFLKSDQSSSYDDDEYSKPCCDLCMCTRSMPPQCSCEDIRLNSCHSDCKSCMCTRSQPGQCRCLDTNDFCYKPCKSRDD soybean_1PI2.jpg ...

  7. Fecal microbiota transplantation: current clinical efficacy and future prospects

    OpenAIRE

    Bowman KA; Broussard EK; Surawicz CM

    2015-01-01

    Kathryn A Bowman,1 Elizabeth K Broussard,2 Christina M Surawicz2 1Department of Medicine, 2Division of Gastroenterology, University of Washington School of Medicine, Seattle, WA, USA Abstract: Fecal microbiota transplantation (FMT) has gained mainstream attention with its remarkable efficacy in treating recurrent Clostridium difficile infection (RCDI) when there are no other effective therapies. Methods of selecting donors and routes of administration vary among studies, but there are now ra...

  8. Multiple Neuron Recording in the Hippocampus on Freely-Moving Animals

    Science.gov (United States)

    1994-03-15

    up to 128 single unit waveforms recorded from any combination of 128 microwire electrodes. Tt use of shaped microwire arrays allowed for precise...Pharmacology Dist Special Bowman Gray School of Medicine, / Wake Forest University Medical Center Blvd. Winston-Salem, NC 27157. 15 March 1994 Final...tungsten electrodes, and small bundles of stainless-steel microwire electrodes. The DSP-based spike-sorter system and shaped arrays of microwires were

  9. Profiles for High-Priority Species. Focus of the Army Threatened and Endangered Species Research Program

    Science.gov (United States)

    2007-11-01

    maintain the character of this habitat. Other prominent plants include lichens , yuccas, palmetto, shrubs, wildflowers, gopher apple, and prickly pear... DNA . Molecular Ecology: in press. Willard, F.C. 1912. A week afield in southern Arizona. Condor 14:53-63. Williams, J.E., D.B. Bowman, J.E...Examination of population structure in red-cockaded woodpeckers using DNA profiles. Evolution 47:185-194. Hamrick, D. 1992. Assisting homeless

  10. Keratectasia after laser in situ keratomileusis. Clinicopathological case report.

    Science.gov (United States)

    Kim, Hyojin; Song, In Kyung; Joo, Choun-Ki

    2006-01-01

    To describe the morphological features of a prominent ectasia of the cornea after laser in situ keratomileusis (LASIK). The morphology of the ectatic corneas was examined using corneal topography, light microscopy and transmission electron microscopy in 2 cases who underwent penetrating keratoplasty due to poor visual acuity induced by progressive corneal ectasia after LASIK. On topographic examination, the apex of the corneal surface was observed within the central 3-mm zone, and the smallest thickness was 0.116 and 0.271 mm in each case. On histological examination, the epithelial layer became thinner and detached easily. Bowman's membrane was broken down and folded. An irregular arrangement of the stromal lamellae with fibroblastic keratocytes was found. The fulled fiber cell, a transformed epithelial cell, was visible in a plane on Bowman's layer in the central region. In contrast, the corneal endothelium was intact, and no abnormality was found in both cases. On morphological examination of 2 cases with corneal ectasia, a forward protrusion of both the anterior and posterior corneal surfaces occurred, and epithelial detachment, Bowman's membrane breakage and folding and irregular lamellae were found. The 2 cases had greatly thinned and protruding corneas, yet there was no abnormality in the corneal endothelium. 2006 S. Karger AG, Basel

  11. Mad, Bad, and Dangerous to Know? The Strange Allure and Elusive Reality of North Korea

    Directory of Open Access Journals (Sweden)

    John Lie

    2016-03-01

    Full Text Available Sandra Fahy, Marching Through Suffering: Loss and Survival in North Korea. New York: Columbia University Press, 2015. 272 pp. $40 (cloth/e-book. Hazel Smith, North Korea: Markets and Military Rule. Cambridge: Cambridge University Press, 2015. 394 pp. $90 (cloth, $33 (paper, $26 (e-book. Lady Caroline Lamb famously called Lord Byron “mad, bad, and dangerous to know.” In describing North Korea, Hazel Smith replaces “dangerous to know” with “sad,” but she, like Sandra Fahy, seeks to recuperate the ultimate humanity of North Koreans. Both Smith and Fahy have spent considerable time in North Korea or with North Koreans, and they convey the contemporary dynamics of North Korea without relying on the ready-made caricatures and stereotypes that dominate in the West (and the rest...

  12. Arts@CERN | ACCELERATE Austria | 19 May | IdeaSquare

    CERN Multimedia

    2016-01-01

    ​Arts@CERN welcomes you to a talk by architects Sandra Manninger and Matias Del Campo, at IdeaSquare (Point 1) on May 19 at 6:00 p.m.   Sensible Bodies - architecture, data, and desire. Sandra and Matias are the winning architects for ACCELERATE Austria. Focusing on the notion of geometry, they are at CERN during the month of May, as artists in residence. Their research highlights how to go beyond beautiful data to discover something that could be defined voluptuous data. This coagulation of numbers, algorithms, procedures and programs uses the forces of thriving nature and, passing through the calculation of a multi-core processor, knits them with human desire. Read more. ACCELERATE Austria is supported by The Department of Arts of the Federal Chancellery of Austria. Thursday, May 19 at 6:00 p.m. at IdeaSquare.  See event on Indico. 

  13. Loitsumees ja salapärane autojuht / Mare Müürsepp

    Index Scriptorium Estoniae

    Müürsepp, Mare, 1958-

    2014-01-01

    Artikkel on kirjutatud Sandra Rannastiku magistritöö põhjal (Tallinna Ülikool, kasvatusteaduste instituut, algõpetuse osakond, 2014). Magistritöö põhineb uuringul, mille jaoks valiti välja kümme raamatut, et uurida milliseid ootusi üks või teine raamat lastes tekitab ja viidi läbi 72 neljanda klassi õpilase hulgas

  14. Pathophysiology, risk factors, and screening methods for prediabetes in women with polycystic ovary syndrome

    OpenAIRE

    Gourgari E; Spanakis E; Dobs AS

    2016-01-01

    Evgenia Gourgari,1 Elias Spanakis,2 Adrian Sandra Dobs3 1Division of Pediatric Endocrinology, Georgetown University School of Medicine, Washington, DC, 2Division of Endocrinology, University of Maryland School of Medicine, 3Department of Endocrinology, Johns Hopkins University School of Medicine, Baltimore, MD, USA Abstract: Polycystic ovary syndrome (PCOS) is a syndrome associated with insulin resistance (IR), obesity, infertility, and increased cardiometabolic risk. This is a des...

  15. Leadership Development: A Senior Leader Case Study

    Science.gov (United States)

    2014-10-01

    Aeronautical University; DBA, Walden University) is the deputy direc- tor for air traffic control and landing systems logistics and maintenance at...develop- ment organization. Sandra L. Kolberg, PhD Dr. Kolberg (BA, Western Michigan University; MA, MA, Eastern Michigan University; PhD, Walden ...the PhD in Management program and a DBA contributing faculty member for the School of Management and Technology at Walden University. September

  16. El Departamento de Medio Oriente (DEMO) : Su renovación

    OpenAIRE

    1997-01-01

    En marzo de 1997 se renovó el Departamento de Medio Oriente, por decisión del Director del Instituto de Relaciones Internacionales, profesor Dr. Norberto Consani en el marco de la Universidad Nacional de La Plata. Fueron designados como coordinadores del Departamento el Licenciado Pedro Brieger y la Licenciada Sandra De Rose. A partir de la fecha de nombramiento, comenzó la etapa preparatoria de un plan de trabajo y la convocatoria de estudiantes, graduados, docentes, e investigadores inte...

  17. The Role of IDO in Muc1 Targeted Immunotherapy

    Science.gov (United States)

    2013-01-01

    Besmer*, Teresa L. Tinder , Lopamudra Das Roy, Joseph Lustgarten, Sandra J. Gendler, Pinku Mukherjee Intratumoral Delivery of CpG-Conjugated Anti...3073-87. Epub 2012 Jan 11. PMID: 22238308 3. Mahnaz Sahraei , Lopamudra Das Roy , Jennifer Curry , Teresa Tinder , Sritama Nath , Dahlia M...10.1038/onc.2011.651 4. Dahlia M. Besmer , Dr. Jennifer M. Curry , Dr. Lopamudra D. Roy , Ms. Teresa L. Tinder , Ms. Mahnaz M. Sahraei , Dr

  18. Book reviews

    OpenAIRE

    Redactie KITLV

    2010-01-01

    Edward Aspinall, Islam and nation; Separatist rebellion in Aceh, Indonesia. (Gerry van Klinken) Greg Bankoff and Sandra Swart (with Peter Boomgaard, William Clarence-Smith, Bernice de Jong Boers and Dhiravat na Pombejra), Breeds of empire; The ‘invention’ of the horse in Southeast Asia and Southern Africa 1500–1950. (Susie Protschky) Peter Boomgaard, Dick Kooiman and Henk Schulte Nordholt (eds), Linking destinies; Trade, towns and kin in Asian history. (Hans Hägerdal)...

