WorldWideScience

Sample records for samarium 149

  1. Comparison of xenon-135 and samarium-149 poisoning in the Miniature Neutron Source Reactor

    International Nuclear Information System (INIS)

    Khattab, K.

    2005-05-01

    The Xe-135 equilibrium reactivity was calculated previously using the WIMSD4 and CITATION codes to estimate the fission product poisoning factor in the Syrian Miniature Neutron Source Reactor (MNSR). The fission product poisoning factor was used to calculate the Xe-135 concentrations and reactivities during the reactor operation, at saturation, and after shutdown. The fission product poisoning factor is used in this study to calculate the Sm-149 concentrations and reactivities during the reactor operation, at saturation, and after shutdown. The results are compared with Xe-135 concentrations and reactivities which were calculated before. The Xe-135 concentration increases versus the reactor operation time and reaches 2.836*10 13 atoms/cm 3 after 6 hours, where the Sm-149 concentration reaches 0.745*10 12 atoms/cm 3 . The Xe-135 and Sm-149 reactivities reach -0.451 and -0.256*10 -3 mk respectively after 6 hours of the reactor operation time. It is found that the Xe-135 and Sm-149 reactivities do not reach the equilibrium reactivities during typical reactor daily operating time. The Xe-235 concentration and reactivity are increased and reach to maximum values after 30000 second from the reactor shut down. Its maximum reactivity is -0.903 mk. Hence, the Xe-235 generates -0.452 mk extra reactivity after the reactor shutdown. The Sm-149 concentration and reactivates are increased after the reactor shut down. The Sm-149 reactivity reaches -0.249*10 -2 mk after 100000 second from the reactor shut down, and the Sm-149 introduces -2.231*10 -3 mk extra reactivity after the reactor shut down. Finally, the amount of Sm-149 accumulated in the reactor core after 1, 2, 5, and 10 years of the reactor operation time are: 3.995*10 -3 , 7.694*10 -3 , 17.226*10 -3 , and 2.892*10 -2 grams respectively. (Author)

  2. Basis for developing samarium AMS for fuel cycle analysis

    International Nuclear Information System (INIS)

    Buchholz, Bruce A.; Biegalski, Steven R.; Whitney, Scott M.; Tumey, Scott J.; Jordan Weaver, C.

    2010-01-01

    Modeling of nuclear reactor fuel burnup indicates that the production of samarium isotopes can vary significantly with reactor type and fuel cycle. The isotopic concentrations of 146 Sm, 149 Sm, and 151 Sm are potential signatures of fuel reprocessing, if analytical techniques can overcome the inherent challenges of lanthanide chemistry, isobaric interferences, and mass/charge interferences. We review the current limitations in measurement of the target samarium isotopes and describe potential approaches for developing Sm-AMS. AMS sample form and preparation chemistry will be discussed as well as possible spectrometer operating conditions.

  3. Xe-135 and Sm-149 Isotopic Evolution Analysis Xesamo code

    International Nuclear Information System (INIS)

    Caro, R.; Gallego, J.; Martinez Fanegas, R.

    1977-01-01

    In this report the time evolution analysis of the nuclides concentration Xe-135 and Sm-149 as a function of the neutron flux is carried out. The neutron flux may be any function of time. It is analyzed as well the reactivity changes associated with the xenon and samarium concentration variations. (Author) 5 refs

  4. Xe-135 and Sm-149 Isotopic Evolution Analysis Xesamo code; Analisis de la Evolucion Isotopica del Xe-135 y Sm-149. Programa Xesamo

    Energy Technology Data Exchange (ETDEWEB)

    Caro, R; Gallego, J; Martinez Fanegas, R

    1977-07-01

    In this report the time evolution analysis of the nuclides concentration Xe-135 and Sm-149 as a function of the neutron flux is carried out. The neutron flux may be any function of time. It is analyzed as well the reactivity changes associated with the xenon and samarium concentration variations. (Author) 5 refs.

  5. Conductometric investigations on samarium soaps

    International Nuclear Information System (INIS)

    Mehrotra, K.N.; Chauhan, Mithlesh; Shukla, R.K.

    1989-01-01

    The critical micelle concentration (CMC), degree of dissociation and dissociation constant of samarium soaps (valerate, caproate, caprylate and caprate) in a mixture of 60 per cent benzene and 40 per cent methanol were determined by using conductometric measurements. The soaps behaved as simple electrolyte in dilute solutions and the CMC was found to decrease with increasing chainlength of the fatty acid constituent of the soap. (author). 7 refs., 2 tabs

  6. Labeling fish with an activable element through their diet. [samarium

    Energy Technology Data Exchange (ETDEWEB)

    Michibata, Hitoshi (Toyama Univ. (Japan). Faculty of Science)

    1981-10-01

    Stable samarium, one of the rare earth elements, was fed to medaka (Oryzias latipes) and goldfish (Carassius auratus). The concentration of samarium in the labeled fish was determined by neutron activation analysis. In O. latipes, samarium was detectable even 1 yr after the labeled diet was eaten. In C. auratus, samarium was retained in the fifth brachial arch, scales, and gills.

  7. Implementation of an analytical technique for Samarium

    International Nuclear Information System (INIS)

    Garcia G, N.

    2004-01-01

    Since the Samarium presents the same chemical properties that the plutonium, it has been used as homologous in studies that allow us to know the behavior that the plutonium presents in solution, with the advantage of working with an inactive and not very dangerous element. At the moment studies of sorption of plutonium or samarium are made on some mineral matrices that present certain surface properties. Due to the low concentrations that are used in the studies of sorption of samarium on those reagent substrates, their detection becomes very difficult for the conventional analysis media. The luminescence is a technique that can detect lower concentrations, smaller at 1 X 10 - 2 M, but when fluorofors are used this limit of detection increases in several orders of magnitude. In this work it has been used the arsenazo-III as fluorofor agent since it reacts in a specific way with the samarium, forming a complex that presents a proportional luminescence to the concentration of the present samarium. The advantage of making the quantification of samarium by luminescence is that it can use the same instrumental equipment to determine the speciation of the samarium sipped in the zircon. (Author)

  8. Synthesis of samarium binding bleomycin - a possible NCT radiosensitizer

    Energy Technology Data Exchange (ETDEWEB)

    Mendes, B.M., E-mail: bmm@cdtn.b [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil); Mendes, T.M.; Campos, T.P.R., E-mail: campos@nuclear.ufmg.b [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil)

    2011-07-01

    Bleomycin (BLM) is a drug that has attractive features for the development of a new radiopharmaceutical, particularly with regard to neutron capture therapy (NCT) sensitized by Sm-149. It has the ability to chelate many metal ions. In vitro studies have shown that up to 78% of BLM present in a cell is accumulated inside the nucleus or in the nuclear membrane. In addition, this drug has higher affinity for tumor tissues than for normal tissues. Radioactive isotopes carried by this antibiotic would be taken preferentially to one important cellular targets DNA. Besides, BLM displays intrinsic anti-tumor activity - it is a chemotherapic antibiotic clinically used against some cancers. This study aimed to obtain bleomycin molecules bound to samarium (BLM-Sm) for NCT studies in vitro and in vivo. The binding technique employed in this work has great simplicity and low cost. Thin layer chromatography, high performance liquid chromatography, fast protein liquid chromatography and analysis by ICP-AES were applied to verify the binding molecule. ICP-AES results showed the presence of samarium in the sample peaks related to BLM-Sm. However, efficiency and stability of this bond needs to be investigated. (author)

  9. Synthesis of samarium binding bleomycin - a possible NCT radiosensitizer

    International Nuclear Information System (INIS)

    Mendes, B.M.; Mendes, T.M.; Campos, T.P.R.

    2011-01-01

    Bleomycin (BLM) is a drug that has attractive features for the development of a new radiopharmaceutical, particularly with regard to neutron capture therapy (NCT) sensitized by Sm-149. It has the ability to chelate many metal ions. In vitro studies have shown that up to 78% of BLM present in a cell is accumulated inside the nucleus or in the nuclear membrane. In addition, this drug has higher affinity for tumor tissues than for normal tissues. Radioactive isotopes carried by this antibiotic would be taken preferentially to one important cellular targets DNA. Besides, BLM displays intrinsic anti-tumor activity - it is a chemotherapic antibiotic clinically used against some cancers. This study aimed to obtain bleomycin molecules bound to samarium (BLM-Sm) for NCT studies in vitro and in vivo. The binding technique employed in this work has great simplicity and low cost. Thin layer chromatography, high performance liquid chromatography, fast protein liquid chromatography and analysis by ICP-AES were applied to verify the binding molecule. ICP-AES results showed the presence of samarium in the sample peaks related to BLM-Sm. However, efficiency and stability of this bond needs to be investigated. (author)

  10. Laser spectroscopy of atomic samarium

    International Nuclear Information System (INIS)

    Barkov, L.M.; Melik-Pashaev, D.A.; Zolotorev, M.S.

    1988-01-01

    Samarium spectrum was studied with a purpose to find transitions to be used in experiments on parity nonconservation. Macaluso-Corbino effect - Faraday rotation near resonance was used for the search and study of spectral lines. We have identified previously unknown energy levels belonging to the 4f 5 6s 2 5 D term: 15914.55(3) cm -4 (J=1), 17864.29(3) cm -4 (J=2), 20195.76(3) cm -4 (J=3). M1-transitions to these levels from the levels of the ground 4f 5 6s 2 7 F term were observed. There are several peculiarities of these transitions which are due to the fact that they occut within an inner 4f 5 -shell, particularly, a very small presuure broadening by inert gases. 44 refs.; 17 figs.; 7 tabs

  11. Synthesis of Samarium Cobalt Nanoblades

    Energy Technology Data Exchange (ETDEWEB)

    Darren M. Steele

    2010-08-25

    As new portable particle acceleration technologies become feasible the need for small high performance permanent magnets becomes critical. With particle accelerating cavities of a few microns, the photonic crystal fiber (PCF) candidate demands magnets of comparable size. To address this need, samarium cobalt (SmCo) nanoblades were attempted to be synthesized using the polyol process. Since it is preferable to have blades of 1-2 {micro}m in length, key parameters affecting size and morphology including method of stirring, reaction temperature, reaction time and addition of hydroxide were examined. Nanoparticles consisting of 70-200 nm spherical clusters with a 3-5 nm polyvinylpyrrolidone (PVP) coating were synthesized at 285 C and found to be ferromagnetic. Nanoblades of 25nm in length were observed at the surface of the nanoclusters and appeared to suggest agglomeration was occurring even with PVP employed. Morphology and size were characterized using a transmission electron microscope (TEM). Powder X-Ray Diffraction (XRD) analysis was conducted to determine composition but no supportive evidence for any particular SmCo phase has yet been observed.

  12. A NOVEL SAMARIUM COMPLEX WITH INTERESTING ...

    African Journals Online (AJOL)

    delocalized π-electrons of the pyridyl rings obtains increasing attention in ... BaSO4 plate was used as a reference (100% reflectance), on which the finely ground .... several are samarium-containing complex with bipy [41-45]. Figure 2.

  13. Optical isotope shifts for unstable samarium isotopes

    International Nuclear Information System (INIS)

    Eastham, D.A.; Walker, P.M.; Griffith, J.A.R.; Evans, D.E.; Grant, I.S.; England, J.G.; Fawcett, M.J.

    1984-01-01

    Using a tunable dye laser beam intersecting a thermal atomic beam, optical isotope shifts and hyperfine splittings have been measured for the four unstable samarium isotopes between 144 Sm and 154 Sm, covering the well known transition region from spherical to deformed shapes. (orig.)

  14. Nonlinear Faraday rotation in samarium vapor

    International Nuclear Information System (INIS)

    Barkov, L.M.; Melik-Pashaev, D.A.; Zolotorev, M.S.

    1988-01-01

    Experiments on nonlinear magnetic optical (Faraday) rotation on resonance transitions of atomic samarium are described. Measurements were carried out on transitions with different angular momenta of upper and lower states: 1→0, 0→1 and 1→1. Qualitative explanations of observed phenomena are given

  15. Thermal diffusivity of samarium-gadolinium zirconate solid solutions

    International Nuclear Information System (INIS)

    Pan, W.; Wan, C.L.; Xu, Q.; Wang, J.D.; Qu, Z.X.

    2007-01-01

    We synthesized samarium-gadolinium zirconate solid solutions and determined their thermal diffusivities, Young's moduli and thermal expansion coefficients, which are very important for their application in thermal barrier coatings. Samarium-gadolinium zirconate solid solutions have extremely low thermal diffusivity between 20 and 600 deg. C. The solid solutions have lower Young's moduli and higher thermal expansion coefficients than those of pure samarium and gadolinium zirconates. This combination of characteristics is promising for the application of samarium and gadolinium zirconates in gas turbines. The mechanism of phonon scattering by point defects is discussed

  16. Investigation of samarium solubility in the magnesium based solid solution

    International Nuclear Information System (INIS)

    Rokhlin, L.L.; Padezhnova, E.M.; Guzej, L.S.

    1976-01-01

    Electric resistance measurements and microscopic analysis were used to investigate the solubility of samarium in a magnesium-based solid solution. The constitutional diagram Mg-Sm on the magnesium side is of an eutectic type with the temperature of the eutectic transformation of 542 deg C. Samarium is partly soluble in solid magnesium, the less so, the lower is the temperature. The maximum solubility of samarium in magnesium (at the eutectic transformation point) is 5.8 % by mass (0.99 at. %). At 200 deg C, the solubility of samarium in magnesium is 0.4 % by mass (0.063 at. %)

  17. Anodic dissolution of samarium in acetonitrile solution of acetylacetone

    International Nuclear Information System (INIS)

    Kostyuk, N.N.; Dik, T.A.; Trebnikov, A.G.; Shirokij, V.L.

    2003-01-01

    Electrochemical dissolution of metal samarium in acetonitrile medium in the presence of 0.1 M tetraethylammoniumbromide and 0.9 M acetylacetone (HAA) in argon atmosphere under a voltage of 3 V was considered for studying feasibility of electrochemical synthesis of samarium β-diketonates. Using IR and mass spectrometry, thermal and elementary analyses it was ascertained that, depending on cathode and anode areas ratio, anodic dissolution of samarium can give rise to formation of complexes of bi- and trivalent samarium featuring the composition Sm 4 (AA) 8 · 3HAA, Sm(AA) 3 · HAA and Sm(AA) 3 · 4HAA [ru

  18. Crystallization of Yttrium and Samarium Aluminosilicate Glasses

    OpenAIRE

    Lago, Diana Carolina; Prado, Miguel Oscar

    2016-01-01

    Aluminosilicate glasses containing samarium and yttrium (SmAS and YAS glasses) exhibit high glass transition temperatures, corrosion resistance, and glass stability on heating which make them useful for technological applications. Yttrium aluminosilicate glass microspheres are currently being used for internal selective radiotherapy of liver cancer. During the preparation process, crystallization needs to be totally or partially avoided depending on the final application. Thus knowing the cry...

  19. Plasma sprayed samarium--cobalt permanent magnets

    International Nuclear Information System (INIS)

    Willson, M.C.; Janowiecki, R.J.

    1975-01-01

    Samarium--cobalt permanent magnets were fabricated by arc plasma spraying. This process involves the injection of relatively coarse powder particles into a high-temperature gas for melting and spraying onto a substrate. The technique is being investigated as an economical method for fabricating cobalt--rare earth magnets for advanced traveling wave tubes and cross-field amplifiers. Plasma spraying permits deposition of material at high rates over large areas with optional direct bonding to the substrate, and offers the ability to fabricate magnets in a variety of shapes and sizes. Isotropic magnets were produced with high coercivity and good reproducibility in magnetic properties. Post-spray thermal treatments were used to enhance the magnetic properties of sprayed deposits. Samarium--cobalt magnets, sprayed from samarium-rich powder and subjected to post-spray heat treatment, displayed energy products in excess of 9 million gauss-oersteds and coercive forces of approximately 6000 oersteds. Bar magnet arrays were constructed by depositing magnets on ceramic substrates. (auth)

  20. Synthesis of samarium, europium and ytterbium acetylenides

    International Nuclear Information System (INIS)

    Bochkarev, M.N.; Fedorova, E.A.; Glushkova, N.V.; Protchenko, A.V.; Druzhkov , O.N.; Khorshev, S.Ya.

    1995-01-01

    Ethynyl complexes of samarium, europium and ytterbium were prepared by interaction of naphthalinides of metals with acetylene in tetrahydrofuran. The compounds are isolated in the form of dark-coloured pyrophore powders. Data of magnetic measurements suggest that in the course of the reaction Sm(2) is oxidized completely to Sm(3), Yb(2) transforms into Yb(3) partially, whereas europium preserves its initial bivalent state. Hydrolysis of the compounds prepared provides acetylene, ethylene, ethane and hydrogen which indicates the presence of acethylenide Ln 2 C 2 and hydride LnH groupings (Ln = Sm, Eu, Yb). 9 refs., 2 tabs

  1. High purity samarium oxide from mixed rare earth carbonates

    International Nuclear Information System (INIS)

    Queiroz, Carlos A. da S.; Seneda, Jose A.; Vasconcellos, Mari E. de; Pedreira Filho, Walter dos R.

    2013-01-01

    A simple and economical chemical process for the production of highly pure samarium oxides is discussed. The raw material, which was used in the form of rare earth carbonates was produced industrially from the chemical treatment of Brazilian monazite. Ion exchange chromatography was performed using a strong cationic resin that is typically employed in water treatment processes to fractionate rare earth elements (REE) without the use of retention ions. Under these conditions, 99.9% pure Sm 2 O 3 was eluted using the ammonium salt of ethylenediaminetetraacetic acid (EDTA) at a controlled pH. The EDTA-samarium complex was separated from EDTA and then precipitated as oxalate and fired to samarium oxide. Molecular absorption spectrophotometry was used to monitor the samarium content during the proposed process, and sector field inductively coupled plasma mass spectrometry was used to certify the purity of the samarium oxide. Typical samarium oxide obtained from the proposed procedure contained the following contaminants in micrograms per gram: Sc (20.90); Y (11.80); La (8.4); Ce (4.3); Pr (2.5); Nd (5.1); Eu (94); Gd (114); Tb (3.6); Dy (2.5), Ho (2.3); Er (3.0); Tm (2.3); Yb (38,2); Lu (25.6). The high-purity samarium oxides produced in the present study can be used as an alternative to imported products in research and development applications. (author)

  2. Plasma sprayed samarium--cobalt permanent magnets

    International Nuclear Information System (INIS)

    Willson, M.C.; Janowiecki, R.J.

    1975-01-01

    Samarium--Co permanent magnets were fabricated by arc plasma spraying. This process involves the injection of relatively coarse powder particles into a high temperature gas for melting and spraying onto a substrate. The technique is being investigated as an economical method for fabricating Co--rare earth magnets for advanced traveling wave tubes and cross-field amplifiers. Plasma spraying permits deposition of material at high rates over large areas with optional direct bonding to the substrate, and offers the ability to fabricate magnets in a variety of shapes and sizes. Isotropic magnets were produced with high coercivity and good reproducibility in magnetic properties. Post-spray thermal treatments were used to enhance the magnetic properties of sprayed deposits. Samarium--Co magnets, sprayed from Sm-rich powder and subjected to post-spray heat treatment, displayed energy products in excess of 9 million G-Oe and coercive forces of approximately 6000 Oe. Bar magnet arrays were constructed by depositing magnets on ceramic substrates

  3. Physico-chemical studies on samarium soaps in solid state

    International Nuclear Information System (INIS)

    Mehrotra, K.N.; Chauhan, M.; Shukla, R.K.

    1989-01-01

    The physico-chemical characteristics of samarium soaps (caproate and caprate) in solid state were investigated by IR, X-ray diffraction and TGA measurements. The IR results revealed that the fatty acids exist in dimeric state through hydrogen bonding and samarium soaps possess partial ionic character. The X-ray diffraction measurements were used to calculate the long spacings and the results confirmed the double layer structure of samarium soaps. The decomposition reaction was found kinetically of zero order and the values of energy of activation for the decomposition process for caproate and caprate were found to be 8,0 and 7,8 kcal mol -1 , respectively. (Authors)

  4. The ion-exchange obtaining of high purity samarium oxide

    International Nuclear Information System (INIS)

    Brzyska, W.; Soltysiak, I.; Cygan, J.

    1987-01-01

    The use of lactic acid - EDTA mixture as an eluent for the obtaining of high purity samarium oxide was studied. The studies were carried out at room temperature on cation exchange resin Wofatit KPS X 8. The best results were obtained for lactic acid (0,26 mol/dm 3 ) - EDTA (0,013 mol/dm 3 ) mixture at pH 3,3. As the result of 57% samarium concentrate elution with column load 1:3 and flow rate 0,4 cm/min, over 99% pure samarium oxide with 73% yield has been obtained. The yield of spectrally pure Sm 2 O 3 exceeded 45%. (author)

  5. Cross sections for d-{sup 3}H neutron interactions with samarium isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Luo, Junhua; He, Long [Hexi Univ., Zhangye (China). School of Physics and Electromechanical Engineering; Wu, Chunlei; Jiang, Li [Chinese Academy of Engineering Physics, Mianyang (China). Inst. of Nuclear Physics and Chemistry

    2016-11-01

    The cross sections for (n,x) reactions on samarium isotopes were measured at (d-T) neutron energies of 13.5 and 14.8 MeV with the activation technique. Samples were activated along with Nb and Al monitor foils to determine the incident neutron flux. Theoretical calculations of excitation functions were performed using the nuclear model codes TALYS-1.6 and EMPIRE-3.2 Malta with default parameters, at neutron energies varying from the reaction threshold to 20 MeV. The results were discussed and compared with experimental data found in the literature. At neutron energies 13.5 and 14.8 MeV, the cross sections of the {sup 149}Sm(n,p){sup 149}Pm reaction are reported for the first time. The cross sections of the {sup 150}Sm(n,p){sup 150}Pm, {sup 144}Sm(n,p){sup 144}Pm, {sup 152}Sm(n,α){sup 149}Nd and {sup 144}Sm(n,α){sup 141}Nd reactions at different neutron energies reported in the present work can be added as new data in the nuclear databases.

  6. Yellow-green electroluminescence of samarium complexes of 8-hydroxyquinoline

    Energy Technology Data Exchange (ETDEWEB)

    Behzad, Sara Karimi; Najafi, Ezzatollah [Department of Chemistry Shahid Beheshti University G.C., Tehran 1983963113 (Iran, Islamic Republic of); Amini, Mostafa M., E-mail: m-pouramini@sbu.ac.ir [Department of Chemistry Shahid Beheshti University G.C., Tehran 1983963113 (Iran, Islamic Republic of); Janghouri, Mohammad; Mohajerani, Ezeddin [Laser Research Institute Shahid Beheshti University G.C., Tehran 1983963113 (Iran, Islamic Republic of); Ng, Seik Weng [Department of Chemistry, University of Malaya, 50603 Kuala Lumpur (Malaysia)

    2014-12-15

    Four novel samarium complexes were prepared by reacting samarium(III) nitrate with 8-hydroxyquinoline, 2-methyl-8-hydroxyquinoline, and 1,10-phenanthroline and utilized as emitting materials in the electroluminescence device. All complexes were characterized by elemental analysis, infrared, UV–vis and {sup 1}H NMR spectroscopes and the molecular structure of a representative complex, [Sm{sub 2}(Me-HQ){sub 4}(NO{sub 3}){sub 6}] (1), was determined by single-crystal X-ray diffraction. Utilization of a π-conjugated (phenanthroline) ligand as a second ligand in the structure of the samarium complexes resulted in red shifts in both absorption and fluorescence spectra of complexes and moderately enhanced the photoluminescence intensity and the fluorescence quantum yield. The maximum emission peaks showed that a good correlation exists between the nature of the substituent group on the 8-hydroxyquinoline and the addition of the π-conjugated ligand in the structure of samarium complexes and emission wavelength. Devices with samarium(III) complexes with structure of ITO/PEDOT:PSS (90 nm)/PVK:PBD:Sm(III) complexes (75 nm)/Al (180 nm) were fabricated. In the electroluminescence (EL) spectra of the devices, a strong ligand-centered emission and narrow bands arising from the {sup 4}G{sub 5/2}→{sup 6}H{sub J} transitions (J=7/2, 9/2, and 11/2) of the samarium ion were observed for the complexes. The electroluminescent spectra of the samarium complexes were red-shifted as compared with the PVK:PBD blend. We believe that the electroluminescence performance of OLED devices based on samarium complexes relies on overlaps between the absorption of the samarium compounds and the emission of PVK:PBD. This revealed that it is possible to evaluate the electroluminescence performance of the samarium compounds-doped OLED devices based on the emission of PVK:PBD and the absorption of the dopants. - Highlights: • Four novel photoluminescence samarium complexes have been synthesized.

  7. Neutron Capture and Transmission Measurements and Resonance Parameter Analysis of Samarium

    International Nuclear Information System (INIS)

    Leinweber, G.; Burke, J.A.; Knox, H.D.; Drindak, N.J.; Mesh, D.W.; Haines, W.T.; Ballad, R.V.; Block, R.C.; Slovacek, R.E.; Werner, C.J.; Trbovich, M.J.; Barry, D.P.; Sato, T.

    2001-01-01

    The purpose of the present work is to accurately measure the neutron cross sections of samarium. The most significant isotope is 149 Sm, which has a large neutron absorption cross section at thermal energies and is a 235 U fission product with a 1% yield. Its cross sections are thus of concern to reactor neutronics. Neutron capture and transmission measurements were performed by the time-of-flight technique at the Rensselaer Polytechnic institute (RPI) LINAC facility using metallic and liquid Sm samples. The capture measurements were made at the 25 meter flight station with a multiplicity-type capture detector, and the transmission total cross-section measurements were performed at 15- and 25-meter flight stations with 6 Li glass scintillation detectors. Resonance parameters were determined by a combined analysis of six experiments (three capture and three transmission) using the multi-level R-matrix Bayesian code SAMMY version M2. The significant features of this work are as follows. Dilute samples of samarium nitrate in deuterated water (D 2 O) were prepared to measure the strong resonances at 0.1 and 8 eV without saturation. Disk-shaped spectroscopic quartz cells were obtained with parallel inner surfaces to provide a uniform thickness of solution. The diluent feature of the SAMMY program was used to analyze these data. The SAMMY program also includes multiple scattering corrections to capture yield data and resolution functions specific to the RPI facility. Resonance parameters for all stable isotopes of samarium were deduced for all resonances up to 30 eV. Thermal capture cross-section and capture resonance integral calculations were made using the resultant resonance parameters and were compared to results obtained using resonance parameters from ENDF/B-VI updated through release 3. Extending the definition of the capture resonance integral to include the strong 0.1 eV resonance in 149 Sm, present measurements agree within estimated uncertainties with En

  8. Role of samarium additions on the shape memory behavior of iron based alloys

    International Nuclear Information System (INIS)

    Shakoor, R.A.; Khalid, F. Ahmad; Kang, Kisuk

    2011-01-01

    Research highlights: → The effect of samarium contents on shape memory behavior has been studied. → Addition of samarium increases the strength, c/a ratio and ε (hcp martensite). → Addition of samarium retards the nucleation of α (bcc martensite). → Improvement in shape memory effect with the increase in samarium contents. - Abstract: The effect of samarium contents on shape memory behavior of iron based shape memory alloys has been studied. It is found that the strength of the alloys increases with the increase in samarium contents. This effect can be attributed to the solid solution strengthening of austenite by samarium addition. It is also noticed that the shape memory effect increases with the increase in samarium contents. This improvement in shape memory effect presumably can be regarded as the effect of improvement in strength, increase in c/a ratio and obstruction of nucleation of α in the microstructure.

  9. Samarium ion exchanged montmorillonite for high temperature cumene cracking reaction

    International Nuclear Information System (INIS)

    Binitha, N.N.

    2009-01-01

    Full text: Nano material Montmorillonite clay is cation exchanged with samarium and its catalytic influence in cumene cracking reaction is investigated. Effect of exchange with sodium ions on further exchange with samarium ions is also noted. Acidity measurements are done using TPD of ammonia. The retention of basic structure is proved from FTIR spectra and XRD patterns. Elemental analysis result shows that samarium exchange has occurred, which is responsible for the higher catalytic activity. Surface area and pore volume remains more or less unaffected upon exchange. Thermogravimetric analysis indicates the enhanced thermal stability on exchanging. Cumene cracking reaction is carried out at atmospheric pressure in a fixed bed glass reactor at 673 K. The predominance of Bronsted acidity is confirmed from high selectivity to benzene. (author)

  10. 4f and 5d magnetism in samarium

    International Nuclear Information System (INIS)

    Stunault, A.; Bernhoeft, N.; Vettier, C.; Dumesnil, K.; Dufour, C.

    2001-01-01

    We report on resonant magnetic X-ray scattering studies of a samarium epitaxial film at the samarium L 3 edge. We observe one quadrupolar resonance below the edge, reflecting the polarization of the 4f electrons, and two dipolar resonances above the edge, related to the polarization of the 5d band. We demonstrate, by following the thermal evolution of resonant magnetic intensities of both types, that the polarization of the 4f and 5d electrons present exactly the same temperature dependence, even very close to the ordering temperature, in agreement with the RKKY model for long-range magnetic order in rare earths

  11. Level structure of 149Nd. The decay of 149Pr

    International Nuclear Information System (INIS)

    Pinston, J.A.; Roussille, R.; Sadler, G.; Tenten, W.; Bocquet, J.P.; Pfeiffer, B.; Warner, D.D.

    1977-01-01

    The decay of 149 Pr (Tsub(1/2) = 2.2 min) has been studied using the two fission product separators JOSEF and LOHENGRIN to produce the 149 Pr nucleus. A level scheme for 149 Nd has been established. The β-branching of log ft values for the excited levels were deduced from the analysis of γ-intensity balances. Furthermore, the spins and parities for most of the excited states observed were obtained from the comparison between the present work, the neutron capture results and the pick-up reactions. The positive parity levels have been described with the Nilsson model with Coriolis and ΔN = 2 interactions included. The properties of the negative parity states cannot be explained as easily; however, it has been attempted to extract the structure of the ground state and the first excited states. (orig.) [de

  12. Behavior of Samarium III during the sorption process

    International Nuclear Information System (INIS)

    Ordonez R, E.; Garcia G, N.; Garcia R, G.

    2004-01-01

    In this work the results of the behavior of samarium in solution are presented, in front of a fine powder of zirconium silicate (zircon). For that which is necessary to characterize the zircon, studying the crystallinity, the morphology, the surface area and the isoelectric point. The behavior of samarium in solution is studied by means of the elaboration of isotherm of sorption, using the technique by lots. One observes that to pH values of nearer to the isoelectric point (pH = 7.23) the process of sorption of the samarium begins, reaching a maximum to near pH at 9. The technique of luminescence is used to determine the concentration of the sipped samarium (phosphorescence) and also to make the speciation of the species formed in the surface of the zircon (phosphorescence). The results can be extrapolated with the plutonium when making the modeling of the migration of alpha emitting coming from the repositories of radioactive waste since both they have similar chemical properties (they are homologous). (Author)

  13. Studies on ultrasonic velocity and electrical conductivity of samarium soaps in non-aqueous medium

    International Nuclear Information System (INIS)

    Mehrotra, K.N.; Chauhan, M.; Shukla, R.K.

    1990-01-01

    The ultrasonic velocity of solutions of samarium soaps in non-aqueous medium has been measured at a constant temperature and the results have been used to evaluate the various acoustic parameters. The pre-micellar association and the formation of micelles in samarium soap solutions have been determined by conductometric measurements. The molar conductance at infinite dilution, degree of ionisation and ionisation constant have been evaluated. The results show that samarium soaps behave as weak electrolyte in dilute solutions. (Authors)

  14. Solubility isotherms in ternary systems of samarium nitrate, water and nitrates of amidopyrine, benzotriazole

    International Nuclear Information System (INIS)

    Starikova, L.I.

    1991-01-01

    Solubility in the system of samarium nitrate-amidopyrine nitrate-water at 25 and 50 deg C was studied. Solubility isotherms consist of three branches, corresponding to crystallization of samarium nitrate tetrahydrate, amidopyrine nitrate and congruently soluble compounds of Sm(NO 3 ) 3 · 2C 13 H 17 ON 3 ·HNO 3 composition. Its thermal behaviour was studied. The system of samarium nitrate-benzotriazole nitrate-water is referred to eutonic type

  15. Dependence of samarium-soil interaction on samarium concentration: Implications for environmental risk assessment.

    Science.gov (United States)

    Ramírez-Guinart, Oriol; Salaberria, Aitor; Vidal, Miquel; Rigol, Anna

    2018-03-01

    The sorption and desorption behaviour of samarium (Sm), an emerging contaminant, was examined in soil samples at varying Sm concentrations. The obtained sorption and desorption parameters revealed that soil possessed a high Sm retention capacity (sorption was higher than 99% and desorption lower than 2%) at low Sm concentrations, whereas at high Sm concentrations, the sorption-desorption behaviour varied among the soil samples tested. The fractionation of the Sm sorbed in soils, obtained by sequential extractions, allowed to suggest the soil properties (pH and organic matter solubility) and phases (organic matter, carbonates and clay minerals) governing the Sm-soil interaction. The sorption models constructed in the present work along with the sorption behaviour of Sm explained in terms of soil main characteristics will allow properly assessing the Sm-soil interaction depending on the contamination scenario under study. Moreover, the sorption and desorption K d values of radiosamarium in soils were strongly correlated with those of stable Sm at low concentrations (r = 0.98); indicating that the mobility of Sm radioisotopes and, thus, the risk of radioactive Sm contamination can be predicted using data from low concentrations of stable Sm. Copyright © 2017 Elsevier Ltd. All rights reserved.

  16. Optical properties of zinc–vanadium glasses doped with samarium ...

    Indian Academy of Sciences (India)

    Abstract. Zinc–vanadium glasses doped with samarium oxide having the chemical composition Sm2O3(x). ZnO(40−x)V2O5(60)(where x = 0·1–0·5 mol%) were prepared by melt quenching method. The density of these glasses was measured by Archimedes method; the corresponding molar volumes have also been ...

  17. Level densities and γ-strength functions in 148,149Sm

    International Nuclear Information System (INIS)

    Siem, S.; Guttormsen, M.; Ingeberg, K.; Melby, E.; Rekstad, J.; Schiller, A.; Voinov, A.

    2002-01-01

    The level densities and γ-strength functions of the weakly deformed 148 Sm and 149 Sm nuclei have been extracted. The temperature versus excitation energy curve, derived within the framework of the microcanonical ensemble, shows structures, which we associate with the breakup of Cooper pairs. The nuclear heat capacity is deduced within the framework of both the microcanonical and canonical ensembles. We observe negative heat capacity in the microcanonical ensemble whereas the canonical heat capacity exhibits an S shape as a function of temperature, both signals of a phase transition. The structures in the γ-strength functions are discussed in terms of the pygmy resonance and the scissors mode built on excited states. The samarium results are compared with data for the well-deformed 161,162 Dy, 166,167 Er, and 171,172 Yb isotopes and with data from (n,γ) experiments and giant dipole resonance studies

  18. 17 CFR 149.102 - Application.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Application. 149.102 Section 149.102 Commodity and Securities Exchanges COMMODITY FUTURES TRADING COMMISSION ENFORCEMENT OF... COMMISSION § 149.102 Application. This part applies to all programs or activities conducted by the agency. ...

  19. 9 CFR 149.3 - Site audit.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Site audit. 149.3 Section 149.3... LIVESTOCK IMPROVEMENT VOLUNTARY TRICHINAE CERTIFICATION PROGRAM § 149.3 Site audit. (a) General. (1) The producer must contact a QAV or QVMO to request a site audit. A list of available QAVs may be obtained by...

  20. 9 CFR 149.4 - Spot audit.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Spot audit. 149.4 Section 149.4... LIVESTOCK IMPROVEMENT VOLUNTARY TRICHINAE CERTIFICATION PROGRAM § 149.4 Spot audit. (a) In addition to regularly scheduled site audits, certified production sites will be subject to spot audits. (1) Random spot...

  1. Chrome-free Samarium-based Protective Coatings for Magnesium Alloys

    Science.gov (United States)

    Hou, Legan; Cui, Xiufang; Yang, Yuyun; Lin, Lili; Xiao, Qiang; Jin, Guo

    The microstructure of chrome-free samarium-based conversion coating on magnesium alloy was investigated and the corrosion resistance was evaluated as well. The micro-morphology, transverse section, crystal structure and composition of the coating were observed by scanning electron microscopy (SEM), X-ray diffraction (XRD), energy dispersive spectroscopy (EDS) and X- ray photoelectron spectroscopy (XPS), respectively. The corrosion resistance was evaluated by potentiodynamic polarization curve and electrochemical impedance spectroscopy (EIS). The results reveal that the morphology of samarium conversion coating is of crack-mud structure. Tiny cracks distribute in the compact coating deposited by samarium oxides. XRD, EDS and XPS results characterize that the coating is made of amorphous and trivalent-samarium oxides. The potentiodynamic polarization curve, EIS and OCP indicate that the samarium conversion coating can improve the corrosion resistance of magnesium alloys.

  2. Separation of lanthanum (3) and samarium (3) extraction with tributylphosphate in the solvent presence of solid phase

    International Nuclear Information System (INIS)

    Korotkevich, I.B.; Kolesnikov, A.A.; Bomshtejn, V.E.

    1990-01-01

    Lanthanum (3) and samarium (3) extraction from nitric acid solutions by tributylphosphate in the presence of solid phase has been investigated. An increase in samarium α-nitrate distribution factor in the presence of solid phase with a decrease in its concentration in the initial solution and with lanthanum nitrate concentration increase is detected. The greatest effect of separation is observed in samarium nitrate microregion. The method of quantitative extraction of samarium from lanthanum nitrate solutions with samarium-lanthanum separation factor exceeding 50 has been suggested

  3. Lanthanum (samarium) nitrate-4-aminoantipyrine nitrate-water systems

    International Nuclear Information System (INIS)

    Starikova, L.I.; Zhuravlev, E.F.

    1985-01-01

    Using the isothermal method of cross-sections at 50 deg C systems lanthanum nitrate-4-aminoantipyrine nitrate-water (1), samarium nitrate-4-aminoantipyrine nitrate-water (2), are studied. Isotherms of system 1 consist of two crystallization branches of initial salt components. In system 2 formation of congruently soluble compounds of the composition Sm(No) 3 ) 3 xC 11 H 13 ON 3 xHNO 3 is established. Analytical, X-ray phase and thermogravimetric analysis of the isolated binary salt are carried out

  4. Implementation of an analytical technique for Samarium; Implementacion de una tecnica analitica para Samario

    Energy Technology Data Exchange (ETDEWEB)

    Garcia G, N. [ININ, Carretera Mexico-Toluca Km. 36.5, 52045 Estado de Mexico (Mexico)

    2004-07-01

    Since the Samarium presents the same chemical properties that the plutonium, it has been used as homologous in studies that allow us to know the behavior that the plutonium presents in solution, with the advantage of working with an inactive and not very dangerous element. At the moment studies of sorption of plutonium or samarium are made on some mineral matrices that present certain surface properties. Due to the low concentrations that are used in the studies of sorption of samarium on those reagent substrates, their detection becomes very difficult for the conventional analysis media. The luminescence is a technique that can detect lower concentrations, smaller at 1 X 10{sup -} {sup 2} M, but when fluorofors are used this limit of detection increases in several orders of magnitude. In this work it has been used the arsenazo-III as fluorofor agent since it reacts in a specific way with the samarium, forming a complex that presents a proportional luminescence to the concentration of the present samarium. The advantage of making the quantification of samarium by luminescence is that it can use the same instrumental equipment to determine the speciation of the samarium sipped in the zircon. (Author)

  5. Preparation and examination of properties of samarium-153-EDTMP complex

    International Nuclear Information System (INIS)

    Nowak, M.; Garnuszek, P.; Lukasiewicz, A.; Wozniak, I.; Zulczyk, W.; Licinska, I.

    1995-01-01

    Preparation and properties of ethylenediaminetetramethylenephosphonic acid (EDTMP) as well as some properties of 153 Sm-EDTMP chelate have been examined. The chelate formed by samarium-153 (46.3 h, β - -decay) with EDTMP exhibits high bone uptake and can be used for treatment of disseminated, painful skeletal metastases. The purity and stability of solutions of 153 Sm-EDTMP chelate were examined in a broad range of samarium concentration and 153 Sm specific activity. The complex under study was examined by radio-TLC, -electrophoresis and radio-HPLC. The results obtained suggest the small size of molecules of 153 Sm-EDTMP chelate as compared with molecules of ''free''EDTMP. The results of biodistribution of 153 Sm-EDTMP determined in rats indicate the quick blood clearance, high deposition of radioactivity in bone and quick excretion of radioactivity into urine. No specific uptake of 153 Sm-EDTMP in extra-skeletal organs was found. (author). 42 refs, 13 figs, 22 tabs

  6. Influence of tellurite on lifetime for samarium doped lanthanum lead borate glass

    Science.gov (United States)

    Madhu, A.; Eraiah, B.

    2018-04-01

    Samarium substituted tellurium lanthanum lead borate glass is prepared using melt quenching technique. Luminescence spectra have been recorded upon excitation with 402 nm various transitions from 4G5/2 level, for samarium doped tellurite glasses are studied and also lifetime for all the samples exhibit single exponential behaviour of decay curve. Luminescence spectra of present glasses show quenching effect due to cross-relation channels of samarium ions. The lifetime of glass samples decrease as the tellurite concentration is decreased. So, it evidences that to attain longer lifetime for lasing material one can tune the host by selecting concentration of tellurite.

  7. 9 CFR 149.6 - Slaughter facilities.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Slaughter facilities. 149.6 Section... AGRICULTURE LIVESTOCK IMPROVEMENT VOLUNTARY TRICHINAE CERTIFICATION PROGRAM § 149.6 Slaughter facilities. Only slaughter facilities that are under continuous inspection by the Food Safety and Inspection Service or under...

  8. 28 CFR 35.149 - Discrimination prohibited.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Discrimination prohibited. 35.149 Section... STATE AND LOCAL GOVERNMENT SERVICES Program Accessibility § 35.149 Discrimination prohibited. Except as... subjected to discrimination by any public entity. ...

  9. 17 CFR 149.140 - Employment.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Employment. 149.140 Section... COMMISSION § 149.140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity conducted by the agency. The...

  10. 27 CFR 28.149 - Losses.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Losses. 28.149 Section 28... Exportation, Use as Supplies on Vessels and Aircraft, or Transfer to a Foreign-Trade Zone § 28.149 Losses. When there has been a loss of beer or beer concentrate while in transit from the brewery to a port for...

  11. Resonances of coherent population trapping in samarium vapours

    International Nuclear Information System (INIS)

    Kolachevsky, Nikolai N; Akimov, A V; Kiselev, N A; Papchenko, A A; Sorokin, Vadim N; Kanorskii, S I

    2001-01-01

    Resonances of coherent population trapping were detected in atomic vapours of the rare-earth element samarium. The coherent population trapping was produced by two external-cavity diode lasers (672 and 686 nm) in a Λ-system formed by the three levels of 154 Sm: the 4f 6 6s 2 ( 7 F 0 ) ground state, the first fine-structure 4f 6 6s 2 ( 7 F 1 ) sublevel of the ground state and the 4f 6 ( 7 F)6s6p( 3 P o ) 9 F o 1 upper level. The dependence of the spectral shapes and resonance contrasts on the polarisation of the laser beams and the direction of the applied magnetic field was studied. The obtained results were analysed. (nonlinear optical phenomena)

  12. Optical and physical properties of samarium doped lithium diborate glasses

    Science.gov (United States)

    Hanumantharaju, N.; Sardarpasha, K. R.; Gowda, V. C. Veeranna

    2018-05-01

    Sm3+ doped lithium di-borate glasses with composition 30Li2O-60B2O3-(10-x) PbO, (where 0 molar volume with samarium ion content indicates the openness of the glass structure. The gradual increase in average separation of boron-boron atoms with VmB clearly indicates deterioration of borate glass network, which in turn leads to decrease in the oxygen packing density. The replacements of Sm2O3 for PbO depolymerise the chain structure and that would increase the concentration of non-bridging oxygens. The marginal increase of optical band gap energy after 1.0 mol.% of Sm2O3 is explained by considering the structural modification in lead-borate. The influence of Sm3+ ion on physical and optical properties in lithium-lead-borate glasses is investigated and the results were discussed in view of the structure of borate glass network.

  13. Magnetic behavior study of samarium nitride using density functional theory

    Science.gov (United States)

    Som, Narayan N.; Mankad, Venu H.; Dabhi, Shweta D.; Patel, Anjali; Jha, Prafulla K.

    2018-02-01

    In this work, the state-of-art density functional theory is employed to study the structural, electronic and magnetic properties of samarium nitride (SmN). We have performed calculation for both ferromagnetic and antiferromagnetic states in rock-salt phase. The calculated results of optimized lattice parameter and magnetic moment agree well with the available experimental and theoretical values. From energy band diagram and electronic density of states, we observe a half-metallic behaviour in FM phase of rock salt SmN in while metallicity in AFM I and AFM III phases. We present and discuss our current understanding of the possible half-metallicity together with the magnetic ordering in SmN. The calculated phonon dispersion curves shows dynamical stability of the considered structures. The phonon density of states and Eliashberg functional have also been analysed to understand the superconductivity in SmN.

  14. New reduced variant in gadolinium and samarium monoxide thin films

    Energy Technology Data Exchange (ETDEWEB)

    Bist, B M.S.; Kumar, J; Srivastava, O N [Banaras Hindu Univ. (India). Dept. of Physics

    1977-01-01

    A new reduced phase has been observed in the thin films of gadolinium and samarium monoxides. This phase results on imparting an annealing treatment to the monoxides and is formed as a result of the creation and ordering of vacancies in the oxygen sublattice. The new phase has been analysed to possess a rhombohedral unit cell with lattice parameters a/sub R/ = a/sub 0/ square root of (3/2) and c/sub R/ = a/sub 0/ square root of 3 (based on hexagonal axes, a/sub 0/ being the lattice parameter of the fundamental zinc blende type unit cell of the monoxide). Based on the proposed structure, the new phase can be assigned the solid state chemical formula RO/sub x/ where R = Gd, Sm and x = 0.66.

  15. Biodistribution study of 153Sm-EDTMP produced by irradiation of natural and enriched Samarium, in rats

    International Nuclear Information System (INIS)

    Meftahi, M.; Bahrami Samani, A.; Babaei, M. H.; Shamsaei Zafarghandi, M.; Ghannadi Maragheh, M.

    2010-01-01

    ''1 53 Sm-EDTMP is one of the well known radiopharmaceuticals for pain palliation of bone metastases. Despite that, it is used just in a few countries. It is due to some reasons like being costly enriched samarium that usually used as target for irradiation and short half-life of 153 Sm. In this investigation, certain amounts of radiopharmaceuticals prepared by irradiation of enriched and natural samarium were injected to some normal rats. Then, the rodents were sacrificed and some of their organs were removed. All of the mentioned stages were performed in order to consider the possibility of exploiting natural samarium instead of enriched samarium by study of biodistribution of both radiopharmaceuticals in various organs especially in bone as the target tissue. At the end, the acceptable results were obtained using natural samarium in comparison with the enriched samarium from the point of view of the biodistribution studies.

  16. Samarium-153-EDTMP in the metastatic bone pain treatment

    International Nuclear Information System (INIS)

    Lins Filho, M.L.M.; Santos, A.O.; Nappi, A.P.B.; Meirelles, M.B.; Arouca, P.T.; Ramos, C.D.; Etchebehere, E.C.S.C.; Teixeira, L.C.; Netto Junior, N.R.; D'Ancona Cal; Camargo, E.E.

    1997-01-01

    Full text: Bone metastasis is the most reason of pain in prostate and mammary cancer patients. The Samarium-153-EDTMP has been showed as an alternative to the treatment of the metastasis bone pain. With the objective to evaluate the use of the Sm-153-EDTMP as a systemic therapy for the metastasis bone pain, 30 patients (19 male, 11 female, average age of 64,5 years) were studied. 19 patients with prostate cancer and 11 with mammary cancer. All the patients presented previous bone scintiscanning with multiple metastasis; interruption of the chemotherapy or radiotherapy for two or more weeks and leukocyte count higher than 2,000 leukocytes/mm 3 and platelets higher than 80,000/mm 3 . The patients were classified previously to the radioisotope therapy, as far the intensity of the pain in a scale from 0 to 10 is concerned. All the patients received 37 MBq/kg (1m Ci/kg) of weight of Sm-153-EDTMP by venous via. The evaluation 6 weeks after the therapy showed complete or partial pain relief in 22 patients (73,3%). Complete or partial pain relief has been obtained in 91,0% (10 in 11) of the patients with mammary cancer and in 62,2% (12 in 19) of the patients with prostate cancer. Transitory leukopenia (lower than 2,000 leukocytes/mm 3 ) and platelet count (lower than 80,000/mm 3 ) occurred in 33,3% of the patients. 8 patients (26,7%) did not responded to the therapy. The therapy with Samarium-153-EDTMP is a simple, safe and efficient method in the treatment of the bone pain caused by metastasis

  17. Electrochemical extraction of samarium from molten chlorides in pyrochemical processes

    International Nuclear Information System (INIS)

    Castrillejo, Y.; Fernandez, P.; Medina, J.; Hernandez, P.; Barrado, E.

    2011-01-01

    This work concerns the electrochemical extraction of samarium from molten chlorides. In this way, the electrochemical behaviour of samarium ions has been investigated in the eutectic LiCl-KCl at the surface of tungsten, aluminium and aluminium coated tungsten electrodes. On a W inert electrode the electro-reduction of Sm(III) takes place in only one soluble-soluble electrochemical step Sm(III)/Sm(II). The electrochemical system Sm(II)/Sm(0) has not been observed within the electrochemical window, because of the prior reduction of Li(I) ions from the solvent, which inhibits the electro-extraction of Sm species from the salt on such a substrate. Sm metal in contact with the melt react to give Li(0) according to the reaction: Sm(0) + 2Li(I) ↔ Sm(II) + 2Li(0). On the contrary, on reactive Al electrodes the electrochemical system Sm(II)/Sm(0) was observed within the electroactive range. The potential shift of the redox couple is caused by the decrease of Sm activity in the metal phase due to the formation of Sm-Al alloys at the interface. The formation mechanism of the intermetallic compounds was studied in a melt containing: (i) both Sm(III) and Al(III) ions, using W and Al coated tungsten electrodes, and (ii) Sm(III) ions using an Al electrode. Analysis of the samples after potentiostatic electrolysis by X-ray diffraction and scanning electron microscopy (SEM) with energy dispersive X-ray spectroscopy (EDS), allowed the identification of Al 3 Sm and Al 2 Sm.

  18. Electrochemical extraction of samarium from molten chlorides in pyrochemical processes

    Energy Technology Data Exchange (ETDEWEB)

    Castrillejo, Y., E-mail: ycastril@qa.uva.es [QUIANE/Dept Quimica Analitica, F. de Ciencias, Universidad de Valladolid, Prado de la Magdalena s/n, 47005 Valladolid (Spain); Fernandez, P. [QUIANE/Dept Quimica Analitica, F. de Ciencias, Universidad de Valladolid, Prado de la Magdalena s/n, 47005 Valladolid (Spain); Medina, J. [Dept Fisica Materia Condensada Cristalografia y Mineralogia, F. de Ciencias, Universidad de Valladolid, Prado de la Magdalena s/n, 47005 Valladolid (Spain); Hernandez, P. [Centro de Investigaciones Quimicas, Universidad Autonoma del Estado de Hidalgo, Carr. Pachuca-Tulancingo Km. 4.5, C.P. 42076 Pachuca, Hidalgo (Mexico); Barrado, E. [QUIANE/Dept Quimica Analitica, F. de Ciencias, Universidad de Valladolid, Prado de la Magdalena s/n, 47005 Valladolid (Spain)

    2011-10-01

    This work concerns the electrochemical extraction of samarium from molten chlorides. In this way, the electrochemical behaviour of samarium ions has been investigated in the eutectic LiCl-KCl at the surface of tungsten, aluminium and aluminium coated tungsten electrodes. On a W inert electrode the electro-reduction of Sm(III) takes place in only one soluble-soluble electrochemical step Sm(III)/Sm(II). The electrochemical system Sm(II)/Sm(0) has not been observed within the electrochemical window, because of the prior reduction of Li(I) ions from the solvent, which inhibits the electro-extraction of Sm species from the salt on such a substrate. Sm metal in contact with the melt react to give Li(0) according to the reaction: Sm(0) + 2Li(I) {r_reversible} Sm(II) + 2Li(0). On the contrary, on reactive Al electrodes the electrochemical system Sm(II)/Sm(0) was observed within the electroactive range. The potential shift of the redox couple is caused by the decrease of Sm activity in the metal phase due to the formation of Sm-Al alloys at the interface. The formation mechanism of the intermetallic compounds was studied in a melt containing: (i) both Sm(III) and Al(III) ions, using W and Al coated tungsten electrodes, and (ii) Sm(III) ions using an Al electrode. Analysis of the samples after potentiostatic electrolysis by X-ray diffraction and scanning electron microscopy (SEM) with energy dispersive X-ray spectroscopy (EDS), allowed the identification of Al{sub 3}Sm and Al{sub 2}Sm.

  19. Australian manufacture of QuadrametTM (Samarium-153 EDTMP)

    International Nuclear Information System (INIS)

    Wood, N.R.; Whitwell, J.

    1997-01-01

    Quadramet T (Samarium-153 EDTMP) has been shown overseas to be potentially useful in the palliation of painful osteoblastic skeletal metastases and has been approved this year for general marketing in the USA. Australian Radioisotopes (ARI) has licensed this product from the Australian patent holders, Dow Chemical. Within the facilities of ARI, a hot cell has been dedicated to this product and fitted out to manufacture it weekly on a cycle related to the operating cycle of the Australian reactor HIFAR. Due to neutron flux limitations of HIFAR, the local formulation has an elemental Samarium content up to 200μg/mL whereas the overseas formulation has a level of 20-46μg/mL. All other specifications of the two products are essentially the same. In 1995 and 1996 a small clinical trial with 19 patients was held which demonstrated that the pharmacokinetic behaviour was also essentially the same by measuring blood clearance rates and skeletal uptake dynamics. Soft tissue uptake was also qualitatively determined. The ARI version is now the subject of an application for general marketing within Australia. Some useful characteristics of this agent are: almost complete excretion or fixation in the skeleton within 6 hours, rapid onset of clinical effect, applicability in most cases where an abnormal diagnostic bone scan correlates with painful sites, dosage can be tailored to individual patient uptake due to easy dose measurement and retreatment is quite possible. The use of this class of agents in pain palliation continues to increase. Australian manufacture of Quadramet TM provides a further option in the management of these difficult cases

  20. Fluorimetric determination of samarium(III) and europium(III) in neodymium oxide by separation with a resin column

    Energy Technology Data Exchange (ETDEWEB)

    Shaorong Liu; Jian Meng (Beijing Research Institute of Chemical Engineering and Metallurgy (China)); Wenhua Liu (General Research Institute for Non-Ferrous Metals (China))

    1992-08-24

    When thenoyltrifluoroacetone-phenanthroline-Triton X-100 is used to determine samarium(III) and europium(III) fluorimetrically, only a limited amount of neodymium(III) can be tolerated. By using an on- line separation which can partially separate neodymium(III) from samarium(III), a practical and convenient method was developed to detect samarium(III) at concentrations >0.05% and europium(III) at concentrations >0.005% in neodymium oxide. (author). 7 refs.; 4 figs.; 3 tabs.

  1. Fluorimetric determination of samarium(III) and europium(III) in neodymium oxide by separation with a resin column

    International Nuclear Information System (INIS)

    Shaorong Liu; Jian Meng; Wenhua Liu

    1992-01-01

    When thenoyltrifluoroacetone-phenanthroline-Triton X-100 is used to determine samarium(III) and europium(III) fluorimetrically, only a limited amount of neodymium(III) can be tolerated. By using an on- line separation which can partially separate neodymium(III) from samarium(III), a practical and convenient method was developed to detect samarium(III) at concentrations >0.05% and europium(III) at concentrations >0.005% in neodymium oxide. (author). 7 refs.; 4 figs.; 3 tabs

  2. 27 CFR 24.149 - Corporate surety.

    Science.gov (United States)

    2010-04-01

    ... OF THE TREASURY LIQUORS WINE Establishment and Operations Bonds and Consents of Surety § 24.149.... Copies may be obtained from the Audit Staff, Financial Management Service, Department of the Treasury...

  3. 41 CFR 101-26.4901-149 - Standard Form 149, U.S. Government National Credit Card.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Standard Form 149, U.S. Government National Credit Card. 101-26.4901-149 Section 101-26.4901-149 Public Contracts and Property... 149, U.S. Government National Credit Card. Note: The form illustrated in § 101-26.4901-149 is filed as...

  4. Sorption-desorption of samarium in Febex bentonite

    International Nuclear Information System (INIS)

    Ramirez-Guinart, O.; Rigol, A.; Vidal, M.; Fernandez-Poyatos, P.; Alba, M. D.

    2012-01-01

    Document available in extended abstract form only. The chemical and physical nature of the clay is a key issue in the design of engineered barriers. The FEBEX bentonite is one of the clays candidates to be used in engineered barriers in deep geology repositories (DGR). Here, its performance was tested with respect to the sorption-desorption of samarium, which is a lanthanide that, besides being considered as a natural analogue of actinides, may also be present in high level radioactive waste in the form of the radioactive isotope 151 Sm. FEBEX bentonite was used in this study. This is a di-octahedral smectite, with isomorphic substitutions in tetrahedral and octahedral sheets. Its theoretical cation exchange capacity value is 1500 meq kg -1 . Sorption isotherms were obtained for Sm in the range of initial concentrations of 0.01 and 9 meq l -1 . Tests were carried out in deionized water and in a medium simulating the composition of interstitial water. Sorption tests were performed equilibrating 30 ml of the Sm solution with 0.2 g of clay. After a contact time of 24 hours, supernatants were decanted off after centrifugation. The quantification of the concentration of Sm in the initial and final solutions allowed us to quantify the Sm equilibrium concentration (C eq ), the fraction sorbed in the FEBEX bentonite (C sorb ) and to derive the sorption K d data. Desorption tests were applied to determine the desorption K d and the percentage of Sm reversibly sorbed. Desorption tests were performed with the bentonite residue from the sorption step, under the same experimental conditions, but without Sm. Powder X-ray diffractograms were obtained from 3 to 70 deg. 2θ with a step of 0.05 deg. and a counting time of 3 s. The crystalline phases were identified using the computer program X'Pert HighScore. The morphology of the samples was analyzed by SEM at 20 kV. An EDX system was fitted to the SEM equipment to perform chemical analyses of the samples using a Si/Li detector

  5. Determination of 0.01–0.1% of samarium in 40–100 mg of lead chloride

    NARCIS (Netherlands)

    Agterdenbos, J.; Jütte, B.A.H.G.; Schuring, J.

    1971-01-01

    A method is described for the determination of 5–25 μg of samarium in about 40 mg of lead chloride, based on the removal of the lead by electrolysis and determination of the samarium by extraction with PAN and measurement of the extinction of the complex at 552 nm.

  6. Samarium (III Selective Membrane Sensor Based on Tin (IV Boratophosphate

    Directory of Open Access Journals (Sweden)

    Ashok S. K. Kumar

    2004-08-01

    Full Text Available Abstract: A number of Sm (III selective membranes of varying compositions using tin (IV boratophosphate as electroactive material were prepared. Polyvinyl chloride, polystyrene and epoxy resin were used as binding materials. Membrane having composition of 40% exchanger and 60% epoxy resin exhibited best performance. This membrane worked well over a wide concentration range of 1x10-5M to 1x10-1 M of samarium ions with a Super-Nernstian slope of 40 mV/decade. It has a fast response time of less than 10 seconds and can be used for at least six months without any considerable divergence in potentials. The proposed sensor revealed good selectivities with respect to alkali, alkaline earth, some transition and rare earth metal ions and can be used in the pH range of 4.0-10.0. It was used as an indicator electrode in the potentiometric titration of Sm (III ions against EDTA. Effect of internal solution was studied and the electrode was successfully used in non-aqueous media, too.

  7. Structural phase transition and electronic properties in samarium chalcogenides

    Energy Technology Data Exchange (ETDEWEB)

    Panwar, Y. S., E-mail: yspanwar2011@gmail.com [Department of Physics, Govt. New Science College Dewas-455001 (India); Aynyas, Mahendra [Department of Physics, C.S.A. Govt. P.G. College, Sehore, 466001 (India); Pataiya, J.; Sanyal, Sankar P. [Department of Physics, Barkatullah University, Bhopal, 462026 (India)

    2016-05-06

    The electronic structure and high pressure properties of samarium monochalcogenides SmS, SmSe and SmTe have been reported by using tight binding linear muffin-tin-orbital (TB-LMTO) method within the local density approximation (LDA). The total energy as a function of volume is evaluated. It is found that these monochalcogenides are stable in NaCl-type structure under ambient pressure. We predict a structural phase transition from NaCl-type (B{sub 1}-phase) structure to CsCl-type (B{sub 2}-type) structure for these compounds. Phase transition pressures were found to be 1.7, 4.4 and 6.6 GPa, for SmS, SmSe and SmTe respectively. Apart from this, the lattice parameter (a{sub 0}), bulk modulus (B{sub 0}), band structure (BS) and density of states (DOS) are calculated. From energy band diagram we observed that these compounds exhibit metallic character. The calculated values of equilibrium lattice parameter and phase transition pressure are in general good agreement with available data.

  8. Description and exploitation of benchmarks involving {sup 149}Sm, a fission product taking part of the burn up credit in spent fuels

    Energy Technology Data Exchange (ETDEWEB)

    Anno, J.; Poullot, G. [CEA Centre d`Etudes de Fontenay-aux-Roses, 92 (France). Inst. de Protection et de Surete Nucleaire; Fouillaud, P.; Grivot, P. [CEA Centre d`Etudes de Valduc, 21 - Is-sur-Tille (France)

    1995-12-31

    Up to now, there was no benchmark to validate the Fission Products (FPs) cross sections in criticality safety calculations. The protection and nuclear safety institute (IPSN) has begun an experimental program on 6 FPs ({sup 103}Rh, {sup 133}Cs, {sup 143}Nd, {sup 149}Sm, {sup 152}Sm, and {sup 155}Gd daughter of {sup 155}Eu) giving alone a decrease of reactivity equal to half the whole FPs in spent fuels (except Xe and I). Here are presented the experiments with the {sup 149}Sm and the results obtained with the APOLLO I-MORET III calculations codes. 11 experiments are carried out in a zircaloy tank of 3.5 1 containing slightly nitric acid solutions of Samarium (96,9% in weight of {sup 149S}m) at 0.1048 -0.2148 - 0.6262 g/l concentrations. It was placed in the middle of arrays of UO{sub 2} rods (4.742 % U5 weight %) at square pitch of 13 mm. The underwater height of the rods is the critical parameter. In addition, 7 experiments were performed with the same apparatus with water and boron proving a good experimental representativeness and a good accuracy of the calculations. As the reactivity worth of the Sm tank is between 2000 and 6000 10{sup -5}, the benchmarks are well representative and the cumulative absorption ratios show that {sup 149}Sm is well qualified under 1 eV. (authors). 8 refs., 7 figs., 6 tabs.

  9. Description and exploitation of benchmarks involving 149Sm, a fission product taking part of the burn up credit in spent fuels

    International Nuclear Information System (INIS)

    Anno, J.; Poullot, G.

    1995-01-01

    Up to now, there was no benchmark to validate the Fission Products (FPs) cross sections in criticality safety calculations. The protection and nuclear safety institute (IPSN) has begun an experimental program on 6 FPs ( 103 Rh, 133 Cs, 143 Nd, 149 Sm, 152 Sm, and 155 Gd daughter of 155 Eu) giving alone a decrease of reactivity equal to half the whole FPs in spent fuels (except Xe and I). Here are presented the experiments with the 149 Sm and the results obtained with the APOLLO I-MORET III calculations codes. 11 experiments are carried out in a zircaloy tank of 3.5 1 containing slightly nitric acid solutions of Samarium (96,9% in weight of 149S m) at 0.1048 -0.2148 - 0.6262 g/l concentrations. It was placed in the middle of arrays of UO 2 rods (4.742 % U5 weight %) at square pitch of 13 mm. The underwater height of the rods is the critical parameter. In addition, 7 experiments were performed with the same apparatus with water and boron proving a good experimental representativeness and a good accuracy of the calculations. As the reactivity worth of the Sm tank is between 2000 and 6000 10 -5 , the benchmarks are well representative and the cumulative absorption ratios show that 149 Sm is well qualified under 1 eV. (authors). 8 refs., 7 figs., 6 tabs

  10. 7 CFR 762.149 - Liquidation.

    Science.gov (United States)

    2010-01-01

    ... for judgment; (A) If the borrower has converted loan security, the lender will determine whether... of the disposition of loan security and its proceeds; (iii) A copy of the loan ledger indicating loan... SPECIAL PROGRAMS GUARANTEED FARM LOANS § 762.149 Liquidation. (a) Mediation. When it has been determined...

  11. Magnetoresistance of samarium in the 4.2-300 K range

    International Nuclear Information System (INIS)

    Trubitsyn, V.A.; Shalashov, V.F.

    1980-01-01

    Electric conductivity, transverse and longitudinal magnetoresistance of polycrystalline samarium with the purity of 99.9% in the 4.2-300 K temperature range and in magnetic fields up to 50 ke, are measured. The constituent of specific electric conductivity caused by spin disorder is 30.7 μOhmxcm, m*/m=2.6, the exchange parameter is G=3.1 eVxA 3 . Both transverse and longitudinal magnetoresistance are positive at 4.2 K; and the increase of temperature reveals a number of anomalies, evidently conditioned by the alteration of samarium magnetic structure

  12. Samarium oxide as a radiotracer to evaluate the in vivo biodistribution of PLGA nanoparticles

    CSIR Research Space (South Africa)

    Mandiwana, V

    2015-09-01

    Full Text Available the biodistribution of poly(D,L-lactide-co-glycolide) (PLGA) nanoparticles containing samarium-153 oxide ([(sup153)Sm]Sm(sub2)O(sub3)) in vivo to prove that orally administered nanoparticles alter the biodistribution of a drug. These were then activated in a nuclear...

  13. Expedient Method for Samarium(II) Iodide Preparation Utilizing a Flow Approach

    Czech Academy of Sciences Publication Activity Database

    Voltrová, Svatava; Šrogl, Jiří

    2013-01-01

    Roč. 24, č. 3 (2013), s. 394-396 ISSN 0936-5214 R&D Projects: GA MŠk LH12013 Institutional support: RVO:61388963 Keywords : flow * samarium * iodide * reduction Subject RIV: CC - Organic Chemistry Impact factor: 2.463, year: 2013

  14. Collective effects in even-mass samarium isotopes by polarized-proton scattering

    NARCIS (Netherlands)

    Petit, R.M.A.L.; Hall, van P.J.; Klein, S.S.; Moonen, W.H.L.; Nijgh, G.J.; Overveld, van C.W.A.M.; Poppema, O.J.

    1993-01-01

    The even-mass samarium isotopes 148,...,152Sm have been investigated by polarized proton scattering at 20.4 MeV beam energy. The data have been analysed with an 'extended' optical model, where the intensities of the first maxima of the main inelastic channels are fitted in a coupled-channels

  15. Identification of the lines in the L emission spectrum of cerium and samarium

    International Nuclear Information System (INIS)

    Shrivastava, B.D.; Singh, D.

    1992-01-01

    The occurrence of a line at 2.1556 A in the L emission spectrum of cerium and two lines at 1.6679 and 1.8379 A in the L emission spectrum of samarium, reported many years ago, has remained a puzzle. These have now been identified as EXAFS minima occurring at the L absorption edges of the respective elements. (author)

  16. ppt level detection of samarium(III) with a coated graphite sensor based on an antibiotic.

    Science.gov (United States)

    Ganjali, Mohammad Reza; Rezapour, Morteza; Pourjavid, Mohammad Reza; Haghgoo, Soheila

    2004-07-01

    N-[2-[4-[[[(Cyclohexylamino)carbonyl]amino]sulfonyl]phenyl]ethyl]-5-methyl pyrazine carboxamide (glipizid) was explored as an electro-active material for preparing a polymeric membrane-based sensor selective to samarium ions. The membrane incorporated 30% poly(vinyl chloride) (PVC), 53% benzyl acetate (BA), 11% glipizid and 6% sodium tetraphenyl borate. When coated on the surface of a graphite electrode, it exhibits Nernstian responses in the concentration range of 1.0 x 10(-5) to 1.0 x 10(-10) M, with a detection limit of 8.0 x 10(-11)M samarium. The electrode shows high selectivity towards samarium over several cations (alkali, alkaline earth, transition and heavy metal ions), and specially lanthanide ions. The proposed sensor has a very short response time (pH range for at least ten weeks. It was used as an indicator electrode in potentiometric titration of Sm(III) ions with an EDTA solution, and for determination of samarium in binary and ternary mixtures.

  17. Diffusion of samarium into cobalt in the reduction-diffusion process

    International Nuclear Information System (INIS)

    Freitas Nogueira, P. de; Neto, F.B.; Landgraf, F.J.G.

    1998-01-01

    The presence of metallic cobalt in samarium-cobalt powders is a major cause for low magnetic properties in magnets. This paper intends to investigate the effect of time and temperature in the microstructure of powders produced by reduction-diffusion. This process, developed for the production of rare earth-transition metal alloys, consists on the reduction of the rare earth oxide with metallic calcium (or calcium hydride) and its subsequent diffusion into the cobalt particle. In the present work, a mixture of samarium oxide, cobalt powder and metallic calcium was heated to 1100 or 1200 C for 2 or 4 hours in a tubular furnace under one atmosphere of purified argon. The material thereof obtained, a sintered mass is disintegrated by aqueous crepitation. The powder was evaluated in terms of its chemical composition, its samarium yield and the intermetallic compounds present. The samarium, oxygen and calcium content of the powders produced were adequate for magnet production. However, despite the massive formation of the SmCo 5 compound after 2 hours at 1100 C, final homogeneity is attained only after 4 hours at 1200 C, with the presence of SmCo 5 and Sm 2 Co 7 and the absence of the Sm 5 Co 19 compound. Also, metallic cobalt and Sm 2 Co 17 were observed in the materials produced after 2 hours at 1100 or 1200 C. (orig.)

  18. Pressure and irradiation effects on transport properties of samarium compounds with instable valence

    International Nuclear Information System (INIS)

    Morillo, J.

    1981-01-01

    Electron transport properties in samarium compounds with instable valence are studied in this thesis: from SmS in its integer valence phases at common pressure to SmB 6 compound IV at common pressure through SmSsub(1-x)Psub(x) (x 6 is presented [fr

  19. Adsorption and the initial stages of samarium condensation on iridium coated by graphite monolayer

    International Nuclear Information System (INIS)

    Abdullaev, R.M.; Tontegode, A.Ya.; Yusifov, F.K.

    1978-01-01

    Adsorption and the initial stages of vacuum samarium condensation on iridium coated by graphite monolayer (valent-saturated neutral substrate) were studied by the thermodesorption mass-spectrometry and thermoemission methods, and were compared with samarium adsorption and condensation on iridium. Desorption heat of samarium atoms with thin coating of Ir-C, equal to E approximately 1.9 eV has been determined. For desorption with Ir E is approximately 6 eV. Such a great difference in desorption heats is connected with the reduction of covalent constituent of adsorption bond in a neutral substrate. Samarium on Ir-C is found to be condensated in two states: loosely bound and tightly bound which sharply differ in properties. The tightly bound state is characterized by abnormally low vapour pressure. Possible nature of this state is discussed. Double effect on the condensation of the substrate valent saturation is noted. On the one hand, the reduction of the particle bond with the substrate decreases their concentration on the surface, preventing condensation. On the other hand, the release of the valent eloctrons of adatous brings about strong lateral interaction between them, which in its turn, promotes condensation during eased migration on the neutral substrate

  20. Samarium-153 Oksabifor in the treatment of metastatic bone disease

    International Nuclear Information System (INIS)

    Solodyannikova, O.; Voit, N.; Sukach, G.; Sagan, D.

    2015-01-01

    patients - reducing the number of foci and the level of radiopharmaceutical uptake in them. Conclusions: radionuclide therapy in patients with BM can effectively suppress pain and significantly reduce the number of analgesics. Post-treatment patients, life quality statistically significantly improved. Samarium-153 has the ability to reduce BM number and intensity of radiopharmaceutical accumulation in spots in the control study. (authors)

  1. 19 CFR 201.149 - Program accessibility: Discrimination prohibited.

    Science.gov (United States)

    2010-04-01

    .... 201.149 Section 201.149 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION GENERAL RULES OF... Conducted by the U.S. International Trade Commission § 201.149 Program accessibility: Discrimination... agency's facilities are inaccessible to or unusable by handicapped persons, be denied the benefits of, be...

  2. 45 CFR 149.100 - Amount of reimbursement.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Amount of reimbursement. 149.100 Section 149.100... REQUIREMENTS FOR THE EARLY RETIREE REINSURANCE PROGRAM Reinsurance Amounts § 149.100 Amount of reimbursement... reimbursement in the amount of 80 percent of the costs for health benefits (net of negotiated price concessions...

  3. 45 CFR 149.300 - General reimbursement rules.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false General reimbursement rules. 149.300 Section 149... REQUIREMENTS FOR THE EARLY RETIREE REINSURANCE PROGRAM Reimbursement Methods § 149.300 General reimbursement rules. Reimbursement under this program is conditioned on provision of accurate information by the...

  4. 45 CFR 149.200 - Use of reimbursements.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Use of reimbursements. 149.200 Section 149.200 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES REQUIREMENTS RELATING TO HEALTH CARE ACCESS REQUIREMENTS FOR THE EARLY RETIREE REINSURANCE PROGRAM Use of Reimbursements § 149.200 Use of reimbursements...

  5. 45 CFR 2490.149 - Program accessibility: Discrimination prohibited.

    Science.gov (United States)

    2010-10-01

    .... 2490.149 Section 2490.149 Public Welfare Regulations Relating to Public Welfare (Continued) JAMES MADISON MEMORIAL FELLOWSHIP FOUNDATION ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE JAMES MADISON MEMORIAL FELLOWSHIP FOUNDATION § 2490.149 Program...

  6. 41 CFR 51-10.149 - Program accessibility: Discrimination prohibited.

    Science.gov (United States)

    2010-07-01

    ...: Discrimination prohibited. 51-10.149 Section 51-10.149 Public Contracts and Property Management Other Provisions Relating to Public Contracts COMMITTEE FOR PURCHASE FROM PEOPLE WHO ARE BLIND OR SEVERELY DISABLED 10... FOR PURCHASE FROM PEOPLE WHO ARE BLIND OR SEVERELY DISABLED § 51-10.149 Program accessibility...

  7. 40 CFR 1.49 - Office of Water.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Office of Water. 1.49 Section 1.49... INFORMATION Headquarters § 1.49 Office of Water. The Office of Water, under the supervision of the Assistant Administrator for Water who serves as the principal adviser to the Administrator in matters pertaining to water...

  8. The samarium Grignard reaction. In situ formation and reactions of primary and secondary alkylsamarium(III) reagents

    Energy Technology Data Exchange (ETDEWEB)

    Curran, D.P.; Totleben, M.J. [Univ. of Pittsburgh, PA (United States)

    1992-07-15

    This work shows that primary and secondary radicals are rapidly reduced in THF/HMPA to form primary- and secondary-alkylsamarium reagents. The primary- and secondary-radicals can be formed either by direct SmI{sup 2} reductions of primary- and secondary-halides or by a previous rapid radical cyclization. The samarium reagents have moderate stability in solution, and they react with a variety of typical electrophiles, including aldehydes and ketones. The work further shows that organosamarium intermediates can be involved in the traditional samarium Barbier reaction of aldehydes and ketones conducted in THF/HMPA. A new procedure called the {open_quotes}samarium Grignard{close_quotes} method is introduced, and it is suggested that this new procedure will have considerably more scope and generality than the samarium Barbier reaction. 37 refs., 4 tabs.

  9. Influence of pretreatment temperature cycling on the radiating defect formation in silicon doped by samarium

    International Nuclear Information System (INIS)

    Abdurakhmanov, K.P.; Nazyrov, D.E.

    2006-01-01

    Full text: The raise of thermal and radiation stability as it is known, is one of actual problems of physics semiconductors. Recently it is established, that the rare-earth elements (REE) raise a stability of silicon to exterior action. In this connection the investigation of silicon doped REE by samarium and influence on its properties of heat treatments and radiation exposure is important. In sectional operation the outcomes of investigations of influence of samarium on thermal (600 degree C are reduced; 600 deg. + 900 deg. C; 900 deg. C; 900 deg. C + 600 deg. C; 1100 deg. C; 600 deg. C + 900 deg. C + 1100 deg. C; 900 deg. C + 600 deg. C + 1100 deg. C) thermal defect formation and radiation defect formation (exposure of γ-quanta 60 Co) both in beforehand wrought, and in thermally unfinished samples. After each cycle of heat treatments samples cool fast (throwing off in oil) or slowly (together with the furnace). Doping n-silicon REE by gadolinium and samarium was carried out during cultivation. The concentration of gadolinium and samarium in silicon, on sectional of a neutron-activation analysis was equaled 10 14 - 10 18 cm -3 . As control is model monocrystal silicon such as KEP-15/50. Para-meters of deep levels originating in control and doped REE samples, both past heat treatment or temperature cycling, and irradiated by the γ-quanta are defined by methods of a capacity spectroscopy: DLTS and IRC. The obtained outcomes have shown, that in irradiated with the γ-quanta 60 Co deep levels samples are formed with energies: E C -0,17 eV, E C -0,32 eV, EC-0,41 eV. Thus the parameters of deep levels vary depending on requirements of prestress heat treatment. For example heat treatment at 600 deg. C essentially increments a velocity of introduction of and centre (deep level of E C -0,17 eV), in comparison with a velocity of introduction of this level in samples with prestress heat treatment at 900 deg. C. In samples n-Si doped by samarium effectiveness of formation

  10. Solar nebula heterogeneity in p-process samarium and neodymium isotopes.

    Science.gov (United States)

    Andreasen, Rasmus; Sharma, Mukul

    2006-11-03

    Bulk carbonaceous chondrites display a deficit of approximately 100 parts per million (ppm) in 144Sm with respect to other meteorites and terrestrial standards, leading to a decrease in their 142Nd/144Nd ratios by approximately 11 ppm. The data require that samarium and neodymium isotopes produced by the p process associated with photodisintegration reactions in supernovae were heterogeneously distributed in the solar nebula. Other samarium and neodymium isotopes produced by rapid neutron capture (r process) in supernovae and by slow neutron capture (s process) in red giants were homogeneously distributed. The supernovae sources supplying the p- and r-process nuclides to the solar nebula were thus disconnected or only weakly connected.

  11. Ultrasonic and viscosimetric studies of samarium laurate in benzene-dimethylsulfoxide mixtures

    International Nuclear Information System (INIS)

    Mehrotra, K.N.; Anis, M.

    1995-01-01

    Ultrasonic and viscosity measurements of samarium laurate in benzene-DMSO mixtures of different compositions (7:3 and 1:1 V/V) have been used to determine the critical micelle concentration (CMC), soap-solvent interaction, and various acoustic parameters of the system. The values of critical micelle concentration increase with increasing amount of DMSO in the solvent mixtures. The viscosity results have been explained on the basis of equations proposed by Einstein, Vand. Moulik, and Jones-Dole. The values of CMC for samarium laurate obtained from the viscosity measurements are in agreement with the results obtained from ultrasonic measurements. The results show that the soap molecules do not aggregate appreciably below CMC there is a marked change in the aggregation behaviour at CMC. (author)

  12. Removal of trivalent samarium from aqueous solutions by activated biochar derived from cactus fibres

    Institute of Scientific and Technical Information of China (English)

    Loukia Hadjittofi; Styliana Charalambous; Ioannis Pashalidis

    2016-01-01

    The efficiency of activated biochar fibres obtained fromOpuntia Ficus Indica regarding the sorption of trivalent samarium (Sm(III)) from aqueous solutions was investigated by batch experiments. The effect of various physicochemical parameters (e.g. pH, initial metal concentration, ionic strength, temperature and contact time) on the Sm(III) adsorption was studied and the surface species were characterized by FTIR spectroscopy prior to and after the lanthanide sorption. The experimental results showed that the acti-vated biochar fibres possessed extraordinary sorption capacity for Sm(III) in acidic solutions (qmax=90 g/kg, pH 3.0) and near neutral solutions (qmax=350 g/kg, pH 6.5). This was attributed to the formation of samarium complexes with the surface carboxylic moieties, available in high density on the lamellar structures of the bio-sorbent.

  13. Enhanced electron-lattice coupling under uniaxial stress in layered double hydroxides intercalated with samarium complexes

    International Nuclear Information System (INIS)

    Park, Ta-Ryeong

    2004-01-01

    We have applied uniaxial stress to samarium complexes by intercalating them into the gallery of a layered material and by using a diamond-anvil cell at 28 K. Although uniaxial stress reduces symmetry and removes degeneracy, the overall number of photoluminescence (PL) peaks evidently decreased with the application of uniaxial stress. This contradictory observation is explained by an increased electron-lattice coupling strength under uniaxial stress. This behavior is also confirmed by time-resolved PL data.

  14. Synthesis of samarium complexes with the derivative binder of Schiff Quinolinic base. Characterization and photophysical study

    International Nuclear Information System (INIS)

    Lucas H, J.

    2016-01-01

    In this work we determined the metal: binder stoichiometry of the species formed during the UV/Vis spectrophotometric titration of the derivative binder of Schiff quinolinic base, L1 with the samarium nitrate pentahydrate in methanol. Statistical analysis of the data allowed proposing the metal: binder stoichiometry for the synthesis of the complexes which was one mole of samarium salt by 2.5 moles of binder and thus favor the formation of complexes with 1M: 1L and 1M: 2L stoichiometries. They were synthesized in aqueous-organic medium (water-ethanol), isolated and purified two complexes with stoichiometry 1 Sm: 1 L1, complex 1 and 1 Sm: 2 L1, complex 2. The overall yield of the reaction was 76%. The characterization of the formed complexes was performed by visible ultraviolet spectrometry (UV/Vis), nuclear magnetic resonance, X-ray photoelectron spectroscopy (XP S), thermal gravimetric analysis with differential scanning calorimetry (TGA/DSC), and radial distribution function. These complexes were studied by fluorescence and emission phosphorescence at variable temperature. Spectroscopic techniques used in both solution and solid demonstrated the formation and stability of these complexes. In addition XP S indicated that in both complexes the samarium retains its oxidation state 3+. Luminescence studies indicated that there is intra-binding charge transfer which decreases the transfer of light energy from the binder to the samarium. Based on the experimental results, L1 binder molecules and complexes 1 and 2 were modeled that demonstrated the proposed Nc for each complex, as well as allowed to visualize the structural arrangement of the molecules, complexes and binder. (Author)

  15. Sorption of samarium in iron (II) and (III) phosphates in aqueous systems

    International Nuclear Information System (INIS)

    Diaz F, J.C.

    2006-01-01

    The radioactive residues that are stored in the radioactive confinements its need to stay isolated of the environment while the radioactivity levels be noxious. An important mechanism by which the radioactive residues can to reach the environment, it is the migration of these through the underground water. That it makes necessary the investigation of reactive materials that interacting with those radionuclides and that its are able to remove them from the watery resources. The synthesis and characterization of materials that can be useful in Environmental Chemistry are very important because its characteristics are exposed and its behavior in chemical phenomena as the sorption watery medium is necessary to use it in the environmental protection. In this work it was carried out the sorption study of the samarium III ion in the iron (II) and (III) phosphate; obtaining the sorption isotherms in function of pH, of the phosphate mass and of the concentration of the samarium ion using UV-visible spectroscopy to determine the removal percentage. The developed experiments show that as much the ferrous phosphate as the ferric phosphate present a great affinity by the samarium III, for what it use like reactive material in contention walls can be very viable because it sorption capacity has overcome 90% to pH values similar to those of the underground and also mentioning that the form to obtain these materials is very economic and simple. (Author)

  16. Impact of educational strategies in positioning Samarium-153 EDTMP as a treatment for metastatic bone pain

    International Nuclear Information System (INIS)

    Seminario, C.; Morales, R.; Castro, M.; Cano, R.A.; Mendoza, G.

    2005-01-01

    To educate is a difficult task but its results make efforts worthwhile. Many patients in Peru suffer from intractable bone pain due to metastases. Since 1993 radionuclides were used to palliate bone pain due to metastases in Peru. First, with the help of the IAEA, Peru participated in a clinical trial using Phosphorus 32 and Strontium 89. Then, efforts were performed to produce Samarium 153 EDMTP locally, which was achieved in 1995. Nevertheless, years passed and Samarium use did not increase proportionally to the needs of people with cancer and bone pain, mainly the poor. Educational strategies have been proven useful for delivering solutions to many health problems in other diseases and also in cancer. Health education makes patients and their relatives assume responsible care of their problems. The purpose of this work was to increase Samarium EDTMP use as palliative treatment in patients with bone pain due to metastases, using educational strategies as means to change attitudes towards this health problem. In September 2003, a task group conducted studies in order to apply several methods to achieve the goal of increasing Samarium EDTMP use. Educational strategies employed were performed to provide verbal and written information to patients, physicians, medical students, residents, pain specialists, oncologists and neurologists, as well as general public. Verbal information included radio interviews, television spots and a phone number (in charge of two secretaries, prepared for answering and if not possible, a physician was in charge of attending patient consultation), e-mail and a web page for consultation. Written material was delivered to several newspapers, including clinical use of Samarium, possibilities of being elected for treatment, benefits and risks and a photography of the product. Politics of the institution producing Samarium changed, in order to achieve minimum cost of the product and it was delivered to all publics at the lowest cost for a year

  17. 7 CFR 1260.149 - Powers of the Board.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Powers of the Board. 1260.149 Section 1260.149 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING... thereof, in any interest-bearing account or certificate of deposit of a bank that is a member of the...

  18. 12 CFR 410.149 - Program accessibility: Discrimination prohibited.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Program accessibility: Discrimination prohibited. 410.149 Section 410.149 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY EXPORT-IMPORT BANK OF THE UNITED...