  19. Reviews of recent publications

    Directory of Open Access Journals (Sweden)

    various authors

    1993-01-01

    Full Text Available Gilbert, Sandra M. and Sagan Gubar. Blindspots of an Old Dream of Equality: Liberal Feminism as Exclusionary Practice in No Man's Land

  20. Changes in coronary heart disease risk profiles of HIV patients in Zimbabwe over 9 months: a follow-up study

    OpenAIRE

    Zhou DT; Oktedalen O; Shawarira-Bote S; Stray-Pedersen B

    2016-01-01

    Danai Tavonga Zhou,1,2 Olav Oektedalen,3 Sandra Shawarira-Bote,4 Babill Stray-Pedersen5 1Department of Medical Laboratory Sciences, College of Health Sciences, University of Zimbabwe, Avondale, Harare, Zimbabwe; 2Institute of Clinical Medicine, University of Oslo, 3Department of Infectious Diseases, Oslo University Hospital, Oslo, Norway; 4Newlands Clinic, Harare, Zimbabwe; 5Institute of Clinical Medicine, University in Oslo and Womens Clinic, Oslo University Hospital, Oslo, Norway A...

  1. Benchmarking Naval Shipbuilding With 3D Laser Scanning, Additive Manufacturing, and Collaborative Product Lifecycle Management

    Science.gov (United States)

    2016-04-30

    wasted time, energy, and material across the entire organization and into the supply chain , PLM drives the next generation of lean thinking...Manufacturing, and Collaborative Product Lifecycle Management David Ford, Associate Professor, Texas A&M University Tom Housel, Professor, NPS Sandra Hom...2016 1:45 p.m. – 3:15 p.m. Chair: Major General L. Neil Thurgood, U.S. Army, Deputy for Acquisition and Systems Management , OASA (ALT

  2. Сандра Баллок поблагодарила Алара Кивило / Тийт Туумалу

    Index Scriptorium Estoniae

    Туумалу, Тийт, 1971-

    2010-01-01

    Näitleja Sandra Bullock tänas oma Filminäitlejate Gildi Auhindade (American Screen Actors Guild Awards) tseremoonia tänukõnes ka operaator Alar Kivilod. Artiklis Kanadas sündinud ja Los Angeleses töötavast eesti päritolu filmioperaatorist ning lähemalt tema ühest südamelähedasemast tööst, filmist "Taking Chance" (USA 2009)

  3. Surm kevadises Tallinnas ehk Kunstnike valuline reaktsioon meie ajale / Reet Varblane

    Index Scriptorium Estoniae

    Varblane, Reet, 1952-

    2006-01-01

    Mark Soosaare näitus "Aeg" Tallinna Kunstihoone galeriis kuni 23. IV, Jaan Paavle maalinäitus "1 minut" 3.-15. IV Draakoni galeriis, Sandra Jõgeva ja Kristin Kalamehe "Leave like a Lady" Draakoni galerii keldrisaalis 4.-15. IV, Marianne Männi näitus "Paradiis" Hobusepea galeriis 5.-17. IV. Maailma positiivsemale poolusele osutab 20. IV Tallinna Linnagaleriis avatud Mari ja Kaarel Kurismaa ruumiinstallatsioon "Teine süütus"

  4. La pelle del selfie

    Directory of Open Access Journals (Sweden)

    Theresa Senft

    2015-12-01

    Full Text Available This is an essay about power and faces. Specifically, it about the faces that manifest in the global self-imaging practice referred to as “selfie culture.” More specifically still, it is about circulation of selfies featuring the face of Sandra Bland, an African American activist with the group Black Lives Matter, who police claim hung herself in a cell after being imprisoned after a routine traffic stop.

  5. Reflections on Software Agility and Agile Methods: Challenges, Dilemmas, & the Way Ahead

    Science.gov (United States)

    2016-06-21

    six months” Cusumano, 1998 © 2005 Carnegie Mellon University 8 Whack a Mole?! Source: Michel Baudin, 3/16/99. Lean production: the end of management ...Linda Levine Software Engineering Institute, Carnegie Mellon University Jan Pries-Heje The IT University of Copenhagen Sandra Slaughter Graduate School ...2005 Carnegie Mellon University 12 Phase 1: Detailed Interviews With: • senior managers , project managers • software engineers, QA engineers Questions

  6. Say No to Excess Salt (A Cup of Health with CDC)

    Centers for Disease Control (CDC) Podcasts

    2016-01-14

    Hypertension is a leading cause of heart disease and stroke and occurs in nearly one in three U.S. adults. Reducing salt intake can lower blood pressure, helping to prevent and treat hypertension. In this podcast, Dr. Sandra Jackson discusses the importance of consuming a diet low in sodium.  Created: 1/14/2016 by MMWR.   Date Released: 1/14/2016.

  7. A Synopsis of Personalized Medicine Projects Within the United States Air Force

    Science.gov (United States)

    2017-06-16

    MEMORANDUM FOR ST DEPARTMENT OF THE AIR FORCE 59TH MEDICAL WING (AETC) JOINT BASE SAN ANTONIO - LACKLAND TEXAS ATTN: SANDRA VAL TIER FROM: 59...United States Air Force presented at/published to San Antonio Military Health System and Universities Research Forum (SURF), T X, 16 June 2017 in...WlTHIN THE UNITED STATES AIR FORCE 7. FUNDING RECEIVED FOR THIS STUDY? IZI YES D NO FUNDING SOURCE: SGS R&D 8. DO YOU NEED FUNDING SUPPORT FOR

  8. The Quest for Diversity in Library Staffing: From Awareness to Action

    Directory of Open Access Journals (Sweden)

    Jennifer Vinopal

    2016-01-01

    Full Text Available The work of diversity in libraries begins at the crossroad where superiority, inaction, and denial become intolerable. – Sandra Ríos Balderrama, “This Trend Called Diversity” In Brief: Despite our ongoing quest for diversity and a growing number of initiatives to increase it, the demographics of the professional librarian population haven’t changed in any significant way. […

  9. Self-stigma among caregivers of people with mental illness: toward caregivers’ empowerment

    OpenAIRE

    Girma E; Möller-Leimkühler AM; Dehning S; Mueller N; Tesfaye M; Froeschl G

    2014-01-01

    Eshetu Girma,1,2 Anne Maria Möller-Leimkühler,2,3 Sandra Dehning,2,3 Norbert Mueller,2,3 Markos Tesfaye,4 Guenter Froeschl2,5 1Department of Health Education and Behavioral Sciences, Jimma University, Jimma, Ethiopia; 2CIHLMU Center for International Health, Ludwig-Maximilians-Universität, Munich, Germany; 3Department of Psychiatry and Psychotherapy, Ludwig-Maximilians-Universität, Munich, Germany; 4Department of Psychiatry, Jimma University, Jimma, Ethiopi...

  10. Kuidas edasi, "Berlinale"? / Endel Link

    Index Scriptorium Estoniae

    Link, Endel

    2006-01-01

    56. Berliini filmifestivali auhinnasaajatest- Kuldkaru saaja bosnialanna Jasmila Zhbavic filmi "Grbavica" eest, režii Hõbekaru saajad britid Michael Winterbottom ja Mat Whitecross filmi eest "Teekond Guatanamosse" ("The Road to Guantanamo"), parima filmi Hõbekaru ja debüüdiauhinna saanud taanlanna Pernille Fischer Christensen filmi "Seep" eest ja iraanlane Jafar Panahi filmi "Suluseis" eest. Parimad näitlejad olid Sandra Hüller ja Moritz Bleibtreu

  11. Kunst aitab klisheesid lõhkuda : prostitutsioon / Reet Varblane

    Index Scriptorium Estoniae

    Varblane, Reet, 1952-

    2007-01-01

    Prostitutsiooniteemast kunstis, praeguste prostitutsiooni käsitlevate näituste ("Sex Work. Kunst. Mythos. Realität" Berliinis, Ann-Sofi Sideni projekt "Warte mal! Prostitutsion after the Velvet Revolution" jt.) rollist. Pikemalt näitusest "Kehaturg / Sex market" Tallinna Kunstihoones. Anu Juuraku, Foxy Haze'i, Teemu Mäki, Tatjana Antoshina, Kari Bie Erenurme, Sandra Jõgeva, Shula Kesheti, Deimantas Narkeviciuse ja Pal Hollenderi töödest

  12. Repealing Don’t Ask, Don’t Tell: Addressing the Ripple Effects

    Science.gov (United States)

    2010-02-25

    integration of homosexuals . The research will look at current societal opinions of allowing gays and lesbians to serve openly in the U.S. military... homosexuals . The research will look at current societal opinions of allowing gays and lesbians to serve openly in the U.S. military. Furthermore... Homosexuals in the U.S. Military”. 75 Wilber Scott and Sandra Carson Stanley. eds., Gays and Lesbians in the Military: Issues, Concerns, and Contrasts

  13. Tallinna XIII graafikatriennaali grand prix' pälvis leedu graafik Egle Kuckaite

    Index Scriptorium Estoniae

    2004-01-01

    Kolm võrdset preemiat: Sang-gon Chung Lõuna-Koreast, Krishs Salmanis Lätist ja Joanne Soroka Shotimaalt. Diplomid: Anonymous Boh ja Eve Kiiler Eestist, Pete Nevin Inglismaalt, Hanna Oinonen Soomest ja venetsueela-soome kunstnik Sandra Vina de Karila. Tallinna linna preemia: John Smith (Marko Mäetamm & Kaido Ole) Eestist. Eesti Kunstimuuseumi preemia: Markus Lampinen Soomest. Eesti Panga preemia: Leonards Laganovskis Lätist

  14. Loitsumees ja salapärane autojuht / Mare Müürsepp

    Index Scriptorium Estoniae

    Müürsepp, Mare, 1958-

    2014-01-01

    Artikkel on kirjutatud Sandra Rannastiku magistritöö põhjal (Tallinna Ülikool, kasvatusteaduste instituut, algõpetuse osakond, 2014). Magistritöö põhineb uuringul, mille jaoks valiti välja kümme raamatut, et uurida milliseid ootusi üks või teine raamat lastes tekitab ja viidi läbi 72 neljanda klassi õpilase hulgas

  15. Susceptibility of Adult Mosquitoes to Insecticides in Aqueous Sucrose Baits

    Science.gov (United States)

    2011-06-01

    of the lack of ingestion as a result of repellency due to high survival of water-deprived control mosquitoes at 24 hr and the abundance of abdomens...Vol. 36, no. 1 Journal of Vector Ecology 59 Susceptibility of adult mosquitoes to insecticides in aqueous sucrose baits Sandra A. Allan Center for...2010 ABSTRACT: Mosquitoes characteristically feed on plant-derived carbohydrates and honeydew just after emergence and intermittently during their

  16. Criticism, context and community: Connections between Wittgenstein’s On and feminist epistemology

    Directory of Open Access Journals (Sweden)

    Carol Caraway

    2002-12-01

    Full Text Available In this article the conceptual connections between Wittgenstein’s On Certainty and the work of three contemporary feminist epistemologists: standpoint theorist Sandra Harding and feminist empiricists Helen Longino and Lynn Hankinson Nelson, are explored. The inquiry reveals both surprising similarities and important differences between Wittgensteinian and feminist epistemologies. Exploring these similarities and differences (criticism, context and community clarifies Wittgenstein’s epistemology and reveals the ways in which feminist epistemologists developed the themes from On Certainty.

  17. Kuldkaru sai Bosnia naisrežissöör / Grete Nootre

    Index Scriptorium Estoniae

    Nootre, Grete

    2006-01-01

    56. Berliini filmifestivali auhinnasaajatest- Kuldkaru saaja bosnialanna Jasmila Zhbavic filmi "Grbavica" eest, režii Hõbekaru saajad britid Michael Winterbottom ja Mat Whitecross filmi eest "Teekond Guatanamosse" ("The Road to Guantanamo"), parima filmi Hõbekaru ja debüüdiauhinna saanud taanlanna Pernille Fischer Christensen filmi "Seep" eest ja iraanlane Jafar Panahi filmi "Suluseis" eest. Parimad näitlejad olid Sandra Hüller ja Moritz Bleibtreu. Lisatud nimekiri "Võitjad"

  18. Berlinale : snõ o Sarajeve

    Index Scriptorium Estoniae

    2006-01-01

    56. Berliini filmifestivali auhinnasaajatest- Kuldkaru saaja bosnialanna Jasmila Zhbavic filmi "Grbavica" eest, režii Hõbekaru saajad britid Michael Winterbottom ja Mat Whitecross filmi eest "Teekond Guatanamosse" ("The Road to Guantanamo"), parima filmi Hõbekaru ja debüüdiauhinna saanud taanlanna Pernille Fischer Christensen filmi "Seep" eest ja iraanlane Jafar Panahi filmi "Suluseis" eest. Parimad näitlejad olid Sandra Hüller ja Moritz Bleibtreu.

  19. Maailm Berlinale filmipeeglis. Kus oleme meie? / Annika Koppel

    Index Scriptorium Estoniae

    Koppel, Annika

    2006-01-01

    56. Berliini filmifestivali auhinnasaajatest- Kuldkaru saaja bosnialanna Jasmila Zhbavic filmi "Grbavica" eest, režii Hõbekaru saajad britid Michael Winterbottom ja Mat Whitecross filmi eest "Teekond Guatanamosse" ("The Road to Guantanamo"), parima filmi Hõbekaru ja debüüdiauhinna saanud taanlanna Pernille Fischer Christensen filmi "Seep" eest ja iraanlane Jafar Panahi filmi "Suluseis" eest. Parimad näitlejad olid Sandra Hüller ja Moritz Bleibtreu. Eestlased filmiturul. Lisatud nimekiri "56. Berliini rahvusvahelise filmifestivali auhinnad"

  20. The Introduction of Appreciative Inquiry to the U.S. Navy Using Appreciative Inquiry Interviews and the Large Group Intervention with Applications to U.S. Marine Corps Logistics Strategic Management

    Science.gov (United States)

    2002-03-01

    organization at once, rather than follow the slow, waterfall-type process of earlier methods. One of these senior practitioners was Marvin Weisbord , who...Sandra and Weisbord , Marvin . Future Search: An Action Guide to Finding Common Ground in Organizations and Communities. Berrett-Kohler Publishers...Leading and Managing in the Strategic Arena: A Reference Text 1996-1997, Carlisle Barracks, Pennsylvania. Weisbord , Marvin . Discovering Common

  1. Implications of a Resurgent Russian Federation for U.S. European Command

    Science.gov (United States)

    2011-06-10

    republic and a member of NATO and the EU.174 The president of the Czech Republic is Vaclav Klaus ; elected to a five-year term in 2008.175 Russian...Republic has a Russian-leaning president in Vaclav Klaus , who seeks closer ties between the Czech Republic and Russia.212 This- coupled with growing...Eorsi, Istvan Gyarmati, Vaclav Havel, Rastislav Kacer, Sandra Kalniete, Karel Schwarzenberg, Michal Kovac, Ivan Krastev, Alexander Kwasniewski, Mart

  2. The Effects of Soy Protein and Isoflavones on Lipid Oxidation and Blood Lipid Profile on Humans Participating in Moderate Physical Activity

    OpenAIRE

    Shehadeh, Sandra C

    1999-01-01

    THE EFFECTS OF SOY PROTEIN AND ISOFLAVONES ON LIPID OXIDATION AND BLOOD LIPID PROFILE ON HUMANS PARTICIPATING IN MODERATE PHYSICAL ACTIVITY Sandra C. Shehadeh The purpose of our study was to compare the effects of dietary soy protein and animal protein (casein) on plasma lipoprotein concentrations, and exercise induced oxidation in human subjects. Sixteen normocholesterolemic young men participated in 30 min of cycling at 70% VO2pk to induce plasma oxidation. Each subject then followe...

  3. Plasma Jet Interactions with Liquids in Partial Fulfillment of an NRL Karles Fellowship

    Science.gov (United States)

    2015-11-30

    Naval Research Laboratory Washington, DC 20375-5320 NRL /MR/6750--15-9650 Plasma Jet Interactions with Liquids in Partial Fulfillment of an NRL ...ABSTRACT Plasma Jet Interactions with Liquids in Partial Fulfillment of an NRL Karle’s Fellowship Sandra (Hernandez) Hangarter Naval Research Laboratory 4555...Overlook Avenue, SW Washington, DC 20375-5320 NRL /MR/6750--15-9650 ONR Approved for public release; distribution is unlimited. Unclassified Unlimited

  4. Eripalgeline universum Polymeri kultuuritehases / Marian Kivila

    Index Scriptorium Estoniae

    Kivila, Marian

    2008-01-01

    23. V toimunud rahvusvahelise tegevuskunstifestivali "Diverse Universe IV" performance''i-programmist Non Grata Kunstikonteineris Kultuuritehases Polymer. Sandra Jõgeva ja rühmituse Cnopt, rühmituse Non Grata, korealase Kim Baek-Ki ning sakslaste Micha Stegeri ja Andreas Stadleri, poolakate Marta Zioleki ja Agata Siniarska, ameeriklase Travis McCoy Fulleri, Russ Butleri (Bermuda), rühmituse HorseCow (Sacramento) performance'itest. Lühidalt Non Grata videonäitusest

  5. Evaluación de los niveles del aducto 8-OHdG y fragmentación del ADN en linfocitos periféricos humanos expuestos in vitro a hidrocarburos aromáticos policíclicos con y sin activación metabólica animal /

    OpenAIRE

    Rodríguez Romero, María Isabel

    2011-01-01

     tesis que para obtener el grado de Doctor en Ciencias Biológicas, presenta María Isabel Rodríguez Romero ; asesor María Elena Calderón Segura, Sandra Luz Gómez Arroyo, Luis Felipe Jiménez García. 106 páginas : diagramas. Doctorado en Ciencias Biológicas UNAM, Instituto de Geología, 2011

  6. 什么是你的吸引力?

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    Contrary to what most people believe, what we attract in life does not depend on our looks, our status, or our IQ."It depends on our AQ-Attraction Quotient,"says Sandra Anne Taylor,"which is determined by the energetic message we send out about ourselves. Whether we realize it or not,the daily resonance of our beliefs,emotions and attitudes toward ourselves is what determines the quality of our lives."……

  7. What's your attraction quotient?%什么是你的吸引力?

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    @@ Contrary to what most people believe, what we attract in life does not depend on our looks, our status, or our IQ."It depends on our AQ-Attraction Quotient,"says Sandra Anne Taylor,"which is determined by the energetic message we send out about ourselves. Whether we realize it or not,the daily resonance of our beliefs,emotions and attitudes toward ourselves is what determines the quality of our lives."