  19. 34 CFR 300.149 - SEA responsibility for general supervision.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 2 2010-07-01 2010-07-01 false SEA responsibility for general supervision. 300.149 Section 300.149 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF SPECIAL EDUCATION AND REHABILITATIVE SERVICES, DEPARTMENT OF EDUCATION ASSISTANCE TO STATES FOR THE EDUCATION OF CHILDREN WITH DISABILITIES State...

  20. Inductively coupled plasma optical emission spectrometry analysis of lanthanum, samarium and gadolinium oxides for rare earths impurities

    International Nuclear Information System (INIS)

    Reino, L.C.P.; Lordello, A.R.

    1990-09-01

    An inductively coupled plasma optical emission spectrometry method is described for the determination of Sm, Eu, La, Gd, Dy, Pr, Ho, Nd, Tb and Y in purified oxides of lanthanum, samarium and gadolinium. The method enables a simple, precise and readily available determination. Dissolution of the samples is achieved with diluted hydrochloric acid (1:1). The solutions are diluted to volume for a concentration of 1mg/ml. The lowest determination limit is 0,01% for most elements and 0,05 or 0,1% for a few rare earths in samarium and gadolinium matrices. Lanthanum, Samarium and Gadolinium concentrates with purity grade of 99,9%, 99,6% and 99,8%, respectively, can be analysed by this procedure. (author)

  1. Synthesis and structure of unprecedented samarium complex with bulky bis-iminopyrrolyl ligand via intramolecular C=N bond activation

    Energy Technology Data Exchange (ETDEWEB)

    Das, Suman; Anga, Srinivas; Harinath, Adimulam; Panda, Tarun K. [Department of Chemistry, Indian Institute of Technology, Hyderabad (India); Pada Nayek, Hari [Department of Applied Chemistry, Indian Institute of Technology, (ISM) Dhanbad, Jharkhand (India)

    2017-12-29

    An unprecedentate samarium complex of the molecular composition [{κ"3-{(Ph_2CH)N=CH}{sub 2}C{sub 4}H{sub 2}N}{κ"3-{(Ph_2CHN=CH)(Ph_2CHNCH)C_4H_2N}Sm}{sub 2}] (2), which was isolated by the reaction of a potassium salt of 2,5-bis{N-(diphenylmethyl)-iminomethyl}pyrrolyl ligand [K(THF){sub 2}{(Ph_2CH)N=CH}{sub 2}C{sub 4}H{sub 2}N] (1) with anhydrous samarium diiodide in THF at 60 C through the in situ reduction of imine bond is presented. The homoleptic samarium complex [[κ{sup 3}-{(Ph_2CH)-N=CH}{sub 2}C{sub 4}H{sub 2}N]{sub 3}Sm] (3) can also be obtained from the reaction of compound 1 with anhydrous samarium triiodide (SmI{sub 3}) in THF at 60 C. The molecular structures of complexes 2 and 3 were established by single-crystal X-ray diffraction analysis. The molecular structure of complex 2 reveals the formation of a C-C bond in the 2,5-bis{N-(diphenylmethyl)iminomethyl}pyrrole ligand moiety (Ph{sub 2}Py{sup -}). However, complex 3 is a homoleptic samarium complex of three bis-iminopyrrolyl ligands. In complex 2, the samarium ion adopts an octahedral arrangement, whereas in complex 3, a distorted three face-centered trigonal prismatic mode of nine coordination is observed around the metal ion. (copyright 2017 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  2. X-ray spectrum in the range (6-12) A emitted by laser-produced plasma of samarium

    International Nuclear Information System (INIS)

    Louzon, Einat; Henis, Zohar; Levi, Izhak; Hurvitz, Gilad; Ehrlich, Yosi; Fraenkel, Moshe; Maman, Shlomo; Mandelbaum, Pinchas

    2009-01-01

    A detailed analysis of the x-ray spectrum emitted by laser-produced plasma of samarium (6-12 A) is presented, using ab initio calculations with the HULLAC relativistic code and isoelectronic considerations. Resonance 3d-nf (n=4 to 7), 3p-4d, 3d-4p, and 3p-4s transitions in Ni samarium ions and in neighboring ionization states (from Mn to Zn ions) were identified. The experiment results show changes in the fine details of the plasma spectrum for different laser intensities.

  3. Peculiarities of electronic, phonon and magnon subsystems of lanthanum and samarium tetraborides

    Energy Technology Data Exchange (ETDEWEB)

    Novikov, V.V., E-mail: vvnovikov@mail.ru; Mitroshenkov, N.V.; Matovnikov, A.V.

    2015-10-15

    Experimental research was carried out to study the temperature dependences of heat capacity C{sub p}(T = 2–300 K), lattice parameters a(T), and ≿(T), (5–300 K) of lanthanum and samarium tetraborides. A comparison with data obtained previously for LuB{sub 4} reveals the peculiar influence of lanthanide contraction and the rare-earths mass on the thermodynamic properties of rare earth tetraborides at low and high temperatures. Sharp anomalies were found in the heat capacity and thermal expansion for SmB{sub 4} at T{sub N} = 25.1 K, conditioned by the phase transition into antiferromagnetic state. The more poorly defined heat capacity anomaly around 7 K is referred to the quadrupole orbital fluctuation of the atomic magnetic moments for Sm{sup 3+} ions. The electronic, lattice, and magnetic contributions to the heat capacity and thermal expansion of samarium tetraboride were defined. Our approach makes it possible to adequately approximate the lattice components of heat capacity and thermal expansion by combining the Debye and Einstein contributions, which are based on the joint analysis of calorimetric and X-ray data. The influence of the frustration of the atomic magnetic moment system for Sm{sup 3+} ions on the thermodynamic characteristics of the samarium tetraboride magnetic phase transition was revealed. - Highlights: • The heat capacity and lattice parameters for LaB{sub 4} and SmB{sub 4} were determined at 2–300 K. • The anomalies of C{sub p}(T), a(T), c(T) for SmB{sub 4} due to the phase transition are revealed. • The lattice contributions to the thermal properties of LaB{sub 4} and SmB{sub 4} are analyzed.

  4. Separation of lanthanum from samarium on solid aluminum electrode in LiCl-KCl eutectic melts

    International Nuclear Information System (INIS)

    De-Bin Ji; Mi-Lin Zhang; Xing Li; Xiao-Yan Jing; Wei Han; Yong-De Yan; Yun Xue; Zhi-Jian Zhang; Harbin Engineering University, Harbin

    2015-01-01

    This paper presents an electrochemical study on the separation of lanthanum from samarium on aluminum electrode at 773 K. The results from different electrochemical methods showed that Sm(III) and La(III) formed Al-Sm and Al-La intermetallic compounds on an aluminum electrode at electrode potential around -1.67 and -1.46 V, respectively. The electrochemical separation of lanthanum was carried out in LiCl-KCl-LaCl 3 -SmCl 3 melts on solid aluminum electrodes at 773 K by potentiostatic electrolysis at -1.45 V for 40 h and the separation efficiency was 99.1 %. (author)

  5. Determination of micro amounts of samarium and europium by analogue derivative spectrophotometry

    International Nuclear Information System (INIS)

    Ishii, H.; Satoh, K.

    1982-01-01

    Derivative spectrophotometry using the analogue differentiation circuit was applied to the determination of samarium and europium at ppm levels. By measuring the second or the fourth derivative spectra of the characteristic absorption bands of both the rare earth ions around 400 nm, they can be determined directly and selectively in the presence of large amounts of most other rare earths without any prior separation. Further, aptly selecting conditions for the measurement of the derivative spectra, the simultaneous determination of both the rare earth elements was feasible. The principle and the characteristics of analogue derivative spectrophotometry are also described. (orig.) [de

  6. Evaluation of samarium-153 and holmium-166-EDTMP in the normal baboon model

    Energy Technology Data Exchange (ETDEWEB)

    Louw, W.K.A.; Dormehl, I.C.; Rensburg, A.J. van; Hugo, N.; Alberts, A.S.; Forsyth, O.E.; Beverley, G.; Sweetlove, M.A.; Marais, J.; Loetter, M.G.; Aswegen, A. van

    1996-11-01

    Bone-seeking radiopharmaceuticals such as ethylenediaminetetramethylene phosphonate (EDTMP) complexes of samarium-153 and holmium-166 are receiving considerable attention for therapeutic treatment of bone metastases. In this study, using the baboon experimental model, multicompartmental analysis revealed that with regard to pharmacokinetics, biodistribution, and skeletal localisation, {sup 166}Ho-EDTMP was significantly inferior to {sup 153}Sm-EDTMP and {sup 99m}Tc-MDP. A more suitable {sup 166}Ho-bone-seeking agent should thus be sought for closer similarity to {sup 153}Sm-EDTMP to exploit fully the therapeutic potential of its shorter half-life and more energetic beta radiation.

  7. Body composition analysis by DEXA by using dynamically changing samarium filtration

    DEFF Research Database (Denmark)

    Gotfredsen, Arne; Baeksgaard, L; Hilsted, J

    1997-01-01

    Dual-energy X-ray absorptiometry (DEXA) has a high accuracy for body composition analysis but is influenced by beam hardening and other error sources in the extremes of measurement. To compensate for beam hardening, the Norland XR-36 introduces a dynamically changing samarium filtration system......). Scans of six healthy volunteers covered with combinations of beef and lard (approximately 5-15 kg) showed a good agreement (r = 0.99) between reference and DEXA values of added soft tissue mass and fat percentage. We conclude that the DEXA method (and, in particular, the Norland XR-36 using dynamic...

  8. Performance analysis of samarium cobalt P.M. synchronous motor fed from PWM inverters

    International Nuclear Information System (INIS)

    Rahman, M.A.; Choudhury, M.A.

    1985-01-01

    This paper presents an analysis and performance of samarium cobalt permanent magnet (P.M.) synchronous motors fed from two types of voltage source pulse width modulated (PWM) inverters. The analysis and test results on the steady state performance of a P.M. motor fed from PWM inverters are presented. PWM inverters are used in variable voltage variable frequency applications to avoid a double conversion process of ordinary inverters. In drives, they are used for voltage and speed regulation of motors. Use of modulation technique in inverters also allow to eliminate or minimize selected harmonics from the inverter output voltage

  9. Folate Receptor Targeted Alpha-Therapy Using Terbium-149

    CERN Document Server

    Müller, Cristina; Haller, Stephanie; Dorrer, Holger; Köster, Ulli; Johnston, Karl; Zhernosekov, Konstantin; Türler, Andreas; Schibli, Roger

    2014-01-01

    Terbium-149 is among the most interesting therapeutic nuclides for medical applications. It decays by emission of short-range α-particles (Eα = 3.967 MeV) with a half-life of 4.12 h. The goal of this study was to investigate the anticancer efficacy of a 149Tb-labeled DOTA-folate conjugate (cm09) using folate receptor (FR)-positive cancer cells in vitro and in tumor-bearing mice. 149Tb was produced at the ISOLDE facility at CERN. Radiolabeling of cm09 with purified 149Tb resulted in a specific activity of ~1.2 MBq/nmol. In vitro assays performed with 149Tb-cm09 revealed a reduced KB cell viability in a FR-specific and activity concentration-dependent manner. Tumor-bearing mice were injected with saline only (group A) or with 149Tb-cm09 (group B: 2.2 MBq; group C: 3.0 MBq). A significant tumor growth delay was found in treated animals resulting in an increased average survival time of mice which received 149Tb-cm09 (B: 30.5 d; C: 43 d) compared to untreated controls (A: 21 d). Analysis of blood parameters rev...

  10. Production of SmCo5 alloy by calciothermic reduction of samarium oxide

    International Nuclear Information System (INIS)

    Krishnan, T.S.; Gupta, C.K.

    1988-01-01

    Among the established permanent magnets, SmCo 5 magnet occupies the foremost position as it offers a unique combination of high energy product, coercivity and curie temperature. The SmCo 5 magnets are thus extensively used for high field applications. These are also best suited for use in environments where high demagnetizing field and high temperature are operative. Also, for applications where high performance and miniaturization are the over-riding considerations, the choice again falls on SmCo 5 magnets. The main deterrent to the widespread use of SmCo 5 magnet is its high cost. Both samarium and cobalt metals are high priced, and the magnets prepared from their directly melted alloy are thus naturally very expensive. An alternate process involving calcium reduction of their oxide intermediates has, therefore, been studied and the alloy prepared by this process has been evaluated and found satisfactory for magnet production. The process essentially involves compaction of the charge mix containing samarium oxide, cobalt oxide (or metal) and calcium metal and reduction of the charge compact at 1000-1300 degrees C in hydrogen atmosphere, followed by water and acid leaching, drying and classification

  11. Polypyrrole-coated samarium oxide nanobelts: fabrication, characterization, and application in supercapacitors

    Science.gov (United States)

    Liu, Peng; Wang, Yunjiao; Wang, Xue; Yang, Chao; Yi, Yanfeng

    2012-11-01

    Polypyrrole-coated samarium oxide nanobelts were synthesized by the in situ chemical oxidative surface polymerization technique based on the self-assembly of pyrrole on the surface of the amine-functionalized Sm2O3 nanobelts. The morphologies of the polypyrrole/samarium oxide (PPy/Sm2O3) nanocomposites were characterized using transmission electron microscope. The UV-vis absorbance of these samples was also investigated, and the remarkable enhancement was clearly observed. The electrochemical behaviors of the PPy/Sm2O3 composites were investigated by cyclic voltammetry, electrochemical impedance spectroscopy, and galvanostatic charge-discharge. The results indicated that the PPy/Sm2O3 composite electrode was fully reversible and achieved a very fast Faradaic reaction. After being corrected into the weight percentage of the PPy/Sm2O3 composite at a current density of 20 mA cm-2 in a 1.0 M NaNO3 electrolyte solution, a maximum discharge capacity of 771 F g-1 was achieved in a half-cell setup configuration for the PPy/Sm2O3 composites electrode with the potential application to electrode materials for electrochemical capacitors.

  12. Ekstraksi Pemisahan Neodimium dari Samarium, Itrium dan Praseodimium Memakai Tri Butil Fosfat

    Directory of Open Access Journals (Sweden)

    Maria Veronica Purwani

    2017-05-01

    Full Text Available The extraction of Nd(OH3 (neodymium hydroxide concentrate containing Y (yttrium, Sm (samarium and Pr (praseodymium as product of monazite processed has been done. The purpose of this study is to determine the separation of Nd from Y, Pr and Nd Sm in Nd concentrate. The aqueous phase was concentrated Nd (OH3 in HNO3 and extractant while organic phase was Tri Butyl Phosphate (TBP in kerosene. Parameters studied were pH and concentration feed, concentration of TBP in kerosene, extraction time and stirring speed. The result showed that the optimization of separation extraction neodymium from samarium, yttrium and praseodymium in Nd(OH3 concentrated with TBP, obtained the optimum condition of pH = 0.2, concentration of feed 100 g /L, concentration of TBP in kerosene 5%, extraction time 15 minutes and stirring speed 150 rpm. With the conditions, Separation Factor (SF obtained for Nd-Y, Nd-Pr, Nd-Sm are 2.242, 4.811, 4.002 respectively, while D and extraction efficiency of Nd are 0.236 and 19.07%.

  13. Thermomechanical behavior of Fe-Mn-Si-Cr-Ni shape memory alloys modified with samarium

    International Nuclear Information System (INIS)

    Shakoor, R.A.; Khalid, F. Ahmad

    2009-01-01

    The deformation and training behavior of Fe-14Mn-3Si-10Cr-5Ni (wt.%) shape memory alloys containing samarium addition has been studied in the iron-based shape memory alloys. It is noticed that thermomechanical treatment (training) has significant influence on proof stress, critical stress and shape memory behavior of the alloys. The improvement in shape memory behavior can be attributed to the decrease in the proof stress and critical stress which facilitates the formation of ε (hcp martensite). It is also observed that alloy 2 containing samarium undergoes less softening as compared to alloy 1 with training which inhibits the formation of α (bcc martensite) and thus enhances the shape memory behavior. The excessive thermomechanical treatment with increase in the training cycle has led to the formation of α (bcc martensite) along with ε (hcp martensite) in the alloy 1 which appeared to have decline in the shape memory effect. This has been demonstrated by the examination of microstructure and identification of α (bcc martensite) martensite in the alloy 1 as compared to alloy 2

  14. Phase Composition of Samarium Niobate and Tantalate Thin Films Prepared by Sol-Gel Method

    Science.gov (United States)

    Bruncková, H.; Medvecký, Ľ.; Múdra, E.; Kovalčiková, A.; Ďurišin, J.; Šebek, M.; Girman, V.

    2017-12-01

    Samarium niobate SmNbO4 (SNO) and tantalate SmTaO4 (STO) thin films ( 100 nm) were prepared by sol-gel/spin-coating process on alumina substrates with PZT interlayer and annealing at 1000°C. The precursors of films were synthesized using Nb or Ta tartrate complexes. The improvement of the crystallinity of monoclinic M'-SmTaO4 phase via heating was observed through the coexistence of small amounts of tetragonal T-SmTa7O19 phase in STO precursor at 1000°C. The XRD results of SNO and STO films confirmed monoclinic M-SmNbO4 and M'-SmTaO4 phases, respectively, with traces of orthorhombic O-SmNbO4 (in SNO). In STO film, the single monoclinic M'-SmTaO4 phase was revealed. The surface morphology and topography of thin films were investigated by SEM and AFM analysis. STO film was smoother with roughness 3.2 nm in comparison with SNO (6.3 nm). In the microstructure of SNO film, small spherical ( 50 nm) and larger cuboidal particles ( 100 nm) of the SmNbO4 phase were observed. In STO, compact clusters composed of fine spherical SmTaO4 particles ( 20-50 nm) were found. Effect of samarium can contribute to the formation different polymorphs of these films for the application to environmental electrolytic thin film devices.

  15. Polypyrrole-coated samarium oxide nanobelts: fabrication, characterization, and application in supercapacitors

    Energy Technology Data Exchange (ETDEWEB)

    Liu Peng, E-mail: pliu@lzu.edu.cn; Wang Yunjiao; Wang Xue; Yang Chao; Yi Yanfeng [College of Chemistry and Chemical Engineering, Lanzhou University, Key Laboratory of Nonferrous Metal Chemistry and Resources Utilization of Gansu Province and State Key Laboratory of Applied Organic Chemistry (China)

    2012-11-15

    Polypyrrole-coated samarium oxide nanobelts were synthesized by the in situ chemical oxidative surface polymerization technique based on the self-assembly of pyrrole on the surface of the amine-functionalized Sm{sub 2}O{sub 3} nanobelts. The morphologies of the polypyrrole/samarium oxide (PPy/Sm{sub 2}O{sub 3}) nanocomposites were characterized using transmission electron microscope. The UV-vis absorbance of these samples was also investigated, and the remarkable enhancement was clearly observed. The electrochemical behaviors of the PPy/Sm{sub 2}O{sub 3} composites were investigated by cyclic voltammetry, electrochemical impedance spectroscopy, and galvanostatic charge-discharge. The results indicated that the PPy/Sm{sub 2}O{sub 3} composite electrode was fully reversible and achieved a very fast Faradaic reaction. After being corrected into the weight percentage of the PPy/Sm{sub 2}O{sub 3} composite at a current density of 20 mA cm{sup -2} in a 1.0 M NaNO{sub 3} electrolyte solution, a maximum discharge capacity of 771 F g{sup -1} was achieved in a half-cell setup configuration for the PPy/Sm{sub 2}O{sub 3} composites electrode with the potential application to electrode materials for electrochemical capacitors.

  16. Pemisahan Unsur Samarium dan Yttrium dari Mineral Tanah Jarang dengan Teknik Membran Cair Berpendukung (Supported Liquid Membrane

    Directory of Open Access Journals (Sweden)

    Amri Amin

    2009-06-01

    Full Text Available he increasing use of rare earth elements in high technology industries needs to be supported by developmental work for the separation of elements. The research objective is fiercely attracting and challenging considering the similarity of bath physical and chemical properties among these elements. The rate separation of samarium and yttrium elements using supported liquid membrane has been studied. Polytetrafluoroethylene (PTFE with pore size of 0.45 µm has been used as the membrane and di(2-ethylhexyl phosphate (D2EHP in hexane has been used as a carrier and nitric acid solution has been used as receiving phase. Result of experiments showed that the best separation rate of samarium and yttrium elements could be obtained at feeding phase of pH 3.0, di(2-ethylhexyl phosphate (D2EHP concentration of 0.3 M, agitation rate of 700 rpm, agitation time of 2 hours, and nitric acid and its solution concentrations of 1.0 M and 0.1 M, respectively. At this condition, separation rates of samarium and yttrium were 64.4 and 67.6%, respectively.   Keywords: liquid membrane, rare earth elements, samarium, yttrium

  17. Behavior of Samarium III during the sorption process; Comportamiento del Samario-III durante el proceso de sorcion

    Energy Technology Data Exchange (ETDEWEB)

    Ordonez R, E.; Garcia G, N.; Garcia R, G. [ININ, Carr. Mexico-Toluca Km 36.5, Salazar, Estado de Mexico (Mexico)]. e-mail: edo@nuclear.inin.mx

    2004-07-01

    In this work the results of the behavior of samarium in solution are presented, in front of a fine powder of zirconium silicate (zircon). For that which is necessary to characterize the zircon, studying the crystallinity, the morphology, the surface area and the isoelectric point. The behavior of samarium in solution is studied by means of the elaboration of isotherm of sorption, using the technique by lots. One observes that to pH values of nearer to the isoelectric point (pH = 7.23) the process of sorption of the samarium begins, reaching a maximum to near pH at 9. The technique of luminescence is used to determine the concentration of the sipped samarium (phosphorescence) and also to make the speciation of the species formed in the surface of the zircon (phosphorescence). The results can be extrapolated with the plutonium when making the modeling of the migration of alpha emitting coming from the repositories of radioactive waste since both they have similar chemical properties (they are homologous). (Author)

  18. The systems cerium(3) (samarium) nitrate-quinoline nitrate-water

    International Nuclear Information System (INIS)

    Khisaeva, D.A.; Zhuravlev, E.F.; Semenova, Eh.B.

    1982-01-01

    Using the method of cross sections at 25 and 50 deg C the solubility in the systems cerium (3) nitrate-quinoline nitrate-water and samarium nitrate-quinoline nitrate-water has been studied. It is established that in the systems during chemical interaction of components congruently melting compounds of the composition: Ce(NO 3 ) 2 x2[C 9 H 7 NxHNO 3 ]x6H 2 O and Sm(NO 3 ) 3 x2[C 9 H 7 NxHNO 3 ]x2H 2 O are formed. New solid phases are separated preparatively and are subjected to chemical, differential thermal and IR spectroscopic analyses. The investigation results are compared with similar ones for nitrates of other representatives of lanthanide group

  19. The systems lanthanum (cerium, samarium) nitrate-tetramethyl-ammonium nitrate-water

    International Nuclear Information System (INIS)

    Zhuravlev, E.F.; Khisaeva, D.A.; Semenova, Eh.B.

    1984-01-01

    The method of cross sections at 25 and 50 deg C has been applied to study solubility in the systems lanthanum nitrate-tetramethyl ammonium nitrate-water (1), cesium (3) nitrate-tetramethyl ammonium nitrate-water (2) and samarium nitrate-tetramethyl ammonium nitrate-water (3). Crystallization fields of congruently dissolving compounds with 1:3 ratio of salt components (in system 1) and 1:2 ratio (in systems 2 and 3) are found in the systems. New solid phases are separated preparatively and subjected to chemical, differential thermal and IR spectroscopic analyses. Compositions of formed compounds are compared with the compositions known for nitrates of other representatives of light lanthanides

  20. Preparation and biological behaviour of samarium-153-hydroxyapatite particles for radiation synovectomy

    International Nuclear Information System (INIS)

    Agrueelles, M.G.; Luppi Berlanga, I.S.; Torres, E.A.; Rutty Sola, G.A.; Rimoldi, G.

    1998-01-01

    The preparation and labelling procedures of 153 Sm-hydroxyapatite ( 153 Sm-HA) are described in this paper. Hydroxyapatite (HA) was prepared and studied as a radiosynovectomy agent. HA particles were prepared from the reaction of calcium nitrate and ammonia phosphate at high pH Samarium-153 labelling was done in two steps with citric acid. A serie of experimental conditions, such as specific activity, citric acid mass, radioactive solution volume, in-vitro stability, have been carried out. Radiolabelling efficiency was greater than 95%. In vitro studies showed high stability (≥99%). Animal studies showed a good retention in the synovium, with a very low extra-articular leakage over 6 days after administration. (author)

  1. Efficacy and toxicity of Samarium-153-EDTMP locally produced in the treatment of painful skeletal metastases

    International Nuclear Information System (INIS)

    Olea, E.; Quintana, J.C.; Nagel, J.; Arenas, L.; Tomicic, M.; Gil, M.C.; Araya, G.

    2001-01-01

    Samarium-153 emits medium-energy beta particles an a gamma photon with a physical half-life of 46,3 hours. When chelated to ethylenediaminetetramethylenephosphonic acid (EDTMP), it is remarkably stable in vitro and in vivo. In this study we administered randomly 0,5 and 1,0 mCi/Kg body weight (two groups), to 30 patients with painful metastatic bone cancer. Slight and spontaneously reversible myelotoxicity was observed. A bigger leukocyte and platelet suppression was obtained with 1,0 mCi/kg than 0,5 mCi/Kg dose. Pain palliation was obtained in 66% of the treated patients. Our preliminary results indicate that 153 Sm-EDTMP is a promising radiotherapeutic agent for palliative treatment of metastatic bone cancer pain where a reactor is available and at a very affordable cost. (author)

  2. Studies on the structural, optical and dielectric properties of samarium coordinated with salicylic acid single crystal

    Science.gov (United States)

    Singh, Harjinder; Slathia, Goldy; Gupta, Rashmi; Bamzai, K. K.

    2018-04-01

    Samarium coordinated with salicylic acid was successfully grown as a single crystal by low temperature solution technique using mixed solvent of methanol and water in equal ratio. Structural characterization was carried out by single crystal X-ray diffraction analysis and it crystallizes in centrosymmetric space group P121/c1. FTIR and UV-Vis-NIR spectroscopy confirmed the compound formation and help to determine the mode of binding of the ligand to the rare earth-metal ion. Dielectric constant and dielectric loss have been measured over the frequency range 100 Hz - 30MHz. The decrease in dielectric constant with increases in frequency is due to the transition from interfacial polarization to dipolar polarization. The small value of dielectric constant at higher frequency ensures that the crystal is good candidate for NLO devices. Dielectric loss represents the resistive nature of the material.

  3. Use of dispersive liquid-liquid microextraction for simultaneous preconcentration of samarium, europium, gadolinium and dysprosium

    International Nuclear Information System (INIS)

    Mallah, M.H.; Atomic Energy Organization of Iran, Tehran; Shemirani, F.; Ghannadi Maragheh, M.

    2008-01-01

    A new preconcentration method of dispersive liquid-liquid microextraction (DLLME) was developed for simultaneous preconcentration of samarium, europium, gadolinium and dysprosium. DLLME technique was successfully used as a sample preparation method. In this preconcentration method, an appropriate mixture of extraction solvent, disperser solvent was injected rapidly into an aqueous solution containing Sm, Eu, Gd and Dy after complex formation using chelating reagent of the 1-(2-pyridylazo)-2-naphthol (PAN). After phase separation, 0.5 mL of the settled phase containing enriched analytes was determined by inductively coupled plasma optical emission spectrometry (ICP-OES). The main factors affected the preconcentration of Sm, Eu, Gd and Dy were extraction and dispersive solvent type and their volume, extraction time, volume of chelating agent (PAN), centrifuge speed and drying temperature of the samples. Under the best operating condition simultaneous preconcentration factors of 80, 100, 103 and 78 were obtained for Sm, Eu, Gd and Dy, respectively. (author)

  4. Europium and samarium doped calcium sulfide thin films grown by PLD

    International Nuclear Information System (INIS)

    Christoulakis, S.; Suchea, M; Katsarakis, N.; Koudoumas, E

    2007-01-01

    Europium and samarium doped calcium sulfide thin films (CaS:Eu,Sm) with different thickness were prepared by the pulsed laser deposition technique using sintered targets. A typical homemade deposition chamber and XeCl excimer laser (308 nm) were employed and the films were deposited in helium atmosphere onto silicon and corning glass substrates. Structural investigations carried out by X-ray diffraction and atomic force microscopy showed a strong influence of the deposition parameters on the film properties. The films grown had an amorphous or polycrystalline structure depending on growth temperature and the number of pulses used, the same parameters affecting the film roughness, the grain shape and dimensions, the film thickness and the optical transmittance. This work indicates that pulsed laser deposition can be a suitable technique for the preparation of CaS:Eu,Sm thin films, the film characteristics being controlled by the growth conditions

  5. Radiochemical separation of Tb-149 after tandem accelerator production

    International Nuclear Information System (INIS)

    Sarkar, S.R.

    1996-01-01

    Full text: Terbium-149 is produced by the heavy ion induced reaction of the type 142 Nd( 12 C,5n) 149 Dy→ 149 Tb. This work concerns the separation of terbium from neodymium target, and other lanthanides produced by secondary reactions on neodymium target. Firstly, anion-exchange separation is carried out at room temperature using acid-alcohol media (90% methanol-10% 5M nitric acid) as eluent. But the separation is not satisfactory. To achieve satisfactory separation, cation exchange separation is performed under pressure at room temperature using 0.1 6M α-hydroxyisobutyric acid of pH 5 as eluent. The pressure is exerted from a nitrogen gas cylinder. The simplicity and efficacy of this method for the separation of terbium are discussed in comparison with the commercially available high performance liquid chromatography system

  6. Effect of samarium in corrosion and microstructure of Al-5Zn-0.5Cu as low driving voltage sacrificial anode

    Science.gov (United States)

    Pratesa, Yudha; Ferdian, Deni; Ramadhan, Fajar Yusya; Maulana, Bramuda

    2018-05-01

    Sacrificial Anode Low voltage is the latest generation of the sacrificial anode that can prevent the occurrence of Hydrogen Cracking (HIC) due to overprotection. The Al-5n-0.5Cu alloy showed the potential to be developed as the new sacrificial anode. However, the main problem is copper made Al2Cu intermetallic in grain boundary. Samarium is added to modify the shape of the intermetallic to make it finer and make the corrosion uniform. Several characterizations were conducted to analyze the effect of Samarium. Scanning electron microscope (SEM) and Energy dispersive spectroscopy was used to analyzed the microstructure of the alloy. Metallography preparation was prepared for SEM analysis. Corrosion behavior was characterized by cyclic polarization in 3.5% NaCl solution. The results show samarium can change the shape of intermetallic and refine the grains. In addition, samarium makes better pitting resistance and exhibits a tendency for uniform corrosion. It is indicated by the loop reduction (ΔEpit-prot). Current density increased as an effect of samarium addition from 6x10-5 Ampere (Al-5Zn-0.5Cu) to 2.5x10-4 Ampere (Al-5Zn-0.5Cu-0.5Sm). Steel potential protection increased after addition of samarium which is an indication the possibility of Al-Zn-Cu-Sm to be used as low voltage sacrificial anode.

  7. Myelotoxicity of Samarium Sm153 lexidronam in patients with painful bony metastases

    International Nuclear Information System (INIS)

    Ben Ghachem, T.; Mhiri, A.; Slim, I.; Bahloul, A.; Yeddes, I.; Elbez, I.; Meddeb, I.; Ben Slimene, M.F.

    2015-01-01

    Full text of publication follows. Introduction: the management of bone pain includes analgesia, radiation, hormones, radiofrequency (RF) ablation, chemotherapy, and surgery. Bone pain palliation therapy with radiopharmaceuticals is a cost-effective systemic therapy to relieve pain from skeletal metastases with a consequent decrease in morbidity and an improvement in quality of life. The aim of our study is to evaluate the effect of myelotoxicity of samarium lexidronam (Sm 153 ) in patients with painful bony metastasis. Methods: we reviewed 116 patients aged from 14 to 87 years old, 91 males (78%) and 25 females (22%), having received 1 to 4 treatments of Sm 153 (37 MBq/kg) for painful bony metastases from different primitive tumors: 67 cases of prostate cancer (57.7%), 22 cases of breast cancer (18.9%), 10 cases of pulmonary cancer (8.6%) and others in 14.6% of cases. Clinical follow-up was available for 159 treatments, consisting on blood count each week over at least two months, in order to evaluate myelotoxicity according to WHO classification. Results: no patients had grade 4 toxicity after its cures. A grade 2-3 myelotoxicity was observed after 52 treatments (34%) during the second week and after 50 treatments (32.6%) during the fourth week with a satisfactory reversibility. At 10 weeks of treatment, myelotoxicity was reclassified from 0 to 2 for 139 cures (90,8%). Moreover, we found that prior treatment with radiotherapy or chemotherapy did not affect the rates of myelotoxicity. Conclusion: multiple treatments with samarium Sm 153 lexidronam had no significant effect on myelotoxicity. Patients with bone predominant metastatic disease may survive for extended periods of time and may safely be treated with multiple modalities of therapy. (authors)

  8. 38 CFR 17.149 - Sensori-neural aids.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Sensori-neural aids. 17... Prosthetic, Sensory, and Rehabilitative Aids § 17.149 Sensori-neural aids. (a) Notwithstanding any other provision of this part, VA will furnish needed sensori-neural aids (i.e., eyeglasses, contact lenses...

  9. 7 CFR 929.149 - Determination of sales history.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Determination of sales history. 929.149 Section 929... Determination of sales history. A sales history for each grower shall be computed by the Committee in the following manner. (a) For each grower with acreage with 7 or more years of sales history, a new sales...

  10. 49 CFR 28.149 - Program accessibility: Discrimination prohibited.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false Program accessibility: Discrimination prohibited... § 28.149 Program accessibility: Discrimination prohibited. Except as otherwise provided in § 28.150, no... otherwise be subjected to discrimination under any program or activity conducted by the Department. ...

  11. 32 CFR 1699.149 - Program accessibility: discrimination prohibited.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 6 2010-07-01 2010-07-01 false Program accessibility: discrimination prohibited... CONDUCTED BY SELECTIVE SERVICE SYSTEM § 1699.149 Program accessibility: discrimination prohibited. Except as... participation in, or otherwise be subject to discrimination under any program or activity conducted by the...

  12. 45 CFR 149.315 - Reimbursement conditioned upon available funds.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Reimbursement conditioned upon available funds... TO HEALTH CARE ACCESS REQUIREMENTS FOR THE EARLY RETIREE REINSURANCE PROGRAM Reimbursement Methods § 149.315 Reimbursement conditioned upon available funds. Notwithstanding a sponsor's compliance with...

  13. Potentiometric study of samarium oxides formation from its chloride in a molten eutectic mixture of sodium and cesium chlorides

    International Nuclear Information System (INIS)

    Smolenskij, V.V.; Bove, A.L.; Del'mukhamedov, R.D.; Borodina, N.P.; Gavrilov, A.G.

    1997-01-01

    Interaction of trivalent samarium cations with oxide-ions in NaCl-2CsCl melt at 973 K has been studied by potentiometric method using electrochemical cell with two platinum-oxygen electrodes with a solid electrolyte membrane. The mechanism of the interaction and composition of the reaction products, depending on the medium oxyacidity, have been considered. Certain thermodynamic characteristics of the process have been calculated

  14. Structural and luminescence properties of samarium doped lead alumino borate glasses

    Science.gov (United States)

    Mohan, Shaweta; Kaur, Simranpreet; Singh, D. P.; Kaur, Puneet

    2017-11-01

    The study reports the effect of samarium concentration on the physical, structural and spectroscopic characteristics of samarium doped lead alumino borate glasses having composition 20PbO-(10-x)Al2O3-70B2O3-xSm2O3; x = 0.1, 0.5, 1.0 and 2.0 mol %. The glasses were fabricated by conventional melt-quenching technique and then characterized by XRD, FTIR, optical absorption and fluorescence spectra. X-ray diffraction studies confirmed the amorphous nature of the prepared glasses. FTIR spectra indicate the presence of BO3, BO4, AlO6 and a few other structural groups. Various physical properties such as density, molar volume, refractive index, rare earth ion concentration, boron-boron distance and polarizability etc. were determined using conventional methods and standard formulae. The Judd-Ofelt theory was applied on the optical absorption spectra of the glasses to evaluate the three phenomenological intensity parameters Ω2, Ω4 and Ω6. The value of Ω2 was found to be highest for glass with 1 mol% Sm2O3 and attributed to the asymmetry of the ligand field at the rare earth ion site and the rare earth oxygen (Sm-O) covalency. The calculated intensity parameters and fluorescence spectra were further used to predict the radiative transition probability (A), radiative lifetime (τR), branching ratio (βR), peak wavelength (λp), effective line widths (Δλeff) and stimulated emission cross-section (σ) for the characteristic 4G5/2 → 6H5/2, 6H7/2 and 6H9/2 transitions of the Sm3+ ion. Concentration quenching was observed for 2 mol% concentration of Sm2O3 and ascribed to energy transfer through various cross-relaxation channels between Sm3+ ions. Reasonably high values of branching ratios and stimulated emission cross-section for the prepared glasses points towards their utility in the development of visible lasers emitting in the reddish-orange spectral region. However, the glass with 1 mol% Sm2O3 was found to show better radiative properties.

  15. Fluorometric determination of samarium and europium in rare earth minerals with. beta. -diketoneternary complex

    Energy Technology Data Exchange (ETDEWEB)

    Huang, H; Hiraki, K; Nishikawa, Y [Kinki Univ., Higashi-Osaka, Osaka (Japan). Faculty of Science and Technology

    1981-07-01

    This communication reported the optimum conditions for the fluorometric determination of these ions, and the method was adopted in the simultaneous determination of samarium and europium in xenotime and monazite minerals. From the experimental results on the effect of diverse ions and the extraction pH of the aqueous phase, it became clear that TTA-TOPO hexane method was the best system for the determination of samarium and europium because of the highest fluorescence sensitivity of the ternary complex, and also because the lower extraction pH eliminated the effect of diverse ions. Moreover, the very high detection limit (2 ppb) of Sm was achieved by the use of a red sensitive photomultiplier. Which was used at 644 nm, and that of Eu (0.02 ppb) at 614 nm. The procedure was established as follows: The rare earth minerals (xenotime, monazite) sample was treated with hot conc. H/sub 2/SO/sub 4/ and twice precipitated with 0.5 mol dm/sup -3/ oxalic acid (pH was adjusted to 2.0 -- 2.2). Then the precipitate was filtered and ignited to give the rare earth oxide. Fifty milligrams of the oxide was dissolved in HCl and diluted with water in order to obtain the solution containing 5 ..mu..g cm/sup -3/ rare earth oxide. An aliquot of the solution ((1.0 -- 3.0) cm/sup 3/) was adjusted to pH 5.5 with sodium acetate and shaken with 1 x 10/sup -4/ mol dm/sup -3/ TTA- 2 x 10/sup -2/ mol dm/sup -3/ TOPO hexane solution. Then the fluorescence intensity of the organic layer was measured at 644 nm for Sm and 614 nm for Eu. In this procedure, the recovery of Sm and Eu was found to be about 96%. Xenotime contained 0.70% of Sm and 0.004% of Eu, and monazite contained 1.84% of Sm and 0.003% of Eu.

  16. Dicty_cDB: SSE149 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSE149 (Link to dictyBase) - - - Contig-U01658-1 | Contig-U165... library) Clone ID SSE149 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U016...58-1 | Contig-U16509-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/S...g significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium discoideum mRNA. 64 1e-17 2 AC100496...egans clone T13G4, complete sequence. 36 5.0 2 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ictalurus p

  17. Beta-delayed proton activities: 147Dy and 149Er

    International Nuclear Information System (INIS)

    Toth, K.S.; Moltz, D.M.; Schloemer, E.C.; Cable, M.D.; Avignone, F.T. III; Ellis-Akovali, Y.A.

    1984-01-01

    The present paper discusses mainly the β-delayed proton spectra of 147 Dy and of the hitherto unknown isotope, 149 Er. However, following the submittal of the abstract for this conference we have now observed delayed protons following the decay of 145 Dy. Additionally, we have identified a 0.5-s delayed-proton emitter and tentatively assign it to the new isotope, 151 Yb

  18. Solar Hydrogen Production via a Samarium Oxide-Based Thermochemical Water Splitting Cycle

    Directory of Open Access Journals (Sweden)

    Rahul Bhosale

    2016-04-01

    Full Text Available The computational thermodynamic analysis of a samarium oxide-based two-step solar thermochemical water splitting cycle is reported. The analysis is performed using HSC chemistry software and databases. The first (solar-based step drives the thermal reduction of Sm2O3 into Sm and O2. The second (non-solar step corresponds to the production of H2 via a water splitting reaction and the oxidation of Sm to Sm2O3. The equilibrium thermodynamic compositions related to the thermal reduction and water splitting steps are determined. The effect of oxygen partial pressure in the inert flushing gas on the thermal reduction temperature (TH is examined. An analysis based on the second law of thermodynamics is performed to determine the cycle efficiency (ηcycle and solar-to-fuel energy conversion efficiency (ηsolar−to−fuel attainable with and without heat recuperation. The results indicate that ηcycle and ηsolar−to−fuel both increase with decreasing TH, due to the reduction in oxygen partial pressure in the inert flushing gas. Furthermore, the recuperation of heat for the operation of the cycle significantly improves the solar reactor efficiency. For instance, in the case where TH = 2280 K, ηcycle = 24.4% and ηsolar−to−fuel = 29.5% (without heat recuperation, while ηcycle = 31.3% and ηsolar−to−fuel = 37.8% (with 40% heat recuperation.

  19. Charge and transition densities of samarium isotopes in the interacting Boson model

    International Nuclear Information System (INIS)

    Moinester, M.A.; Alster, J.; Dieperink, A.E.L.

    1982-01-01

    The interacting boson approximation (IBA) model has been used to interpret the ground-state charge distributions and lowest 2 + transition charge densities of the even samarium isotopes for A = 144-154. Phenomenological boson transition densities associated with the nucleons comprising the s-and d-bosons of the IBA were determined via a least squares fit analysis of charge and transition densities in the Sm isotopes. The application of these boson trasition densities to higher excited 0 + and 2 + states of Sm, and to 0 + and 2 + transitions in neighboring nuclei, such as Nd and Gd, is described. IBA predictions for the transition densities of the three lowest 2 + levels of 154 Gd are given and compared to theoretical transition densities based on Hartree-Fock calculations. The deduced quadrupole boson transition densities are in fair agreement with densities derived previously from 150 Nd data. It is also shown how certain moments of the best fit boson transition densities can simply and sucessfully describe rms radii, isomer shifts, B(E2) strengths, and transition radii for the Sm isotopes. (orig.)

  20. Development and evaluation of copper-67 and samarium-153 labeled conjugates for tumor radioimmunotherapy

    International Nuclear Information System (INIS)

    Srivastava, S.C.; Mausner, L.F.; Mease, R.C.; Meinken, G.E.; Joshi, V.; Kolsky, K.; Sweet, M.; Steplewski, Z.