  8. Optical Digital Image Storage System

    Science.gov (United States)

    1991-03-18

    This could be accomplished even if the files were artificially determined. " Super files," composed of a number of files, could be artificially created...in order to expedite transfer through the scanning process. These " super files" could later be broken down into their actual component files. Another...hesitant about implementing an optical disk system. While Sandra Napier believed it "looks promising," she felt an optical disk replacement of microfilm

  9. Eripalgeline universum Polymeri kultuuritehases / Marian Kivila

    Index Scriptorium Estoniae

    Kivila, Marian

    2008-01-01

    23. V toimunud rahvusvahelise tegevuskunstifestivali "Diverse Universe IV" performance''i-programmist Non Grata Kunstikonteineris Kultuuritehases Polymer. Sandra Jõgeva ja rühmituse Cnopt, rühmituse Non Grata, korealase Kim Baek-Ki ning sakslaste Micha Stegeri ja Andreas Stadleri, poolakate Marta Zioleki ja Agata Siniarska, ameeriklase Travis McCoy Fulleri, Russ Butleri (Bermuda), rühmituse HorseCow (Sacramento) performance'itest. Lühidalt Non Grata videonäitusest

  10. Microclimates and Corrosion: A Mathematical Model of Corrosion for Gando AFB, Spain

    Science.gov (United States)

    1990-09-01

    certain points); pitting (highly localized corrosion resulting in deep penetration at only a few spots); parting (the selective attack of one or more... Exposicion Ambiental(1987-1988). Unpublished Report No. 15. INTA, Madrid, Spain, 1989. 16. Schlotzhauer, D. Sandra and Littell, C. Ramon. SAS System for...LIME: An Environmental Corrosion Severity Classification System: Final Report Part I. Sep 1978 - Dec 1979. Contract F33615-78-C-5224. East Lansing MI

  11. Kunst aitab klisheesid lõhkuda : prostitutsioon / Reet Varblane

    Index Scriptorium Estoniae

    Varblane, Reet, 1952-

    2007-01-01

    Prostitutsiooniteemast kunstis, praeguste prostitutsiooni käsitlevate näituste ("Sex Work. Kunst. Mythos. Realität" Berliinis, Ann-Sofi Sideni projekt "Warte mal! Prostitutsion after the Velvet Revolution" jt.) rollist. Pikemalt näitusest "Kehaturg / Sex market" Tallinna Kunstihoones. Anu Juuraku, Foxy Haze'i, Teemu Mäki, Tatjana Antoshina, Kari Bie Erenurme, Sandra Jõgeva, Shula Kesheti, Deimantas Narkeviciuse ja Pal Hollenderi töödest

  12. Zwischen Faszination und Abwehr : Indienbilder in Reiseberichten italienischer Schriftsteller des 20. Jahrhunderts

    OpenAIRE

    Kleinert, Susanne

    2008-01-01

    Der Aufsatz analysiert folgende Reiseberichte italienischer Schriftsteller: Guido Gozzanos Verso la cuna del mondo. Lettere dall';India (1917), Alberto Moravia, Un';idea dell';India (1962), Pier Paolo Pasolinis L';odore dell';India (1962), Beppino Disertoris Esperienza dell';India (1966), Giorgio Manganellis Esperimento con l';India (1992) und Sandra Petrignanis Ultima India (1996). Nach Gozzanos ambivalenter Haltung zu Indien, die noch stark von kolonialistischen Bildern eines "barbarischen'...

  13. Acquiring Technical Data With Renewable Real Options

    Science.gov (United States)

    2016-04-30

    Thomas Housel, Professor, NPS Johnathan Mun, Research Professor, NPS David Ford, Research Associate Professor, NPS Sandra Hom, Research Associate, NPS...users who have no PLM access (Doyle & Grossman , 2014). Such systems typically include strong digital rights management features that are suitable for...www.dtic.mil/whs/directives/corres/pdf/500002p.pdf Doyle, K., & Grossman , J. (2014). Teamcenter supplier collaboration: Optimizing product design between

  14. Tallinna XIII graafikatriennaali grand prix' pälvis leedu graafik Egle Kuckaite

    Index Scriptorium Estoniae

    2004-01-01

    Kolm võrdset preemiat: Sang-gon Chung Lõuna-Koreast, Krishs Salmanis Lätist ja Joanne Soroka Shotimaalt. Diplomid: Anonymous Boh ja Eve Kiiler Eestist, Pete Nevin Inglismaalt, Hanna Oinonen Soomest ja venetsueela-soome kunstnik Sandra Vina de Karila. Tallinna linna preemia: John Smith (Marko Mäetamm & Kaido Ole) Eestist. Eesti Kunstimuuseumi preemia: Markus Lampinen Soomest. Eesti Panga preemia: Leonards Laganovskis Lätist

  15. Self-stigma among caregivers of people with mental illness: toward caregivers’ empowerment

    OpenAIRE

    Girma E; Möller-Leimkühler AM; Dehning S; Mueller N; Tesfaye M; Froeschl G

    2014-01-01

    Eshetu Girma,1,2 Anne Maria Möller-Leimkühler,2,3 Sandra Dehning,2,3 Norbert Mueller,2,3 Markos Tesfaye,4 Guenter Froeschl2,5 1Department of Health Education and Behavioral Sciences, Jimma University, Jimma, Ethiopia; 2CIHLMU Center for International Health, Ludwig-Maximilians-Universität, Munich, Germany; 3Department of Psychiatry and Psychotherapy, Ludwig-Maximilians-Universität, Munich, Germany; 4Department of Psychiatry, Jimma University, Jimma, Ethiopi...

  16. Scratch's Third Body: Video Talks Back to Television

    OpenAIRE

    Leo Goldsmith

    2015-01-01

    Emerging in the UK in the 1980s, Scratch Video established a paradoxical union of mass-media critique, Left-wing politics, and music-video and advertising aesthetics with its use of moving-image appropriation in the medium of videotape. Enabled by innovative professional and consumer video technologies, artists like George Barber, The Gorilla Tapes, and Sandra Goldbacher and Kim Flitcroft deployed a style characterized by the rapid sampling and manipulation of dissociated images drawn from br...

  17. The Ethics of Gender in Milton's Paradise Lost

    OpenAIRE

    Erickson, Sandra S. Fernandes

    2010-01-01

    ERICKSON, Sandra S.Fernandes. The ethics of gender in Milton's paradise lost. Principios: revista de filosofia. Natal (RN). v. 5, n. 6, p. 155-170. 1998. ISSN 1983-2109. Disponivel em: . Acesso em: 04 out. 2010. Existe uma acirrada discussao entre os estudiosos do classico ingles Paradise Lost (John Milton, 1674) sobre o suposto misogenismo do autor. A maioria dos estudiosos, inclusive mulheres sustentam que niio. A analise da Eva Miltoniana apresentada abaixo deixa claro que niio...

  18. Kuidas edasi, "Berlinale"? / Endel Link

    Index Scriptorium Estoniae

    Link, Endel

    2006-01-01

    56. Berliini filmifestivali auhinnasaajatest- Kuldkaru saaja bosnialanna Jasmila Zhbavic filmi "Grbavica" eest, režii Hõbekaru saajad britid Michael Winterbottom ja Mat Whitecross filmi eest "Teekond Guatanamosse" ("The Road to Guantanamo"), parima filmi Hõbekaru ja debüüdiauhinna saanud taanlanna Pernille Fischer Christensen filmi "Seep" eest ja iraanlane Jafar Panahi filmi "Suluseis" eest. Parimad näitlejad olid Sandra Hüller ja Moritz Bleibtreu

  19. Kuldkaru sai Bosnia naisrežissöör / Grete Nootre

    Index Scriptorium Estoniae

    Nootre, Grete

    2006-01-01

    56. Berliini filmifestivali auhinnasaajatest- Kuldkaru saaja bosnialanna Jasmila Zhbavic filmi "Grbavica" eest, režii Hõbekaru saajad britid Michael Winterbottom ja Mat Whitecross filmi eest "Teekond Guatanamosse" ("The Road to Guantanamo"), parima filmi Hõbekaru ja debüüdiauhinna saanud taanlanna Pernille Fischer Christensen filmi "Seep" eest ja iraanlane Jafar Panahi filmi "Suluseis" eest. Parimad näitlejad olid Sandra Hüller ja Moritz Bleibtreu. Lisatud nimekiri "Võitjad"

  20. Berlinale : snõ o Sarajeve

    Index Scriptorium Estoniae

    2006-01-01

    56. Berliini filmifestivali auhinnasaajatest- Kuldkaru saaja bosnialanna Jasmila Zhbavic filmi "Grbavica" eest, režii Hõbekaru saajad britid Michael Winterbottom ja Mat Whitecross filmi eest "Teekond Guatanamosse" ("The Road to Guantanamo"), parima filmi Hõbekaru ja debüüdiauhinna saanud taanlanna Pernille Fischer Christensen filmi "Seep" eest ja iraanlane Jafar Panahi filmi "Suluseis" eest. Parimad näitlejad olid Sandra Hüller ja Moritz Bleibtreu.

  1. Maailm Berlinale filmipeeglis. Kus oleme meie? / Annika Koppel

    Index Scriptorium Estoniae

    Koppel, Annika

    2006-01-01

    56. Berliini filmifestivali auhinnasaajatest- Kuldkaru saaja bosnialanna Jasmila Zhbavic filmi "Grbavica" eest, režii Hõbekaru saajad britid Michael Winterbottom ja Mat Whitecross filmi eest "Teekond Guatanamosse" ("The Road to Guantanamo"), parima filmi Hõbekaru ja debüüdiauhinna saanud taanlanna Pernille Fischer Christensen filmi "Seep" eest ja iraanlane Jafar Panahi filmi "Suluseis" eest. Parimad näitlejad olid Sandra Hüller ja Moritz Bleibtreu. Eestlased filmiturul. Lisatud nimekiri "56. Berliini rahvusvahelise filmifestivali auhinnad"

  2. Cultural Intelligence, Meeting Today’s Challenges

    Science.gov (United States)

    2007-11-02

    24 4 Carl Von Clausewitz, On War , ed. and trans. Michael Howard and Peter Paret (Princeton NJ: Princeton University Press, 1976), 133 3 Simply...defense planning, the noted foreign correspondent and author of numerous books on foreign relations and political figures, Georgie Anne Geyer, opined “that...1996. Clausewitz, Carl Von. On War. Edited and translated by Michael Howard and Peter Paret. New Jersey: Princeton University Press, 1976. Erwin, Sandra

  3. Swarming Mechanisms in the Yellow Fever Mosquito: Aggregation Pheromones are Involved in the Mating Behavior of Aedes aegypti

    Science.gov (United States)

    2014-12-01

    Vol. 39, no. 2 Journal of Vector Ecology 347 Swarming mechanisms in the yellow fever mosquito : aggregation pheromones are involved in the mating...behavior of Aedes aegypti Emadeldin Y. Fawaz1, Sandra A. Allan2, Ulrich R. Bernier2, Peter J. Obenauer3, and Joseph W. Diclaro II1 1Vector Biology ...Accepted 15 July 2014 ABSTRACT: Mosquitoes of various species mate in swarms comprised of tens of thousands of flying males. In this study, we examined

  4. A contemplation in negation and emphasizes of outstanding philosophers of Tehran philosophy school in immortality of subject in substantial movement.

    Directory of Open Access Journals (Sweden)

    mohamad khosravi farsani

    2015-03-01

    Full Text Available Agha Ali and Jelveh ,two of outstanding of Tehran philosophy school, have reconsidered Sandra's opinions in two opposite sides. Agha Ali is the claimant of negation and ambiguity in most of Sandra's opinions while emphasizing on transcendent theosophy foundations ,and he tries to make these ambiguities clear .However , Jelveh follows Avicenna's way and has the idea of criticizing Sandra .This article has chosen the problem Of immortality of subject in substantial movement between all debates of these two philosophers of the same age.in this essay we are going to survey Agha Ali's claims in his new explantation in one hand ,and survey and criticize the new explanation of Jelveh in negation Of substantial movement .One of the consequences of surveying and criticizing these two philosophers is that we recognize Agha Ali has succeeded in making Sadra's opinions clear by presenting a new explanation of substantial movement subject. However ,Jelveh has merged Sadra's opinions with Avicenna's instead of debilitating Sadra's opinions and stabilizing Avicenna's opinions.

  5. An observational test of the stress accumulation model based on seismicity preceding the 1992 Landers, CA earthquake

    Science.gov (United States)

    Levin, Shoshana Z.; Sammis, Charles G.; Bowman, David D.

    2006-02-01

    We test the Bowman and King [Bowman, D.D., King, G.C.P., 2001a, Accelerating seismicity and stress accumulation before large earthquakes. Geophys. Res. Lett., 28 (21), 4039-4042, Bowman, D.D., King, G.C.P., 2001b. Stress transfer and seismicity changes before large earthquakes. C. R. Acad. Sci. Paris, 333, 591-599] Stress Accumulation model by examining the evolution of seismicity rates prior to the 1992 Landers, California earthquake. The Stress Accumulation (SA) model was developed to explain observations of accelerating seismicity preceding large earthquakes. The model proposes that accelerating seismicity sequences result from the tectonic loading of large fault structures through aseismic slip in the elasto-plastic lower crust. This loading progressively increases the stress on smaller faults within a critical region around the main structure, thereby causing the observed acceleration of precursory activity. A secondary prediction of the SA model is that the precursory seismicity rates should increase first at the edges of the critical region, with the rates gradually rising over time at closer distances to the main fault. We test this prediction by examining year-long seismicity rates between 1960 and 2004, as a function of distance from the Landers rupture. To quantify the significance of trends in the seismicity rates, we auto-correlate the data, using a range of spatial and temporal lags. We find weak evidence for increased seismicity rates propagating towards the Landers rupture, but cannot conclusively distinguish these results from those obtained for a random earthquake catalog. However, we find a strong indication of periodicity in the rate fluctuations, as well as high correlation between activity 130-170 km from Landers and seismicity rates within 50 km of the Landers rupture temporally offset 1.5-2 years. The implications of this spatio-temporal correlation will be addressed in future studies.

  6. Production of monoclonal antibodies to human glomerular basement membrane.

    Directory of Open Access Journals (Sweden)

    Mino,Yasuaki

    1984-10-01

    Full Text Available Using the technique of somatic cell fusion, we produced monoclonal antibodies to collagenase-digested human glomerular basement membrane (GBM. Fourteen monoclonal antibodies which reacted with normal human kidney in indirect immunofluorescence (IIF studies were produced. An analysis of the binding patterns indicated that the antigens recognized could be divided into six broad groups. Monoclonal antibody B3-H10 (Group 1 reacted with only GBM in a fine granular pattern. A5-B12 and B5-C2 (Group 2 reacted with GBM and peritubular capillary in a linear pattern. B2-A12 (Group 3 reacted with only epithelial cells. Al-C9 and A4-E2 (Group 4 showed a mesangial pattern in glomerulus and a lineal pattern in tubular basement membrane (TBM, Bowman's capsule and peritubular capillary. A1-E1, A1-E11, A2-E6, A3-B6, A4-F8 and B5-H2 (Group 5 recognized determinants common to GBM, TBM, Bowman's capsule and/or peritubular capillary. A3-F1 and B5-E10 (Group 6 reacted with TBM and Bowman's capsule. The staining pattern of B3-H10 (Group 1 was characteristic because it was not linear, but finely granular along the GBM. The staining pattern of B2-A12 (Group 3 was also characteristic because only epithelial cells were stained, and processes of epithelial cells were observed as fine fibrils. To the best of our knowledge, these two types of monoclonal antibodies have not been reported previously.

  7. Structural analysis of how podocytes detach from the glomerular basement membrane under hypertrophic stress

    Directory of Open Access Journals (Sweden)

    Wilhelm eKriz

    2014-12-01

    Full Text Available Podocytes are lost by detachment from the GBM as viable cells; details are largely unknown. We studied this process in the rat after growth stimulation with FGF-2. Endothelial and mesangial cells responded by hyperplasia, podocytes underwent hypertrophy, but, in the long run, developed various changes that could either be interpreted showing progressing stages in detachment from the GBM or stages leading to a tighter attachment by foot process effacement (FPE. This occurred in microdomains within the same podocyte; thus features of detachment and of reinforced attachment may simultaneously be found in the same podocyte.(1 Initially, hypertrophied podocytes underwent cell body attenuation and formed large pseudocysts, i.e. expansions of the subpodocyte space.(2 Podocytes entered the process of FPE starting with the retraction of foot processes and the replacement of the slit diaphragm by occluding junctions thereby sealing the filtration slits. Successful completion of this process led to broad attachments of podocyte cell bodies to the GBM. (3 Failure of sealing the slits led to gaps of varying width between retracting foot processes facilitating the outflow of the filtrate from the GBM.(4 Since those gaps are frequently overarched by broadened primary processes the drainage of the filtrate into the Bowman's space may be hindered leading to the formation of small pseudocysts associated with bare areas of GBM.(5 The merging of pseudocysts created a system of communicating chambers through which the filtrate has to pass to reach Bowman's space. Multiple flow resistances in series likely generated an expansile force on podocytes contributing to detachment.(6 Such a situation appears to proceed to complete disconnection generally of a group of podocytes owing to the junctional connections between them. (7 Since such groups of detaching podocytes generally make contact to parietal cells, they start the formation of tuft adhesions to Bowman's capsule.

  8. Structural analysis of how podocytes detach from the glomerular basement membrane under hypertrophic stress.

    Science.gov (United States)

    Kriz, Wilhelm; Hähnel, Brunhilde; Hosser, Hiltraud; Rösener, Sigrid; Waldherr, Rüdiger

    2014-01-01

    Podocytes are lost by detachment from the GBM as viable cells; details are largely unknown. We studied this process in the rat after growth stimulation with FGF-2. Endothelial and mesangial cells responded by hyperplasia, podocytes underwent hypertrophy, but, in the long run, developed various changes that could either be interpreted showing progressing stages in detachment from the GBM or stages leading to a tighter attachment by foot process effacement (FPE). This occurred in microdomains within the same podocyte; thus, features of detachment and of reinforced attachment may simultaneously be found in the same podocyte. (1) Initially, hypertrophied podocytes underwent cell body attenuation and formed large pseudocysts, i.e., expansions of the subpodocyte space. (2) Podocytes entered the process of FPE starting with the retraction of foot processes (FPs) and the replacement of the slit diaphragm by occluding junctions, thereby sealing the filtration slits. Successful completion of this process led to broad attachments of podocyte cell bodies to the GBM. (3) Failure of sealing the slits led to gaps of varying width between retracting FPs facilitating the outflow of the filtrate from the GBM. (4) Since those gaps are frequently overarched by broadened primary processes, the drainage of the filtrate into the Bowman's space may be hindered leading to the formation of small pseudocysts associated with bare areas of GBM. (5) The merging of pseudocysts created a system of communicating chambers through which the filtrate has to pass to reach Bowman's space. Multiple flow resistances in series likely generated an expansile force on podocytes contributing to detachment. (6) Such a situation appears to proceed to complete disconnection generally of a group of podocytes owing to the junctional connections between them. (7) Since such groups of detaching podocytes generally make contact to parietal cells, they start the formation of tuft adhesions to Bowman's capsule.