    1995-01-01

    The potential of utilizing receptor-specific agents such as monoclonal antibodies (MAb), and MAb-derived smaller molecules, as carriers of radionuclides for the selective destruction of tumors has stimulated much research activity. The success of such applications depends on many factors, especially the tumor binding properties of the antibody reagent, the efficiency of labeling and in-vivo stability of the radioconjugate and, on the careful choice of the radionuclide best suited to treat the tumor under consideration. The radiolabeled antibody technique for radioimmunotherapy (RIT), however, has experienced many limitations, and its success has not matched the expectations that were raised more than a decade ago. The problems that have been identified include: (i) degradation of antibody immunoreactivity resulting from chemical manipulations required for labeling; (ii) lack of suitable radioisotopes and methods for stable attachment of the radiolabel; (iii) in-vivo instability of the radioimmunoconjugates; (iv) excessive accumulation of activity in non-target locations; and (v) lack of radioimmunoconjugate accessibility to cells internal to a tumor mass. A careful choice of the radionuclide(s) best suited to treat the tumor under consideration is one of the most important requirements for successful radioimmunotherapy. This study evaluates copper 67 and samarium 153 for tumor radioimmunotherapy

  1. Enhancement of the fluorescence of the samarium (III) complex by gadolinium (III)

    International Nuclear Information System (INIS)

    Yun-Xiang, C.; Zhang-Hua, L.

    1988-01-01

    The increase in sensitivity and selectivity of reactions in which colored species are formed by the addition of different metal ions is an area of research that has recently been developed. This phenomenon, which is sometimes called cocolaration effect, has been explained by the formation of mixed metal complex. The authors found an analogous phenomenon of reactions forming fluorescent complexes. The complexes of Sm(III)-thenoyltrifluoroacetone (TTA)-phenanthroline (Phen)-Triton-X-100 (TX-100) and Gd(III) (or La(III), Lu(III) and Y(III))-TTA-Phen-TX-100 had practically no fluorescence separately. Instead, a fluorescence-enhancement phenomenon caused by adding Gd or La, Lu and Y ions to the system was observed for the first time. The intensity of the enhanced fluorescence of Sm(III) complex was increased in the following order: La< Y< Lu< Gd. By analogy with cocoloration effect, the authors call this new fluorescence-enhancement phenomenon the co-fluorescence effect. The object of this work was to study the enhancement effect of Gd(III) on the fluorescence of the Sm(III)-TTA-Phen-TX-100 system. The recommended fluorimetric method has been applied to the determination of trace amounts of samarium in ytterbium oxide with satisfactory results. A general reaction mechanism for the system studied was proposed

  2. Pharmacokinetics of labelled compounds with technetium-99m and samarium-153

    International Nuclear Information System (INIS)

    Borda O, L.B.; Torres L, M.N.

    1997-01-01

    The purpose of this investigation was to establish the different pharmacokinetics parameters of the main radiopharmaceuticals labeled with technetium-99m and samarium-153. These parameters could be subsequently used as reference to compare other products with the same use. Mathematical models and a computerized pharmacokinetic program were used to this purpose. A biodistribution study in quadruplicate and/or quintuplicate was conducted for each radiopharmaceutical, data was was obtained in injection dose percentages. The biodistribution study involved the injection of a predetermined dose of the radiopharmaceutical into animals (rats or mice), which were subsequently put away at different time intervals, removing the relevant organs. Activity in each organ was read by means of a well-type NaI scintillation counter, data obtained in activity counts was transformed into injection dose percentages. Based on these percentages, the mathematical model was constructed and the pharmacokinetic parameters were obtained using the computerized program Expo 2 v. 1, which is written in C language and works in windows. Analyzing the results obtained, we can conclude that the use of the Expo 2 v. 1 program for a bi compartmental analysis allowed us to obtain reliable pharmacokinetic parameters which describe what happens in the organism when the radiopharmaceutical passes from the central compartment to the peripheral one and vice versa

  3. Memory effect of calcined layered samarium hydroxy chlorides in aqueous solution

    International Nuclear Information System (INIS)

    Lee, Byung Il; Byeon, Song Ho

    2015-01-01

    The decomposition and recovery behavior of layered samarium hydroxychloride (Sm 2 (OH) 5 Cl·nH 2 O, LSmH) has been closely studied in various conditions. Although the heat treatment of LSmH at 700 °C completely collapsed typical layered structure, the calcined LSmH (c-LSmH) recovered its layered characteristics and consequently its ability to intercalate anions into the interlayer space when it was rehydroxylated and rehydrated in aqueous solutions containing organic and inorganic anions. This phenomenon is similar to the memory effect observed in classical layered double hydroxides (LDHs), where LDHs calcined to a mixture of metal oxides can recover their layered structures in aqueous solutions. In contrast, the recovery reaction of c-LSmH in water without any counter anions was unsuccessful and instead resulted in the formation of Sm(OH) 3 . Such a difference was interpreted on the basis of the salt effect on Sm 2 (OH) 5 Cl·nH 2 O–Sm(OH) 3 phase equilibria in water

  4. Characterization of luminescent samarium doped HfO2 coatings synthesized by spray pyrolysis technique

    International Nuclear Information System (INIS)

    Chacon-Roa, C; Guzman-Mendoza, J; Aguilar-Frutis, M; Garcia-Hipolito, M; Alvarez-Fragoso, O; Falcony, C

    2008-01-01

    Trivalent samarium (Sm 3+ ) doped hafnium oxide (HfO 2 ) films were deposited using the spray pyrolysis deposition technique. The films were deposited on Corning glass substrates at temperatures ranging from 300 to 550 deg. C using chlorides as raw materials. Films, mostly amorphous, were obtained when deposition temperatures were below 350 deg. C. However, for temperatures higher than 400 deg. C, the films became polycrystalline, presenting the HfO 2 monoclinic phase. Scanning electron microscopy of the films revealed a rough surface morphology with spherical particles. Also, electron energy dispersive analysis was performed on these films. The photoluminescence and cathodoluminescence characteristics of the HfO 2 : SmCl 3 films, measured at room temperature, exhibited four main bands centred at 570, 610, 652 and 716 nm, which are due to the well-known intra-4f transitions of the Sm 3+ ion. It was found that the overall emission intensity rose as the deposition temperature was increased. Furthermore, a concentration quenching of the luminescence intensity was also observed

  5. Effect of Zinc Oxide Doping on Electroluminescence and Electrical Behavior of Metalloporphyrins-Doped Samarium Complex

    Science.gov (United States)

    Janghouri, Mohammad; Amini, Mostafa M.

    2018-02-01

    Samarium complex [(Sm(III)] as a new host material was used for preparation of red organic light-emitting diodes (OLEDs). Devices with configurations of indium-doped tin oxide (ITO)/poly(3,4-ethylenedioxythiophene):(poly(styrenesulfonate) (PEDOT:PSS (50 nm)/polyvinyl carbazole (PVK):[zinc oxide (ZnO)] (50 nm)/[(Sm(III)]:[zinc(II) 2,3-tetrakis(dihydroxyphenyl)-porphyrin and Pt(II) 2,3-dimethoxyporphyrin] (60 nm)/2,9-dimethyl-4,7-diphenyl-1,10-phenanthroline (BCP) (15 nm)/Al (150 nm) have been fabricated and investigated. An electroplex occurring at the (PVK/Sm: Pt(II) 2,3-dimethoxyporphyrin) interface has been suggested when ZnO nanoparticles were doped in PVK. OLED studies have revealed that the photophysical characteristics and electrical behavior of devices with ZnO nanoparticles are much better than those of devices with pure PVK. The efficiency of devices based on [(Sm(III)] was superior than that of known aluminum tris(8-hydroxyquinoline) (Alq3) and also our earlier reports on red OLEDs under the same conditions.

  6. Pyroelectric properties and electrical conductivity in samarium doped BiFeO 3 ceramics

    KAUST Repository

    Yao, Yingbang

    2012-06-01

    Samarium (Sm 3+) doped BiFeO 3 (BFO) ceramics were prepared by a modified solid-state-reaction method which adopted a rapid heating as well as cooling during the sintering process. The pyroelectric coefficient increased from 93 to 137 μC/m 2 K as the Sm 3+ doping level increased from 1 mol% to 8 mol%. Temperature dependence of the pyroelectric coefficient showed an abrupt decrease above 80 °C in all samples, which was associated with the increase of electrical conductivity with temperature. This electrical conduction was attributed to oxygen vacancy existing in the samples. An activation energy of ∼0.7 eV for the conduction process was found to be irrespective of the Sm 3+ doping level. On the other hand, the magnetic Néel temperature (T N) decreased with increasing Sm 3+ doping level. On the basis of our results, the effects of Sm doping level on the pyroelectric and electrical properties of the BFO were revealed. © 2011 Elsevier Ltd. All rights reserved.

  7. Detonation nanodiamond introduced into samarium doped ceria electrolyte improving performance of solid oxide fuel cell

    Science.gov (United States)

    Pei, Kai; Li, Hongdong; Zou, Guangtian; Yu, Richeng; Zhao, Haofei; Shen, Xi; Wang, Liying; Song, Yanpeng; Qiu, Dongchao

    2017-02-01

    A novel electrolyte materials of introducing detonation nanodiamond (DNDs) into samarium doped ceria (SDC) is reported here. 1%wt. DNDs doping SDC (named SDC/ND) can enlarge the electrotyle grain size and change the valence of partial ceria. DNDs provide the widen channel to accelerate the mobility of oxygen ions in electrolyte. Larger grain size means that oxygen ions move easier in electrolyte, it can also reduce the alternating current (AC) impedance spectra of internal grains. The lower valence of partial Ce provides more oxygen vacancies to enhance mobility rate of oxygen ions. Hence all of them enhance the transportation of oxygen ions in SDC/ND electrolyte and the OCV. Ultimately the power density of SOFC can reach 762 mw cm-2 at 800 °C (twice higher than pure SDC, which is 319 mw cm-2 at 800 °C), and it remains high power density in the intermediate temperature (600-800 °C). It is relatively high for the electrolyte supported (300 μm) cells.

  8. 33 CFR 149.310 - What are the muster and embarkation requirements for survival craft?

    Science.gov (United States)

    2010-07-01

    ... embarkation requirements for survival craft? 149.310 Section 149.310 Navigation and Navigable Waters COAST... and embarkation requirements for survival craft? Muster and embarkation arrangements for survival craft must comply with 46 CFR 108.540. ...

  9. Retention capacity of samarium (III) in zircon for it possible use in retaining walls for confinement of nuclear residues

    International Nuclear Information System (INIS)

    Garcia G, N.

    2006-01-01

    Mexico, as country that produces part of its electric power by nuclear means, should put special emphasis in the development of technologies guided to the sure and long term confinement of the high level nuclear residuals. This work studies the capacity that has the natural zircon to retain to the samarium (III) in solution, by what due, firstly, to characterize the zircon for technical instrumental to determine the purity and characteristic of the mineral in study. The instrumental techniques that were used to carry out the physicochemical characterization were the neutron activation analysis (NAA), the infrared spectroscopy (IS), the thermal gravimetric analysis (TGA), scanning electron microscopy (SEM), transmission electron microscopy (TEM), semiquantitative analysis, dispersive energy spectroscopy (EDS), X-ray diffraction (XRD) and luminescence technique. The characterization of the surface properties carries out by means of the determination of the surface area using the BET multipoint technique, acidity constants, hydration time, the determination of the point of null charge (pH PCN ) and density of surface sites (D s ). The luminescence techniques were useful to determine the optimal point hydration of the zircon and for the quantification of the samarium, for that here intends the development of both analysis techniques. With the adjustment of the titration curves in the FITEQL 4 package the constants of surface acidity in the solid/liquid interface were determined. To the finish of this study it was corroborated that the zircon is a mineral that presents appropriate characteristics to be proposed as a contention barrier for the deep geologic confinement. With regard to the study of adsorption that one carries out the samarium retention it is superior to 90% under the described conditions. This investigation could also be applicable in the confinement of dangerous industrial residuals. (Author)

  10. 33 CFR 149.655 - What are the requirements for helicopter fueling facilities?

    Science.gov (United States)

    2010-07-01

    ... helicopter fueling facilities? 149.655 Section 149.655 Navigation and Navigable Waters COAST GUARD... EQUIPMENT Design and Equipment Helicopter Fueling Facilities § 149.655 What are the requirements for helicopter fueling facilities? Helicopter fueling facilities must comply with 46 CFR 108.489 or an equivalent...

  11. 33 CFR 149.321 - How many ring life buoys must be on each deepwater port?

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false How many ring life buoys must be on each deepwater port? 149.321 Section 149.321 Navigation and Navigable Waters COAST GUARD... EQUIPMENT Lifesaving Equipment Manned Deepwater Port Requirements § 149.321 How many ring life buoys must be...

  12. 33 CFR 149.409 - How many fire extinguishers are needed?

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false How many fire extinguishers are needed? 149.409 Section 149.409 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND... Fire Protection Equipment Firefighting Requirements § 149.409 How many fire extinguishers are needed...

  13. 33 CFR 149.412 - How many fire axes are needed?

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false How many fire axes are needed? 149.412 Section 149.412 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY... Protection Equipment Firefighting Requirements § 149.412 How many fire axes are needed? Each manned deepwater...

  14. 33 CFR 149.323 - What are the requirements for first aid kits?

    Science.gov (United States)

    2010-07-01

    ... first aid kits? 149.323 Section 149.323 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF... Lifesaving Equipment Manned Deepwater Port Requirements § 149.323 What are the requirements for first aid kits? (a) Each manned deepwater port must have an industrial first aid kit, approved by an appropriate...

  15. 33 CFR 149.580 - What are the requirements for a radar beacon?

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false What are the requirements for a radar beacon? 149.580 Section 149.580 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF... Navigation Miscellaneous § 149.580 What are the requirements for a radar beacon? (a) A radar beacon (RACON...

  16. 33 CFR 149.125 - What are the requirements for the malfunction detection system?

    Science.gov (United States)

    2010-07-01

    ... malfunction detection system? 149.125 Section 149.125 Navigation and Navigable Waters COAST GUARD, DEPARTMENT... Pollution Prevention Equipment § 149.125 What are the requirements for the malfunction detection system? (a... Commandant (CG-5) will evaluate proposed leak-detection systems for natural gas on an individual basis. ...

  17. 40 CFR 61.149 - Standard for waste disposal for asbestos mills.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 8 2010-07-01 2010-07-01 false Standard for waste disposal for asbestos mills. 61.149 Section 61.149 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... Standard for Asbestos § 61.149 Standard for waste disposal for asbestos mills. Each owner or operator of...

  18. 45 CFR 149.610 - Secretary's authority to reopen and revise a reimbursement determination.

    Science.gov (United States)

    2010-10-01

    ... reimbursement determination. 149.610 Section 149.610 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES... of Data Inaccuracies § 149.610 Secretary's authority to reopen and revise a reimbursement determination. (a) The Secretary may reopen and revise a reimbursement determination upon the Secretary's own...

  19. 45 CFR 149.41 - Consequences of Non-Compliance, Fraud, or Similar Fault.

    Science.gov (United States)

    2010-10-01

    ... Fault. 149.41 Section 149.41 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES REQUIREMENTS... Eligible Employment-Based Plans § 149.41 Consequences of Non-Compliance, Fraud, or Similar Fault. Upon failure to comply with the requirements of this part, or if fraud, waste, and abuse, or similar fault are...

  20. 45 CFR 149.320 - Universe of claims that must be submitted.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Universe of claims that must be submitted. 149.320 Section 149.320 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES REQUIREMENTS RELATING TO HEALTH... Universe of claims that must be submitted. (a) Claims submitted for an early retiree, as defined in § 149.2...

  1. Determination of the nuclear electric charge distribution of samarium isotopes 144, 148, 150, 152, 154 by the muonic atom method

    International Nuclear Information System (INIS)

    Barreau, Pierre.

    1977-01-01

    The theory of the nucleus-negative muon system in the case of electrical interactions is discussed. The interactions of muons with the samarium isotopes 152, 154, 144, 148, 150 are investigated. After a description of the experimental device, from muon beam production to data acquisition (detection of the gamma spectra), the results are analyzed and the nuclear charge distribution parameters determined: for each isotope the absolute value of c (half-density radius) and t (skin thickness); for 152 Sm and 154 Sm the parameter β 2 (quadrupolar defomation). Nuclear polarization was accounted for throughout the analysis [fr

  2. Effects of the atomic environment on the electron binding energies in samarium

    Czech Academy of Sciences Publication Activity Database

    Inoyatov, A. K.; Kovalík, Alojz; Filosofov, D. V.; Ryšavý, Miloš; Vénos, Drahoslav; Yushkevich, Y. V.; Perevoshchikov, L. L.; Zhdanov, V. S.

    2016-01-01

    Roč. 207, FEB (2016), s. 38-49 ISSN 0368-2048 R&D Projects: GA ČR(CZ) GAP203/12/1896; GA MŠk LG14004 Institutional support: RVO:61389005 Keywords : Sm-149 * atomic environment * electron ginding energy * intermediate-valence state * chemical shift * natural atomic level width Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.661, year: 2016

  3. Fabrication and properties of samarium doped calcium sulphate thin films using spray pyrolysis technique

    Energy Technology Data Exchange (ETDEWEB)

    Reghima, Meriem [Université Tunis El Manar, Faculté des Sciences de Tunis, Département de Physique, LR99ES13 Laboratoire de Physique de la Matière Condensée (LPMC), 2092 Tunis, Tunisie (Tunisia); Institut d' Electronique et des systèmes, Unité Mixte de Recherche 5214 UM2-CNRS (ST2i) – Université Montpellier, 860 rue de Saint Priest, Bâtiment 5, 34097 Montpellier (France); Faculté des Sciences de Bizerte, Université de Carthage, Zarzouna 7021 (Tunisia); Guasch, Cathy [Institut d' Electronique et des systèmes, Unité Mixte de Recherche 5214 UM2-CNRS (ST2i) – Université Montpellier, 860 rue de Saint Priest, Bâtiment 5, 34097 Montpellier (France); Azzaza, Sonia; Alleg, Safia [Laboratoire de Magnétisme et Spectroscopie des Solides (LM2S), Département de Physique, Faculté des Sciences, Université Badji Mokhtar Annaba, B.P. 12, 23000 Annaba (Algeria); Kamoun-Turki, Najoua [Université Tunis El Manar, Faculté des Sciences de Tunis, Département de Physique, LR99ES13 Laboratoire de Physique de la Matière Condensée (LPMC), 2092 Tunis, Tunisie (Tunisia)

    2016-10-01

    Using low cost spray pyrolysis technique, polycrystalline CaSO{sub 4} thin films were successfully grown on a glass substrate with a thickness of about 1 μm. Samarium doping has been performed on CaSO{sub 4} thin films to explore luminescence properties. The characterizations of these films were carried out using X-ray diffraction, Scanning Electron Microscopy and optical measurements. The structural analyses reveal the existence of hexagonal CaSO{sub 4} phase with a (200) preferred orientation belonging to CaS compound for substrate temperatures below 350 °C. It is shown that the crystallinity of the sprayed thin films can be improved by increasing substrate temperature up to 250 °C. Warren-Averbach analysis has been applied on X-ray diffractogram to determine structural parameters involving the phase with its amount, the grain size and the lattice parameters using Maud software. The surface topography shows a rough surface covered by densely packed agglomerated clusters having faceted and hexagonal shapes. Energy dispersive microscopy measurements confirm the presence of calcium and sulfur in equal proportions as well as high percentage of oxygen. Photoluminescence at room temperature revealed that luminescence peaks are attributed to the intrinsic emission of pure CaSO{sub 4} phase. - Highlights: • Warren Averbach analysis reveal the presence of hcp structure of CaSO{sub 4} phase. • A mixture of CaSO{sub 4} and CaHO{sub 4.5}S phases has been detected for lower T{sub s}. • For increasing T{sub s}, the CaHO{sub 4.5}S phase has been disappeared. • The origin of PL peaks has been identified.

  4. Samarium oxide as a radiotracer to evaluate the in vivo biodistribution of PLGA nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Mandiwana, Vusani, E-mail: VMandiwana@csir.co.za; Kalombo, Lonji, E-mail: LKalombo@csir.co.za [Centre of Polymers and Composites, CSIR (South Africa); Venter, Kobus, E-mail: Kobus.Venter@mrc.ac.za [South African Medical Research Council (South Africa); Sathekge, Mike, E-mail: Mike.Sathekge@up.ac.za [University of Pretoria and Steve Biko Academic Hospital, Department of Nuclear Medicine (South Africa); Grobler, Anne, E-mail: Anne.Grobler@nwu.ac.za; Zeevaart, Jan Rijn, E-mail: zeevaart@necsa.co.za [North-West University, DST/NWU Preclinical Drug Development Platform (South Africa)

    2015-09-15

    Developing nanoparticulate delivery systems that will allow easy movement and localization of a drug to the target tissue and provide more controlled release of the drug in vivo is a challenge in nanomedicine. The aim of this study was to evaluate the biodistribution of poly(d,l-lactide-co-glycolide) (PLGA) nanoparticles containing samarium-153 oxide ([{sup 153}Sm]Sm{sub 2}O{sub 3}) in vivo to prove that orally administered nanoparticles alter the biodistribution of a drug. These were then activated in a nuclear reactor to produce radioactive {sup 153}Sm-loaded-PLGA nanoparticles. The nanoparticles were characterized for size, zeta potential, and morphology. The nanoparticles were orally and intravenously (IV) administered to rats in order to trace their uptake through imaging and biodistribution studies. The {sup 153}Sm-loaded-PLGA nanoparticles had an average size of 281 ± 6.3 nm and a PDI average of 0.22. The zeta potential ranged between 5 and 20 mV. The [{sup 153}Sm]Sm{sub 2}O{sub 3} loaded PLGA nanoparticles, orally administered were distributed to most organs at low levels, indicating that there was absorption of nanoparticles. While the IV injected [{sup 153}Sm]Sm{sub 2}O{sub 3}-loaded PLGA nanoparticles exhibited the highest localization of nanoparticles in the spleen (8.63 %ID/g) and liver (3.07 %ID/g), confirming that nanoparticles are rapidly removed from the blood by the RES, leading to rapid uptake in the liver and spleen. From the biodistribution data obtained, it is clear that polymeric nanoscale delivery systems would be suitable for improving permeability and thus the bioavailability of therapeutic compounds.

  5. Study of samarium modified lead zirconate titanate and nickel zinc ferrite composite system

    Energy Technology Data Exchange (ETDEWEB)

    Rani, Rekha [Department of Physics, SD PG College, Panipat 132103 (India); School of Physics and Materials Science, Thapar University, Patiala 147004 (India); Juneja, J.K., E-mail: jk_juneja@yahoo.com [Department of Physics, Hindu College, Sonepat 131001 (India); Singh, Sangeeta [Department of Physics, GVM Girls College, Sonepat 131001 (India); Raina, K.K. [School of Physics and Materials Science, Thapar University, Patiala 147004 (India); Prakash, Chandra [Solid State Physics Laboratory, Timarpur, Delhi 110054 (India)

    2015-03-15

    In the present work, composites of samarium substituted lead zirconate titanate and nickel zinc ferrite with compositional formula 0.95Pb{sub 1−3x/2} Sm{sub x}Zr{sub 0.65}Ti{sub 0.35}O{sub 3}–0.05Ni{sub 0.8}Zn{sub 0.2}Fe{sub 2}O{sub 4} (x=0, 0.01, 0.02 and 0.03) were prepared by the conventional solid state route. X-ray diffraction analysis was carried out to confirm the coexistence of individual phases. Microstructural study was done by using scanning electron microscope. Dielectric constant and loss were studied as a function of temperature and frequency. To study ferroelectric and magnetic properties of the composite samples, corresponding P–E and M–H hysteresis loops were recorded. Change in magnetic properties of electrically poled composite sample (x=0.02) was studied to confirm the magnetoelectric (ME) coupling. ME coefficient (dE/dH) of the samples (x=0 and 0.02) was measured as a function of DC magnetic field. - Highlights: • We are reporting the effect of Sm substitution on PZT–NiZn ferrite composites. • Observation of both P–E and M–H loops confirms ferroelectric and magnetic ordering. • With Sm substitution, significant improvement in properties was observed. • Increase in magnetization for electrically poled sample is evidence of ME coupling. • Electric polarization is generated by applying magnetic field.

  6. The effectiveness of samarium-153 (153Sm) lexidronam (EDTMP) in treatment of bone metastases

    International Nuclear Information System (INIS)

    Ma Yubo; Huang Gang; Liu Jianjun

    2004-01-01

    Objectives: To evaluate the effectiveness of samarium-153 (153Sm) lexidronam (EDTMP) in treatment of bone metastases. Methods: 380 patients with bone metastases were studied (221 men, 159 women; average age 65.3 y; ranged 27-91 y; average weight 59.3 kg, ranged 39-95 kg). The tumor types were prostate carcinoma (n=155), pulmonary carcinoma (n=92), breast cancer (n=57), gastric carcinoma (n=12), colorectal carcinoma (n=22), nasopharyngeal carcinoma (n=8), lymphoma (n=8), hepatic carcinoma (n=6), ovary carcinoma (n=4) and others (n=16). All patients were received 135Sm-EDTMP 0.8 or 1.0 mCi/kg during 1 to 7 course of treatment. Patients and physician evaluations were used to assess pain relief. Numbers of metastatic foci and activity of ROIs were used to observe post-therapy change in bone scanning. Results: In 380 patients, pain relief was observed in 257 patients (67.6%). Persistence of pain relief was seen through 2 to 24 weeks. The mean relief time is 5.8±3.4 weeks. KPS score was higher 10% than pre-therapy (71.2%±9.6% Vs 80.9%±10.3%, p<0.001). Numbers of metastatic foci (11.2+8.8 Vs 8.4±5.7, p<0.001) and activity of ROIs (3.28±2.04 Vs 2.15±0.94, p<0.01) were less than pre-therapy. Bone marrow suppression was mild and reversible (5.87±1.56 Vs 4.94±1.16 x 109/L). Conclusions: 153Sm-EDTMP provided relief of pain associated with bone metastases and inhibition of metastatic foci. As a relief drug of painful bone metastases, 153Sm-EDTMP is safe and effective. (authors)

  7. Theoretical evaluation of the production of the poisons Xe-135 and Sm-149 of the TRIGA Mark III reactor with mixed core

    International Nuclear Information System (INIS)

    Paredes G, L.C.

    1991-11-01

    It was theoretically determined the accumulation of the Xe 135 and Sm 149 in function, of the time during a stationary state of 72 h. continuous for the reactor TRIGA Mark III to 1 MW of thermal power with mixed core. The values of negative reactivity due to these isotopes are of 2.04 dollars and 0.694 dollars to the 72 h, quantities that will have to be compensated if wants that the reactor continues working to this power. Under the same conditions but considering a core with standard fuel, it was found a value of ρ = 1.70 dollars, resulting a difference of 0.30 dollars of negative reactivity in function of the type of analyzed core. This difference is important for the calculations of fuel management of a reactor. The concentration in balance of the xenon was reaches after an operation to constant power of 1 MW by 50 h, contrary to the samarium that reaches it balance after 3 weeks of operation starting from the initial start up and it stays constant along the useful life of the reactor while a change of fuel doesn't exist. It was obtained that for operation times greater to 60 h. at 1 MW, a peak of negative reactivity of the Xe 135 is generated between the 7 and 11 h after the instantaneous shut down, with a value of 2.43 dollars, that is to say 0.39 additional dollars to those taken place during the continuous irradiation. (Author)

  8. Graphite furnace atomic absorption spectrometry with a tantalum boat for the determination of yttrium, samarium, and dysprosium in a mish metal

    International Nuclear Information System (INIS)

    Daidoji, Hidehiro; Tamura, Shohei

    1982-01-01

    The determination of yttrium, samarium, and dysprodium by means of graphite-furnace atomic absorption spectrometry (AAS) was studied by a tantalum boat inserted into a graphite tube atomizer. These elements could not be determined by the use of a commercial graphite tube, In the atomization from a tantalum boat, better analytical sensitivities and negligible memory effects for these rare earths are obtained. The analytical sensitivities of yttrium, samarium, and dysprodium with the tantalum boat were 0.60 ng, 0.86 ng, and 0.17 ng respectively. This method was applied for the determination of yttrium, samarium, and dysprosium in a mish metal. The measurements were performed with slightly acidified solutions (0.01 mol dm 3 HCI or HNO 3 ). The sensitivities and the precisions for these elements decreased with increasing acid concentration. An enhancement in the sensitivities of yttrium and dysprosium upon the addition of a large excess of lanthanum, neodymium, and praseodymium salts were observed. The yttrium, samarium, and dysprosium in a mish metal were determined with both analytical curves of standard solutions containing an excess of lanthanum, cerium, and neodymium ions and of the standard addition. The precisions for this work were in the 3 - 9.3% range. (author)

  9. Optical properties and electronic transitions of zinc oxide, ferric oxide, cerium oxide, and samarium oxide in the ultraviolet and extreme ultraviolet

    DEFF Research Database (Denmark)

    Pauly, N; Yubero, F; Espinós, J P

    2017-01-01

    Optical properties and electronic transitions of four oxides, namely zinc oxide, ferric oxide, cerium oxide, and samarium oxide, are determined in the ultraviolet and extreme ultraviolet by reflection electron energy loss spectroscopy using primary electron energies in the range 0.3-2.0 ke...

  10. Feeding of the superdeformed yrast band in sup 149 Gd

    Energy Technology Data Exchange (ETDEWEB)

    Haas, B.; Vivien, J.P.; Beck, F.A.; Benet, P.; Byrski, T.; Curien, D.; Duchene, G.; Gehringer, C.; Merdinger, J.C.; Romain, P. (Strasbourg-1 Univ., 67 (France). Centre de Recherches Nucleaires); Basu, S.K. (Strasbourg-1 Univ., 67 (France). Centre de Recherches Nucleaires Bhabha Atomic Research Centre, Calcutta (India). Variable Energy Cyclotron Centre); Kluge, H. (Strasbourg-1 Univ., 67 (France). Centre de Recherches Nucleaires Hahn-Meitner-Institut Berlin GmbH (Germany, F.R.)); Santos, D. (Strasbourg-1 Univ., 67 (France). Centre de Recherches Nucleaires Consejo Nacional de Investigaciones Cientificas y Tecnicas, Buenos Aires (Argentina)); Flibotte, S. (Hahn-Meitner-Institut Berlin GmbH (Germany, F.R.)); Gascon, J.; Taras, P. (Montreal Univ., Quebec (Canada). Lab. de Physique Nucleaire); Bozek, E.; Zuber, K. (Institute of Nuclear Physics, Krakow (Poland))

    1990-08-02

    The feeding pattern of the superdeformed yrast band in {sup 149}Gd has been found to remain essentially the same, using the {sup 124}Sn+{sup 30}Si reaction at beam energies of 150, 155 and 160 MeV leading to different input angular momenta and excitation energies in the compound nuclear system. This similarity as well as the relative yields of the superdeformed states as a function of beam energy may be understood in terms of the nuclear level density dependence on deformation and the onset of fission. In addition, it has been shown that, at all three beam energies, the selection of high-energy gamma rays does not enhance the yield of the superdeformed yrast states. (orig.).

  11. Experimental determination of anomalous scattering lengths of samarium for thermal neutrons

    International Nuclear Information System (INIS)

    Engel, D.W.; Koetzle, T.F.

    1981-01-01

    Anomalous scattering lengths of natural Sm for thermal neutrons with wavelengths between 0.827 and 1.300 A have been determined using a single crysrtal of a Sm-complex of known structure. 140 selected reflections were measured at each wavelength and b 0 + b' and b'' refined in each case. The values obtained are in good agreement with theoretical values obtained from a Breit-Wigner calculation using tabulated resonance parameters for 149 Sm. A value of b 0 = 4.3 +- 0.2 fm is deduced from the diffraction experiment

  12. An estimation of influence of humic acid and organic matter originated from bentonite on samarium solubility

    International Nuclear Information System (INIS)

    Kanaji, Mariko; Sato, Haruo; Sasahira, Akira

    1999-10-01

    Organic acids in groundwater are considered to form complexes and increase the solubility of radionuclides released from vitrified waste in a high-level radioactive waste (HLW) repository. To investigate whether the solubility of samarium (Sm) is influenced by organic substances, we measured Sm solubility in the presence of different organic substances and compared those values with results from thermodynamic predictions. Humic acid (Aldrich) is commercially available and soluble organic matter originated from bentonite were used as organic substances in this study. Consequently, the solubility of Sm showed a tendency to apparently increase with increasing the concentration of humic acid, but in the presence of carbonate, thermodynamic predictions suggested that the dominant species are carbonate complexes and that the effect of organic substances are less than that of carbonate. Based on total organic carbon (TOC), the increase of Sm solubility measured with humic acid (Aldrich) was more significant than that in the case with soluble organic matter originated from bentonite. Since bentonite is presumed to include also simple organic matters of which stability constant for forming complexes is low, the effect of soluble organic matter originated from bentonite on the solubility of Sm is considered to be less effective than that of humic acid (Aldrich). Experimental values were compared with model prediction, proposed by Kim, based on data measured in a low pH region. Tentatively we calculated the increase in Sm solubility assuming complexation with humic acid. Trial calculations were carried out on the premise that the complexation reaction of metal ion with humic acid is based on neutralization process by 1-1 complexation. In this process, it was assumed that one metal ion coordinates with one unit of complexation sites which number of proton exchange sites is equal to ionic charge. Consequently, Kim's model indicated that carbonate complexes should be dominant

  13. Anchoring samarium oxide nanoparticles on reduced graphene oxide for high-performance supercapacitor

    Energy Technology Data Exchange (ETDEWEB)

    Dezfuli, Amin Shiralizadeh [Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of); Ganjali, Mohammad Reza, E-mail: ganjali@khayam.ut.ac.ir [Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of); Biosensor Research Center, Endocrinology & Metabolism Molecular-Cellular Sciences Institute, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of); Naderi, Hamid Reza [Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of)

    2017-04-30

    Highlights: • Samarium oxide nanoparticles have been anchored on the surface of reduced graphene oxide for the first time. • Sm{sub 2}O{sub 3}/RGO nanocomposite show high capacitance, good rate and cycling performance. • Sm{sub 2}O{sub 3}/RGO nanocomposite can serve as efficient electrode material for energy storage. • The best composite electrode exhibits specific capacitance of 321 F g{sup −1} in 2 mV s{sup −1}. - Abstract: We have synthesized Sm{sub 2}O{sub 3} nanoparticles (SmNs) and anchored them onto the surface of reduced graphene oxide (RGO) through a self-assembly thereof by utilizing a facile sonochemical procedure. The nanomaterials were characterized by means of powder X-ray diffraction (XRD), Field-emission scanning electron microscopy (FE-SEM), fourier transform infrared spectroscopy (FT-IR) spectra, and X-ray photoelectron spectroscopy (XPS). As the next step, the supercapacitive behavior of the resulting nanocomposites were investigated when used as electrode material, through with cyclic voltammetric (CV), galvanostatic charge-discharge and electrochemical impedance spectroscopy (EIS) techniques. The SmNs decorated RGO (SmN-RGO) nanocomposites were found to possess a specific capacitance (SC) of 321 F g{sup −1} when used in a 0.5 M Na{sub 2}SO{sub 4} solution as an electrolyte, in a scan rate of 2 mV s{sup −1}. The SC of the SmN-RGO based electrodes were also found to be 268 F g{sup −1} at a current density of 2 A g{sup −1} through galvanostatic charge-discharge tests. The outstanding properties of the SmN-RGOs were attributed to synergy of the high charge mobility of SmNs and the flexibility of the sheets of RGOs. Additionally, the nano-composite revealed a unique cycling durability (maintaining 99% of its SC even after 4000 cycles).

  14. Fluorescence properties of europium and samarium. beta. -diketonates and their use in fluorometry

    Energy Technology Data Exchange (ETDEWEB)

    Huang, H; Hiraki, K; Nishikawa, Y [Kinki Univ., Higashi-Osaka, Osaka (Japan). Faculty of Science and Technology

    1981-01-01

    Several europium and samarium ..beta..-diketonates (tta, ntfa, bfa) complexed with 1, 10-phenanthroline, or with trioctylphosphine oxide (topo) were synthesized. The fluorescence properties of these compounds in benzene or hexane have been studied. Absorption and fluorescence spectra, fluorescence quantum yield, fluorescence sensitivity index (F.S.I.), and fluorescence lifetime were measured. From the measurement of fluorescence lifetime of the ..beta..-diketonates, the velocity of radiative process (k sub(f)/phi sub(f)) has almost the same value for benzene and hexane solvent. The red fluorescence (Em. max. : 619 nm) of Eu(III) in these chelates is attributed to transitions from /sup 5/D/sub 0/ ..-->.. /sup 7/F/sub 2/ levels of this ion, and the three-band spectrum (Em. max. : 569 nm, 606 nm, 650 nm) indicates the transitions from the /sup 4/G sub(5/2) ..-->.. /sup 6/H sub(5/2), /sup 4/G sub(5/2) ..-->.. /sup 6/H sub(7/2), and /sup 4/G sub(5/2) ..-->.. /sup 6/H sub(9/2) levels of Sm(III), respectively. These spectra are not changed by any solvents and ligands. From the results, the fluorescence of the ..beta..-diketonates in organic solvent has been attributed to m* ..-->.. m luminescence transition. The complexes of Eu(III) and Sm(III) show radiative transition within orbitals, composed exclusively of 4f orbitals of rare earth ions (m* ..-->.. m radiative transition). Fluorinated ligands show better sensitivity than unfluorinated ligands, and the best sensitivity is obtained with TTA-phen system, and/or TTA-topo system for the spectrofluorometric determination of the two metals. In the case of Eu determination, 619 nm emission wavelength is used (the determinable range : 0.2 -- 10 ppb Eu), and in the case of Sm determination, 650 nm emission wavelength is adopted (the determinable range : 0.1 -- 1 ppm Sm), because of much higher sensitivity than the other two peaks (569, 606 nm) without interference from europium complex.

  15. The dynamics of the laser-induced metal-semiconductor phase transition of samarium sulfide (SmS)

    International Nuclear Information System (INIS)

    Kaempfer, Tino

    2009-01-01

    The present thesis is dedicated to the experimental study of the metal-semiconductor phase transition of samarium sulfide (SmS): Temperature- and time-resolved experiments on the characterization of the phase transition of mixed-valence SmS samples (M-SmS) are presented. The measurement of the dynamics of the laser-induced phase transition pursues via time-resolved ultrashort-time microscopy and by X-ray diffraction with sub-picosecond time resolution. The electronic and structural processes, which follow an excitation of M-SmS with infrared femtosecond laser pulses, are physically interpreted on the base of the results obtained in this thesis and model imaginations. [de

  16. Thermodynamics of coproportionation reactions of homogeneous samarium (3) and yttrium (3) nitrates solvates with neutral organic phosphorus compounds

    International Nuclear Information System (INIS)

    Pyartman, A.K.

    1995-01-01

    Reaction heats of homogeneous samarium (3) and yttrium (3) nitrate solvates coproportionation with neutral organophosphoric compounds (tri-n.-butylphosphate, diisooctylmethylphosphonate, diisoamylmethylphosphonate) at T=298.15 K in hexane have been measured by thermochemical method. It has been ascertained that enthalpies of coproportionation reactions practically do not depend on the nature, concentration of rare earth metal (3) nitrate solvates in hexane, nature of neutral organophosphoric compound and constitute 1.1±-.2 kJ/mol. The Gibbs free energy of coproportionation reactions is -5.43 kJ/mol, while entropy of the reactions in 14.5±0.7 J/mol·K. 8 refs., 1 tab

  17. On the effects of pressure and irradiation on the transport properties of samarium compounds with unstable valence

    International Nuclear Information System (INIS)

    Morillo, J.

    1983-06-01

    We present the first extensive study of electronic transport properties of ''quasi-stoichiometric'' SmS as a function of pressure P, temperature T, magnetic field B and defect concentration C. SmS which is a semiconductor, undergoes with increasing P a first order transition towards an homogeneous intermediate valence state. In the semiconducting phase (s.c.), the energie epsilon(f) necessary to delocalize a 4f electron increases greatly with T and is about 250meV at 300K. The phase diagram for the first order electronic transition Sm 2 + →Smsup(2+epsilon) with P has been determined for T 6 has been investigated by resistivity measurements under irradiation at 21K. The threshold energy Ed for displacement of Sm in SmS has been determined: Ed(Sm) = 20 +- 2 eV, and the observed effects of irradiation have been associated to samarium displacements (vacancies and interstitials) [fr

  18. Sorption of samarium in soils: influence of soil properties and Sm concentration

    Energy Technology Data Exchange (ETDEWEB)

    Ramirez-Guinart, Oriol; Salaberria, Aitor; Rigol, Anna; Vidal, Miquel [Analytical Chemistry department, Faculty of Chemistry, University of Barcelona, Marti i Franques 1-11, 08028, Barcelona (Spain)

    2014-07-01

    Due to the fact that barriers of Deep Geological Repositories (DGR) may lose efficiency before the radioisotopes present in the High Level Radioactive Waste (HLRW) completely decay, it is possible that, in the long-term, radioactive leachates may escape from the DGR and reach the soil and water compartments in the biosphere. Therefore, it is required to examine the interaction and mobility of radionuclides present in the HLRW, or their chemical analogues, to predict the impact of their eventual incorporation in the biosphere and to assess the derived risk. Although relevant data have been recently obtained for a few radionuclides in soils, there are still some important gaps for some radionuclides, such us for samarium (Sm). Sm is a lanthanide that, besides being considered as a natural analogue of actinides, may also be present in HLRW in the form of the radioactive isotope {sup 151}Sm. The main objective of this work was to obtain sorption data (K{sub d}) of {sup 151}Sm gathered from a set of soil samples physicochemical fully-characterized (pH, texture, cationic exchange capacity, soil solution cationic composition, organic matter, carbonate and metallic oxides content, etc.). Additionally, as an alternative for testing sorption capacity of radionuclides in soils is the use of the corresponding stable isotope or a chemical analogue, the influence of Sm concentration was also checked. To evaluate {sup 151}Sm sorption, batch assays were carried out for each soil sample, which consisted in a pre-equilibration step of 2 g of each soil with 50 ml of double deionised water, and a subsequent equilibration step with the same solution, but labelled with {sup 151}Sm. The activity of {sup 151}Sm in initial and final solutions was measured by liquid scintillation and K{sub d} ({sup 151}Sm) data were calculated. The reversibly sorbed fraction was estimated by the application of a single extraction test, with double deionised water, to soil residues coming from the previous

  19. Theoretical evaluation of the production of the poisons Xe-135 and Sm-149 of the TRIGA Mark III reactor with mixed core; Evaluacion teorica de la produccion de los venenos Xe-135 y Sm-149 del reactor TRIGA Mark III con nucleo mixto

    Energy Technology Data Exchange (ETDEWEB)

    Paredes G, L.C

    1991-11-15

    It was theoretically determined the accumulation of the Xe{sup 135} and Sm {sup 149} in function, of the time during a stationary state of 72 h. continuous for the reactor TRIGA Mark III to 1 MW of thermal power with mixed core. The values of negative reactivity due to these isotopes are of 2.04 dollars and 0.694 dollars to the 72 h, quantities that will have to be compensated if wants that the reactor continues working to this power. Under the same conditions but considering a core with standard fuel, it was found a value of {rho} = 1.70 dollars, resulting a difference of 0.30 dollars of negative reactivity in function of the type of analyzed core. This difference is important for the calculations of fuel management of a reactor. The concentration in balance of the xenon was reaches after an operation to constant power of 1 MW by 50 h, contrary to the samarium that reaches it balance after 3 weeks of operation starting from the initial start up and it stays constant along the useful life of the reactor while a change of fuel doesn't exist. It was obtained that for operation times greater to 60 h. at 1 MW, a peak of negative reactivity of the Xe{sup 135} is generated between the 7 and 11 h after the instantaneous shut down, with a value of 2.43 dollars, that is to say 0.39 additional dollars to those taken place during the continuous irradiation. (Author)

  20. [Burnout in Tunisian medical residents: About 149 cases].

    Science.gov (United States)

    Ben Zid, A; Homri, W; Ben Romdhane, I; Bram, N; Labbane, R

    2017-09-01

    Burnout is a professional psychological chronic stress-induced syndrome defined by three dimensions: emotional exhaustion, depersonalization, and low personal accomplishment. This syndrome concerns all professions but especially healthcare staff. Numerous studies have attempted to document the impact of work activities on the doctor's mental health. According to the literature, junior doctors are more vulnerable to develop this syndrome. Are to determine the prevalence of severe burnout among residents of different specialties: anesthesiology, general surgery, emergency medicine, psychiatry, basic sciences. The secondary end points are to analyze risk factors, causes and consequences associated with burnout. A cross-sectional study conducted among medical residents working in hospitals located in the governorates of Tunis. Three instruments were used: an anonymous self-administered questionnaire, Maslach Burnout Inventory (MBI) to assess burnout, and Abstract Beck Depression Inventory to evaluate the intensity of depression. Severe burnout was defined as a severely high level of both emotional exhaustion and depersonalization associated with a severely low level of personal accomplishment. A total of 149 participants (response rate=76.8%) participated in the survey. Among participants, 17.14% (n=26) had a severe burnout. The emergency medicine residents had the highest rate of emotional exhaustion and depersonalization and severe depression. Overall, resident respondents, 31% (n=46), had moderate to severe depression. Among stress factors, those significantly correlated to burnout were: lack of hobbies (Pburnout were: Antecedents of specialty change (P=0.017) and desire for a specialty change (Pburnout was not found. Medical residents in all specialties are at risk of burnout. Nevertheless, this study revealed that some specialties are more exhausting, which is consistent with the results reported in the literature. Moreover, it is shown that several stress factors

  1. 25 CFR 170.149 - How do tribes identify transit needs?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false How do tribes identify transit needs? 170.149 Section 170... ROADS PROGRAM Indian Reservation Roads Program Policy and Eligibility Transit Facilities § 170.149 How do tribes identify transit needs? Tribes identify transit needs during the tribal transportation...

  2. 16 CFR 14.9 - Requirements concerning clear and conspicuous disclosures in foreign language advertising and...

    Science.gov (United States)

    2010-01-01

    ... conspicuous disclosures in foreign language advertising and sales materials. 14.9 Section 14.9 Commercial... and conspicuous disclosures in foreign language advertising and sales materials. The Federal Trade...” disclosure of certain information in an advertisement or sales material in a newspaper, magazine, periodical...

  3. 33 CFR 149.305 - What are the survival craft requirements for temporary personnel?

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false What are the survival craft... EQUIPMENT Lifesaving Equipment Manned Deepwater Port Requirements § 149.305 What are the survival craft... complement exceeds the capacity of the survival craft required under § 149.304 of this subpart, the port must...

  4. Interaction of antimicrobial peptide Plantaricin149a and four analogs with lipid bilayers and bacterial membranes

    Directory of Open Access Journals (Sweden)

    José Luiz de Souza Lopes

    2013-12-01

    Full Text Available The amidated analog of Plantaricin149, an antimicrobial peptide from Lactobacillus plantarum NRIC 149, directly interacts with negatively charged liposomes and bacterial membranes, leading to their lysis. In this study, four Pln149-analogs were synthesized with different hydrophobic groups at their N-terminus with the goal of evaluating the effect of the modifications at this region in the peptide's antimicrobial properties. The interaction of these peptides with membrane models, surface activity, their hemolytic effect on red blood cells, and antibacterial activity against microorganisms were evaluated. The analogs presented similar action of Plantaricin149a; three of them with no hemolytic effect (< 5% until 0.5 mM, in addition to the induction of a helical element when binding to negative liposomes. The N-terminus difference between the analogs and Plantaricin149a retained the antibacterial effect on S. aureus and P. aeruginosa for all peptides (MIC50 of 19 µM and 155 µM to Plantaricin149a, respectively but resulted in a different mechanism of action against the microorganisms, that was bactericidal for Plantaricin149a and bacteriostatic for the analogs. This difference was confirmed by a reduction in leakage action for the analogs. The lytic activity of Plantaricin149a is suggested to be a result of the peptide-lipid interactions from the amphipathic helix and the hydrophobic residues at the N-terminus of the antimicrobial peptide.

  5. 33 CFR 149.416 - What are the requirements for a dry chemical fire suppression system?

    Science.gov (United States)

    2010-07-01

    ... the requirements for a dry chemical fire suppression system? Each natural gas deepwater port must be... dry chemical fire suppression system? 149.416 Section 149.416 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) DEEPWATER PORTS DEEPWATER PORTS: DESIGN, CONSTRUCTION...

  6. Ferrites Ni0,5Zn0,5Fe2O4 doped with samarium: structural analysis, morphological and electromagnetic

    International Nuclear Information System (INIS)

    Costa, A.C.F.M.; Diniz, A.P.; Viana, K.M.S.; Cornejo, D.R.; Kiminami, R.H.G.A.

    2010-01-01

    This paper proposes to investigate the sintering at 1200 deg C/2h of Ni 0.5 Zn 0.5 Fe 2-x Sm x O 4 ferrite doped with 0.05; 0.075 e 0.1 mol of Sm synthesized by combustion reaction to evaluate the performance materials as absorbers of electromagnetic radiation. The influence of the concentration of samarium on the structure, morphology and electromagnetic properties of ferrites was studied. The resulting samples were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), magnetic measurements and reflectivity measurements in the frequency range between 8-12 GHz. The results showed that increasing the concentration of samarium caused a decrease in particle size of the samples, encouraging, therefore, to obtain materials with better values of magnetization and reflectivity, allowing for use as absorbers in narrow-band frequency between 9-10 GHz. (author)

  7. JAEA thermodynamic database for performance assessment of geological disposal of high-level and TRU wastes. Refinement of thermodynamic data for trivalent actinoids and samarium

    International Nuclear Information System (INIS)

    Kitamura, Akira; Fujiwara, Kenso; Yui, Mikazu

    2010-01-01

    Within the scope of the JAEA thermodynamic database project for performance assessment of geological disposal of high-level radioactive and TRU wastes, the refinement of the thermodynamic data for the inorganic compounds and complexes of trivalent actinoids (actinium(III), plutonium(III), americium(III) and curium(III)) and samarium(III) was carried out. Refinement of thermodynamic data for these elements was based on the thermodynamic database for americium published by the Nuclear Energy Agency in the Organisation for Economic Co-operation and Development (OECD/NEA). Based on the similarity of chemical properties among trivalent actinoids and samarium, complementary thermodynamic data for their species expected under the geological disposal conditions were selected to complete the thermodynamic data set for the performance assessment of geological disposal of radioactive wastes. (author)

  8. Effective visible light-active nitrogen and samarium co-doped BiVO{sub 4} for the degradation of organic pollutants

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Min; Niu, Chao [College of Environmental and Chemical Engineering, Shenyang Ligong University, Shenyang 110165 (China); Liu, Jun, E-mail: minwang62@msn.com [Shenyang Military General Hospital, Shenyang 110016 (China); Wang, Qianwu; Yang, Changxiu; Zheng, Haoyan [College of Environmental and Chemical Engineering, Shenyang Ligong University, Shenyang 110165 (China)

    2015-11-05

    Nitrogen and samarium co-doped BiVO{sub 4} (N–xSm–BiVO{sub 4}) nanoparticles were synthesized using a sol–gel method with a corn stem template. The physicochemical properties of the resultant N–xSm–BiVO{sub 4} particles were characterized using various methods: XPS, XRD, SEM, BET, and UV–Vis DRS analyses. The visible-light photocatalytic activity was successfully demonstrated by degrading a model dye, namely, methyl orange. The dopant content was optimized, and the nitrogen and samarium co-doped BiVO{sub 4} extended the light absorption spectrum toward the visible region, significantly enhancing the photodegradation of the model dye. The Sm and N co-doped BiVO{sub 4} exhibited the highest photocatalytic activity compared to materials with a single dopant or no dopant. The significantly enhanced photocatalytic activity of the N–Sm co-doped BiVO{sub 4} under visible-light irradiation can be attributed to the synergistic effects of the nitrogen and samarium. - Highlights: • The N–Sm codoped BiVO{sub 4} were synthesized using a sol–gel method with a corn stem template. • The N and Sm codoped BiVO{sub 4} has excellent photocatalytic activity of methyl orange degradation. • The maximum activity was observed when the molar ratio of Sm/Bi was 1.0. • The high photocatalytic activity was caused by the synergistic effects between N doping and Sm doping.

  9. Effective visible light-active nitrogen and samarium co-doped BiVO4 for the degradation of organic pollutants

    International Nuclear Information System (INIS)

    Wang, Min; Niu, Chao; Liu, Jun; Wang, Qianwu; Yang, Changxiu; Zheng, Haoyan

    2015-01-01

    Nitrogen and samarium co-doped BiVO 4 (N–xSm–BiVO 4 ) nanoparticles were synthesized using a sol–gel method with a corn stem template. The physicochemical properties of the resultant N–xSm–BiVO 4 particles were characterized using various methods: XPS, XRD, SEM, BET, and UV–Vis DRS analyses. The visible-light photocatalytic activity was successfully demonstrated by degrading a model dye, namely, methyl orange. The dopant content was optimized, and the nitrogen and samarium co-doped BiVO 4 extended the light absorption spectrum toward the visible region, significantly enhancing the photodegradation of the model dye. The Sm and N co-doped BiVO 4 exhibited the highest photocatalytic activity compared to materials with a single dopant or no dopant. The significantly enhanced photocatalytic activity of the N–Sm co-doped BiVO 4 under visible-light irradiation can be attributed to the synergistic effects of the nitrogen and samarium. - Highlights: • The N–Sm codoped BiVO 4 were synthesized using a sol–gel method with a corn stem template. • The N and Sm codoped BiVO 4 has excellent photocatalytic activity of methyl orange degradation. • The maximum activity was observed when the molar ratio of Sm/Bi was 1.0. • The high photocatalytic activity was caused by the synergistic effects between N doping and Sm doping

  10. Sorption of samarium in iron (II) and (III) phosphates in aqueous systems; Sorcion de samario en fosfatos de hierro (II) y (III) en sistemas acuosos

    Energy Technology Data Exchange (ETDEWEB)

    Diaz F, J C

    2006-07-01

    The radioactive residues that are stored in the radioactive confinements its need to stay isolated of the environment while the radioactivity levels be noxious. An important mechanism by which the radioactive residues can to reach the environment, it is the migration of these through the underground water. That it makes necessary the investigation of reactive materials that interacting with those radionuclides and that its are able to remove them from the watery resources. The synthesis and characterization of materials that can be useful in Environmental Chemistry are very important because its characteristics are exposed and its behavior in chemical phenomena as the sorption watery medium is necessary to use it in the environmental protection. In this work it was carried out the sorption study of the samarium III ion in the iron (II) and (III) phosphate; obtaining the sorption isotherms in function of pH, of the phosphate mass and of the concentration of the samarium ion using UV-visible spectroscopy to determine the removal percentage. The developed experiments show that as much the ferrous phosphate as the ferric phosphate present a great affinity by the samarium III, for what it use like reactive material in contention walls can be very viable because it sorption capacity has overcome 90% to pH values similar to those of the underground and also mentioning that the form to obtain these materials is very economic and simple. (Author)

  11. Results after therapy of pain from bone metastases with Samarium-153 in our centers in Lima, Peru

    International Nuclear Information System (INIS)

    Alvarado, N.; Eskenazi, S.; Valle, M.P.; Montoya, J.; Castro, M.; Montiel, L.; Velarde, V.; Jauregui, I.; Cueto, C.

    2004-01-01

    Full text: 105 patients with bone metastases from prostate and breast cancer; between 42 and 78 years age (median 61 years) were evaluated. Patients had intense pain that could not be managed with combinations of analgesic and anti tumoral drugs. All patients received 1.2 mCi/kg of Samarium-153 intravenously as treatment for pain due to bony metastases. The isotope obtained from atomic reactor placed in Lima - Peru, was provided by Peruvian Nuclear Energy Institute (IPEN). One week before therapy, all the patients had a bone scan study with Tc99m-MDP that showed the presence of multiple bone metastases with high blastic activity. Haematology and biochemical parameter checked were: Creatinine ( 150,000 mm3), Leukocytes (> 5,000 mm3), Red cells (>3,500,000 mm3). No problems were encountered during intravenous administration of the radioisotope. The side effects after treatment were: Primary effects: 16 cases of nausea, 2 of vomiting, 3 of headache, 28 had increment of pain, 6 had flushing. 50 patients did not have the primary symptoms. Secondary effects: 3 Patients showed drop in leukocyte count between 2nd and 3rd week of therapy. Red cells showed 10-15% decrease between 6th to 8th week. Platelets showed a decrease of about 15% with one peak between 1st and 2nd week post Samarium therapy. Data was analysed using an analogue visual scale of the pain with values from 0 - 10 (0-no pain; 10-maximum pain) and in the same way using the E.C.O.G. scale (Eastern Cooperative Oncology Group) in relationship with the Karnofsky index in order to establish functional recovery for each patient. The decrease of pain was seen between 4th-7th days (average 8 days). A second dose was given after 60 days in 12 patients and a third dose in 3 cases.11 patients died due to different causes between 30 - 60 days post treatment. The analgesic dose came down significantly in 80% of patients. We conclude that palliative therapy of metastatic bone pain in Peru is possible with radionuclides. It

  12. 42 CFR 84.149 - Type C supplied-air respirator, demand and pressure demand class; minimum requirements.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Type C supplied-air respirator, demand and pressure demand class; minimum requirements. 84.149 Section 84.149 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT... OF RESPIRATORY PROTECTIVE DEVICES Supplied-Air Respirators § 84.149 Type C supplied-air respirator...

  13. Samarium-modified vanadium phosphate catalyst for the selective oxidation of n-butane to maleic anhydride

    International Nuclear Information System (INIS)

    Wu, Hua-Yi; Wang, Hai-Bo; Liu, Xin-Hua; Li, Jian-Hui; Yang, Mei-Hua; Huang, Chuan-Jing; Weng, Wei-Zheng; Wan, Hui-Lin

    2015-01-01

    Graphical abstract: The addition of a small amount of Sm into VPO catalyst brought about great changes in its physicochemical properties such as surface area, surface morphology, phase composition and redox property, thus leading to a higher catalytic performance in the selective oxidation of n-butane to maleic anhydride, as compared to the undoped VPO catalyst. - Highlights: • The addition of Sm leads to great changes in the structure of VPO catalyst. • Sm improves performance of VPO for oxidation of n-butane to maleic anhydride. • Catalytic performance is closely related to structure of VPO catalyst. - Abstract: A series of samarium-modified vanadium phosphate catalysts were prepared and studied in selective oxidation of n-butane to maleic anhydride. The catalytic evaluation showed that Sm modification significantly increased the overall n-butane conversion and intrinsic activity. N 2 -adsorption, XRD, SEM, Raman, XPS, EPR and H 2 -TPR techniques were used to investigate the intrinsic difference among these catalysts. The results revealed that the addition of Sm to VPO catalyst can increase the surface area of the catalyst, lead to a significant change in catalyst morphology from plate-like structure into rosette-shape clusters, and largely promote the formation of (VO) 2 P 2 O 7 . All of these were related to the different catalytic performance of Sm-doped and undoped VPO catalysts. The roles of the different VOPO 4 phases and the influence of Sm were also described and discussed

  14. Study of unstable valences of cadmium and samarium by pulse radiolysis. Influence of complexation by some synthetical ionophores

    International Nuclear Information System (INIS)

    Lerat-Parizot, O.

    1992-01-01

    Instable valences of cations in solution are evidenced by pulse radiolysis, in spite of a lifetime often lower than a milli-second they participate to electron transfer reactions, owing to their redox potential. In this work are studied Cd + and Sm 2+ obtained respectively by reduction of Cd 2+ and Sm 3+ by a solvated electron. The reactivity of Cd + in a cryptand and in a coronand is studied; it is a powerful reducing agent (redox potential -2V) going back to the stable valence by electron transfer to an acceptor. Transfer kinetics is studied by reduction of organic molecules, effect of solvents and ligands is also examined. For samarium the reduction kinetics by hydrated electrons is increased when the ion is in a cryptand in agreement with electrochemical observations, showing that the valence 2+ is stabilized in respect to the valence 3+ for lanthanides. The difference of behaviour between Cd + and Sm 2+ is probably due to the fact that for Cd the transferred electron comes from the external layer and for Sm it is a f electron protected by the 5s and 5p orbitals

  15. Fabrication of samarium strontium aluminate ceramic and deposition of thermal barrier coatings by air plasma spray process

    Directory of Open Access Journals (Sweden)

    Baskaran T

    2018-01-01

    Full Text Available Thermal barrier coatings (TBC with the metallic NiCrAlY bond coat are often used in many aircraft engines to protect superalloy components from high-temperature corrosion thereby to improve the life of gas turbine components. The search for new TBC material has been intensified in recent years due to lack of thermo-physical properties of conventionally used Yttria stabilized Zirconia (YSZ TBCs. Recently, the rare earth containing Samarium Strontium Aluminate (SSA based ceramic was proposed as a new TBC material due to its matching thermo-physical properties with the substrate. The present work focused on the synthesis of SSA ceramics for TBCs application and its coatings development on Ni-based superalloy Inconel 718 substrate by air plasma spray process. The X-ray photoelectron spectroscopy (XPS result confirmed the formation of single phase SSA ceramic after synthesis. The surface morphology of SSA TBCs is mainly composed of melted splats, semi and un-melted particles. The cross-sectional SEM micrographs did not show any spallation at the interface which indicated good mechanical interlocking between the bond coat and ceramic top coat. The Young’s modulus and hardness of SSA TBCs were found to be 80 and 6.1 GPa, respectively. The load-depth curve of SSA TBC showed good elastic recovery about 47 %.

  16. Observation of near infrared and enhanced visible emissions from electroluminescent devices with organo samarium(III) complex

    Energy Technology Data Exchange (ETDEWEB)

    Chu, B [Key Laboratory of the Excited States Process, Changchun Institute of Optics, Fine Mechanics and Physics, Chinese Academy of Sciences, 16-Dong NanHu Road, Economic Development Area, Changchun, 130033 (China); Li, W L [Key Laboratory of the Excited States Process, Changchun Institute of Optics, Fine Mechanics and Physics, Chinese Academy of Sciences, 16-Dong NanHu Road, Economic Development Area, Changchun, 130033 (China); Hong, Z R [Key Laboratory of the Excited States Process, Changchun Institute of Optics, Fine Mechanics and Physics, Chinese Academy of Sciences, 16-Dong NanHu Road, Economic Development Area, Changchun, 130033 (China); Zang, F X [Key Laboratory of the Excited States Process, Changchun Institute of Optics, Fine Mechanics and Physics, Chinese Academy of Sciences, 16-Dong NanHu Road, Economic Development Area, Changchun, 130033 (China); Wei, H Z [Key Laboratory of the Excited States Process, Changchun Institute of Optics, Fine Mechanics and Physics, Chinese Academy of Sciences, 16-Dong NanHu Road, Economic Development Area, Changchun, 130033 (China); Wang, D Y [Key Laboratory of the Excited States Process, Changchun Institute of Optics, Fine Mechanics and Physics, Chinese Academy of Sciences, 16-Dong NanHu Road, Economic Development Area, Changchun, 130033 (China); Li, M T [Key Laboratory of the Excited States Process, Changchun Institute of Optics, Fine Mechanics and Physics, Chinese Academy of Sciences, 16-Dong NanHu Road, Economic Development Area, Changchun, 130033 (China); Lee, C S [Department of Physics and Materials Science, City University of Hong Kong, Hong Kong (China); Lee, S T [Department of Physics and Materials Science, City University of Hong Kong, Hong Kong (China)

    2006-11-07

    Samarium (dibenzoylmethanato){sub 3} bathophenanthroline (Sm(DBM){sub 3} bath) was employed as an emitting and electron transport layer in organic light emitting diodes (OLEDs), and narrow electroluminescent (EL) emissions of a Sm{sup 3+} ion were observed in the visible and near infrared (NIR) region, differing from those of the same devices with Eu{sup 3+}- or Tb{sup 3+}-complex EL devices with the same structure. The EL emissions of the Sm{sup 3+}-devices originate from transitions from {sup 4}G{sub 5/2} to the lower respective levels of Sm{sup 3+} ions. A maximum luminance of 490 cd m{sup -2} at 15 V and an EL efficiency of 0.6% at 0.17 mA cm{sup -2} were obtained in the visible region, and the improved efficiency should be attributed to introducing a transitional layer between the N,N'-diphenyl-N,N'-bis(3-methylphenyl)-1,1'-diphenyl-4,4'-diamine (TPD) film and the Sm(DBM){sub 3} bath film and the avoidance of interfacial exciplex emission in devices. Sharp emissions of Sm{sup 3+} ions in the NIR region were also observed under a lower threshold value less than 4.5 V.

  17. Effects of increasing doses of samarium-153-ethylenediaminetetramethylene phosphonate on axial and appendicular skeletal growth in juvenile rabbits

    International Nuclear Information System (INIS)

    Essman, Stephanie C.; Lewis, Michael R.; Fox, Derek B.

    2008-01-01

    Introduction: Targeted radiotherapy using samarium-153-ethylenediaminetetramethylene phosphonate ( 153 Sm-EDTMP) is currently under investigation for treatment of osteosarcoma. Osteosarcoma often occurs in children, and previous studies on a juvenile rabbit model demonstrated that clinically significant damage to developing physeal cartilage may occur as a result of systemic 153 Sm-EDTMP therapy. The aim of this study was to evaluate the late effects of 153 Sm-EDTMP on skeletal structures during growth to maturity and to determine if there is a dose response of 153 Sm-EDTMP on growth of long bones. Methods: Female 8-week-old New Zealand white rabbits were divided into three treatment groups plus controls. Each rabbit was intravenously administered a predetermined dose of 153 Sm-EDTMP. Multiple bones of each rabbit were radiographed every 2 months until physeal closure, with subsequent measurements made to assess for abbreviated bone growth. Statistical analyses were performed to determine the differences in bone length between groups, with significance set at P 153 Sm-EDTMP. Further investigation regarding the effects of bone-seeking radiopharmaceuticals on bone growth and physeal cartilage is warranted

  18. Synthesis and characterization of samarium-doped ZnS nanoparticles: A novel visible light responsive photocatalyst

    Energy Technology Data Exchange (ETDEWEB)

    Hanifehpour, Younes, E-mail: y_hanifehpour@yu.ac.kr [School of Mechanical Engineering, Yeungnam University, Gyeongsan 712-749 (Korea, Republic of); Soltani, Behzad; Amani-Ghadim, Ali Reza; Hedayati, Behnam [Department of Chemistry, Faculty of Basic Sciences, Azarbaijan Shahid Madani University, Tabriz (Iran, Islamic Republic of); Khomami, Bamin [Department of Chemical and Biomolecular Engineering, University of Tennessee, Knoxville, TN 37996 (United States); Joo, Sang Woo, E-mail: swjoo1@gmail.com [School of Mechanical Engineering, Yeungnam University, Gyeongsan 712-749 (Korea, Republic of)

    2016-04-15

    Highlights: • Sm-doped ZnS Nanomaterials were synthesized by hydrothermal method. • The as-prepared compounds were characterized by XRD, TEM, XPS, SEM and UV techniques. • The photocatalytic effect of compounds was determined by Reactive Red 43 degradation. • The degradation of RRed 43 followed the Langmuir–Hinshelwood kinetic model. - Abstract: We prepared pure and samarium-doped ZnS (Sm{sub x}Zn{sub 1−x}S{sub 1+0.5x}) nanoparticles via hydrothermal process at 160 °C for 24 h. XRD analysis shows that the particles were well crystallized and corresponds to a cubic sphalerite phase. SEM and TEM images indicate that the sizes of the particles were in the range of 20–60 nm. The photocatalytic activity of Sm-doped ZnS nanoparticles was evaluated by monitoring the decolorization of Reactive Red 43 in aqueous solution under visible light irradiation. The color removal efficiency of Sm{sub 0.04}Zn{sub 0.96}S and pure ZnS was 95.1% and 28.7% after 120 min of treatment, respectively. Among the different amounts of dopant agent used, 4% Sm-doped ZnS nanoparticles indicated the highest decolorization. We found that the presence of inorganic ions such as Cl{sup −}, CO{sub 3}{sup 2−} and other radical scavengers such as buthanol and isopropyl alcohol reduced the decolorization efficiency.

  19. Determination of the speciation and bioavailability of samarium to Chlamydomonas reinhardtii in the presence of natural organic matter.

    Science.gov (United States)

    Rowell, Justine-Anne; Fillion, Marc-Alexandre; Smith, Scott; Wilkinson, Kevin J

    2018-06-01

    As technological interest and environmental emissions of the rare earth elements increase, it is becoming more important to assess their potential environmental impact. Samarium (Sm) is a lanthanide of intermediate molar mass that is used in numerous high-technology applications including wind turbines, solar panels, and electric vehicles. The present study relates the speciation of Sm determined in the presence of natural organic matter (NOM) to its bioavailability to the unicellular green alga Chlamydomonas reinhardtii. The free ion concentration was determined using a cation exchange resin (ion exchange technique) in dynamic mode and compared with thermodynamic modeling. Short-term biouptake experiments were performed in the presence of 4 types of NOM: Suwannee River fulvic acids, Pahokee Peat fulvic acids, Suwannee River humic acids, and a Luther Marsh dissolved organic matter isolate (90-95% humic acids). It was clearly shown that even a small amount of NOM (0.5 mg C L -1 ) resulted in a significant decrease (10 times) in the Sm internalization fluxes. Furthermore, complexation with humic acids (and the corresponding reduction in Sm bioavailability) was stronger than that with fulvic acids. The results showed that the experimentally measured (free) Sm was a better predictor of Sm internalization than either the total concentrations or the free ion concentrations obtained using thermodynamic modeling. Environ Toxicol Chem 2018;37:1623-1631. © 2018 SETAC. © 2018 SETAC.

  20. Contribution of the Tyr-1 in Plantaricin149a to Disrupt Phospholipid Model Membranes

    Directory of Open Access Journals (Sweden)

    Georgina Tonarelli

    2013-06-01

    Full Text Available Plantaricin149a (Pln149a is a cationic antimicrobial peptide, which was suggested to cause membrane destabilization via the carpet mechanism. The mode of action proposed to this antimicrobial peptide describes the induction of an amphipathic α-helix from Ala7 to Lys20, while the N-terminus residues remain in a coil conformation after binding. To better investigate this assumption, the purpose of this study was to determine the contributions of the Tyr1 in Pln149a in the binding to model membranes to promote its destabilization. The Tyr to Ser substitution increased the dissociation constant (KD of the antimicrobial peptide from the liposomes (approximately three-fold higher, and decreased the enthalpy of binding to anionic vesicles from −17.2 kcal/mol to −10.2 kcal/mol. The peptide adsorption/incorporation into the negatively charged lipid vesicles was less effective with the Tyr1 substitution and peptide Pln149a perturbed the liposome integrity more than the analog, Pln149S. Taken together, the peptide-lipid interactions that govern the Pln149a antimicrobial activity are found not only in the amphipathic helix, but also in the N-terminus residues, which take part in enthalpic contributions due to the allocation at a lipid-aqueous interface.

  1. Fabrication of a PVC membrane samarium(III) sensor based on N,N Prime ,N Double-Prime -tris(4-pyridyl)trimesic amide as a selectophore

    Energy Technology Data Exchange (ETDEWEB)

    Zamani, Hassan Ali, E-mail: haszamani@yahoo.com [Department of Applied Chemistry, Mashhad Branch, Islamic Azad University, Mashhad (Iran, Islamic Republic of); Naghavi-Reyabbi, Fatemeh [Resident of General Surgery, Endoscopic and Minimaly Invasive Surgery Research Center, Ghaem Hospital, Faculty of Medicine, Mashhad University of Medical Sciences, Mashhad (Iran, Islamic Republic of); Faridbod, Farnoush [Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of); Mohammadhosseini, Majid [Department of Chemistry, Faculty of Basic Sciences, Shahrood Branch, Islamic Azad University, Shahrood (Iran, Islamic Republic of); Ganjali, Mohammad Reza [Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of); Tadjarodi, Azadeh; Rad, Maryam [Department of Chemistry, Iran University of Science and Technology, Tehran (Iran, Islamic Republic of)

    2013-03-01

    A new ion-selective electrode for Sm{sup 3+} ion is described based on the incorporation of N,N Prime ,N Double-Prime -tris(4-pyridyl)trimesic amide (TPTA) in a poly(vinylchloride) (PVC) matrix. The membrane sensor comprises nitrobenzene (NB) as a plasticizer, and oleic acid (OA) as an anionic additive. The sensor with the optimized composition shows a Nernstian potential response of 19.8 {+-} 0.5 mV decade{sup -1} over a wide concentration range of 1.0 Multiplication-Sign 10{sup -2} and 1 Multiplication-Sign 10{sup -6} mol L{sup -1}, with a lower detection limit of 4.7 Multiplication-Sign 10{sup -7} mol L{sup -1} and satisfactor applicable pH range of 3.6-9.2. Having a short response time of less than 10 s and a very good selectivity towards the Sm{sup 3+} over a wide variety of interfering cations (e.g. alkali, alkaline earth, transition and heavy metal ions) the sensor seemed to be a promising analytical tool for determination of the Sm{sup 3+}. Hence, it was used as an indicator electrode in the potentiometric titration of samarium ion with EDTA. It was also applied to the direct samarium recovery in binary mixtures. - Highlights: Black-Right-Pointing-Pointer A new Sm{sup 3+}-PVC membrane sensor is introduced for determination of Sm{sup 3+} ions in the solutions. Black-Right-Pointing-Pointer N,N Prime ,N Double-Prime -tris(4-pyridyl)trimesic amide was used as a suitable selectophore for samarium sensor. Black-Right-Pointing-Pointer Detection limit of the sensor is 4.7 Multiplication-Sign 10{sup -7} mol L{sup -1} with a short response time of less than 10 s.

  2. Fabrication of a PVC membrane samarium(III) sensor based on N,N′,N″-tris(4-pyridyl)trimesic amide as a selectophore

    International Nuclear Information System (INIS)

    Zamani, Hassan Ali; Naghavi-Reyabbi, Fatemeh; Faridbod, Farnoush; Mohammadhosseini, Majid; Ganjali, Mohammad Reza; Tadjarodi, Azadeh; Rad, Maryam

    2013-01-01

    A new ion-selective electrode for Sm 3+ ion is described based on the incorporation of N,N′,N″-tris(4-pyridyl)trimesic amide (TPTA) in a poly(vinylchloride) (PVC) matrix. The membrane sensor comprises nitrobenzene (NB) as a plasticizer, and oleic acid (OA) as an anionic additive. The sensor with the optimized composition shows a Nernstian potential response of 19.8 ± 0.5 mV decade −1 over a wide concentration range of 1.0 × 10 −2 and 1 × 10 −6 mol L −1 , with a lower detection limit of 4.7 × 10 −7 mol L −1 and satisfactor applicable pH range of 3.6–9.2. Having a short response time of less than 10 s and a very good selectivity towards the Sm 3+ over a wide variety of interfering cations (e.g. alkali, alkaline earth, transition and heavy metal ions) the sensor seemed to be a promising analytical tool for determination of the Sm 3+ . Hence, it was used as an indicator electrode in the potentiometric titration of samarium ion with EDTA. It was also applied to the direct samarium recovery in binary mixtures. - Highlights: ► A new Sm 3+ -PVC membrane sensor is introduced for determination of Sm 3+ ions in the solutions. ► N,N′,N″-tris(4-pyridyl)trimesic amide was used as a suitable selectophore for samarium sensor. ► Detection limit of the sensor is 4.7 × 10 −7 mol L −1 with a short response time of less than 10 s.

  3. The theoretical basis and clinical methodology for stereotactic interstitial brain tumor irradiation using iododeoxyuridine as a radiation sensitizer and samarium-145 as a brachytherapy source

    International Nuclear Information System (INIS)

    Goodman, J.H.; Gahbauer, R.A.; Kanellitsas, C.; Clendenon, N.R.; Laster, B.H.; Fairchild, R.G.

    1989-01-01

    High grade astrocytomas have proven resistant to all conventional therapy. A technique to produce radiation enhancement during interstitial brain tumor irradiation by using a radiation sensitizer (IdUrd) and by stimulation of Auger electron cascades through absorption of low energy photons in iodine (Photon activation) is described. Clinical studies using IdUrd, 192 Ir as a brachytherapy source, and external radiation have produced promising results. Substituting samarium-145 for 192 Ir in this protocol is expected to produce enhanced results. 15 refs

  4. The properties of samarium-doped zinc oxide/phthalocyanine structure for optoelectronics prepared by pulsed laser deposition and organic molecular evaporation

    Czech Academy of Sciences Publication Activity Database

    Novotný, Michal; Marešová, Eva; Fitl, Přemysl; Vlček, Jan; Bergmann, M.; Vondráček, Martin; Yatskiv, Roman; Bulíř, Jiří; Hubík, Pavel; Hruška, Petr; Drahokoupil, Jan; Abdellaoui, N.; Vrňata, M.; Lančok, Ján

    2016-01-01

    Roč. 122, č. 3 (2016), 1-8, č. článku 225. ISSN 0947-8396 R&D Projects: GA MŠk(CZ) LG15050; GA ČR(CZ) GAP108/11/0958; GA MŠk(CZ) LM2011029; GA ČR(CZ) GA14-10279S; GA MŠk(CZ) 7AMB14FR010 Institutional support: RVO:68378271 ; RVO:67985882 Keywords : samarium-doped zinc oxide zinc/phthalocyanine deposition * evaporation * pulsed laser deposition * thin films Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.455, year: 2016

  5. Effects of increasing doses of samarium-153-ethylenediaminetetramethylene phosphonate on axial and appendicular skeletal growth in juvenile rabbits

    Energy Technology Data Exchange (ETDEWEB)

    Essman, Stephanie C. [Department of Veterinary Medicine and Surgery, College of Veterinary Medicine, University of Missouri-Columbia, Columbia, MO 65211 (United States)], E-mail: essmans@missouri.edu; Lewis, Michael R. [Department of Veterinary Medicine and Surgery, College of Veterinary Medicine, University of Missouri-Columbia, Columbia, MO 65211 (United States); Department of Radiology, University of Missouri-Columbia, Columbia, MO 65211 (United States); Nuclear Science and Engineering Institute, University of Missouri-Columbia, Columbia, MO 65211 (United States); Research Service, Harry S. Truman Memorial Veterans' Hospital, Columbia, MO 65201 (United States); Fox, Derek B. [Department of Veterinary Medicine and Surgery, College of Veterinary Medicine, University of Missouri-Columbia, Columbia, MO 65211 (United States)

    2008-02-15

    Introduction: Targeted radiotherapy using samarium-153-ethylenediaminetetramethylene phosphonate ({sup 153}Sm-EDTMP) is currently under investigation for treatment of osteosarcoma. Osteosarcoma often occurs in children, and previous studies on a juvenile rabbit model demonstrated that clinically significant damage to developing physeal cartilage may occur as a result of systemic {sup 153}Sm-EDTMP therapy. The aim of this study was to evaluate the late effects of {sup 153}Sm-EDTMP on skeletal structures during growth to maturity and to determine if there is a dose response of {sup 153}Sm-EDTMP on growth of long bones. Methods: Female 8-week-old New Zealand white rabbits were divided into three treatment groups plus controls. Each rabbit was intravenously administered a predetermined dose of {sup 153}Sm-EDTMP. Multiple bones of each rabbit were radiographed every 2 months until physeal closure, with subsequent measurements made to assess for abbreviated bone growth. Statistical analyses were performed to determine the differences in bone length between groups, with significance set at P<.05. Results: Significant differences in lengths of multiple bones were detected between the high-dose group and other treatment groups and controls at each time interval. A significant difference in lengths of the tibias was also noted in the medium-treatment group, compared to controls. Mean reduction of bone length was first detected at 4 months and did not increase significantly over time. Conclusions: These data suggest that clinically significant bone shortening may occur as a result of high-dosage administration of {sup 153}Sm-EDTMP. Further investigation regarding the effects of bone-seeking radiopharmaceuticals on bone growth and physeal cartilage is warranted.

  6. Effect of samarium (Sm) addition on the microstructures and mechanical properties of Al–7Si–0.7Mg alloys

    International Nuclear Information System (INIS)

    Qiu, Hongxu; Yan, Hong; Hu, Zhi

    2013-01-01

    Highlights: •Sm affected the secondary dendrite arm spacing of Al–7Si–0.7Mg alloy. •The coarse plate-like eutectic silicon was fully modified into a fine branched and particle structure when 0.6 wt.% Sm added. •The tensile properties were enhanced by the addition of Sm. •Sm has marked effects on eutectic temperature and the latent heat ΔH R on remelting behavior. •The morphology and chemical composition of Sm-rich intermetallics were studied. -- Abstract: The effects of samarium (Sm) additions (0–0.9 wt.%) on the microstructures and mechanical properties of Al–7Si–0.7Mg alloys have been studied in this article. The microstructures of the as-cast samples were examined by optical microscopy (OM) and scanning electron microscopy (SEM). The experimental results indicated that the rare earth Sm affected the secondary dendrite arm spacing (SDAS) of Al–7Si–0.7Mg alloy. And it was found that Sm had great modification effects on the microstructures of eutectic silicon. When 0.6 wt.% Sm was added to the alloy, the coarse plate-like eutectic silicon was fully modified into a fine fibrous structure; the dendrites of Al–7Si–0.7Mg alloy was best refined. The mechanical properties were investigated by tensile test. The findings indicate that the tensile properties and elongation were improved by the addition of Sm. And a good combination of ultimate tensile strength (215 MPa) and elongation (3.3%) was obtained when the Sm addition was up to 0.6 wt.%. Furthermore the results of thermal analysis reveal that Sm addition had marked effects on eutectic temperature and the latent heat ΔH R on remelting behavior

  7. In vitro analysis of the invasive phenotype of SUM 149, an inflammatory breast cancer cell line

    Directory of Open Access Journals (Sweden)

    Dharmawardhane Suranganie F

    2005-04-01

    Full Text Available Abstract Background Inflammatory breast cancer (IBC is the most lethal form of locally invasive breast cancer known. However, very little information is available on the cellular mechanisms responsible for manifestation of the IBC phenotype. To understand the unique phenotype of IBC, we compared the motile and adhesive interactions of an IBC cell line, SUM 149, to the non-IBC cell line SUM 102. Results Our results demonstrate that both IBC and non-IBC cell lines exhibit similar adhesive properties to basal lamina, but SUM 149 showed a marked increase in adhesion to collagen I. In vitro haptotaxis assays demonstrate that SUM 149 was less invasive, while wound healing assays show a less in vitro migratory phenotype for SUM 149 cells relative to SUM 102 cells. We also demonstrate a role for Rho and E-cadherin in the unique invasive phenotype of IBC. Immunoblotting reveals higher E-cadherin and RhoA expression in the IBC cell line but similar RhoC expression. Rhodamine phalloidin staining demonstrates increased formation of actin stress fibers and larger focal adhesions in SUM 149 relative to the SUM 102 cell line. Conclusion The observed unique actin and cellular architecture as well as the invasive and adhesive responses to the extracellular matrix of SUM 149 IBC cells suggest that the preference of IBC cells for connective tissue, possibly a mediator important for the vasculogenic mimicry via tubulogenesis seen in IBC pathological specimens. Overexpression of E-cadherin and RhoA may contribute to passive dissemination of IBC by promoting cell-cell adhesion and actin cytoskeletal structures that maintain tissue integrity. Therefore, we believe that these findings indicate a passive metastatic mechanism by which IBC cells invade the circulatory system as tumor emboli rather than by active migratory mechanisms.

  8. Multi-particle excitations in the superdeformed {sup 149}Gd nucleus

    Energy Technology Data Exchange (ETDEWEB)

    Flibotte, S. [Strasbourg-1 Univ., 67 (France). Centre de Recherches Nucleaires]|[Department of Physics and Astronomy, McMaster, University, Hamilton ON L8S 4M1 (Canada)]|[AECL Research, Chalk River Laboratories, Chalk River ON K0J 1J0 (Canada); Hackman, G. [Department of Physics and Astronomy, McMaster, University, Hamilton ON L8S 4M1 (Canada); Ragnarsson, I. [Department of Mathematical Physics, Lund institute of Technology, Box 118 S-221, Lund (Sweden); Theisen, C. [Strasbourg-1 Univ., 67 (France). Centre de Recherches Nucleaires; Andrews, H.R. [AECL Research, Chalk River Laboratories, Chalk River ON K0J 1J0 (Canada); Ball, G.C. [AECL Research, Chalk River Laboratories, Chalk River ON K0J 1J0 (Canada); Beausang, C.W. [Oliver Lodge Laboratory, University of Liverpool, Liverpool L69 3BX (United Kingdom); Beck, F.A. [Strasbourg-1 Univ., 67 (France). Centre de Recherches Nucleaires; Belier, G. [Strasbourg-1 Univ., 67 (France). Centre de Recherches Nucleaires; Bentley, M.A. [Staffordshire University, Stoke on Trent (United Kingdom); Byrski, T. [Strasbourg-1 Univ., 67 (France). Centre de Recherches Nucleaires; Curien, D. [Strasbourg-1 Univ., 67 (France). Centre de Recherches Nucleaires; France, G. de [Strasbourg-1 Univ., 67 (France). Centre de Recherches Nucleaires; Disdier, D. [Strasbourg-1 Univ., 67 (France). Centre de Recherches Nucleaires; Duchene, G. [Strasbourg-1 Univ., 67 (France). Centre de Recherches Nucleaires; Haas, B. [Strasbourg-1 Univ., 67 (France). Centre de Recherches Nucleaires; Haslip, D.S. [Department of Physics and Astronomy, McMaster, University, Hamilton ON L8S 4M1 (Canada); Janzen, V.P. [Department of Physics and Astronomy, McMaster, University, Hamilton ON L8S 4M1 (Canada)]|[AECL Research, Chalk River Laboratories, Chalk River ON K0J 1J0 (Canada); Jones, P.M. [Oliver Lodge Laboratory, University of Liverpool, Liverpool L69 3BX (United Kingdom); Kharraja, B.

    1995-02-20

    Six rotational bands built on superdeformed intrinsic configurations have been observed in the {sup 149}Gd nucleus with the Eurogam spectrometer. Orbital configuration assignments have been suggested on the basis of their effective alignments calculated with the Nilsson-Strutinsky cranking model. Most of the excited bands have identical partners in neighboring nuclei including one case differing by four mass units. Measurements of feeding patterns indicate that the {sup 149}Gd yrast superdeformed band is fed over a wider range of angular momentum than other yrast superdeformed bands in this mass region whereas weaker excited bands in the same nucleus are populated in narrower spin windows. ((orig.))

  9. Determination of trace amounts of rare earth elements in samarium, terbium and disprosium oxides by graphite furnace atomic-absorption spectrometry

    International Nuclear Information System (INIS)

    Dantas, E.S.K.