  9. Vitalidad y tradición de hipocorísticos empleados en la ciudad de México: 1955-1999. Un estudio comparativo

    OpenAIRE

    Baez Pinal, Gloria Estela; Centro de Lingüística Hispánica, Instituto de Investigaciones Filológicas, UNAM

    2013-01-01

    La antroponimia en español es sin duda uno de los campos menos atendidos en los estudios lingüísticos de nuestro país, hecho que se refleja en los contados trabajos dedicados a los hipocorísticos. Dentro de este tema hay uno cuya lectura resulta obligada para los interesados en él, me refiero al artículo de Peter Boyd-Bowman, "Cómo obra la fonética infantil en la formación de los hipocorísticos", publicado en la ya lejana década de los cincuenta.

  10. Polymerase Chain Reaction (PCR) Analysis of Microbial Consortia on Wastewater Treatment Processes for High Explosives

    Science.gov (United States)

    2009-09-01

    propagating explo- sions have occurred on Navy ships, most notably the Forrestal in 1967 and Enterprise in 1969 ( Darwin et al. 2005). To prevent such...Applied Biosystems (ABI) Sequencing Buffer (Applied Biosys- tems, Forest City, CA) • 1 μl of 1 μM M13 forward primer • 0.75 μl of water ERDC/CERL...Magazine. Jul-Aug:31-34. Darwin , R. L., H. L. Bowman, M. Hunstad, W. B. Leach, and F. W. Williams. 2005. Aircraft carrier flight and hangar deck fire

  11. El mundo del libro: Diciembre de 1966

    Directory of Open Access Journals (Sweden)

    Agustín Rodríguez Garavito

    1966-12-01

    Full Text Available Se presentan las reseñas de las siguientes obras y autores: -Epicoidal. Fajardo, Julio José -Índice geobiográfico de cuarenta mil pobladores españoles de america en el siglo XVI. Boyd-Bowman, Peter -Frontera lírica. Gutiérrez Calderón, Teodoro -Historia extensa de Colombia. Lerner -Raíces silenciosas. Rosales, Rafael María -Jauja Antigua. Espinosa Bravo, Clodoaldo Alberto -Caro en Roma. Instituto Caro y Cuervo.

  12. Familial band--shaped keratopathy and spheroidal degeneration. Clinical and electron microscopic study.

    Science.gov (United States)

    Kloucek, F

    1977-12-31

    Presumptive primary band-shaped keratopathy was described in a 35-year-old man and his 62-year-old paternal uncle. Lamellar keratoplasty was performed in one eye in each of these patients. The light and electron microscopic studies were carried out on both corneal specimens. Histologic stains for calcium were negative. Noncalcific band-shaped keratopathy was confirmed by electron microscopic findings too. Electron-dense globular deposits were found in the region of Bowman's membrane and superficial stroma. These may be characterized as a secondary form of spheroidal degeneration.

  13. Label-free structural characterization of mitomycin C-modulated wound healing after photorefractive keratectomy by the use of multiphoton microscopy

    Science.gov (United States)

    Lo, Wen; Wang, Tsung-Jen; Chen, Wei-Liang; Hsueh, Chiu-Mei; Chen, Shean-Jen; Chen, Yang-Fang; Chou, Hsiu-Chu; Lin, Pi-Jung; Hu, Fung-Rong; Dong, Chen-Yuan

    2010-05-01

    We applied multiphoton autofluorescence (MAF) and second-harmonic generation (SHG) microscopy to monitor corneal wound healing after photorefractive keratectomy (PRK). Our results show that keratocyte activation can be observed by an increase in its MAF, while SHG imaging of corneal stroma can show the depletion of Bowman's layer after PRK and the reticular collagen deposition in the wound healing stage. Furthermore, quantification of the keratocyte activation and collagen deposition in conjunction with immunohistochemistry and histological images demonstrate the effectiveness of mitomycin C (MMC) in suppressing myofibroblast proliferation and collagen regeneration in the post-PRK wound healing process.

  14. Morphological evaluation of normal human corneal epithelium

    DEFF Research Database (Denmark)

    Ehlers, Niels; Heegaard, Steffen; Hjortdal, Jesper

    2010-01-01

    PURPOSE: The human corneal epithelium is usually described as a 50-µm-thick layer of regular stratified squamous non-keratinized cells with a thickness of 5-7 cells. The purpose of this study is systemically to revisit the histopathological appearance of 100 corneas. METHODS: 5-µm-thick sections...... in Bowman's membrane. No intraepithelial microcysts, as found in Meesmann corneal dystrophy, were observed. CONCLUSION: The total corneal thickness was higher than reported in in vivo studies and with a wider variation. This may be an effect of uncontrolled swelling and dehydration during preparation...

  15. The Role of Mitogen-Activated Protein (MAP Kinase Signaling Components in the Fungal Development, Stress Response and Virulence of the Fungal Cereal Pathogen Bipolaris sorokiniana.

    Directory of Open Access Journals (Sweden)

    Yueqiang Leng

    Full Text Available Mitogen-activated protein kinases (MAPKs have been demonstrated to be involved in fungal development, sexual reproduction, pathogenicity and/or virulence in many filamentous plant pathogenic fungi, but genes for MAPKs in the fungal cereal pathogen Bipolaris sorokiniana have not been characterized. In this study, orthologues of three MAPK genes (CsSLT2, CsHOG1 and CsFUS3 and one MAPK kinase kinase (MAPKKK gene (CsSTE11 were identified in the whole genome sequence of the B. sorokiniana isolate ND90Pr, and knockout mutants were generated for each of them. The ∆Csfus3 and ∆Csste11 mutants were defective in conidiation and formation of appressoria-like structures, showed hypersensitivity to oxidative stress and lost pathogenicity on non-wounded leaves of barley cv. Bowman. When inoculated on wounded leaves of Bowman, the ∆Csfus3 and ∆Csste11 mutants were reduced in virulence compared to the wild type. No morphological changes were observed in the ∆Cshog1 mutants in comparison with the wild type; however, they were slightly reduced in growth under oxidative stress and were hypersensitive to hyperosmotic stress. The ∆Cshog1 mutants formed normal appressoria-like structures but were reduced in virulence when inoculated on Bowman leaves. The ∆Csslt2 mutants produced more vegetative hyphae, had lighter pigmentation, were more sensitive to cell wall degrading enzymes, and were reduced in virulence on Bowman leaves, although they formed normal appressoria like the wild type. Root infection assays indicated that the ∆Cshog1 and ∆Csslt2 mutants were able to infect barley roots while the ∆Csfus3 and ∆Csste11 failed to cause any symptoms. However, no significant difference in virulence was observed for ∆Cshog1 mutants while ∆Csslt2 mutants showed significantly reduced virulence on barley roots in comparison with the wild type. Our results indicated that all of these MAPK and MAPKKK genes are involved in the regulation of fungal

  16. Revisiting the JDL Model for Information Exploitation

    Science.gov (United States)

    2013-07-01

    L. Bowman, and F. E. White, “Revisions to the JDL model,” Joint NATO/IRIS Conf., 1998. [3] E. Blasch and S. Plano , “JDL Level 5 Fusion model ‘user...33] E. Blasch and S. Plano , “Cognitive Fusion Analysis Based on Context,” Proc. of SPIE, Vol. 5434, 2004. [34] E. Blasch, “Level 5 (User...Aerospace Elect. Conf., 2011. [46] E. Blasch and S. Plano , “Proactive Decision Fusion for Site Security,” Int. Conf. on Info Fusion, 2005. [47] A. N

  17. Action of plant proteinase inhibitors on enzymes of physiopathological importance.

    Science.gov (United States)

    Oliva, Maria Luiza V; Sampaio, Misako U

    2009-09-01

    Obtained from leguminous seeds, various plant proteins inhibit animal proteinases, including human, and can be considered for the development of compounds with biological activity. Inhibitors from the Bowman-Birk and plant Kunitz-type family have been characterized by proteinase specificity, primary structure and reactive site. Our group mostly studies the genus Bauhinia, mainly the species bauhinioides, rufa, ungulata and variegata. In some species, more than one inhibitor was characterized, exhibiting different properties. Although proteins from this group share high structural similarity, they present differences in proteinase inhibition, explored in studies using diverse biological models.

  18. Computational Prediction of Kinetic Rate Constants

    Science.gov (United States)

    2009-02-01

    Scotland , 2000 (unpublished). 7. R. S. Zhu and M. C. Lin, J. Chem. Phys. 119 (20), 10667 (2003). 8. J. F. Stanton, J. Gauss, W. J. Lauderdale, and R...Miller and C. T. Bowman, Prog. Energy. Combust. Sci. 15, 287 (1989); D. Lindackers, M. Burmeister and P. Roth , in: 23rd Symp. (Int.) Combust. Proc...Proc. 25, 801 - 808 (1994) F. Kaufman,and F.P. Del Greco, Symp. Int. Combust. Proc. 9 (1963); K. Natarajan, and P. Roth , Combust. Flame 70, 267 - 279

  19. Association of fluorescein anterior corneal mosaic and corneal K-structures by in vivo laser confocal microscopy in patients with keratoconus.

    Science.gov (United States)

    Kobayashi, Akira; Yokogawa, Hideaki; Mori, Natsuko; Masaki, Toshinori; Sugiyama, Kazuhisa

    2017-01-01

    To report the in vivo laser confocal microscopy findings of corneas with keratoconus, with special attention to abnormality of Bowman's layer and sub-Bowman's fibrous structures (Kobayashi-structures [K-structures]). Sixteen keratoconic eyes in 8 consecutive patients with keratoconus (4 males, 4 females, mean age, 41.1 years) were included in this study. Slit-lamp biomicroscopic photos were taken with or without fluorescein staining. The existence of anterior corneal mosaic (ACM) after eyelid rubbing under fluorescein staining was documented. In vivo laser confocal microscopic examinations were performed for all patients in both the central cone and the peripheral cornea to examine the existence of K-structures. According to the Amsler-Krumeich scale, the eyes were graded as follows: stage 1 (n=3), stage 2 (n=1), stage 3 (n=1), and stage 4 (n=11). ACM was observed in 7 eyes (61.1%) in the cone area and 16 eyes (100%) in the peripheral cornea among all keratoconic eyes enrolled in this study. In addition, K-structures were observed in the 7 eyes (61.1%) and 16 eyes (100%) in the peripheral cornea among all keratoconic eyes. The presence of the K-structures was completely matched (100%) with the presence of ACM in both the central cone and the peripheral cornea. In 11 eyes with stage 4 keratoconus, ACM and K-structure was absent in 9 eyes (81.8%) in the cone area. On the contrary, in 5 eyes with mild-to-moderate keratoconus (grade 1 to 3), ACM and K-structure was present in all eyes (100%) in the cone area. The absent ratio of ACM and K-structures in the cone area was significantly higher in stage 4 severe keratoconus compared to mild-to-moderate keratoconus (grade 1 to 3) (Fisher, P=0.005). The existence of ACM and K-structures in both the central cone and the peripheral cornea showed perfect accord in patients with keratoconus, indicating a strong association of ACM and K-structures in patients with keratoconus. With the progress of the keratoconus, it seemed that

  20. Leaders as Targets

    Science.gov (United States)

    2008-05-16

    Pablo Escobar .18 Some analysts also assert that the U.S. military air strikes in Libya in 1983, the U.S. inva- 6 sion of Panama in 1989, and the U.S. air...snapshot17.htm 18 See Bowden, Mark, Killing Pablo , (Atlantic Monthly Press, New York), 2001 19 Strikes summarized in Bowman, Stephen When the Eagle...Causes and Prevention of War, 2d Edition. New York: St Martin’s Press, 1994, pp. 7-40, 246-247 Bowden, Mark. Killing Pablo . New York: Atlantic

  1. Summaries of Papers Presented at the Picosecond Electronics and Optoelectronics Topical Meeting Held in Salt Lake City, Utah on March 8-10, 1989

    Science.gov (United States)

    1989-12-31

    Rochester; X. J. Song, G. Wicks, W. J. Schaff , L F. Eastman, microwave compatible process with current densities of 1.3 Cornell U.; G. A. Mourou, U...Photoconductive Switches, Steven C. Moss, John F. Knud- 5:30 PM-7:00 PM sen, Robert C. Bowman, Paul M. Adams , Duane D. Smith, WE POSTER...Road, Rochester, NY 14623; X.J. Song, 0. Wicks, W.J. Schaff , and L.F. Eastman, The School of Electrical Engineering, Cornell University, Ithaca, NY 14850

  2. Uncovering Topological Structures in Unstructured Data

    Science.gov (United States)

    2015-04-20

    AFRL-OSR-VA-TR-2015-0091 Uncovering Topological Structures in Unstructured Data Keith Bowman ILLINOIS INSTITUTE OF TECHNOLOGY Final Report 04/20/2015...COVERED (From - To)      01-05-2012 to 30-04-2015 4.  TITLE AND SUBTITLE Uncovering Topological Structures in Unstructured Data 5a.  CONTRACT NUMBER 5b...scanned point-cloud data . It has two stages. In the first stage, we analyzed scan data and extracted topologically critical points. We used these critical

  3. Morphological characterization of keratoconus-affected human corneas by SHG imaging and correlation analysis

    Science.gov (United States)

    Mercatelli, R.; Ratto, F.; Tatini, F.; Rossi, F.; Menabuoni, L.; Nicoletti, R.; Pini, R.; Pavone, Frederick; Cicchi, R.

    2016-03-01

    Keratoconus is an ophthalmic disease in which the cornea acquires an abnormal conical shape that prevents the correct focusing on the retina, causing visual impairment. The late diagnosis of keratoconus is among the principal causes of corneal transplantation surgery. In this study, we characterize the morphology of keratoconic corneas by means of the correlation of SHG images, finding that keratoconus can be diagnosed by analyzing the inclination of lamellae below Bowman's membrane. In addition, imaging performed with both sagittal and "en face" geometry demonstrated that this morphological features can be highlighted both ex vivo and in vivo.

  4. Kartagener syndrome with focal segmental glomerulosclerosis.

    Science.gov (United States)

    Momeni, Ali; Doroushi, Behzad; Taheri, Nadia

    2013-11-01

    Primary ciliary dyskinesia is characterized by congenital impairment of mucociliary clearance. Kartagener syndrome (KS) is a clinical variant of primary ciliary dyskinesia which is involved in situs inversus associated with chronic respiratory infections. In addition, glomerular disease in KS syndrome is rare and reported cases are limited. We had a 27-year-old female patient with KS who presented with proteinuria, hematuria, normal kidney function, and a family history of systemic lupus erythematosus. Kidney biopsy showed segmental scar with adhesion to Bowman capsule, which was indicative of focal segmental glomerulosclerosis.

  5. The Role of Mitogen-Activated Protein (MAP) Kinase Signaling Components in the Fungal Development, Stress Response and Virulence of the Fungal Cereal Pathogen Bipolaris sorokiniana.

    Science.gov (United States)

    Leng, Yueqiang; Zhong, Shaobin

    2015-01-01

    Mitogen-activated protein kinases (MAPKs) have been demonstrated to be involved in fungal development, sexual reproduction, pathogenicity and/or virulence in many filamentous plant pathogenic fungi, but genes for MAPKs in the fungal cereal pathogen Bipolaris sorokiniana have not been characterized. In this study, orthologues of three MAPK genes (CsSLT2, CsHOG1 and CsFUS3) and one MAPK kinase kinase (MAPKKK) gene (CsSTE11) were identified in the whole genome sequence of the B. sorokiniana isolate ND90Pr, and knockout mutants were generated for each of them. The ∆Csfus3 and ∆Csste11 mutants were defective in conidiation and formation of appressoria-like structures, showed hypersensitivity to oxidative stress and lost pathogenicity on non-wounded leaves of barley cv. Bowman. When inoculated on wounded leaves of Bowman, the ∆Csfus3 and ∆Csste11 mutants were reduced in virulence compared to the wild type. No morphological changes were observed in the ∆Cshog1 mutants in comparison with the wild type; however, they were slightly reduced in growth under oxidative stress and were hypersensitive to hyperosmotic stress. The ∆Cshog1 mutants formed normal appressoria-like structures but were reduced in virulence when inoculated on Bowman leaves. The ∆Csslt2 mutants produced more vegetative hyphae, had lighter pigmentation, were more sensitive to cell wall degrading enzymes, and were reduced in virulence on Bowman leaves, although they formed normal appressoria like the wild type. Root infection assays indicated that the ∆Cshog1 and ∆Csslt2 mutants were able to infect barley roots while the ∆Csfus3 and ∆Csste11 failed to cause any symptoms. However, no significant difference in virulence was observed for ∆Cshog1 mutants while ∆Csslt2 mutants showed significantly reduced virulence on barley roots in comparison with the wild type. Our results indicated that all of these MAPK and MAPKKK genes are involved in the regulation of fungal development under

  6. A vision for better healthcare in India.

    Science.gov (United States)

    Baillie, Jonathan

    2013-10-01

    Ian Hinitt, until the Summer of 2012 deputy director of Estates at Bradford Teaching Hospitals NHS Foundation Trust, is spearheading an ambitious joint-venture project between Apex 4D, he and his business partner, Balbir Panesar's recently established Bradford-based outsourced FM company, and Leeds-headquartered architectural practice, Bowman Riley, which the project partners hope will initiate the construction of a new generation of modular buildings to improve healthcare provision throughout India, and, in the process, generate significant reciprocal trade opportunities for both UK and Indian suppliers to the sector. HEJ editor, Jonathan Baillie, reports.

  7. Two Myxobolus spp. infecting the kidney of Nile tilapia (Oreochromis niloticus) in the River Nile at Beni-Suef governorate, Egypt, and the associated renal changes.