    1990-01-01

    A graphite furnace atomic-absorption spectrometry method for the determination of neodymium, europium, terbium, dysprosium and yttrium at trace level in samarium oxide; of samarium, europium, dysprosium, holmium, erbium and yttrium in terbium oxide and of europium, terbium, holmium, erbium and yttrium in dysprosium oxide was established. The best pyrolysis and atomization temperatures were determined for each lanthanide considered. Calibration curves were obtained for the pure elements, for binary mixtures formed by the matrix and each of the lanthanides studied and, finally, for the complex mixtures constituted by the matrix and all the other lanthanide of the group under scrutiny. This study has been carried out to examine the interference of the presence of one lanthanide on the behaviour of the other, since a lack of linearity on the calibration curves has been observed in some cases. Detection and determination limits have been determined as well. The detection limits encountered were within the range 0.002 to 0.3% for different elements. The precision of the method expressed as the relative standard deviation was calculated for each element present in each of the matrices studied. The conclusion arrived at is that the method can be applied for determining the above mentioned lanthanides present in the matrices studied with purity up to 99.50%. (author)

  10. Preparation and examination of properties of samarium-153-EDTMP complex; Otrzymywanie chelatu kwasu etylenodiaminotetrametylenofosfonowego (EDTMP) z samarem-153 i badanie jego wlasciwosci

    Energy Technology Data Exchange (ETDEWEB)

    Nowak, M. [Institute of Atomic Energy, Otwock-Swierk (Poland); Garnuszek, P.; Lukasiewicz, A.; Wozniak, I.; Zulczyk, W. [Osrodek Badawczo-Rozwojowy Izotopow, Otwock-Swierk (Poland); Licinska, I. [Instytut Lekow, Warsaw (Poland)

    1995-12-31

    Preparation and properties of ethylenediaminetetramethylenephosphonic acid (EDTMP) as well as some properties of {sup 153}Sm-EDTMP chelate have been examined. The chelate formed by samarium-153 (46.3 h, {beta}{sup -}-decay) with EDTMP exhibits high bone uptake and can be used for treatment of disseminated, painful skeletal metastases. The purity and stability of solutions of {sup 153}Sm-EDTMP chelate were examined in a broad range of samarium concentration and {sup 153}Sm specific activity. The complex under study was examined by radio-TLC, -electrophoresis and radio-HPLC. The results obtained suggest the small size of molecules of {sup 153}Sm-EDTMP chelate as compared with molecules of ``free``EDTMP. The results of biodistribution of {sup 153}Sm-EDTMP determined in rats indicate the quick blood clearance, high deposition of radioactivity in bone and quick excretion of radioactivity into urine. No specific uptake of {sup 153}Sm-EDTMP in extra-skeletal organs was found. (author). 42 refs, 13 figs, 22 tabs.

  11. LANTERN: a randomized study of QVA149 versus salmeterol/fluticasone combination in patients with COPD

    Directory of Open Access Journals (Sweden)

    Zhong N

    2015-06-01

    Full Text Available Nanshan Zhong,1 Changzheng Wang,2 Xiangdong Zhou,3 Nuofu Zhang,1 Michael Humphries,4 Linda Wang,4 Chau Thach,5 Francesco Patalano,6 Donald Banerji5On behalf of the LANTERN Investigators 1State Key Laboratory of Respiratory Diseases, First Affiliated Hospital, Guangzhou Medical University, Guangzhou, Guangdong, 2Institute of Respiratory Disease, Xin Qiao Hospital, 3Department of Respiratory Medicine, Southwest Hospital, Third Military Medical University, Chongqing City, Chongqing, 4Beijing Novartis Pharma Co. Ltd., Shanghai, People’s Republic of China; 5Novartis Pharmaceuticals Corporation, East Hanover, NJ, USA; 6Novartis Pharma AG, Basel, SwitzerlandBackground: The current Global initiative for chronic Obstructive Lung Disease (GOLD treatment strategy recommends the use of one or more bronchodilators according to the patient’s airflow limitation, their history of exacerbations, and symptoms. The LANTERN study evaluated the effect of the long-acting β2-agonist (LABA/long-acting muscarinic antagonist (LAMA dual bronchodilator, QVA149 (indacaterol/glycopyrronium, as compared with the LABA/inhaled corticosteroid, salmeterol/fluticasone (SFC, in patients with moderate-to-severe COPD with a history of ≤1 exacerbation in the previous year.Methods: In this double-blind, double-dummy, parallel-group study, 744 patients with moderate-to-severe COPD with a history of ≤1 exacerbations in the previous year were randomized (1:1 to QVA149 110/50 µg once daily or SFC 50/500 µg twice daily for 26 weeks. The primary endpoint was noninferiority of QVA149 versus SFC for trough forced expiratory volume in 1 second (FEV1 at week 26.Results: Overall, 676 patients completed the study. The primary objective of noninferiority between QVA149 and SFC in trough FEV1 at week 26 was met. QVA149 demonstrated statistically significant superiority to SFC for trough FEV1 (treatment difference [∆]=75 mL; P<0.001. QVA149 demonstrated a statistically significant

  12. 26 CFR 1.149(d)-1A - Limitations on advance refundings.

    Science.gov (United States)

    2010-04-01

    ... savings test. If any separate issue in a multipurpose issue increases the aggregate present value debt service savings on the entire multipurpose issue or reduces the present value debt service losses on that... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Limitations on advance refundings. 1.149(d)-1A...

  13. 33 CFR 149.697 - What are the requirements for a noise level survey?

    Science.gov (United States)

    2010-07-01

    ... and Equipment Noise Limits § 149.697 What are the requirements for a noise level survey? (a) A survey... measured over 12 hours to derive a time weighted average (TWA) using a sound level meter and an A-weighted filter or equivalent device. (c) If the noise level throughout a space is determined to exceed 85 db(A...

  14. 7 CFR 905.149 - Procedure for permitting growers to ship tree run citrus fruit.

    Science.gov (United States)

    2010-01-01

    ... Fruit § 905.149 Procedure for permitting growers to ship tree run citrus fruit. (a) Tree run citrus fruit. Tree run citrus fruit as referenced in this section is defined in the Florida Department of... grower shall apply to ship tree run fruit using a Grower Tree Run Certificate Application, furnished by...

  15. 41 CFR 109-38.801 - Obtaining SF 149, U.S. Government National Credit Card.

    Science.gov (United States)

    2010-07-01

    .... Government National Credit Card. 109-38.801 Section 109-38.801 Public Contracts and Property Management..., U.S. Government National Credit Card § 109-38.801 Obtaining SF 149, U.S. Government National Credit Card. DOE offices electing to use national credit cards shall request the assignment of billing address...

  16. Flight test report: Focke wulf PIAGGIO P149D-TP

    CSIR Research Space (South Africa)

    Barker, D

    2015-12-01

    Full Text Available It’s a story of following one’s dream. Belonging to Werner Heiml, ZU-SFP originated from Germany where it was used as a basic trainer in the Luftwaffe. The P149D was originally developed and manufactured by Piaggio & Co, Italy, in 1953...

  17. 33 CFR 149.313 - How must survival craft be arranged?

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false How must survival craft be... Equipment Manned Deepwater Port Requirements § 149.313 How must survival craft be arranged? The operator must arrange survival craft so that they meet the requirements of 46 CFR 108.525 (a) and § 108.530 and...

  18. Photocycle dynamics of the E149A mutant of cryptochrome 3 from Arabidopsis thaliana.

    Science.gov (United States)

    Zirak, P; Penzkofer, A; Moldt, J; Pokorny, R; Batschauer, A; Essen, L-O

    2009-11-09

    The E149A mutant of the cryDASH member cryptochrome 3 (cry3) from Arabidopsis thaliana was characterized in vitro by optical absorption and emission spectroscopic studies. The mutant protein non-covalently binds the chromophore flavin adenine dinucleotide (FAD). In contrast to the wild-type protein it does not bind N5,N10-methenyl-5,6,7,8-tetrahydrofolate (MTHF). Thus, the photo-dynamics caused by FAD is accessible without the intervening coupling with MTHF. In dark adapted cry3-E149A, FAD is present in the oxidized form (FAD(ox)), semiquinone form (FADH(.)), and anionic hydroquinone form (FAD(red)H(-)). Blue-light photo-excitation of previously unexposed cry3-E149A transfers FAD(ox) to the anionic semiquinone form (FAD()(-)) with a quantum efficiency of about 2% and a back recovery time of about 10s (photocycle I). Prolonged photo-excitation leads to an irreversible protein re-conformation with structure modification of the U-shaped FAD and enabling proton transfer. Thus, a change in the photocycle dynamics occurs with photo-conversion of FAD(ox) to FADH(.), FADH(.) to FAD(red)H(-), and thermal back equilibration in the dark (photocycle II). The photocycle dynamics of cry3-E149A is compared with the photocycle behaviour of wild-type cry3 and other photo-sensory cryptochromes.

  19. The effect of samarium doping on structure and enhanced thermionic emission properties of lanthanum hexaboride fabricated by spark plasma sintering

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, Shenlin; Hu, Qianglin [College of Mathematics and Physics, Jinggangshan University, Jian (China); Zhang, Jiuxing; Liu, Danmin [Key Laboratory of Advanced Functional Materials, Ministry of Education, College of Materials Science and Engineering, Beijing University of Technology, Beijing (China); Huang, Qingzhen [NIST Center for Neutron Research, National Institute of Standards and Technology, MD (United States)

    2014-03-15

    Single-phase polycrystalline solid solutions (La{sub 1-x}Sm{sub x})B{sub 6} (x = 0, 0.2, 0.4, 0.8, 1) are fabricated by spark plasma sintering (SPS). This study demonstrates a systematic investigation of structure-property relationships in Sm-doped LaB{sub 6} ternary rare-earth hexaborides. The microstructure, crystallographic orientation, electrical resistivity, and thermionic emission performance of these compounds are investigated. Analysis of the results indicates that samarium (Sm) doping has a noticeable effect on the structure and performance of lanthanum hexaboride (LaB{sub 6}). The analytical investigation of the electron backscatter diffraction confirms that (La{sub 0.6}Sm{sub 0.4})B{sub 6} exhibits a clear (001) texture that results in a low work function. Work functions are determined by pulsed thermionic diode measurements at 1500-1873 K. The (La{sub 0.6}Sm{sub 0.4})B{sub 6} possesses improved thermionic emission properties compared to LaB{sub 6}. The current density of (La{sub 0.6}Sm{sub 0.4})B{sub 6} is 42.4 A cm{sup -2} at 1873 K, which is 17.5% larger than that of LaB{sub 6}. The values of Φ{sub R} for (La{sub 0.6}Sm{sub 0.4})B{sub 6} and LaB{sub 6} are 1.98 ± 0.03 and 1.67 ± 0.03 eV, respectively. Furthermore, the Sm substitution of lanthanum (La) effectively increases the electrical resistivity. These results reveal that Sm doping lead to significantly enhanced thermionic emission properties of LaB{sub 6}. The compound (La{sub 0.6}Sm{sub 0.4})B{sub 6} appears most promising as a future emitter material. (copyright 2014 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  20. The Level of Europium-154 Contaminating Samarium-153-EDTMP Activates the Radiation Alarm System at the US Homeland Security Checkpoints

    Directory of Open Access Journals (Sweden)

    Mohammed Najeeb Al Hallak

    2009-08-01

    Full Text Available 153Sm-EDTMP is a radiopharmaceutical composed of EDTMP (ethylenediamine-tetramethylenephosphonate and Samarium-153 [1]. 153Sm-EDTMP has an affinity for skeletal tissue and concentrates in areas with increased bone turnover; thus, it is successfully used in relieving pain related to diffuse bone metastases [1]. The manufacturing process of 153Sm-EDTMP leads to contamination with 154Eu (Europium-154 [2]. A previous study only alluded to the retention of 154Eu in the bones after receiving treatment with 153Sm-EDTMP [2]. Activation of the alarm at security checkpoints after 153Sm-EDTMP therapy has not been previously reported. Two out of 15 patients who received 153Sm-EDTMP at Roger Maris Cancer Center (Fargo, N. Dak., USA activated the radiation activity sensors while passing through checkpoints; one at a US airport and the other while crossing theAmerican-Canadian border. We assume that the 154Eu which remained in the patients’ bones activated the sensors. Methods: In order to investigate this hypothesis, we obtained the consent from 3 of our 15 patients who received 153Sm-EDTMP within the previous 4 months to 2 years, including the patient who had activated the radiation alarm at the airport. The patients were scanned with a handheld detector and a gamma camera for energies from 511 keV to 1.3 MeV. Results: All three patients exhibited identical spectral images, and further analysis showed that the observed spectra are the result of 154Eu emissions. Conclusion: Depending on the detection thresholds and windows used by local and federal authorities, the remaining activity of 154Eu retained in patients who received 153Sm-EDTMP could be sufficient enough to increase the count rates above background levels and activate the sensors. At Roger Maris Cancer Center, patients are now informed of the potential consequences of 153Sm-EDTMP therapy prior to initiating treatment. In addition, patients treated with 153Sm-EDTMP at Roger Maris Cancer Center

  1. Estimating the four-factor product (ε p Pfnl Ptnl) for the accurate calculation of xenon and samarium reactivities in the Syrian Miniature Neutron Source Reactor

    International Nuclear Information System (INIS)

    Khattab, K.

    2007-01-01

    The modified 135 Xe equilibrium reactivity in the Syrian Miniature Neutron Source Reactor (MNSR) was calculated first by using the WIMSD4 and CITATION codes to estimate the four-factor product (ε p P f nl P t nl). Then, precise calculations of 135 Xe and 149 Sm concentrations and reactivities were carried out and compared during the reactor operation time and after shutdown. It was found that the 135 Xe and 149 Sm reactivities did not reach their equilibrium reactivities during the daily operating time of the reactor. The 149 Sm reactivities could be neglected compared to 135 Xe reactivities during the reactor operating time and after shutdown. (author)

  2. Estimating the four-factor product (ε p Pfnl Ptnl) for the accurate calculation of xenon and samarium reactivities in the Syrian Miniature Neutron Source Reactor

    International Nuclear Information System (INIS)

    Khattab, K.

    2007-01-01

    The modified 135 Xe equilibrium reactivity in the Syrian Miniature Neutron Source Reactor (MNSR) was calculated first by using the WIMSD4 and CITATION codes to estimate the four-factor product (ε p P fnl P tnl ). Then, precise calculations of 135 Xe and 149 Sm concentrations and reactivities were carried out and compared during the reactor operation time and after shutdown. It was found that the 135 Xe and 149 Sm reactivities did not reach their equilibrium reactivities during the daily operating time of the reactor. The 149 Sm reactivities could be neglected compared to 135 Xe reactivities during the reactor operating time and after shutdown. (author)

  3. 33 CFR 149.303 - What survival craft and rescue boats may be used on a manned deepwater port?

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false What survival craft and rescue boats may be used on a manned deepwater port? 149.303 Section 149.303 Navigation and Navigable Waters... craft and rescue boats may be used on a manned deepwater port? (a) Each survival craft on a manned...

  4. 47 CFR 25.149 - Application requirements for ancillary terrestrial components in the mobile-satellite service...

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Application requirements for ancillary terrestrial components in the mobile-satellite service networks operating in the 1.5./1.6 GHz, 1.6/2.4 GHz and 2 GHz mobile-satellite service. 25.149 Section 25.149 Telecommunication FEDERAL COMMUNICATIONS...

  5. In vivo radiochemical properties of Tb-149: A new radiolanthanide for targeted cancer therapy

    International Nuclear Information System (INIS)

    Allen, B.J.; Beyer, G.J.; Morel, C.H.; Aleksandrova, Y.; Jahn, S.

    1996-01-01

    Full text: 149 Tb (4.15 h) decays by the emission of both 3.9 MeV alpha particles (17% branching) and positrons (4% branch), and uniquely combines both therapeutic and PET diagnostic properties. In this paper we report the production route, systemic studies of radio-lanthanides with ethylenediaminetetra methylene phosphonate (EDTMP) ligand, and the first 149 Tb phantom studies using PET. The radio-lanthanides used in this study were produced at the ISOLDE (isotope separator on-line) facility at CERN. They are produced carrier free, isotopically and chemically separated (isobaric separation using cation exchange chromatography) in a form suitable for protein labelling. Batches up to 20 mCi of 1 4 9T b are available. We have established relationships between biokinetics, EDTMP concentration, and the ionic radius of the radiolanthanide used. The tumour to liver ratio in mice reaches a maximum value at 1 mM 10 mM and decreases from 10 by almost two decades according to the ionic radius of the lanthanide. For Tb, a tumour to liver ratio of 5 can be obtained, similar to Gd. No significant differences in the uptake in bone for all lanthanides in the EDTMP system were observed. A fast blood clearance allows clear bone images to be obtained via PET at 60-90 min post-injection, as shown with rabbits using 142 Sm-EDTMP. The first phantom PET studies with 149 Tb are also reported. We conclude that the fast biokinetics and the alpha decay mode open up new possibilities for a more efficient endo-radionuclide therapy using EDTMP. The high purity of the 149T b (isotopically separated and carrier free) produced in this way makes it very suitable for the labelling of octretides

  6. Pairing phase transition and thermodynamical quantities in 148,149Sm

    International Nuclear Information System (INIS)

    Razavi, R.; Behkami, A.N.; Dehghani, V.

    2014-01-01

    The nuclear level densities and entropies in 148,149 Sm have been calculated in the framework of the superconducting theory that includes modified nuclear pairing gap. For modified pairing gap parameter the smooth transition from the BCS to the Fermi type distributions is used. By applying modified pairing gap, the extracted S-shaped heat capacity as a function of nuclear temperature exhibits a physical and smoother behavior instead of the singular behavior predicted by the BCS equations at critical temperature

  7. Multiparticle excitations and identical bands in the superdeformed 149Gd nucleus

    International Nuclear Information System (INIS)

    Flibotte, S.; Hackman, G.; Theisen, C.; Andrews, H.R.; Ball, G.C.; Beausang, C.W.; Beck, F.A.; Belier, G.; Bentley, M.A.; Byrski, T.; Curien, D.; de France, G.; Disdier, D.; Duchene, G.; Fallon, P.; Haas, B.; Janzen, V.P.; Jones, P.M.; Kharraja, B.; Kuehner, J.A.; Lisle, J.C.; Merdinger, J.C.; Mullins, S.M.; Paul, E.S.; Prevost, D.; Radford, D.C.; Rauch, V.; Smith, J.F.; Styczen, J.; Twin, P.J.; Vivien, J.P.; Waddington, J.C.; Ward, D.; Zuber, K.

    1993-01-01

    Eight superdeformed rotational bands have been observed in the 149 Gd nucleus. Several excited bands have partners in neighboring nuclei which differ by up to four nucleons, with nearly identical dynamic moments of inertia and quantized γ-ray phasing. These observations cannot be easily explained by theoretical models including an intrinsic scaling with mass of the moment of inertia. A paired backbend and an interaction due to an accidental degeneracy between two superdeformed levels have also been observed

  8. Study for the determination of samarium, europium,terbium, dysprosium and yttrium in gadolinium oxide matrix by means of atomic absorption spectrophotometry using a graphite furnace

    International Nuclear Information System (INIS)

    Caires, A.C.F.

    1985-01-01

    A study for determination of samarium, europium, terbium, dysprosium and yttrium in a gadolinium oxide matrix by atomic absorption spectrophotometry using a graphite furnace is presented. The best charrring and atomization conditions were estabilished for each element, the most convenient ressonance lines being selected as well. The study was carried out for the mentioned lanthanides both when pure and when in binary mixtures with gadolinium, besides those where all for them were together with gadolinium. The determination limits for pure lanthanides were found to be between 1.3 and 9.6 ng assuming a 20% relative standard deviation as acceptable. The detection limits were in the range 0.51 and 7.5 ng, assuming as positive any answer higher than twofold the standard deviation. (author) [pt

  9. Biodistribution of samarium-153-EDTMP in rats treated with docetaxel Biodistribuição de EDTMP-153-samário em ratos tratados com docetaxel

    Directory of Open Access Journals (Sweden)

    Arthur Villarim Neto

    2009-02-01

    Full Text Available PURPOSE: Many patients with metastatic bone disease have to use radiopharmaceuticals associated with chemotherapy to relieve bone pain. The aim of this study was to assess the influence of docetaxel on the biodistribution of samarium-153-EDTMP in bones and other organs of rats. METHODS: Wistar male rats were randomly allocated into 2 groups of 6 rats each. The DS (docetaxel/samarium group received docetaxel (15 mg/kg intraperitoneally in two cycles 11 days apart. The S (samarium/control group rats were not treated with docetaxel. Nine days after chemotherapy, all the rats were injected with 0.1ml of samarium-153-EDTMP via orbital plexus (25µCi. After 2 hours, the animals were killed and samples of the brain, thyroid, lung, heart, stomach, colon, liver, kidney and both femurs were removed. The percentage radioactivity of each sample (% ATI/g was determined in an automatic gamma-counter (Wizard-1470, Perkin-Elmer, Finland. RESULTS: On the 9th day after the administration of the 2nd chemotherapy cycle, the rats had a significant weight loss (314.50±22.09g compared (pOBJETIVO: Muitos pacientes com metástases ósseas são tratados com radiofármacos associados com quimioterapia para alívio da dor óssea. O objetivo do trabalho foi estudar a influência do docetaxel na biodistribuição do EDTMP-153-samário nos ossos e outros órgãos de ratos. MÉTODOS: Ratos Wistar foram aleatoriamente alocados em 2 grupos de 6 animais cada. O grupo DS (docetaxel/samário recebeu docetaxel (15 mg/kg intraperitoneal em dois ciclos com 11 dias de intervalo. Os ratos do grupo S (samário/controle não foram tratados com docetaxel. Nove dias após a quimioterapia, todos os animais receberam 0,1ml de EDTMP-153-samário via plexo orbital (25µCi. Após 2 horas, os animais foram mortos e feitas biópsias de cérebro, tireóide, pulmão, coração, estômago, cólon, fígado, rim e fêmures. O percentual de radioatividade por grama (%ATI/g de tecido de cada bi

  10. Synthesis and Preliminary Biological Evaluations of Fluorescent or 149Promethium Labeled Trastuzumab-Polyethylenimine

    Directory of Open Access Journals (Sweden)

    Jonathan Fitzsimmons

    2015-12-01

    Full Text Available Background: Radioimmunotherapy utilize a targeting antibody coupled to a therapeutic isotope to target and treat a tumor or disease. In this study we examine the synthesis and cell binding of a polymer scaffold containing a radiotherapeutic isotope and a targeting antibody. Methods: The multistep synthesis of a fluorescent or 149Promethium-labeled Trastuzumab-polyethyleneimine (PEI, Trastuzumab, or PEI is described. In vitro uptake, internalization and/or the binding affinity to the Her2/neu expressing human breast adenocarcinoma SKBr3 cells was investigated with the labeled compounds. Results: Fluorescent-labeled Trastuzumab-PEI was internalized more into cells at 2 and 18 h than fluorescent-labeled Trastuzumab or PEI. The fluorescent-labeled Trastuzumab was concentrated on the cell surface at 2 and 18 h and the labeled PEI had minimal uptake. DOTA-PEI was prepared and contained an average of 16 chelates per PEI; the compound was radio-labeled with 149Promethium and conjugated to Trastuzumab. The purified 149Pm-DOTA-PEI-Trastuzumab had a radiochemical purity of 96.7% and a specific activity of 0.118 TBq/g. The compound demonstrated a dissociation constant for the Her2/neu receptor of 20.30 ± 6.91 nM. Conclusion: The results indicate the DOTA-PEI-Trastuzumab compound has potential as a targeted therapeutic carrier, and future in vivo studies should be performed.

  11. Optimal Timing of Bisphosphonate Administration in Combination with Samarium-153 Oxabifore in the Treatment of Painful Metastatic Bone Disease

    International Nuclear Information System (INIS)

    Rasulova, Nigora; Lyubshin, Vladimir; Arybzhanov, Dauranbek; Sagdullaev, Sh.; Krylov, Valery; Khodjibekov, Marat

    2013-01-01

    While bisphosphonates are indicated for prevention of skeletal-related events, radionuclide therapy is widely used for treatment of painful bone metastases. Combined radionuclide therapy with bisphosphonates has demonstrated improved effectiveness in achieving bone pain palliation in comparison to mono therapy with radionuclides or bisphosphonates alone. However, there are conflicting reports as to whether bisphosphonates adversely influence skeletal uptake of the bone-seeking radiotracers used for therapy. Recent studies analyzing influence of Zoledronic acid on total bone uptake of Samarium-153 EDTMP (Sm-153 EDTMP) by measuring cumulative urinary activity of Sm-153 on baseline study, as well as in combination with bisphosphonates (administrated 48 hours prior to Sm-153) did not provide any statistically significant difference in urinary excretion of Sm-153 between the two groups. It may be noted that the exact temporal sequence of bisphosphonate administration vis a vis radionuclide therapy has not yet been studied. One of the side effects of bisphosphonates is transient flare effect on bone pain. Radionuclide therapy may also have similar side effect. Keeping in view the above the current study was designed with the main objective of determining the exact timing of bisphosphonate administration in patients receiving combined therapy so as to achieve optimal efficacy of bone pain palliation. Ninety-three patients suffering from metastatic bone pain who received combination therapy with Sm-153 oxabifore (an analog of Sm-153 EDTMP) and Zoledronic acid were divided into three groups according to the timing of Zoledronic acid administration: Group I: 39 patients who received Zoledronic acid 7 or more days prior to Sm-153 oxabifore treatment; Group II: 32 patients who received Zoledronic acid 48-72 hours prior to Sm-153 oxabifore treatment and Group III: 22 patients who received Zoledronic acid 7 days after Sm-153 oxabifore treatment. Sm-153 oxabifore was administered

  12. Synthesis of samarium complexes with the derivative binder of Schiff Quinolinic base. Characterization and photophysical study; Sintesis de complejos de samario con el ligante derivado de base de Schiff Quinolinica. Caracterizacion y estudio fotofisico

    Energy Technology Data Exchange (ETDEWEB)

    Lucas H, J.

    2016-07-01

    In this work we determined the metal: binder stoichiometry of the species formed during the UV/Vis spectrophotometric titration of the derivative binder of Schiff quinolinic base, L1 with the samarium nitrate pentahydrate in methanol. Statistical analysis of the data allowed proposing the metal: binder stoichiometry for the synthesis of the complexes which was one mole of samarium salt by 2.5 moles of binder and thus favor the formation of complexes with 1M: 1L and 1M: 2L stoichiometries. They were synthesized in aqueous-organic medium (water-ethanol), isolated and purified two complexes with stoichiometry 1 Sm: 1 L1, complex 1 and 1 Sm: 2 L1, complex 2. The overall yield of the reaction was 76%. The characterization of the formed complexes was performed by visible ultraviolet spectrometry (UV/Vis), nuclear magnetic resonance, X-ray photoelectron spectroscopy (XP S), thermal gravimetric analysis with differential scanning calorimetry (TGA/DSC), and radial distribution function. These complexes were studied by fluorescence and emission phosphorescence at variable temperature. Spectroscopic techniques used in both solution and solid demonstrated the formation and stability of these complexes. In addition XP S indicated that in both complexes the samarium retains its oxidation state 3+. Luminescence studies indicated that there is intra-binding charge transfer which decreases the transfer of light energy from the binder to the samarium. Based on the experimental results, L1 binder molecules and complexes 1 and 2 were modeled that demonstrated the proposed Nc for each complex, as well as allowed to visualize the structural arrangement of the molecules, complexes and binder. (Author)

  13. The electrodeposition of 149Sm targets for (n,α) studies

    International Nuclear Information System (INIS)

    Ingelbrecht, C.; Ambeck-Madsen, J.; Teipel, K.; Robouch, P.; Arana, G.; Pomme, S.

    1999-01-01

    A method of electrodeposition from ethanol was developed for the production of 149 Sm targets of area 50x60 mm 2 to be used for (n,α) experiments. Targets of 60 μg cm -2 Sm were obtained with a Sm yield of 50% and a Sm mass fraction of 35% after calcination of the layers at 450 deg. C. Target substrates were 20 μm aluminium foils mounted on brass frames. A water cooling jig was constructed to protect the glue used for mounting during the calcination process. The layers were characterized by inductively coupled plasma source mass spectrometry (ICP-MS) and by neutron activation analysis (NAA)

  14. An oven control system based on MCU MSP430F149

    International Nuclear Information System (INIS)

    Jing Lan; Zhu Haijun; Liu Caihong; Liu Yali; Gao Shiwei; Chinese Academia of Sciences, Beijing

    2004-01-01

    This paper introduces the structure, principle and feature of new generation of 16 bit and Flash-type microcontroller which belongs to the Texas Instruments MSP430F149 series with low power consumption and high performance. Details of the hardware structure and analysis software of the oven control system based on the microcontroller are expatiated. this systerm has the characteristics of strong function, simple struction, high reliability, strong noise resistances, no peripheral chip etc. The requirements of the temperature measurement and control system are fulfilled. (authors)

  15. A new million-channel analyzer for complex nuclear spectroscopy studies and its application in measurements of the β decay of 149Pr

    International Nuclear Information System (INIS)

    Tenten, W.

    1978-11-01

    A million-channel analyzer with CAMAC instrumentation and PDP-11 control computer was developed and tested using the case of the β decay of 149 Pr and the γ decays of 149 Nd. A level scheme for 149 Nd was developed. (WL) [de

  16. Hydrates removal during the exploration evaluation of the 3-SES-149A well; Remocao de hidrato na avaliacao exploratoria do poco 3-SES-149A

    Energy Technology Data Exchange (ETDEWEB)

    Barros Filho, Armando F.; Franco, Marcus L. de A. [PETROBRAS, Rio de Janeiro, RJ (Brazil); Gomes, Luiz A.Q.M. [Schlumberger, Rio de Janeiro, RJ (Brazil)

    2004-07-01

    The 3-SES-149A well, at a water depth of 1164 meters, is part of the SEAL-100 block located offshore of the State of Sergipe. The objective of the intervention was to evaluate the 3674-3682 meters interval of the Riachuelo Formation. Bottom hole gauges and real time data transmission to the surface were deployed for this test, during which the target interval produced gas and condensate, without any evidence of formation of hydrate at the surface. After the test, while pulling out the electrical cable with the Link Running Tool, it got stuck close to the subsea well-test tree at a depth of 1257 meters. The formation of hydrate not only kept the cable from moving up, but also rendered impossible the reverse circulation in the column and consequently pulling out the test string. Removing the hydrate would allow releasing the logging cable, thus enabling fluid circulation in the string and its safe retrieval. The goal was achieved via the injection of solvent through the subsea well-test tree, drilling fluid circulation through the annulus above the BOP, and fluid circulation on the top of the hydrate plug through Coiled Tubing. The greatest challenge was running the Coiled Tubing in the string with the electrical cable inside. (author)

  17. Photoluminescence and spectroscopic dependence of fluorophosphate glasses on samarium ions concentration and the induced defects by gamma irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Marzouk, M.A., E-mail: marzouk_nrc@yahoo.com [Glass Research Department, National Research Centre, 33 El Bohouth Street (former EL Tahrir), P.O. 12622, Dokki, Giza (Egypt); Hamdy, Y.M. [Spectroscopy Department, National Research Centre, 33 El Bohouth Street (former EL Tahrir), P.O. 12622, Dokki, Giza (Egypt); ElBatal, H.A. [Glass Research Department, National Research Centre, 33 El Bohouth Street (former EL Tahrir), P.O. 12622, Dokki, Giza (Egypt); Ezz ElDin, F.M. [National Institute for Radiation Research & Technology, Nasr City, Cairo (Egypt)

    2015-10-15

    /2} and {sup 6}H{sub 11/2}, respectively. The intensity of the emission spectra is observed to increase with the increase of Sm{sub 2}O{sub 3} content. The optical spectra within the visible–near IR region and photoluminescence spectra of Sm{sub 2}O{sub 3}-doped glasses are found to be stable and show almost no variations after gamma irradiation especially when rare-earth ions are present in noticeable contents (1–3%). FTIR spectra of all the studied glasses reveal repetitive and characteristic vibrational bands mainly due to phosphate groups with abundant of Q{sup 2} and Q{sup 3} groups due to the high content of P{sub 2}O{sub 5} (70 mol%). The introduction of 10% NaF and 20% AlF{sub 3} is observed to cause formation of mixed fluorophosphate groups (PO{sub 3}F){sup 2−}. The formation of (AlPO){sub 4} and/or (AlPO{sub 6}) groups needs further justification by combined techniques. The increase of Sm{sub 2}O{sub 3} content to 3% causes obvious increase of the IR absorption bands within the wavenumbers range of about 850–1400 cm{sup −1} due to suggested depolymerization effect. Gamma irradiation causes no distinct variations in the FTIR spectra due to suggested compactness through the formation of additional structural groups from AlF{sub 4} or AlF{sub 6}. - Highlights: • Samarium ions doped in host fluorophosphate glasses were prepared. • Optical and FT infrared absorption techniques were applied to study the spectral properties of the glasses. • Photoluminescence properties were measured. • Collective spectroscopic variations generated by gamma irradiation were investigated.

  18. Production and separation of terbium-149 and terbium-152 for targeted cancer therapy

    International Nuclear Information System (INIS)

    Sarkar, S.; Leigh, J.

    1997-01-01

    This work reports the production and separation of useful quantities of 149 , 152 Tb from natural neodymium ( nat Nd) and 141 Pr for in vitro studies by bombarding the targets with 12 C projectiles. The physical, chemical and nuclear properties of radionuclides determine their efficacy in therapy and diagnosis. Tb-149 is an alpha-emitter with a half-life of 4.1h and 152 Tb is a positron emitter with a half-life of 17.5 h. Both of the isotopes have suitable gamma emission with good branching ratio suggesting their application to diagnosis apart from therapy. Alpha-emitters are effective in controlling cancer because of their short range and high Relative Biological Effectiveness. Long-lived positron emitters are effective in studying physiological function in positron emission tomography other than therapy. The aim of this work is to optimise the production and carrier free separation of terbium. Because of the presence of other stable isotopes in nat Nd, a number of other lanthanides are produced by secondary reactions during the production of terbium. In order to remove the secondary products, α-hydroxyisobutyric acid of pH 5 was used as eluent. satisfactory separation of terbium was achieved and demonstrate that useful quantities of 144,152 Tb can be produced by Tandem accelerator from 141 Pr and nat Nd targets

  19. Structural and superconducting properties of (Y,Gd)Ba2Cu3O7-δ grown by MOCVD on samarium zirconate buffered IBAD-MgO

    International Nuclear Information System (INIS)

    Stan, L; Holesinger, T G; Maiorov, B; Feldmann, D M; Usov, I O; DePaula, R F; Civale, L; Foltyn, S R; Jia, Q X; Chen, Y; Selvamanickam, V

    2008-01-01

    Textured samarium zirconate (SZO) films have been grown by reactive cosputtering directly on an ion beam assisted deposited (IBAD) MgO template, without an intermediate homoepitaxial MgO layer. The subsequent growth of 0.9 μm thick (Y,Gd)Ba 2 Cu 3 O 7-δ ((Y, Gd)BCO) films by metal organic chemical vapor deposition (MOCVD) yielded well textured films with a full width at half maximum of 1.9 0 and 3.4 0 for the out-of-plane and in-plane texture, respectively. Microstructural characterizations of the SZO buffered samples revealed clean interfaces. This indicates that the SZO not only provides a diffusion barrier, but also functions as a buffer for (Y, Gd)BCO grown by MOCVD. The achievement of self-field critical current densities (J c ) of over 2 MA cm -2 at 75.5 K is another proof of the effectiveness of SZO as a buffer on the IBAD-MgO template. The in-field measurements revealed an asymmetric angular dependence of J c and a shift of the ab-plane maxima due to the tilted nature of the template and (Y,Gd) 2 O 3 particles existing in the (Y, Gd)BCO matrix. The present results are especially important because they demonstrate that high temperature superconducting coated conductors with simpler architecture can be fabricated using commercially viable processes

  20. Pharmacokinetics of labelled compounds with technetium-99m and samarium-153; Farmacocinetica de compuestos marcados con tecnecio-99m y samario-153

    Energy Technology Data Exchange (ETDEWEB)

    Borda O, L B; Torres L, M N

    1997-07-01

    The purpose of this investigation was to establish the different pharmacokinetics parameters of the main radiopharmaceuticals labeled with technetium-99m and samarium-153. These parameters could be subsequently used as reference to compare other products with the same use. Mathematical models and a computerized pharmacokinetic program were used to this purpose. A biodistribution study in quadruplicate and/or quintuplicate was conducted for each radiopharmaceutical, data was was obtained in injection dose percentages. The biodistribution study involved the injection of a predetermined dose of the radiopharmaceutical into animals (rats or mice), which were subsequently put away at different time intervals, removing the relevant organs. Activity in each organ was read by means of a well-type NaI scintillation counter, data obtained in activity counts was transformed into injection dose percentages. Based on these percentages, the mathematical model was constructed and the pharmacokinetic parameters were obtained using the computerized program Expo 2 v. 1, which is written in C language and works in windows. Analyzing the results obtained, we can conclude that the use of the Expo 2 v. 1 program for a bi compartmental analysis allowed us to obtain reliable pharmacokinetic parameters which describe what happens in the organism when the radiopharmaceutical passes from the central compartment to the peripheral one and vice versa.

  1. A high precision n-p scattering measurement at 14.9 MeV

    Directory of Open Access Journals (Sweden)

    Kornilov N.V.

    2017-01-01

    Full Text Available The n-p scattering angular distribution was measured with 14.9 MeV incident neutrons using the traditional time-of-flight technique with neutron-gamma discrimination. The scattering angle varied from 20o to 65o (laboratory system in 5o incremental steps. The efficiency of the neutron detectors was measured in the energy range 2–9 MeV relative to the 252Cf-standard, and was calculated using Monte Carlo methods in the 2–14 MeV energy range. Two methods of analysis were applied for experimental and simulated data: a traditional approach with a fixed threshold, and a dynamic threshold approach. The present data agree with the ENDF/B-VII evaluation for the shape of n-p angular distribution within about 1.5%.

  2. 275 Candidates and 149 Validated Planets Orbiting Bright Stars in K2 Campaigns 0–10

    DEFF Research Database (Denmark)

    Mayo, Andrew W.; Vanderburg, Andrew; Latham, David W.

    2018-01-01

    Since 2014, NASA’s K2 mission has observed large portions of the ecliptic plane in search of transiting planets and has detected hundreds of planet candidates. With observations planned until at least early 2018, K2 will continue to identify more planet candidates. We present here 275 planet...... candidates observed during Campaigns 0–10 of the K2 mission that are orbiting stars brighter than 13 mag (in Kepler band) and for which we have obtained high-resolution spectra ( R = 44,000). These candidates are analyzed using the vespa package in order to calculate their false-positive probabilities (FPP......). We find that 149 candidates are validated with an FPP lower than 0.1%, 39 of which were previously only candidates and 56 of which were previously undetected. The processes of data reduction, candidate identification, and statistical validation are described, and the demographics of the candidates...

  3. Residues Phe103 and Phe149 are critical for the co-chaperone activity of Bacillus licheniformis GrpE.

    Science.gov (United States)

    Lin, Min-Guan; Chi, Meng-Chun; Chen, Bo-En; Wang, Tzu-Fan; Lo, Huei-Fen; Lin, Long-Liu

    2015-01-01

    A tryptophan-free Bacillus licheniformis nucleotide exchange factor (BlGrpE) and its Trp mutants (F70W, F103W, F149W, F70/103W, F70/149W, F103/149W and F70/103/149W) were over-expressed and purified to near homogeneity. Simultaneous addition of B. licheniformis DnaJ, NR-peptide and individual variants synergistically stimulated the ATPase activity of a recombinant DnaK (BlDnaK) from the same bacterium by 3.1-14.7-fold, which are significantly lower than the synergistic stimulation (18.9-fold) of BlGrpE. Protein-protein interaction analysis revealed that Trp mutants relevant to amino acid positions 103 and 149 lost the ability to bind BlDnaK. Circular dichroism measurements indicate that F70W displayed a comparable level of secondary structure to that of BlGrpE, and the wild-type protein and the Trp mutants as well all experienced a reversible behavior of thermal denaturation. Guanidine hydrochloride (GdnHCl)-induced unfolding transition for BlGrpE was calculated to be 1.25 M corresponding to ΔG(N-U) of 4.29 kcal/mol, whereas the unfolding transitions of mutant proteins were in the range of 0.77-1.31 M equivalent to ΔG(N-U) of 2.41-4.14 kcal/mol. Taken together, the introduction of tryptophan residue, especially at positions 103 and 149, into the primary structure of BlGrpE has been proven to be detrimental to structural integrity and proper function of the protein. Copyright © 2014 Elsevier B.V. All rights reserved.

  4. Retention capacity of samarium (III) in zircon for it possible use in retaining walls for confinement of nuclear residues; Capacidad de retencion de samario (III) en circon para su posible uso en barreras de contencion para confinamiento de residuos nucleares

    Energy Technology Data Exchange (ETDEWEB)

    Garcia G, N

    2006-07-01

    Mexico, as country that produces part of its electric power by nuclear means, should put special emphasis in the development of technologies guided to the sure and long term confinement of the high level nuclear residuals. This work studies the capacity that has the natural zircon to retain to the samarium (III) in solution, by what due, firstly, to characterize the zircon for technical instrumental to determine the purity and characteristic of the mineral in study. The instrumental techniques that were used to carry out the physicochemical characterization were the neutron activation analysis (NAA), the infrared spectroscopy (IS), the thermal gravimetric analysis (TGA), scanning electron microscopy (SEM), transmission electron microscopy (TEM), semiquantitative analysis, dispersive energy spectroscopy (EDS), X-ray diffraction (XRD) and luminescence technique. The characterization of the surface properties carries out by means of the determination of the surface area using the BET multipoint technique, acidity constants, hydration time, the determination of the point of null charge (pH{sub PCN}) and density of surface sites (D{sub s}). The luminescence techniques were useful to determine the optimal point hydration of the zircon and for the quantification of the samarium, for that here intends the development of both analysis techniques. With the adjustment of the titration curves in the FITEQL 4 package the constants of surface acidity in the solid/liquid interface were determined. To the finish of this study it was corroborated that the zircon is a mineral that presents appropriate characteristics to be proposed as a contention barrier for the deep geologic confinement. With regard to the study of adsorption that one carries out the samarium retention it is superior to 90% under the described conditions. This investigation could also be applicable in the confinement of dangerous industrial residuals. (Author)

  5. 42 CFR 413.149 - Depreciation: Allowance for depreciation on assets financed with Federal or public funds.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 2 2010-10-01 2010-10-01 false Depreciation: Allowance for depreciation on assets... SKILLED NURSING FACILITIES Capital-Related Costs § 413.149 Depreciation: Allowance for depreciation on assets financed with Federal or public funds. (a) Principle. Depreciation is allowed on assets financed...

  6. Multiparticle excitations in the 149 Gd superdeformed nucleus. Signature of new C4 nucleus symmetry

    International Nuclear Information System (INIS)

    Theisen, C.

    1995-01-01

    The use of 8 π and EUROGAM phase I multi-detectors for the study of high spin states of 149 Gd nucleus has revealed unexpected new phenomenons about the superdeformation in this nucleus. The new excited bands confirm the omnipresence of twin bands phenomenon. A new multi-particle excitation (two protons and one neutron) has been discovered. Thanks to the second generation EUROGAM detector, unexpected discoveries such as C 4 symmetry, level interactions, complete backbending were obtained for the second potential well. The knowledge of interacting levels gives informations about the nucleon-nucleon residual interaction and could allow the determination of SD bands excitation energy. The complex processing and analysis of high multiplicity events has led to the development of new computing tools. An automatic band research program has been written for the discovery of new excited bands, and an exact method for the elimination of uncorrected events has been developed. The improvements of multi-detector performances should allow the discovery of more exceptional phenomenons and new anomalies in the SD bands. (J.S.). 222 refs., 86 figs., 38 tabs

  7. Targeting of GIT1 by miR-149* in breast cancer suppresses cell proliferation and metastasis in vitro and tumor growth in vivo

    Directory of Open Access Journals (Sweden)

    Dong Y

    2017-12-01

    Full Text Available Yan Dong,1,* Cai Chang,2,* Jingtian Liu,3 Jinwei Qiang4 1Department of Ultrasonography, Jinshan Hospital, 2Department of Ultrasonography, Cancer Center, 3Department of General Surgery, 4Department of Radiology, Jinshan Hospital, Fudan University, Shanghai, China *These authors contributed equally to this work Abstract: Breast cancer remains a major cause of cancer-related death in women worldwide. Dysregulation of microRNAs (miRNAs is involved in the initiation and progression of breast cancer. Moreover, it was found that GIT1 was widely involved in the development of many human cancers. Herein, we aimed to investigate the expression changes of miR-149* and GIT1 and the functional effects of miR-149*/GIT1 link in breast cancer. Quantitative reverse transcription-polymerase chain reaction (qRT-PCR and Western blot (WB were used to examine the expression levels of miR-149* and GIT1. Dual luciferase reporter assay was utilized to confirm the target interaction between miR-149* and GIT1. The biological functions, including cell proliferation, invasion, and migration, of miR-149* and GIT1 were determined by MTT assay and Transwell assays, respectively. Eventually, the tumor xenograft model in nude mice injected with stable transfected MDA-MB-231 cells was established to verify the effects of miR-149* and GIT1 on tumor growth. Our results showed that miR-149* expression was decreased, whereas GIT1 expression was increased in clinical samples of breast cancer. Based on the inverse expression trend between miR-149* and GIT1, we further demonstrated that miR-149* indeed directly targets GIT1. Subsequently, it was observed that inhibition of miR-149* significantly promoted cell proliferation, invasion, and migration, but the ability of cell proliferation, invasion, and migration was obviously declined after silencing of GIT1 in MDA-MB-231 cells transfected with miR-149* mimic and/or si-GIT1. Finally, it was also found that elevated miR-149* decelerated

  8. Food Insecurity and Mental Health Status: A Global Analysis of 149 Countries.

    Science.gov (United States)

    Jones, Andrew D

    2017-08-01

    This study sought to determine the association of individual-level food insecurity (FI) with mental health status across all global regions. Cross-sectional data were analyzed in 2016 from the 2014 Gallup World Poll, a series of globally implemented, nationally representative surveys. FI was assessed using the Food Insecurity Experience Scale Survey Module for Individuals, an eight-question psychometric scale reporting individuals' experiences of FI. Individual-level composite indices of mental health, the Negative Experience Index and Positive Experience Index (0-100 scale), were calculated based on responses to five questions of respondents' recent negative and positive experiences, respectively, associated with depression and mental distress. The prevalence of any FI ranged from 18.3% in East Asia to 76.1% in Sub-Saharan Africa. In global analyses (149 countries) using adjusted multiple regression analyses, FI was associated in a dose-response fashion with poorer scores on the mental health indices (coefficient [95% CI]: Negative Experience Index: mild FI, 10.4 [9.5, 11.2]; moderate FI, 17.7 [16.4, 19.0]; severe FI, 24.5 [22.7, 26.3]; Positive Experience Index: mild FI, -8.3 [-9.3, -7.4]; moderate FI, -12.6 [-13.8, -11.3]; severe FI, -16.2 [-17.9, -14.5]). Within-region analyses (11 regions) consistently demonstrated the same trends. FI is associated with poorer mental health and specific psychosocial stressors across global regions independent of SES. The numerous pathways via which FI may contribute to common mental disorders, and the broad social implications of FI linked to cultural norms and self-efficacy, may contribute to the cross-cultural consistency of the findings. Copyright © 2017 American Journal of Preventive Medicine. Published by Elsevier Inc. All rights reserved.

  9. Squamous cell carcinoma of the nasopharynx - An analysis of treatment results in 149 consecutive patients

    International Nuclear Information System (INIS)

    Johansen, Lars V.; Grau, Cai; Overgaard, Jens

    2001-01-01

    The purpose of this study was to evaluate the outcome of primary treatment and treatment of recurrences in patients with nasopharyngeal carcinoma. The material included 149 consecutive patients seen at the Aarhus University Hospital from 1963 to 1991 (49 females and 100 males). The stage distribution was: Stage I -9%, II-3%, III-28%, and IV-60%. Primary treatment was delivered with curative intent in 145 patients (97%). Persistent or recurrent disease after primary radical treatment was observed in 82 of the patients; 54% at the T-level, 40% at the N-level, and 33% at the M-level. A curative salvage attempt was carried out in 14 patients only, all with nodal recurrence: surgery in 8 patients (4 controlled) and radiotherapy in 6 patients (2 controlled). The 5-year local tumour control, locoregional tumour control, disease-specific survival rate and the overall survival rate for the patients treated with curative intent were 66%, 53%, 50% and 43%, respectively. Most of the patients (88%) had poorly differentiated tumours and these patients had the best prognosis. A major complication in three patients was radiation-induced myelopathy due to high-dose radiation delivered to the brain stem. Significant positive prognostic factors for treatment outcome in univariate analyses were early T-classification, small clinical stage, poor differentiation and low age. The Cox multivariate analysis showed that early T-categories, low N-categories and poor differentiation were independent, positive prognostic factors. Nasopharyngeal carcinoma is curable with primary radiotherapy; patients with poorly differentiated tumours have the best prognosis. Only a few patients were salvaged after recurrence. The factor most essential for success is primary control of the disease at the T- and N-levels

  10. Efficacy and safety of QVA149 compared to the concurrent administration of its monocomponents indacaterol and glycopyrronium: the BEACON study

    Directory of Open Access Journals (Sweden)

    Dahl R

    2013-10-01

    Full Text Available Ronald Dahl,1 Dalal Jadayel,2 Vijay KT Alagappan,3 Hungta Chen,3 Donald Banerji31Department of Dermatology, Allergy Centre, Odense University Hospital, Odense, Denmark; 2Novartis Horsham Research Centre, Horsham, UK; 3Novartis Pharmaceuticals Corporation, East Hanover, NJ, USAIntroduction: The BEACON study evaluated the efficacy and safety of QVA149, a once-daily dual bronchodilator containing a fixed-dose combination of the long-acting β2-agonist (LABA indacaterol and long-acting muscarinic antagonist (LAMA glycopyrronium (NVA237, in development for the treatment of patients with chronic obstructive pulmonary disease (COPD, compared with the free-dose concurrent administration of indacaterol plus glycopyrronium (IND+GLY.Methods: In this multicenter, double-blind, parallel group study, patients with stage II or stage III COPD (Global initiative for chronic Obstructive Lung Disease [GOLD] 2010 were randomized (1:1 to once-daily QVA149 (110 µg indacaterol/50 µg glycopyrronium or concurrent administration of indacaterol (150 µg and glycopyrronium (50 µg via the Breezhaler® device (Novartis AG, Basel, Switzerland for 4 weeks. The primary endpoint was to evaluate the noninferiority of QVA149 as compared with concurrent administration of IND+GLY, for trough forced expiratory volume in 1 second (FEV1 after 4 weeks of treatment. The other assessments included FEV1 area under the curve from 0 to 4 hours (AUC0–4 hours at day 1 and week 4, symptom scores, rescue medication use, safety, and tolerability over the 4-week study period.Results: Of 193 patients randomized, 187 (96.9% completed the study. Trough FEV1 at week 4 for QVA149 and IND+GLY was 1.46 L ± 0.02 and 1.46 L ± 0.18, respectively. The FEV1 AUC0–4 hours at day 1 and week 4 were similar between the two treatment groups. Both treatment groups had a similar reduction in symptom scores and rescue medication use for the 4-week treatment period. Overall, 25.6% of patients in QVA149 group

  11. 33 CFR 149.304 - What type and how many survival craft and rescue boats must a manned deepwater port have?

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false What type and how many survival craft and rescue boats must a manned deepwater port have? 149.304 Section 149.304 Navigation and... What type and how many survival craft and rescue boats must a manned deepwater port have? (a) Except as...

  12. 33 CFR 149.419 - Can the water supply for the helicopter deck fire protection system be part of a fire water system?

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Can the water supply for the... § 149.419 Can the water supply for the helicopter deck fire protection system be part of a fire water system? (a) The water supply for the helicopter deck fire protection system required under § 149.420 or...

  13. Helium production cross section Measurement of Pb and Sn for 14.9 MeV neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Takao, Yoshiyuki; Fujimoto, Toshihiro; Ozaki, Shuji; Muramasu, Masatomo; Nakashima, Hideki [Kyushu Univ., Fukuoka (Japan); Kanda, Yukinori; Ikeda, Yujiro

    1998-03-01

    Helium production cross sections of lead and tin for 14.9 MeV neutrons were measured by helium accumulation method. Lead and tin samples were irradiated with FNS, an intense d-T neutron source of JAERI. The amount of helium produced in the samples by the neutron irradiation was measured with the Helium Atoms Measurement System (HAMS) at Kyushu University. As the samples contained a small amount of helium because of their small helium production cross sections at 14.9 MeV, the samples were evaporated by radiation from a tungsten filament to decrease background gases at helium measurement. Uncertainties of the present results were less than {+-}4.4%. The results were compared with other experimental data in the literature and also compared with the evaluated values in JENDL-3.2. (author)

  14. Circulating miR-765 and miR-149: Potential Noninvasive Diagnostic Biomarkers for Geriatric Coronary Artery Disease Patients

    Directory of Open Access Journals (Sweden)

    Md Sayed Ali Sheikh

    2015-01-01

    Full Text Available The purpose of this study was to evaluate the diagnostic value of circulating miR-765 and miR-149 as noninvasive early biomarkers for geriatric coronary artery disease (CAD patients. A total of 69 angiographically documented CAD patients including 37 stable CAD (72.9 ± 4.2 years and 32 unstable CAD (72.03 ± 4.3 years and 20 healthy subjects (71.7 ± 5.2 years, matched for age, sex, smoking habit, hypertension, and diabetes, were enrolled in this study. Compared with healthy subjects, circulating miR-765 levels were increased by 2.9-fold in stable CAD and 5.8-fold in unstable CAD patients, respectively, while circulating miR-149 levels were downregulated by 3.5-fold in stable CAD and 4.2-fold in unstable CAD patients, respectively. Furthermore, plasma levels of miR-765 were found to be positively correlated with ages within control, stable, and unstable groups. The ROC curves of miR-765 and miR-149 represented significant diagnostic values with an area under curve (AUC of 0.959, 0.972 and 0.938, 0.977 in stable CAD patients and unstable CAD patients as compared with healthy subjects, respectively. Plasma levels of miR-765 and miR-149 might be used as noninvasive biomarkers for the diagnosis of CAD in geriatric people.

  15. Multicentre trial on the efficacy and toxicity of single-dose samarium-153-ethylene diamine tetramethylene phosphonate as a palliative treatment for painful skeletal metastases in China

    International Nuclear Information System (INIS)

    Tian Jia-he; Zhang Jin-ming; He Yi-jie; Hou Qing-tian; Oyang Qiao-hong; Wang Jian-min; Chuan Ling

    1999-01-01

    A multicentre trial was organized in China as part of an international coordinated research project to study the efficacy and toxicity of single-dose samarium-153 ethylene diamine tetramethylene phosphonate (EDTMP) as a palliative treatment for painful skeletal metastases. One hundred and five patients with painful bone metastases from various primaries were treated with 153 Sm-EDTMP at a dose of 37 MBq/kg(group I) or 18.5 MBq/kg (group II). The effects were evaluated according to change in daily analgesic consumption, pain score, sum of effect product (SEP), Physician's Global Assessment (PGA), blood counts, and organ function tests conducted regularly for 16 weeks. Fifty-eight of 70 patients in group I and 30 of 35 in group II had a positive response, with SEPs of 22.29±14.47 and 20.13±13.90 respectively. Of 72 patients who had been receiving analgesics, 63 reduced their consumption. PGA showed that the Karnofsky score (KS) increased from 58.54±25.90 to 71.67±26.53, indicating improved general condition, but the difference was not significant. Among subgroups of patients, only those with breast cancer showed a significant change in the Karnofsky score after treatment. Inter-group differences were found for net change in KS between patients with lung and patients with breast cancer, and between patients with lung and patients with oesophageal cancer. Seventeen patients showed no response. No serious side-effects were noted, except for falls in the white blood cell (nadir 1.5 x 10 9 /l) and platelet (nadir 6.0 x 10 10 /l) counts in 44/105 and 34/105 cases, respectively. Ten patients had an abnormal liver function test. Response and side-effects were both independent of dose. In conclusion, 153 Sm-EDTMP provided effective palliation in 83.8% of patients with painful bone metastases; the major toxicity was temporary myelosuppression. Further studies are needed to identify better ways of determining the appropriate dose in the individual case and the efficacy of

  16. Production of 149Tb in deep inelastic transfer reactions: an approach to the angular momentum of fragments

    International Nuclear Information System (INIS)

    Rivet, M.F.; Bimbot, R.; Gardes, D.; Fleury, A.; Hubert, F.; Llabador, Y.

    1978-01-01

    The excitation functions for deep inelastic reactions in which two to six charges are transferred from 40 Ar and 63 Cu ions to rare earth targets have been measured using activation techniques, the observed radionuclides being 150 Dy, 151 Dy and 149 gTb. From the comparison of the curves relative to 149 gTb and those relative to 150 Dy, 151 Dy, it was deduced that the low spin isomer 149 gTb was produced with significant probability for low incident energies. Using data from (heavy ions, xn) reactions, it was possible to attribute this production to the deexcitation of Tb fragments formed in deep inelastic transfers with angular momenta lower than 9n. This result is in good agreement with the angular momentum calculations performed under the hypothesis that the initial angular momentum window leading to deep inelastic reactions is situated between the critical angular momentum for fusion and that corresponding to grazing collisions. As far as Cu induced reactions are concerned, both hypothesis of rolling and sticking are consistent with the experimental data. For Ar induced reactions, the results indicate that the stage of sticking is not reached when the incident energy is lower than 200 MeV

  17. Ultrafast photodynamics of the indoline dye D149 adsorbed to porous ZnO in dye-sensitized solar cells.

    Science.gov (United States)

    Rohwer, Egmont; Richter, Christoph; Heming, Nadine; Strauch, Kerstin; Litwinski, Christian; Nyokong, Tebello; Schlettwein, Derck; Schwoerer, Heinrich

    2013-01-14

    We investigate the ultrafast dynamics of the photoinduced electron transfer between surface-adsorbed indoline D149 dye and porous ZnO as used in the working electrodes of dye-sensitized solar cells. Transient absorption spectroscopy was conducted on the dye in solution, on solid state samples and for the latter in contact to a I(-)/I(3)(-) redox electrolyte typical for dye-sensitized solar cells to elucidate the effect of each component in the observed dynamics. D149 in a solution of 1:1 acetonitrile and tert-butyl alcohol shows excited-state lifetimes of 300±50 ps. This signature is severely quenched when D149 is adsorbed to ZnO, with the fastest component of the decay trace measured at 150±20 fs due to the charge-transfer mechanism. Absorption bands of the oxidized dye molecule were investigated to determine regeneration times which are in excess of 1 ns. The addition of the redox electrolyte to the system results in faster regeneration times, of the order of 1 ns. Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  18. Studies on the rare earth complexes with pyridine derivatives and their N-oxide(II) - Synthesis and properties of fluorescent solid complexes of samarium, europium, gadolium and terbium chlorides with 2,2'-bipyridine-N,N'-dioxide

    International Nuclear Information System (INIS)

    Minyu, T.; Ning, T.; Yingli, Z.; Jiyuan, B.

    1985-01-01

    The solid complexes of rare earth nitrates perchlorates and thiocyanates with 2,2'-bipyridine-N,N'-dioxide (bipyO/sub 2/) have been reported. However, the corresponding complexes of other rear earth chlorides have not been investigated except lanthanum, cerium and yttrium. As an extension of our previous work on the synthesis of complexes of praseodymium and neodymium chlorides wiht bipoyO/sub 2/, the authors have now prepared fluorescent solid complexes of samarium, europium, gadolium and terbium chlorides with biphyO/sub 2/, using methanol as a reaction medium. The new synthesized compounds have been identified by means of elemental analysis, infrared spectrometry, conductometry, differential thermal analysis (DTA), thermogravimetry (TG) and X-ray powder diffraction

  19. E2,M1 Multipole mixing ratios in odd-mass nuclei, 59< or =A< or =149

    International Nuclear Information System (INIS)

    Krane, K.S.

    1977-01-01

    A survey is presented of the E2,M1 mxing ratios of gamma-ray transitions in odd-mass nuclei with 59< or =A< or =149. Angular distribution and correlation data from the literature are analyzed in terms of a consistent choice of the phase relationship between the E2 and M1 matrix elements. A set of recommended values of the mixing ratios is included, based on averages of results from various studies. The survey includes data available in the literature up to September 1976

  20. Hyperfine structure of 147,149Sm measured using saturated absorption spectroscopy in combination with resonance-ionization mass spectroscopy

    International Nuclear Information System (INIS)

    Park, Hyunmin; Lee, Miran; Rhee, Yongjoo

    2003-01-01

    The hyperfine structures of four levels of the Sm isotopes have been measured by means of diode-laser-based Doppler-free saturated absorption spectroscopy in combination with a diode-laser-initiated resonance-ionization mass spectroscopy. It was demonstrated that combining the two spectroscopic methods was very effective for the identification and accurate measurement of the spectral lines of atoms with several isotopes, such as the rare-earth elements. From the obtained spectra, the hyperfine constants A and B for the odd-mass isotopes 147 Sm and 149 Sm were determined for four upper levels of the studied transitions.

  1. Targeted alpha therapy in vivo: direct evidence for single cancer cell kill using 149Tb-rituximab

    International Nuclear Information System (INIS)

    Beyer, G.J.; Soloviev, D.; Buchegger, F.; Miederer, M.; Vranjes-Duric, S.; Comor, J.J.; Kuenzi, G.; Hartley, O.; Senekowitsch-Schmidtke, R.

    2004-01-01

    This study demonstrates high-efficiency sterilisation of single cancer cells in a SCID mouse model of leukaemia using rituximab, a monoclonal antibody that targets CD20, labelled with terbium-149, an alpha-emitting radionuclide. Radio-immunotherapy with 5.5 MBq labelled antibody conjugate (1.11 GBq/mg) 2 days after an intravenous graft of 5.10 6 Daudi cells resulted in tumour-free survival for >120 days in 89% of treated animals. In contrast, all control mice (no treatment or treated with 5 or 300 μg unlabelled rituximab) developed lymphoma disease. At the end of the study period, 28.4%±4% of the long-lived daughter activity remained in the body, of which 91.1% was located in bone tissue and 6.3% in the liver. A relatively high daughter radioactivity concentration was found in the spleen (12%±2%/g), suggesting that the killed cancer cells are mainly eliminated through the spleen. This promising preliminary in vivo study suggests that targeted alpha therapy with 149 Tb is worthy of consideration as a new-generation radio-immunotherapeutic approach. (orig.)

  2. Ferrites Ni{sub 0,5}Zn{sub 0,5}Fe{sub 2}O{sub 4} doped with samarium: structural analysis, morphological and electromagnetic; Ferritas Ni{sub 0,5}Zn{sub 0,5}Fe{sub 2}O{sub 4} dopada com samario: analise estrutural, morfologica e eletromagnetica

    Energy Technology Data Exchange (ETDEWEB)

    Costa, A.C.F.M.; Diniz, A.P., E-mail: anacristina@dema.ufcg.edu.br [Universidade Federal de Campina Grande (UFCG), PB (Brazil). Unidade Academinca de Engenharia de Materiais; Viana, K.M.S. [Universidade Federal do Rio Grande do Norte (UFRN), Natal, PE (Brazil). Escola de Ciencias e Tecnologia; Cornejo, D.R. [Universidade de Sao Paulo (USP), SP (Brazil). Instituto de Fisica; Kiminami, R.H.G.A. [Universidade Federal de Sao Carlos (UFSCar), SP (Brazil). Departamento de Engenharia de Materiais

    2010-07-01

    This paper proposes to investigate the sintering at 1200 deg C/2h of Ni{sub 0.5}Zn{sub 0.5}Fe{sub 2-x}Sm{sub x}O{sub 4} ferrite doped with 0.05; 0.075 e 0.1 mol of Sm synthesized by combustion reaction to evaluate the performance materials as absorbers of electromagnetic radiation. The influence of the concentration of samarium on the structure, morphology and electromagnetic properties of ferrites was studied. The resulting samples were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), magnetic measurements and reflectivity measurements in the frequency range between 8-12 GHz. The results showed that increasing the concentration of samarium caused a decrease in particle size of the samples, encouraging, therefore, to obtain materials with better values of magnetization and reflectivity, allowing for use as absorbers in narrow-band frequency between 9-10 GHz. (author)

  3. Determination of breath acetone in 149 type 2 diabetic patients using a ringdown breath-acetone analyzer.

    Science.gov (United States)

    Sun, Meixiu; Chen, Zhuying; Gong, Zhiyong; Zhao, Xiaomeng; Jiang, Chenyu; Yuan, Yuan; Wang, Zhennang; Li, Yingxin; Wang, Chuji

    2015-02-01

    Over 90% of diabetic patients have Type 2 diabetes. Although an elevated mean breath acetone concentration has been found to exist in Type 1 diabetes (T1D), information on breath acetone in Type 2 diabetes (T2D) has yet to be obtained. In this study, we first used gas chromatography-mass spectrometry (GC-MS) to validate a ringdown breath-acetone analyzer based on the cavity-ringdown-spectroscopy technique, through comparing breath acetone concentrations in the range 0.5-2.5 ppm measured using both methods. The linear fitting of R = 0.99 suggests that the acetone concentrations obtained using both methods are consistent with a largest standard deviation of ±0.4 ppm in the lowest concentration of the range. Next, 620 breath samples from 149 T2D patients and 42 healthy subjects were collected and tested using the breath analyzer. Four breath samples were taken from each subject under each of four different conditions: fasting, 2 h post-breakfast, 2 h post-lunch, and 2 h post-dinner. Simultaneous blood glucose levels were also measured using a standard diabetic-management blood-glucose meter. For the 149 T2D subjects, their exhaled breath acetone concentrations ranged from 0.1 to 19.8 ppm; four different ranges of breath acetone concentration, 0.1-19.8, 0.1-7.1, 0.1-6.3, and 0.1-9.5 ppm, were obtained for the subjects under the four different conditions, respectively. For the 42 healthy subjects, their breath acetone concentration ranged from 0.1 to 2.6 ppm; four different ranges of breath acetone concentration, 0.3-2.6, 0.1-2.6, 0.1-1.7, and 0.3-1.6 ppm, were obtained for the four different conditions. The mean breath acetone concentration of the 149 T2D subjects was determined to be 1.5 ± 1.5 ppm, which was 1.5 times that of 1.0 ± 0.6 ppm for the 42 healthy subjects. No correlation was found between the breath acetone concentration and the blood glucose level of the T2D subjects and the healthy volunteers. This study using a relatively large number of

  4. Stellar Population and Star Formation History of the Distant Galactic H II Regions NGC 2282 and Sh2-149

    Science.gov (United States)

    Dutta, S.; Mondal, S.; Jose, J.; Das, R. K.

    2017-06-01

    We present here the recent results on two distant Galactic H II regions, namely NGC 2282 and Sh2-149, obtained with multiwavelength observations. Our optical spectroscopic analysis of the bright sources have been used to identify the massive members, and to derive the fundamental parameters such as age and distance of these regions. Using IR color-color criteria and Hα-emission properties, we have identified and classified the candidate young stellar objects (YSOs) in these regions. The 12CO(1-0) continuum maps along with the K-band extinction maps, and spatial distribution of YSOs are used to investigate the structure and morphology of the molecular cloud associated with these H II regions. Overall analysis of these regions suggests that the star formation occurs at the locations of the denser gas, and we also find possible evidences of the induced star formation due to the feedback from massive stars to its surrounding molecular medium.

  5. Multiparticle excitations in the {sup 149} Gd superdeformed nucleus. Signature of new C{sub 4} nucleus symmetry; Excitations multiparticules dans le noyau superdeforme {sup 149}Gd. Signature d`une symetrie nouvelle C{sub 4} du noyau

    Energy Technology Data Exchange (ETDEWEB)

    Theisen, C

    1995-01-01

    The use of 8 {pi} and EUROGAM phase I multi-detectors for the study of high spin states of {sup 149} Gd nucleus has revealed unexpected new phenomenons about the superdeformation in this nucleus. The new excited bands confirm the omnipresence of twin bands phenomenon. A new multi-particle excitation (two protons and one neutron) has been discovered. Thanks to the second generation EUROGAM detector, unexpected discoveries such as C{sub 4} symmetry, level interactions, complete backbending were obtained for the second potential well. The knowledge of interacting levels gives informations about the nucleon-nucleon residual interaction and could allow the determination of SD bands excitation energy. The complex processing and analysis of high multiplicity events has led to the development of new computing tools. An automatic band research program has been written for the discovery of new excited bands, and an exact method for the elimination of uncorrected events has been developed. The improvements of multi-detector performances should allow the discovery of more exceptional phenomenons and new anomalies in the SD bands. (J.S.). 222 refs., 86 figs., 38 tabs.

  6. Retrospective evaluation of bone pain palliation after samarium-153-EDTMP therapy Avaliação retrospectiva do tratamento da dor óssea metastática com Samário-153-EDTMP

    Directory of Open Access Journals (Sweden)

    Marcelo Tatit Sapienza

    2004-01-01

    Full Text Available PURPOSE: The aim of this study was to evaluate the degree of metastatic bone pain palliation and medullar toxicity associated with samarium-153-EDTMP treatment. METHODS: Seventy-three patients with metastatic bone pain having previously undergone therapy with samarium-153-EDTMP (1 mCi/kg were retrospectively evaluated. Routine follow-up included pain evaluation and blood counts for 2 months after treatment. Pain was evaluated using a subjective scale (from 0 to 10 before and for 8 weeks after the treatment. Blood counts were obtained before treatment and once a week for 2 months during follow-up. Dosimetry, based upon the urinary excretion of the isotope, was estimated in 41 individuals, and the resulting radiation absorbed doses were correlated with hematological data. RESULTS: Reduction in pain scores of 75% to 100% was obtained in 36 patients (49%, with a decrease of 50% to 75%, 25% to 50%, and 0% to 25% in, respectively, 20 (27%, 10 (14%, and 7 (10% patients. There was no significant relationship between the pain response and location of the primary tumor (breast or prostate cancer. Mild to moderate myelosuppression was noted in 75.3% of patients, usually with hematological recovery at 8 weeks. The mean bone marrow dose was 347 ± 65 cGy, and only a weak correlation was found between absorbed dose and myelosuppression (Pearson coefficient = .4. CONCLUSIONS: Samarium-153-EDTMP is a valuable method for metastatic bone pain palliation. A mild to moderate and transitory myelosuppression is the main toxicity observed after samarium therapy, showing a weak correlation with dosimetric measures.OBJETIVO: O presente trabalho teve por objetivo avaliar o efeito paliativo da dor e a toxicidade medular associados ao tratamento com Samário-153-EDTMP em pacientes com metástases ósseas. MÉTODOS: O estudo foi realizado de forma retrospectiva, a partir do levantamento de prontuário de 178 pacientes submetidos a tratamento com 1mCi/kg de 153Sm

  7. Effects of samarium (Sm) additions on the microstructure and mechanical properties of as-cast and hot-extruded Mg-5 wt%Al-3 wt%Ca-based alloys

    International Nuclear Information System (INIS)

    Son, Hyeon-Taek; Lee, Jae-Seol; Kim, Dae-Guen; Yoshimi, Kyosuke; Maruyama, Kouichi

    2009-01-01

    Samarium (Sm) additions to as-cast Mg-5Al-3Ca-based alloys result in changes, such as equiaxed grains and a refined grain size. The microstructure of as-cast Mg-5Al-3Ca-xSm alloys consists of an α-Mg matrix, a (Mg, Al) 2 Ca eutectic phase, and an Al 2 Sm intermetallic compound. In as-cast alloys, the (Mg, Al) 2 Ca eutectic phase was located at grain boundaries with a chain structure, and the Al 2 Sm intermetallic compounds were homogeneously distributed at the α-Mg matrix and grain boundaries. The eutectic phase of the extruded alloys was elongated in the extrusion direction and crushed into fine particles because of severe deformation during hot extrusion, and the grain size was refined with an increased amount of Sm addition. The maximum values of the yield strength and tensile strength were 313 MPa and 330 MPa at 2 wt%Sm alloy content, respectively

  8. AGR-2 Data Qualification Report for ATR Cycles 147A, 148A, 148B, and 149A

    Energy Technology Data Exchange (ETDEWEB)

    Michael L. Abbott; Keith A. Daum

    2011-08-01

    This report presents the data qualification status of fuel irradiation data from the first four reactor cycles (147A, 148A, 148B, and 149A) of the on-going second Advanced Gas Reactor (AGR-2) experiment as recorded in the NGNP Data Management and Analysis System (NDMAS). This includes data received by NDMAS from the period June 22, 2010 through May 21, 2011. AGR-2 is the second in a series of eight planned irradiation experiments for the AGR Fuel Development and Qualification Program, which supports development of the very high temperature gas-cooled reactor (VHTR) under the Next Generation Nuclear Plant (NGNP) Project. Irradiation of the AGR-2 test train is being performed at the Advanced Test Reactor (ATR) at the Idaho National Laboratory (INL) and is planned for 600 effective full power days (approximately 2.75 calendar years) (PLN-3798). The experiment is intended to demonstrate the performance of UCO (uranium oxycarbide) and UO2 (uranium dioxide) fuel produced in a large coater. Data qualification status of the AGR-1 experiment was reported in INL/EXT-10-17943 (Abbott et al. 2010).

  9. AGR-2 Data Qualification Report for ATR Cycles 147A, 148A, 148B, and 149A

    International Nuclear Information System (INIS)

    Abbott, Michael L.; Daum, Keith A.

    2011-01-01

    This report presents the data qualification status of fuel irradiation data from the first four reactor cycles (147A, 148A, 148B, and 149A) of the on-going second Advanced Gas Reactor (AGR-2) experiment as recorded in the NGNP Data Management and Analysis System (NDMAS). This includes data received by NDMAS from the period June 22, 2010 through May 21, 2011. AGR-2 is the second in a series of eight planned irradiation experiments for the AGR Fuel Development and Qualification Program, which supports development of the very high temperature gas-cooled reactor (VHTR) under the Next Generation Nuclear Plant (NGNP) Project. Irradiation of the AGR-2 test train is being performed at the Advanced Test Reactor (ATR) at the Idaho National Laboratory (INL) and is planned for 600 effective full power days (approximately 2.75 calendar years) (PLN-3798). The experiment is intended to demonstrate the performance of UCO (uranium oxycarbide) and UO2 (uranium dioxide) fuel produced in a large coater. Data qualification status of the AGR-1 experiment was reported in INL/EXT-10-17943 (Abbott et al. 2010).

  10. Real world CO2 and NOx emissions from 149 Euro 5 and 6 diesel, gasoline and hybrid passenger cars.

    Science.gov (United States)

    O'Driscoll, Rosalind; Stettler, Marc E J; Molden, Nick; Oxley, Tim; ApSimon, Helen M

    2018-04-15

    In this study CO 2 and NO x emissions from 149 Euro 5 and 6 diesel, gasoline and hybrid passenger cars were compared using a Portable Emissions Measurement System (PEMS). The models sampled accounted for 56% of all passenger cars sold in Europe in 2016. We found gasoline vehicles had CO 2 emissions 13-66% higher than diesel. During urban driving, the average CO 2 emission factor was 210.5 (sd. 47) gkm -1 for gasoline and 170.2 (sd. 34) gkm -1 for diesel. Half the gasoline vehicles tested were Gasoline Direct Injection (GDI). Euro 6 GDI engines cars. The average urban NO x emission from Euro 6 diesel vehicles 0.44 (sd. 0.44) gkm -1 was 11 times higher than for gasoline 0.04 (sd. 0.04) gkm -1 . We also analysed two gasoline-electric hybrids which out-performed both gasoline and diesel for NO x and CO 2 . We conclude action is required to mitigate the public health risk created by excessive NO x emissions from modern diesel vehicles. Replacing diesel with gasoline would incur a substantial CO 2 penalty, however greater uptake of hybrid vehicles would likely reduce both CO 2 and NO x emissions. Discrimination of vehicles on the basis of Euro standard is arbitrary and incentives should promote vehicles with the lowest real-world emissions of both NO x and CO 2 . Copyright © 2017 Elsevier B.V. All rights reserved.

  11. Who is counseled to lose weight? Survey results and anthropometric data from 3,149 lower socioeconomic women.

    Science.gov (United States)

    Breitkopf, Carmen Radecki; Egginton, Jason S; Naessens, James M; Montori, Victor M; Jatoi, Aminah

    2012-02-01

    Because obesity is a grave public health concern, this study examined the percentage of disadvantaged women who recalled ever having received weight loss advice from a healthcare provider and factors associated with such advice. This study was part of a 5-clinic, cervical cancer prevention trial. Patients not immediately post-partum completed a Spanish/English survey; height and weight were also obtained. Of the 3,149 respondents (response rate 83%), 2,138 (68%) were overweight or obese (body mass index (BMI) ≥ 25); 94% reported a household income of one-third reported ever having been told to lose weight. Based on BMI, these rates were 15% in the 25-29.9 range (overweight); 34% within 30-34.9; 57% within 35-39.9; and 73% ≥ 40. In univariate analyses, among overweight women, diabetes or English-speaking was associated with weight loss advice. In multivariate analyses, being older, more educated, and diabetic were associated with such advice. 48% of non-Hispanic whites, 31% of non-Hispanic blacks, and 29% of Hispanic had a home scale. Among disadvantaged women, obesity alone does not determine who recalls weight loss advice. Language barriers and lack of a home scale merit further study to address obesity.

  12. ORIGINAL ARTICLE 149

    African Journals Online (AJOL)

    Boaz

    infection), Salmonella typhi (typhoid fever), and Vibrio cholerea (cholera). In a nutshell, to reduce the ... Il y avait une différence statistique (p > 0,05) des microbes isolés en saison. ...... Klebsiella spp. as nosocomial pathogens: epidemiology,.

  13. Structural and superconducting properties of (Y,Gd)Ba{sub 2}Cu{sub 3}O{sub 7-{delta}} grown by MOCVD on samarium zirconate buffered IBAD-MgO

    Energy Technology Data Exchange (ETDEWEB)

    Stan, L; Holesinger, T G; Maiorov, B; Feldmann, D M; Usov, I O; DePaula, R F; Civale, L; Foltyn, S R; Jia, Q X [Los Alamos National Laboratory, PO Box 1663, Los Alamos, NM 87545 (United States); Chen, Y; Selvamanickam, V [SuperPower, Incorporated, 450 Duane Avenue, Schenectady, NY 12304 (United States)

    2008-10-01

    Textured samarium zirconate (SZO) films have been grown by reactive cosputtering directly on an ion beam assisted deposited (IBAD) MgO template, without an intermediate homoepitaxial MgO layer. The subsequent growth of 0.9 {mu}m thick (Y,Gd)Ba{sub 2}Cu{sub 3}O{sub 7-{delta}} ((Y, Gd)BCO) films by metal organic chemical vapor deposition (MOCVD) yielded well textured films with a full width at half maximum of 1.9{sup 0} and 3.4{sup 0} for the out-of-plane and in-plane texture, respectively. Microstructural characterizations of the SZO buffered samples revealed clean interfaces. This indicates that the SZO not only provides a diffusion barrier, but also functions as a buffer for (Y, Gd)BCO grown by MOCVD. The achievement of self-field critical current densities (J{sub c}) of over 2 MA cm{sup -2} at 75.5 K is another proof of the effectiveness of SZO as a buffer on the IBAD-MgO template. The in-field measurements revealed an asymmetric angular dependence of J{sub c} and a shift of the ab-plane maxima due to the tilted nature of the template and (Y,Gd){sub 2}O{sub 3} particles existing in the (Y, Gd)BCO matrix. The present results are especially important because they demonstrate that high temperature superconducting coated conductors with simpler architecture can be fabricated using commercially viable processes.

  14. Characteristics of cirrhosis undiagnosed during life: a comparative analysis of 73 undiagnosed cases and 149 diagnosed cases of cirrhosis, detected in 4929 consecutive autopsies

    DEFF Research Database (Denmark)

    Graudal, Niels; Leth, Peter Mygind; Mårbjerg, Lone

    1991-01-01

    In 4929 consecutive autopsies performed during a period of 4 years, 222 cases (4.5%) of cirrhosis were found, of which 149 (3%) were detected while the patients were alive (diagnosed cirrhosis) and 73 (1.5%) were not detected while the patients were living (undiagnosed cirrhosis). Fifty-three of ......In 4929 consecutive autopsies performed during a period of 4 years, 222 cases (4.5%) of cirrhosis were found, of which 149 (3%) were detected while the patients were alive (diagnosed cirrhosis) and 73 (1.5%) were not detected while the patients were living (undiagnosed cirrhosis). Fifty......-three of the 73 undiagnosed patients appeared to be completely without signs of cirrhosis (silent cirrhosis). In the diagnosed group, 70% of patients died from hepatic causes, in contrast to 16% in the undiagnosed group. At autopsy, the following complications of cirrhosis were found more frequently...

  15. Pharmacokinetics of amoxicillin administered in drinking water to recently weaned 3- to 4-week-old pigs with diarrhea experimentally induced by Escherichia coli O149 : F4

    DEFF Research Database (Denmark)

    Jensen, G.M.; Lykkesfeldt, J.; Frydendahl, K.

    2006-01-01

    Objective-To measure effects of Escherichia coli 0149:F4-induced diarrhea on water consumption and pharmacokinetics of amoxicillin after administration in drinking water. Animals-24 recently weaned 24- to 28-day-old crossbred pigs. Procedure-10 pigs were inoculated with E coli O149:F4; all 10 pigs...... of amoxicillin may be appropriate for administration in drinking water during a 4-hour period on the first day that pigs have diarrhea attributable to E coli 0149:F4....

  16. Gamma ray production cross sections for the interactions of 14.9 MeV neutrons with C, Al, V, Fe and Nb at 90 deg

    International Nuclear Information System (INIS)

    Zhou Hongyu; Tang Lin; Yan Yiming

    1986-11-01

    Discrete γ-ray spectra and production cross sections for the interactions of 14.9 MeV neutrons with C, Al, V, Fe and Nb targets have been measured at 90 deg. using a 110.7cm 3 Ge(Li) detector. A single γ-ray peak was measured for C. For Al 34 γ lines, for Fe 41 γ lines, for V 61 γ lines and for Nb 79 γ lines were measured

  17. Effect of amino acid sequence variations at position 149 on the fusogenic activity of the subtype B avian metapneumovirus fusion protein.

    Science.gov (United States)

    Yun, Bingling; Gao, Yanni; Liu, Yongzhen; Guan, Xiaolu; Wang, Yongqiang; Qi, Xiaole; Gao, Honglei; Liu, Changjun; Cui, Hongyu; Zhang, Yanping; Gao, Yulong; Wang, Xiaomei

    2015-10-01

    The entry of enveloped viruses into host cells requires the fusion of viral and cell membranes. These membrane fusion reactions are mediated by virus-encoded glycoproteins. In the case of avian metapneumovirus (aMPV), the fusion (F) protein alone can mediate virus entry and induce syncytium formation in vitro. To investigate the fusogenic activity of the aMPV F protein, we compared the fusogenic activities of three subtypes of aMPV F proteins using a TCSD50 assay developed in this study. Interestingly, we found that the F protein of aMPV subtype B (aMPV/B) strain VCO3/60616 (aMPV/vB) was hyperfusogenic when compared with F proteins of aMPV/B strain aMPV/f (aMPV/fB), aMPV subtype A (aMPV/A), and aMPV subtype C (aMPV/C). We then further demonstrated that the amino acid (aa) residue 149F contributed to the hyperfusogenic activity of the aMPV/vB F protein. Moreover, we revealed that residue 149F had no effect on the fusogenic activities of aMPV/A, aMPV/C, and human metapneumovirus (hMPV) F proteins. Collectively, we provide the first evidence that the amino acid at position 149 affects the fusogenic activity of the aMPV/B F protein, and our findings will provide new insights into the fusogenic mechanism of this protein.

  18. The study of 90 deg. gamma ray production cross sections for interactions of 14.9 Mev neutrons with C, Al, V, Fe, Co, Nb samples

    International Nuclear Information System (INIS)

    Tang Lin; Yan Yiming; Zhou Hongyu; Wen Shenlin; Wang Qi; Sun Shuxu; Ding Xiaoji; Wang Wanhong

    1987-04-01

    The (n,xr) reactions have been studied for incident neutron energy 14.9 Mev and for the samples C, Al, V, Fe, Co and Nb. The pulsed beam Time-of-Flight technique was adopted to discriminate neutrons and de-excitation r-rays and to improve the background conditions of the experiment. 90 deg. differential gamma production cross sections as the results of experiments are presented. Due to very low background many new r-rays peaks have been obtained. (author). 14 refs, 12 figs, 1 tab

  19. Comparative Cytotoxicity Study of Silver Nanoparticles (AgNPs in a Variety of Rainbow Trout Cell Lines (RTL-W1, RTH-149, RTG-2 and Primary Hepatocytes

    Directory of Open Access Journals (Sweden)

    Mona Connolly

    2015-05-01

    Full Text Available Among all classes of nanomaterials, silver nanoparticles (AgNPs have potentially an important ecotoxicological impact, especially in freshwater environments. Fish are particularly susceptible to the toxic effects of silver ions and, with knowledge gaps regarding the contribution of dissolution and unique particle effects to AgNP toxicity, they represent a group of vulnerable organisms. Using cell lines (RTL-W1, RTH-149, RTG-2 and primary hepatocytes of rainbow trout (Oncorhynchus mykiss as in vitro test systems, we assessed the cytotoxicity of the representative AgNP, NM-300K, and AgNO3 as an Ag+ ion source. Lack of AgNP interference with the cytotoxicity assays (AlamarBlue, CFDA-AM, NRU assay and their simultaneous application point to the compatibility and usefulness of such a battery of assays. The RTH-149 and RTL-W1 liver cell lines exhibited similar sensitivity as primary hepatocytes towards AgNP toxicity. Leibovitz’s L-15 culture medium composition (high amino acid content had an important influence on the behaviour and toxicity of AgNPs towards the RTL-W1 cell line. The obtained results demonstrate that, with careful consideration, such an in vitro approach can provide valuable toxicological data to be used in an integrated testing strategy for NM-300K risk assessment.