    Science.gov (United States)

    Abdel-Baki, Abdel-Azeem S; Abdel-Haleem, Heba M; Sakran, Thabet; Zayed, Eman; Ibrahim, Khalid E; Al-Quraishy, Saleh

    2015-03-01

    Two Myxobolus spp. are described from the kidney of the Nile tilapia (Oreochromis niloticus) collected from the River Nile, Egypt. The prevalence of infection was 61 % (47/77), with the infected fish in each case parasitized by the two Myxobolus species simultaneously. The infection was exhibited as free spores in Bowman capsules and renal glomeruli, which makes their original structures difficult to discern. In some cases, the infection appeared as a fibrous plasmodia-like structure containing degenerated developmental stages and spores in the interstitium. The paper identifies each species based on the morphological characteristics of its spores and identifies the histological impacts of Myxobolus infection in this species of fish.

  8. Towards Unbiased Evaluation of Uncertainty Reasoning: The URREF Ontology

    Science.gov (United States)

    2013-01-01

    surrounding the needs and the relevant processes for information fusion. The Joint Director of the Lab’s ( JDL ) model and its subsequent revisions...problem that was the source of the data request. This is a criterion specific to HLIF fusion systems that work at levels 3 and above of the JDL and...Paulo Costa for this research, under grant W911NF- 11-1-0176. REFERENCES [1] A. N. Steinberg, C. L. Bowman, and F. E. White, “Revisions to the JDL

  9. Analysis of Head and Neck Dynamic Response of the U.S. Adult Military Population.

    Science.gov (United States)

    1986-04-15

    simulation results at -6Gx showed the largest error in condyles extension to be in peak and duration of condylar extension motion. Therefore, neck ...satisfactory. It was subsequently concluded that a two-joint neck with pivot points at the occipital * condyles and at T1 cannot produce a condylar ...Report No. 3 Analysis of Head and Neck Wow Dynamic Response of the U.S. Adult Military Population A.C. Bosio B.M. Bowman L-LECTEK JUL 08 i82 PREPARED

  10. Evaluation of Ho:KPb2Cl5 as a Diode-Pumpable Mid-IR Laser Material

    Science.gov (United States)

    2016-09-01

    in our study appears to be better overall, it may have more pairs or clusters of Ho3+ ions than did the older samples. Approved for public release...properties of tare-earth-activated alkali metal lead chlorides. Inorg Mater. 2006;42(1):81–88. 7. Tkachuk AM, Ivanova SE, Joubert M-F, Guyot Y...IEEE J Quantum Electron. 1982;QE-18(5):925–930. 16. Condon NJ, O’Connor S, Bowman SR. Growth and characterization of single- crystal Er3+:KPb2Cl5 as a

  11. 电影 音乐

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    英文名称:Like Mike 中文名称:乔丹传人/像迈克那样首映日期:2002年7月3日 发行公司:福克斯(20th Century Fox)电影导演:约翰·舒尔茨John Schultz主演:利尔·鲍·沃Lil'Bow Wow 莫里斯·柴斯纳特Morris Chestnut 乔纳森·里普尼基Jonathan Lipnicki 桑德拉·普洛斯波Sandra Prosper

  12. Hair stylist wins handsome reward, but will his estate collect?

    Science.gov (United States)

    1999-04-16

    A hair salon in Washington, D.C., has been ordered to pay $445,190 in damages to a former stylist who was fired because he had an AIDS-related skin tumor. The stylist, [name removed], died in 1996, and his estate continued the litigation. Although the salon, Natural Motion by Sandra, Inc., and a partner in the corporation were found to have discriminated against [name removed], the salon is no longer in business. It is questionable if the estate will ever collect. The District of Columbia Human Rights Act prohibits firing workers for discriminatory reasons based on personal appearance or physical disability.

  13. Alterations of the Bone Marrow Microenvironment Contribute to Prostate Cancer Skeletal Metastasis

    Science.gov (United States)

    2012-05-01

    584–593. doi:10.1038/ nrc867 14. Roodman GD (2004) Mechanisms of bone metastasis. New Engl J Med 350(16):1655–1664. doi:10.1056/NEJMra030831 15...90. doi:10.1182/blood-2006-05-021352 39. Shiozawa Y, Havens AM, Jung Y, Ziegler AM, Pedersen EA, Wang J, Lu G, Roodman GD, Loberg RD, Pienta KJ...6 Fabiana N. Soki1, David Sadler1, Sudha Sud2, Sandra Tisdelle5, Stephanie D. Daignault4, Jeffrey A. Nemeth6, 7 Linda A. Snyder6, Thomas J. Wronski5

  14. ¿Como significan los técnicos-profesionales del sistema educativo las llamadas intervenciones institucionales?

    OpenAIRE

    Enrico, Liliana Noemí

    2011-01-01

    Esta ponencia se enmarca en el trabajo de investigación "Intervenciones Institucionales en el espacio escolar actual y transmisión de la cultura" dirigido por la Mg. Sandra Bertoldi, y aprobado por la Secretaria de Investigación de la Universidad Nacional del Comahue, Centro Regional Viedma)La misma tiene como objetivo desmontar las intervenciones que llevan adelante los Técnicos profesionales de la asistencia técnica del sistema educativo rionegrino, para en primer lugar, identificar como la...

  15. Cholesteroid nature of free mycolic acids from m. tuberculosis

    CSIR Research Space (South Africa)

    Benadie, Y

    2008-01-01

    Full Text Available of Free Mycolic Acids from M. tuberculosis. Benadie Yolandy1 ? , Deysel Madrey1 ? , Siko D Gilbert R1, Roberts Vanessa V1, Van Wyngaardt Sandra1, Thanyani T Simon1, Sekanka Gianna1, Ten Bokum Annemieke MC1 , Collett Lynne A2, Grooten Johan3....5, 12.1 ppm. 8 2.4. ELISA The human sera used in the ELISA experiments were from two sources: The first was from a pulmonary TB positive collection that was made in 1994 by the MRC Clinical and Biomedical TB Research Unit at King George V...

  16. Editorial

    Directory of Open Access Journals (Sweden)

    Fábio Vergara Cerqueira

    2012-09-01

    Full Text Available O quarto número dos Cadernos procura trazer estudos concernentes às três temáticas centrais da publicação, Patrimônio, Antropologia e Arqueologia. Composto por seis artigos e uma resenha, a composição autoral deste volume mescla, intencionalmente, autores consagrados em suas áreas de  pesquisa, como os historiadores Sandra Pesavento e Francisco Marshall, com jovens pesquisadores, formados na própria UFPEL, como Rafael Guedes Milheira, Welcsoner Silva da Cunha e Luiz Carlos da Silva Júnior.

  17. Implicancias del discurso y la acción en la relación universitaria con los movimientos sociales : Simposio

    OpenAIRE

    Zaldua, Graciela

    2007-01-01

    Resumen del Simposio coordinado por Graciela Zaldúa, M. Bottinelli y María Pía Pawlowicz y resumen de las ponencias presentadas: -Movimiento de Trabajadores Desocupados y formación de promotores en salud; María Belén Sopransi. -Diagnóstico comunitario del barrio Las Flores; Mariela Nabergoi. -Estudio epidemiológico comunitario de las condiciones de salud en General Mosconi – Salta; Roxana Longo. -Migración y participación asamblearia; Sandra Estrada Maldonado.

  18. Eesti-Leedu sõpruskohtumised / Maarin Ektermann

    Index Scriptorium Estoniae

    Ektermann, Maarin

    2007-01-01

    Noorte maalikunstnike ühisnäitused "Shoot or Shout - No Escape" Vilniuse Art's Printing House'is 19. X-3. XI 2006 (lisaks kodus maalitud töödele maalisid Aivar Reisner, Sirli Hein ja Rait Rosin remake'e leedu kunstnike töödest) ja "Fresh Paint" Vaal-galeriis 29. III-17. IV. Paaride Triinu Lill ja Agne Jonkute, Sirli Hein ja Sandra Lukoshevichiute, Agne Kulbyte ja Merike Estna ning Rait Rosina, Konstantinas Gaitanzhi ja Elis Saarevälja töödest

  19. Kunstnike Liit

    Index Scriptorium Estoniae

    2004-01-01

    EKLi volikogu töökoosolek 5. IV. SA ERF alllfondina loodud Olev Soansi mälestusfondi toetamisest, EKLi 2005. a. aastanäituse korraldamisest Tallinna Kunstihoones, vajalikest täiendustest ja muudatustest põhikirjas, mis puudutavad tehinguid Tallinna Kunstihoone ja selle galeriiga. Võeti vastu tööjuhised SA Tallinna Kunstihoone Fondi nõukogule. EKLi uued liikmed: Kaarel Eelma, Piret Hirv, Sandra Jõgeva, Irene Jürna, Kristin Kalamees, Kristiina Laurits, Eve Margus-Villems, Villu Plink, Lembe Ruben, Katrin Sipelgas, Margus Tamm, Tanel Veenre

  20. Multicultural Counseling : Issues and Analysis

    OpenAIRE

    Donahue, Ray T

    2007-01-01

    In this working paper, I consider a case in multicultural counseling of “Sandra,” a Brazilian black female who emigrated to Portugal but who characterizes her experience there like that of Cinderella’s pumpkin, a heartbreak reversal of fortune. Invited to assess her case, I shall treat it as if a referral for counseling from a case worker, for that is nearly how I got involved. Given a sketchy set of notes from her file, I found that her case could be instructive for multicultural counseling,...