  20. Half-life of samarium-147

    CERN Document Server

    Kinoshita, N; Nakanishi, T

    2003-01-01

    The alpha-decay half-life of sup 1 sup 4 sup 7 Sm has been reevaluated. Known amounts of natural Sm and an alpha-emitter standard ( sup 2 sup 1 sup 0 Po, sup 2 sup 3 sup 8 U, or sup 2 sup 4 sup 1 Am) were mixed well to prepare thin sources for the simultaneous counting of sup 1 sup 4 sup 7 Sm and the alpha-emitter standard by means of an alpha-spectrometer using a silicon surface barrier detector. The alpha-disintegration rate of known amounts of sup 1 sup 4 sup 7 Sm was determined by reference to the alpha activity of the standard. The source preparation and counting were repeated to establish the reproducibility of the present half-life determination, and supplementary alpha spectrometry was carried out by a liquid-scintillation spectrometer. The arithmetic mean of the experimental half-life values was obtained to be (1.17 +- 0.02) x 10 sup 1 sup 1 y. This value is about 10% longer than the currently adopted value, (1.06 +- 0.02) x 10 sup 1 sup 1 y, and the possible factors for this difference are discussed...

  1. Vaporization of Samarium trichloride studied by thermogravimetry

    International Nuclear Information System (INIS)

    Esquivel, Marcelo R.; Pasquevich, Daniel M.

    2003-01-01

    In the present work, the vaporization reaction of SmCl 3 (l) obtained from the 'in situ' reaction of Sm 2 O 3 (s) and Cl 2 (g)-C(s) was studied by thermogravimetry under controlled atmosphere. The effects of both the temperature between 825 C degrees and 950 C degrees and the total flow gas on the vaporization rate of the following reaction: SmCl 3 (l) = SmCl 3 (g) were analyzed. The vaporization rate of the process was found to be independent of then total gas flow rate and highly dependent on the temperature. E ap calculation led to a value of 240 ± 10 kJ.mol -1 . A comparison between this value and that of the molar enthalpy of vaporization allow to the conclusion that the reaction occur in conditions near to equilibrium. The SmCl 3 identity was determined by X-ray diffraction (XRD) and energy dispersive spectroscopy (EDS). (author)

  2. A NOVEL SAMARIUM COMPLEX WITH INTERESTING ...

    African Journals Online (AJOL)

    2017 Chemical Society of Ethiopia and The Authors ... 1Institute of Applied Chemistry, School of Chemistry and Chemical Engineering, Jinggangshan ... 3State Key Laboratory of Structural Chemistry, Fujian Institute of Research ... INTRODUCTION ..... Fenamate cocrystals with 4,4'-bipyridine: structural and thermodynamic ...

  3. Non-CpG island promoter hypomethylation and miR-149 regulate the expression of SRPX2 in colorectal cancer

    DEFF Research Database (Denmark)

    Oster, Bodil; Linnet, Lene; Christensen, Lise Lotte

    2012-01-01

    Gene silencing by DNA hypermethylation of CpG islands is a well-characterized phenomenon in cancer. The effect of hypomethylation in particular of non-CpG island genes is much less well described. By genome-wide screening, we identified 105 genes in microsatellite stable (MSS) colorectal adenocar......Gene silencing by DNA hypermethylation of CpG islands is a well-characterized phenomenon in cancer. The effect of hypomethylation in particular of non-CpG island genes is much less well described. By genome-wide screening, we identified 105 genes in microsatellite stable (MSS) colorectal...... of non-CpG island-associated promoters deregulate gene expression nearly as frequent as do CpG-island hypermethylation. The hypomethylation of SRPX2 is focal and not part of a large block. Furthermore, it often translates to an increased expression level, which may be modulated by miR-149....

  4. Determination of the enantiomer ratio of PBB 149 by GC/NICI-tandem mass spectrometry in the selected reaction monitoring mode

    Energy Technology Data Exchange (ETDEWEB)

    Recke, R. von der; Goetsch, A.; Vetter, W. [Hohenheim Univ., Stuttgart (Germany). Inst. fuer Lebensmittelchemie; Mariussen, E. [Norwegian Inst. for Air Research, Kjeller (Norway); Berger, U.; Herzke, D. [NILU, The Polar Environmental Centre, Tromso (Norway)

    2004-09-15

    Technical mixtures of polybrominated biphenyls (PBBs) have been extensively used as flameretardants in textile and electronic industries and as additives in plastics. Despite a continuous reduction of the worldwide annual production in the last decade, the presence of PBBs in the environment was recently confirmed in a wide range of samples. PBBs exist in a theoretical variety of 209 congeners. Many di-ortho, tri-ortho, and tetra-ortho PBBs form stable pairs of enantiomers, which was experimentally confirmed by enantioselective HPLC separation of chiral PBB in a technical mixture. It is known from the literature, that chiral organohalogen compounds can be degraded enantioselectively. In this work we used a chiral GC stationary phase and developed a method using GC/NICI-MSMS in the single reaction monitoring mode for the determination of the enantioratio of PBB 149 in extracts from Norwegian bird of prey eggs.

  5. Volumetric Heat Generation and Consequence Raise in Temperature Due to Absorption of Neutrons from Thermal up to 14.9 MeV Energies

    CERN Document Server

    Massoud, E

    2003-01-01

    In this work, the heat generation rate and the consequence rise in temperature due to absorption of all neutrons from thermal energies (E<0.025) up to 14.9 MeV in water, paraffin wax, ordinary concrete and heavy concrete and heavy concrete as some selected hydrogenous materials are investigated. The neutron flux distributions are calculated by both ANISN-code and three group method in which the fast neutrons are expressed by the removal cross section concept while the other two groups (epithermal and thermal) are treated by the diffusion equation. The heat generation can be calculated from the neutron macroscopic absorption of each material or mixture multiplied by the corresponding neutron fluxes. The rise in temperature is then calculated by using both of the heat generation and the thermal conductivity of the selected materials. Some results are compared with the available experimental and theoretical data and a good agreement is achieved.

  6. Activation cross section measurement at neutron energy from 13.3 to 14.9 MeV using FNS facility

    Energy Technology Data Exchange (ETDEWEB)

    Kasugai, Yoshimi; Ikeda, Yujiro; Uno, Yoshitomo [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Yamamoto, Hiroshi; Kawade, Kiyoshi [Nagoya Univ. (Japan)

    2001-03-01

    Sixty activation cross sections have been measured in the neutron energy between 13.4 and 14.9 MeV using intense D-T neutrons source (Fusion Neutronics Source, FNS) at JAERI. The following reactions are included in this work: (1) 32 reactions mainly for lanthanide isotopes, (2) 19 reactions for short-lived products (the half-lives are from 1 s to 20 min) and (3) 9 (n, n{alpha}) reactions. The experimental results were compared with the data reported previously and the evaluated data of ENDF/B-VI Rev. 4, JENDL-3.2 and FENDL/A-2.0. The present data for the (n, p) and (n, {alpha}) reactions were compared with the values estimated by using the empirical formulae proposed by our group in order to validate the systematics for the reactions for the lanthanide isotopes. Systematic trend of (n, n{alpha}) reactions were discussed based on the present data. (author)

  7. Juvenile Breast Hypertrophy: A Successful Breast Reduction of 14.9% Body Weight without Recurrence in a 5-Year Follow-Up

    Directory of Open Access Journals (Sweden)

    Akmal Hisham

    2017-01-01

    Full Text Available Juvenile hypertrophy of the breast (JHB is a rare and relentless disease affecting women in the peripubertal period. We present a 13-year-old girl with massive bilateral JHB, successfully treated with a breast reduction and free nipple graft technique. A total of 7300 grams of breast tissue had been removed, accounting for 14.9% of the patient’s total body weight. Prophylactic hormonal therapy was not commenced. During the 5-year follow-up period, there was no recurrence and the patient remains satisfied with the aesthetic outcome. A recent meta-analysis study indicates that subcutaneous mastectomy is associated with reduced risk of recurrence, but it is more deforming and the aesthetic result is inferior to a reduction mammaplasty. In patients treated with the latter technique, some evidence exists suggesting that the use of a free nipple graft is associated with a less frequent risk of recurrence than a pedicle technique. This present case is unique as it demonstrates the clinical course of this patient at a considerably longer follow-up period than most reported studies. We adhered to the limited available evidence and highlight the long-term reliability of breast reduction with free nipple grafting as the first line surgical option in JHB, eliminating the need for repeated surgeries.

  8. Gamma-ray production cross-sections for the interactions of 14.9 MeV neutrons with Si, Cu, Nb and Pb

    International Nuclear Information System (INIS)

    Fan Guoying

    1991-12-01

    Gamma rays produced in the interactions of 14.9 MeV neutrons with Si, Cu, Nb and Pb targets were studied. The neutron beam was produced with the T(d,n)He reaction using 300 KeV Cockroft-Walton accelerator. Absolute neutron flux was determined by the associated particle technique. The time-of-flight technique was used to reduce the background. The FWHM of neutron pulses was 1.5 ns. A Ge(Li) detector was used for gamma-ray detection. 39 gamma lines for Si, 39 gamma lines for Cu, 79 for Nb and 39 for Pb were detected. Most of these gamma rays were emitted in (n,γ), (n,n') and (n,2n) reactions. The measurements were made at 40 deg. C, 55 deg. C, 125 deg. C and 140 deg. C relative to the incident neutron beam. The results are presented in the form of the data tables. 9 refs, 11 figs, 19 tabs

  9. 142 - 149_Safiyanu et al.,

    African Journals Online (AJOL)

    User

    DETOXIFICATION ENZYMES ACTIVITIES IN DELTAMETHRIN AND. BENDIOCARB ... insecticides producing industries whose daily challenge is minimization of malaria burden across ... economic growth and lack of political will bedeviling.

  10. 142 - 149_Safiyanu et al.,

    African Journals Online (AJOL)

    User

    insecticides producing industries whose daily challenge is minimization of malaria burden across the globe. Larvae of ... emerge and currently represents the major threat to ..... eastern Thailand (Pimsamurna et al., 2009) and resistance to ...

  11. Long-term risks after splenectomy among 8,149 cancer-free American veterans: a cohort study with up to 27 years follow-up

    Science.gov (United States)

    Kristinsson, Sigurdur Y.; Gridley, Gloria; Hoover, Robert N; Check, David; Landgren, Ola

    2014-01-01

    Although preservation of the spleen following abdominal trauma and spleen-preserving surgical procedures have become gold standards, about 22,000 splenectomies are still conducted annually in the USA. Infections, mostly by encapsulated organisms, are the most well-known complications following splenectomy. Recently, thrombosis and cancer have become recognized as potential adverse outcomes post-splenectomy. Among more than 4 million hospitalized USA veterans, we assessed incidence and mortality due to infections, thromboembolism, and cancer including 8,149 cancer-free veterans who underwent splenectomy with a follow-up of up to 27 years. Relative risk estimates and 95% confidence intervals were calculated using time-dependent Poisson regression methods for cohort data. Splenectomized patients had an increased risk of being hospitalized for pneumonia, meningitis, and septicemia (rate ratios=1.9–3.4); deep venous thrombosis and pulmonary embolism (rate ratios=2.2); certain solid tumors: buccal, esophagus, liver, colon, pancreas, lung, and prostate (rate ratios =1.3–1.9); and hematologic malignancies: non-Hodgkin lymphoma, Hodgkin lymphoma, multiple myeloma, acute myeloid leukemia, chronic lymphocytic leukemia, chronic myeloid leukemia, and any leukemia (rate ratios =1.8–6.0). They also had an increased risk of death due to pneumonia and septicemia (rate ratios =1.6–3.0); pulmonary embolism and coronary artery disease (rate ratios =1.4–4.5); any cancer: liver, pancreas, and lung cancer, non-Hodgkin lymphoma, Hodgkin lymphoma, and any leukemia (rate ratios =1.3–4.7). Many of the observed risks were increased more than 10 years after splenectomy. Our results underscore the importance of vaccination, surveillance, and thromboprophylaxis after splenectomy. PMID:24056815

  12. Solvent hold tank sample results for MCU-17-122-124 (March 2017), MCU-17-130-132 (April 2017), MCU-17-133-135 (May 2017), and MCU-17-141-149 (June 2017): Quarterly Report

    Energy Technology Data Exchange (ETDEWEB)

    Fondeur, F. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Jones, D. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2017-09-13

    A trend summary of four Solvent Hold Tank (SHT) monthly samples; MCU-16-122-124 (March 2017), MCU-17-130-132 (April 2017), MCU-17-133-135 (May 2017), and MCU-17-141-149 (June 2017) are reported. Analyses of the June SHT sample (MCU-17-141-149) indicated that the modifier (CS-7SB) and the extractant (MaxCalix) concentrations were slightly below (4% each) their nominal recommended levels (169,000 mg/L and 46,400 mg/L respectively). The suppressor (TiDG) level has decreased since the January 2017 measurement but has remained steady in the range of 666 to 705 mg/L, well above the minimum recommended level (479 mg/L), but below the nominal level. The “flat” trends observed in the TiDG, MaxCalix, modifier, and Gamma measurement are consistent with the solvent being idle since January 10, 2017.

  13. Temporal and elevation trends in rainfall erosivity on a 149 km2 watershed in a semi-arid region of the American Southwest

    Directory of Open Access Journals (Sweden)

    Mark A. Nearing

    2015-06-01

    Full Text Available Temporal changes in rainfall erosivity can be expected to occur with changing climate, and because rainfall amounts are known to be in part of a function of elevation, erosivity can be expected to be influenced by elevation as well. This is particularly true in mountainous regions such as are found over much of the western United States. The objective of this study was to identify temporal and elevation trends in rainfall erosivity on a 149 km2 (58 miles2 watershed in a semi-arid region of southeastern Arizona. Data from 84 rain gages for the years 1960–2012 at elevations ranging from 1231 to 1644 m (4038–5394 ft were used in the analyses. The average annual erosivity over the watershed as a whole was 1104 MJ mm ha−1 h−1 yr−1 (65 hundreds of foot ton inch acre−1 h−1 yr−1, and ranged from approximately 950 to 1225 MJ mm ha−1 h−1 yr−1 (56–72 hundreds of foot ton inch acre−1 h−1 yr−1, with a statistical trend showing greater erosivity at the higher elevations. No statistically significant temporal changes in annual or summer erosivities were found. This result stands in contrast to recent modeling studies of runoff and erosion in the area based on downscaled GCM information that project significant levels of erosivity changes over coming decades. These results are consistent with known orographic rainfall effects, but contrast with recent studies that presented projections of significant trends of increasing erosivity in the future based on downscaled GCM outputs for the area. The results illustrate the need for testing and developing improved techniques to evaluate future erosion scenarios for purposes of making targeted soil conservation decisions. Keywords: Climate change, R-factor, RUSLE, Semiarid, Soil erosion, Walnut Gulch

  14. Partial pressure (or fugacity) of carbon dioxide, salinity and other variables collected from time series observations using Bubble type equilibrator for autonomous carbon dioxide (CO2) measurement, Carbon dioxide (CO2) gas analyzer and other instruments from MOORING_GAKOA_149W_60N in the Gulf of Alaska from 2011-05-19 to 2016-03-01 (NODC Accession 0116714)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0116714 includes chemical, meteorological, physical and time series data collected from MOORING_GAKOA_149W_60N in the Gulf of Alaska from 2011-05-19...

  15. cis-Chlorobenzene Dihydrodiol Dehydrogenase (TcbB) from Pseudomonas sp. Strain P51, Expressed in Escherichia coli DH5α(pTCB149), Catalyzes Enantioselective Dehydrogenase Reactions

    OpenAIRE

    Raschke, Henning; Fleischmann, Thomas; Van Der Meer, Jan Roelof; Kohler, Hans-Peter E.

    1999-01-01

    cis-Chlorobenzene dihydrodiol dehydrogenase (CDD) from Pseudomonas sp. strain P51, cloned into Escherichia coli DH5α(pTCB149) was able to oxidize cis-dihydrodihydroxy derivatives (cis-dihydrodiols) of dihydronaphthalene, indene, and four para-substituted toluenes to the corresponding catechols. During the incubation of a nonracemic mixture of cis-1,2-indandiol, only the (+)-cis-(1R,2S) enantiomer was oxidized; the (−)-cis-(S,2R) enantiomer remained unchanged. CDD oxidized both enantiomers of ...

  16. Radiolesão vascular como efeito deletério da braquiterapia intra-arterial com dose elevada de Samário-153 em coelhos hipercolesterolêmicos Vascular radiolesion as a deleterious effect of high-dose-rate intraarterial brachytherapy with Samarium-153 in hypercholesterolemic rabbits

    Directory of Open Access Journals (Sweden)

    Dalton Bertolim Précoma

    2006-10-01

    Full Text Available OBJETIVO: Este estudo tem por objetivo avaliar as alterações vasculares morfológicas e morfométricas induzidas pela braquiterapia com Samário-153 (153 Sm em coelhos hipercolesterolêmicos, com doses elevadas. MÉTODOS: Foram analisados 43 coelhos hipercolesterolêmicos, brancos, da raça New Zealand, e o total de 86 artérias ilíacas submetidas a lesão por balão de angioplastia. Divididos em três grupos: dois (GI irradiados com as doses de 15Gy (n=14 e 60Gy (n=36 e um grupo controle (n=36. Foram realizadas avaliação histológica morfométrica e análise histológica qualitativa para análise tecidual. RESULTADOS: Foram observadas uma redução significativa da neoproliferação intimal (NPI no GI 15 Gy (pOBJECTIVE: This study was designed to evaluate vascular morphological and morphometric changes induced by brachytherapy with samarium-153 (Sm-153 at high doses in hypercholesterolemic rabbits. METHODS: Forty-three New Zealand White hypercholesterolemic rabbits were analyzed, and the total of 86 iliac arteries underwent balloon angioplasty injury. The rabbits were divided into three different groups: two irradiation groups (IG assigned to 15 Gy (n=14 and 60 Gy (n=36 irradiation doses, respectively, and a control group (n = 36. Histomorphometric and qualitative histological analyses were performed for tissue evaluation. RESULTS: Significant reductions were found in neointimal proliferation (NIP (p< 0.0001, media area (MA (p<0.0001 and percent stenosis (p<0.0001 in the 15-Gy IG, compared to the other groups. The 60-Gy IG had the higher rate of NIP, increase in media and vessel areas (VA and percent stenosis. The 60-Gy IG also showed the greatest number of xanthomatous cells (60-Gy IG: 86.11% and 15-Gy IG: 14.29%, p<0.0001 and the highest amount of hyaline amorphous tissue (60-Gy IG:58.33% and 15-Gy IG:0%, p=0.0001 and vascular proliferation (60-Gy IG:30.56% and 15-Gy IG:0%, p=0.0221. No statistically significant differences were found

  17. The analyzing power Asub(y)[(theta) for 12C(n,nsub(0,1))12C betwen 8.9 and] 14.9 MeV neutron energy

    International Nuclear Information System (INIS)

    Woye, E.; Tornow, W.; Mack, G.; Clegg, T.B.; Wylie, W.

    1983-01-01

    The analyzing power Asub(#betta#)(theta) for 12 C(n,n) 12 C elastic scattering and for inelastic scattering to the first excited state (Jsup(π) = 2 + , Q = -4.44 MeV) of 12 C was measured in the energy range from 8.9 to 14.9 MeV in 1 MeV steps. A pulsed polarized neutron beam was produced via the 2 H(d vector,n vector) 3 He polarization transfer reaction. Monte Carlo simulations were used to correct the data for finite geometry and multiple scattering effects. The Asub(#betta#) data, together with publsihed cross-section data, were analyzed in the framework of the spherical optical model and in the coupled-channels formalism. A good description of the data has been achieved. (orig.)

  18. The Molecular Structures of the Local Arm and Perseus Arm in the Galactic Region of l  = [139.°75, 149.°75], b  = [−5.°25, 5.°25

    Energy Technology Data Exchange (ETDEWEB)

    Du, Xinyu; Xu, Ye; Yang, Ji; Sun, Yan, E-mail: xydu@pmo.ac.cn, E-mail: xuye@pmo.ac.cn [Purple Mountain Observatory, Chinese Academy of Science, Nanjing 210008 (China)

    2017-04-01

    Using the Purple Mountain Observatory Delingha (PMODLH) 13.7 m telescope, we report a 96 deg{sup 2} {sup 12}CO/{sup 13}CO/C{sup 18}O mapping observation toward the Galactic region of l  = [139.°75,149.°75], b  = [−5.°25, 5.°25]. The molecular structures of the Local Arm and Perseus Arm are presented. Combining H i data and part of the Outer Arm results, we obtain that the warp structure of both atomic and molecular gas is obvious, while the flare structure only exists in atomic gas in this observing region. In addition, five filamentary giant molecular clouds on the Perseus Arm are identified. Among them, four are newly identified. Their relations with the Milky Way large-scale structure are discussed.

  19. P-glycoprotein binds to ezrin at amino acid residues 149-242 in the FERM domain and plays a key role in the multidrug resistance of human osteosarcoma.

    Science.gov (United States)

    Brambilla, Daria; Zamboni, Silvia; Federici, Cristina; Lugini, Luana; Lozupone, Francesco; De Milito, Angelo; Cecchetti, Serena; Cianfriglia, Maurizio; Fais, Stefano

    2012-06-15

    Overexpression of the mdr1 gene encoding P-glycoprotein (Pgp) exerts a major role in reducing the effectiveness of cytotoxic therapy in osteosarcoma. The interaction between actin and Pgp has been shown to be instrumental in the establishment of multidrug resistance (MDR) in human tumor cells. The cytoskeleton linker ezrin exerts a pivotal role in maintaining the functional connection between actin and Pgp. We investigated the role of ezrin in a human multidrug-resistant osteosarcoma cell line overexpressing Pgp and compared it to its counterpart that overexpresses an ezrin deletion mutant. The results showed that Pgp binds at amino acid residues 149-242 of the N-terminal domain of ezrin. The interaction between ezrin and Pgp occurs in the plasma membrane of MDR cells, where they also co-localize with the ganglioside G(M1) located in lipid rafts. The overexpression of the ezrin deletion mutant entirely restored drug susceptibility of osteosarcoma cells, consistent with Pgp dislocation to cytoplasmic compartments and abrogation of G(M1) /Pgp co-localization at the plasma membrane. Our study provides evidence that ezrin exerts a key role in MDR of human osteosarcoma cells through a Pgp-ezrin-actin connection that is instrumental for the permanence of Pgp into plasma membrane lipid rafts. We also show for the first time that Pgp-binding site is localized to amino acid residues 149-242 of the ezrin Band 4.1, Ezrin/Radixin/Moesin (FERM) domain, thus proposing a specific target for future molecular therapy aimed at counteracting MDR in osteosarcoma patients. Copyright © 2011 UICC.

  20. Samarium-cobalt type rare earth permanent magnets

    International Nuclear Information System (INIS)

    Kamat, S.V.

    2014-01-01

    Permanent magnets are one of the oldest and largest applications of magnetic materials and form an integral part of our modern industrial society. They belong to a special class of functional materials and are characterized for remanence (flux output from the magnet), coercivity (resistance to demagnetization) and energy product (material energy density) from the second quadrant of the magnetic hysteresis loop. The reliability, stability, size, weight, cost and performance of many electro-technical devices depend mainly on the properties of permanent magnets used in them. There are three important families of permanent magnets viz., Ferrites, Alnicos and Rare Earth Permanent Magnets (REPMs) with energy product values ranging from 3 to 50 MGOe and among the front ranking high performance REPMs, SmCo 5 , Sm 2 Co 17 type and NdFeB alloys are technologically the most important materials. They are used in a wide range of applications ranging from consumer products to very specialized areas of tele-communications, microelectronics, defence, space, avionics etc. While NdFeB has the highest energy product, Sm-Co based magnets are preferred for most critical applications where temperature stability of magnetic properties is essential because of their significantly higher Curie temperatures. In this presentation some of the key challenges associated with these Sm-Co based rare earth permanent magnets will be highlighted. (author)

  1. Samarium Polystibides Derived from Highly Activated Nanoscale Antimony.

    Science.gov (United States)

    Schoo, Christoph; Bestgen, Sebastian; Egeberg, Alexander; Klementyeva, Svetlana; Feldmann, Claus; Konchenko, Sergey N; Roesky, Peter W

    2018-05-14

    Zintl ions in molecular compounds are of fundamental interest for basic research and application. Two reactive antimony sources are presented that allow direct access to molecular polystibide compounds. These are Sb amalgam (Sb/Hg) and ultrasmall Sb 0 nanoparticles (d=6.6±0.8 nm), which were used independently as precursors for the synthesis of the largest f-element polystibide, [(Cp* 2 Sm) 4 Sb 8 ]. Whereas the reaction of the nanoparticles with [Cp* 2 Sm] directly led to [(Cp* 2 Sm) 4 Sb 8 ], Sm/Sb/Hg intermediates were isolated when using Sb/Hg as the precursor. These Sm/Sb/Hg intermediates [{(Cp* 2 Sm) 2 Sb} 2 (μ-Hg)] and [{(Cp* 2 Sm) 3 (μ 4 ,η 1:2:2:2 -Sb 4 )} 2 Hg] were synthetically trapped and structurally characterized, giving insight in the formation mechanism of polystibide compounds. © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  2. Samarium-cobalt-copper-iron-titanium permanent magnets

    International Nuclear Information System (INIS)

    Inomata, K.; Yamada, M.

    1980-01-01

    A permanent magnet, which comprises a composition containing a Sm-Co compound and consisting essentially of 23 to 30 wt.% of Sm, 0.2 to 1.5 wt.% Ti, 9 to 13 wt., Cu, 3 to 12 wt.% Fe and the balance Co, said magnet having a residual flux density (Br) of about 10 (kG), a coercive force (IC) of about 8 (KOe) and a maximum energy product (BH max) of about 25 (MGOe), having the aforesaid magnetic properties without the necessity of an ageing treatment

  3. Structural phase transition and elastic properties of samarium monopnictides

    International Nuclear Information System (INIS)

    Pagare, Gitanjali; Chouhan, Sunil Singh; Soni, Pooja; Sanyal, Sankar P.

    2011-01-01

    In recent years the monopnictides and monochalcogenides of the rare-earth elements with rocksalt structure (B 1 ) have aroused intensive interest due to the presence of strongly correlated f electrons in them. Under pressure, the nature of f-electrons of these compounds can be changed from localized to itinerant leading to significant changes in physical and chemical properties. These unusual structural, electronic, and high-pressure properties make them candidates for advanced industrial applications. For these applications they provide unique physical properties which cannot be achieved with other materials

  4. Samarium-153 EDTMP therapy of disseminated skeletal metastasis

    International Nuclear Information System (INIS)

    Turner, J.H.; Martindale, A.A.; Fleay, R.F.; Hoffman, R.F.; Claringbold, P.G.

    1989-01-01

    153 Sm-EDTMP (ethylenediaminetetramethylene phosphonate), prepared from a kit, was administered to 28 patients in a clinical trial of therapy for painful skeletal metastases unresponsive to all conventional treatment. The 103 keV gamma emission of 153 Sm was utilized for prospective individual estimation of beta radiation absorbed dose to red marrow to minimize myelotoxicity and provide optimum internal radiotherapy to skeletal metastases in each patient. Pain relief occurred within 14 days of administration of 153 Sm-EDTMP in 15 of 19 patients (79%) who could vie evaluated at 6 weeks, when clinical response was maximal. Duration of response ranged from 4 to 35 weeks. Recurrence of pain responded to retreatment with 153 Sm-EDTMP in five of eight cases. No dose-response relationship was apparent for pain relief but reversible myelotoxicity was frequently observed at radiation absorbed doses to bone marrow ≥270 cGy. Dosimetry calculation was based on pharmacokinetic studies of a tracer administration of 153 Sm-EDTMP in each patient. Assumptions inherent in this prospective method of predicting dose to bone marrow were validated experimentally. Biodistribution studies in rats demonstrated rapid skeletal uptake and long term retention of 153 Sm-EDTMP in bone over 5 days. Urinary clearance accounted for 40% of injected dose, and less than 0.5% of administered activity was retained in non osseous tissue. Microdensitometry of autoradiographs of sheep vertebra and femur confirmed surface uptake of 153 Sm-EDTMP in cortical bone and demonstrated relatively high trabecular bone activity which is the major component of radiation absorbed dose to bone marrow. Haematological studies in rabbits showed 153 Sm-EDTMP-induced myelotoxicity to be transient and no histopathological abnormalities were demonstrable with doses ten times greater than those administered to patients. (orig.)

  5. Optical properties of samarium doped zinc–tellurite glasses

    Indian Academy of Sciences (India)

    Unknown

    Optical absorption spectra of these glasses were recorded in the range 300–700 nm at room ... cause of their potential as hosts of rare earth elements for ... nature of these glasses was examined by X-ray diffraction ... absorption coefficient).

  6. A novel samarium complex with interesting photoluminescence and ...

    African Journals Online (AJOL)

    The 4,4'-Hbipy moieties, isolated nitrates and [Sm(H2O)4(NO3)3] species are held together via hydrogen bonds and p…p interactions to form a 3-D supramolecular framework. Luminescent investigation reveals a strong emission in blue region. Optical absorption spectrum of 1 reveals the presence of an optical gap of 3.60 ...

  7. Nanocrystalline samarium oxide coated fiber optic gas sensor

    International Nuclear Information System (INIS)

    Renganathan, B.; Sastikumar, D.; Srinivasan, R.; Ganesan, A.R.

    2014-01-01

    Highlights: • This fiber optic gas sensor works at room temperature. • As-prepared and annealed Sm 2 O 3 nanoparticles are act as sensor materials. • Sm 2 O 3 clad modified fiber detect the ammonia, ethanol and methanol gases. • The response of evanescent wave loss has been studied for different concentrations. - Abstract: Nanocrystalline Sm 2 O 3 coated fiber optic sensor is proposed for detecting toxic gases such as ammonia, methanol and ethanol vapors. Sm 2 O 3 in the as prepared form as well as annealed form have been used as gas sensing materials, by making them as cladding of a PMMA fiber. The spectral characteristics of the Sm 2 O 3 gas sensor are presented for ammonia, methanol and ethanol gases with different concentrations ranging from 0 to 500 ppm. The sensor exhibits a linear variation in the output light intensity with the concentration. The enhanced gas sensitivity and selectivity of the sensor for ethanol is discussed briefly

  8. Formation and characterization of samarium oxide generated from different precursors

    International Nuclear Information System (INIS)

    Hussein, G.A.M.; Buttrey, D.J.; DeSanto, P.; Abd-Elgaber, A.A.; Roshdy, Heba; Myhoub, Ali Y.Z.

    2003-01-01

    Sm(NO 3 ) 3 ·6H 2 O and Sm 2 (C 2 O 4 ) 3 ·10H 2 O were used as precursors for the formation of Sm 2 O 3 . Thermal processes involved in the decomposition course of both salts up to 800 deg. C in air were monitored by nonisothermal gravimetry and differential thermal analysis. Intermediates and final solid products were characterized by IR-spectroscopy, X-ray diffraction and scanning electron microscopy. The results showed that Sm(NO 3 ) 3 ·6H 2 O decomposes completely through nine endothermic mass loss processes. The dehydration occurs through the first four steps at 90, 125, 195, and 240 deg. C, culminating in a crystalline nitrate monohydrate, which subsequently decomposes to Sm(OH)(NO 3 ) 2 at 355 deg. C. The latter decomposes rapidly to form a stable and crystalline SmO(NO 3 ) at 460 deg. C, through nonstoichoimetric unstable intermediates. Finally Sm 2 O 3 forms at 520 deg. C. For the oxalate, the dehydration occurs in five steps: the anhydrous oxalate is thermally unstable and immediately decomposes to Sm 2 O 3 at 645 deg. C through two unstable intermediates. The crystalline oxide obtained from the nitrate contains larger pores than the oxide obtained from the oxalate, as indicated from scanning electron microscopy (SEM) results

  9. Measurement of radiative lifetime in atomic samarium using ...

    Indian Academy of Sciences (India)

    2014-02-08

    Feb 8, 2014 ... gations of radiative lifetime measurement of odd-parity energy level at ... introduced by an electronic delay generator between the two ... cascade repopulation and depopulation, Zeeman and hyperfine quantum beats [6]. The.

  10. Optical properties of lead–tellurite glasses doped with samarium ...

    Indian Academy of Sciences (India)

    Administrator

    392. Table 1. Density, molar volume, optical energy bandgap, refractive index, molar refraction and polarizability of oxide ion for. Sm2O3–PbO–TeO2 glasses. Glass composition (mol%). Energy. Molar. Polarizability. Density Molar volume bandgap. Refractive refraction. (αe). Sm2O3. PbO. TeO2. (ρ) (g/cm. 3. ) (Vm) (cm. –3. ).

  11. Contamination of YBCO bulk superconductors by samarium and ytterbium

    Czech Academy of Sciences Publication Activity Database

    Volochová, D.; Jurek, Karel; Radušovská, M.; Piovarči, S.; Antal, V.; Kováč, J.; Jirsa, Miloš; Diko, P.

    2014-01-01

    Roč. 496, JAN (2014), s. 14-17 ISSN 0921-4534 Institutional support: RVO:68378271 Keywords : YBCO bulk superconductors * critical temperature * critical current density * peak effect Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.942, year: 2014

  12. Hydroxyapatite synthesis and labelling with with Samarium-153

    International Nuclear Information System (INIS)

    Miranda, J.; Enciso, A.M.; Herrera, J.; Portilla, A.; Carrillo, D.

    1999-01-01

    153 Sm-labeled hydroxyapatite (HA) is used in synovectomy performed by radiation. HA was synthesized according to the method employed by Hayek and Newesely, using calcium nitrate and ammonium diacid phosphate in basic pH. Chemical characterization of HA was carried out by x-ray diffraction. HA labeling with Sm-153 is conducted using citric acid as ligand; radiochemical purity is greater than 99% and labeled particles are stable up to 9 days. This product is adequate to treat rheumatoid arthritis

  13. Influence of Samarium on Learning and Memory Function of Rats

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    Sixty-four Spraque-Dawley(SD)big rats with weaning weight of (195±15) g were randomly divided into 4 groups with 8 males and 8 females each group. One group drunk with de-ionized water served as control and was also used for analysis of the background. The other three groups rats were raised by de-ionized water containing low, middle and high concentrations of Sm for four months, then learning and memory tests were carried out in Y-electric maze. Compared with the control rats, the learning and memory of rats in low and middle groups shows a deterioration trend, exhibiting the function degradation of rats' brain. It may results from the rare earth elements through blood-brain barrier affecting the normal physiological functions of rats' brain. In addition, the activity of superoxide dismutase (SOD) in rats' brain decreases, while the content of malondialdehyde (MDA) concentration increases. The decreased SOD activity and the increased MDA mean the degeneration the ability of anti-oxidation in rats' brain, which are accordance with the degradation of learning and memory function of rats in low and middle Sm groups.

  14. Isotopic studies on oxidative methane coupling over samarium oxide

    International Nuclear Information System (INIS)

    Otsuka, Kiyoshi; Inaida, Masakatsu; Wada, Yuji; Komatsu, Takayuki; Morikawa, Akira

    1989-01-01

    The evident kinetic isotope effect was observed for the formations of ethylene and ethane through the oxidative coupling of methane on Sm 2 O 3 , when CH 4 and CD 4 were used as the reactants. Ethanes formed in the reaction of a mixture of CH 4 , CD 4 , and O 2 were C 2 H 6 , C 2 H 3 D 3 , and C 2 D 6 as major products. These results indicate that the rate-determining step of the reaction is abstraction of hydrogen from methane and that ethane is formed through the coupling of methyl intermediate. (author)

  15. Oriented growth of thin films of samarium oxide by MOCVD

    Indian Academy of Sciences (India)

    Unknown

    Very thin layers of rare earth oxides, such as Sm2O3 and epitaxial Gd2O3, grown by thermal ... As the inorganic salts of the lanthanides, such as their halides, are ... sodium hydroxide, followed by the addition of ethanolic. 1,10-phenanthroline ...

  16. Reactive Materials for Evaporating Samarium (Pre-Print)

    Science.gov (United States)

    2016-04-15

    further below  in  the  sample were not effectively  heated  and did not ignite.   Heat   transfer  was improved in pressed  pellets, which were, therefore...particles.  This combustion regime is most desired  for Sm  evaporation  based on the measured mass of the remaining coarse  condensed  combustion  products...the  evaporated  Sm could  condense  on top of the cooled burned out pellet,  forming  the surface coating.   Further EDX characterization qualitatively

  17. Spectroscopy of samarium isotopes in the sdg interacting boson model

    International Nuclear Information System (INIS)

    Devi, Y.D.; Kota, V.K.B.

    1992-01-01

    Successful spectroscopic calculations for the 0 1 + , 2 1 + , and 4 1 + levels in 146-158 Sm are carried out in sdg boson space with the restriction that the s-boson number n s ≥2 and the g-boson number n g ≤2. Observed energies, quadrupole and magnetic moments, E2 and E4 transition strengths, nuclear radii, and two-nucleon transfer intensities are reproduced with a simple two-parameter Hamiltonian. For a good simultaneous description of ground, β, and γ bands, a Hamiltonian interpolating the dynamical symmetries in the sdg model is employed. Using the resulting wave functions, in 152,154 Sm, the observed B(E4;0 1 + →4 γ + ) values are well reproduced and E4 strength distributions are predicted. Moreover, a particular ratio scrR involving two-nucleon transfer strengths showing a peak at neutron number 90 is well described by the calculations

  18. 150 KVA Samarium Cobalt VSCF Starter Generator Electrical System

    Science.gov (United States)

    1978-12-01

    4140 material where inertia welded for the bearing journals and spline interfaces. * Hub - The hub material is ’knconel 750" and is heat treated It...radial Conrad con- struction. The bearing balls and rings were vacuum melted AISI U50 tool steel, beat stabilized, and manu- factored to ABEC-7

  19. Enantioselective cyclizations and cyclization cascades of samarium ketyl radicals

    Science.gov (United States)

    Kern, Nicolas; Plesniak, Mateusz P.; McDouall, Joseph J. W.; Procter, David J.

    2017-12-01

    The rapid generation of molecular complexity from simple starting materials is a key challenge in synthesis. Enantioselective radical cyclization cascades have the potential to deliver complex, densely packed, polycyclic architectures, with control of three-dimensional shape, in one step. Unfortunately, carrying out reactions with radicals in an enantiocontrolled fashion remains challenging due to their high reactivity. This is particularly the case for reactions of radicals generated using the classical reagent, SmI2. Here, we demonstrate that enantioselective SmI2-mediated radical cyclizations and cascades that exploit a simple, recyclable chiral ligand can convert symmetrical ketoesters to complex carbocyclic products bearing multiple stereocentres with high enantio- and diastereocontrol. A computational study has been used to probe the origin of the enantioselectivity. Our studies suggest that many processes that rely on SmI2 can be rendered enantioselective by the design of suitable ligands.

  20. Isotopic Ratios of Samarium by TIMS for Nuclear Forensic Application

    Energy Technology Data Exchange (ETDEWEB)

    Louis Jean, James [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Inglis, Jeremy David [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-08-08

    The isotopic ratio of Nd, Sm, and Gd can provide important information regarding fissile material (nuclear devices, reactors), neutron environment, and device yield. These studies require precise measurement of Sm isotope ratios, by either TIMS or MC-ICP-MS. There has been an increasing trend to measure smaller and smaller quantities of Sm bearing samples. In nuclear forensics 10-100 ng of Sm are needed for precise measurement. To measure sub-ng Sm samples using TIMS for nuclear forensic analysis.

  1. Optical characteristics of transparent samarium oxide thin films ...

    Indian Academy of Sciences (India)

    2016-10-07

    Oct 7, 2016 ... The estimated direct optical band gap energy (Ed g) values were found to ... rpm substrate rotation and power of 150 W. The rate of deposition was 2 .... tion by annealing is due to the generation of oxygen vacancies due to ...

  2. Samarium Hexaboride: The First True 3D Topological Insulator?

    Science.gov (United States)

    Wolgast, Steven G.

    The recent theoretical prediction of a topologically protected surface state in the mixed-valent insulator SmB6 has motivated a series of charge transport studies, which are presented here. It is first studied using a specialized configuration designed to distinguish bulk-dominated conduction from surface-dominated conduction. As the material is cooled below 4 K, it exhibits a crossover from thermally activated bulk transport to metallic surface conduction with a fully insulating bulk. The robustness and magnitude of the surface conductivity, as is manifest in the literature of SmB6, is strong evidence for the topological insulator (TI) metallic surface states predicted for this material. This resolves a decades-old puzzle surrounding the low-temperature behavior of SmB6. Next, the magnetotransport properties of the surface are investigated using a Corbino disk geometry, which can directly measure the conductivity of individual surfaces. Both (011) and (001) crystal surfaces show a strong negative magnetoresistance at all magnetic field angles, due primarily to changes in the carrier density. The low mobility value accounts for the failure so far to observe Shubnikov-de Haas oscillations below 95 T. Small variations in the mobility and temperature dependence suggest a suppression of Kondo scattering from native oxide-layer magnetic moments. At low fields, a dynamical field-sweep-rate-dependent hysteretic behavior is observed. It persists at the slowest sweep rates, and cannot be explained by quantum interference corrections; it is likely due to extrinsic effects such as the magnetocaloric effect or glassy ordering of the native oxide moments. Pulsed magnetic field measurements up to 60 T at temperatures throughout the crossover regime clearly distinguish the surface magnetoresistance from the bulk magnetoresistance. The bulk magnetoresistance is due to a reduction in the bulk gap with increasing magnetic field. Finally, small subsurface cracks formed in SmB6 via systematic scratching or sanding results in a counter-intuitive increase in the electrical conduction due to the unique surface-conducting property of TIs, strengthening the building case for SmB 6's topological nature. This material is attractive as a TI because its bulk is fully insulating at a readily achieved 2 K, but it presents a large number of scientific mysteries and experimental challenges for future research.

  3. Coupled IVPs to Investigate a Nuclear Reactor Poison Burn Up

    Science.gov (United States)

    Faghihi, F.; Saidi-Nezhad, M.

    2009-09-01

    A set of coupled IVPs that describe the change rate of an important poison, in a nuclear reactor, has been written herein. Specifically, in this article, we have focused on the samarium-149 (as a poison) burnup in a desired pressurized water nuclear reactor and its concentration are given using our MATLAB-linked "solver."

  4. Coupled IVPs to Investigate a Nuclear Reactor Poison Burn Up

    International Nuclear Information System (INIS)

    Faghihi, F.

    2009-01-01

    A set of coupled IVPs that describe the change rate of an important poison, in a nuclear reactor, has been written herein. Specifically, in this article, we have focused on the samarium-149 (as a poison) burnup in a desired pressurized water nuclear reactor and its concentration are given using our MATLAB-linked 'solver'.

  5. cis-chlorobenzene dihydrodiol dehydrogenase (TcbB) from Pseudomonas sp. strain P51, expressed in Escherichia coli DH5alpha(pTCB149), catalyzes enantioselective dehydrogenase reactions.

    Science.gov (United States)

    Raschke, H; Fleischmann, T; Van Der Meer, J R; Kohler, H P

    1999-12-01

    cis-Chlorobenzene dihydrodiol dehydrogenase (CDD) from Pseudomonas sp. strain P51, cloned into Escherichia coli DH5alpha(pTCB149) was able to oxidize cis-dihydrodihydroxy derivatives (cis-dihydrodiols) of dihydronaphthalene, indene, and four para-substituted toluenes to the corresponding catechols. During the incubation of a nonracemic mixture of cis-1,2-indandiol, only the (+)-cis-(1R,2S) enantiomer was oxidized; the (-)-cis-(S,2R) enantiomer remained unchanged. CDD oxidized both enantiomers of cis-1,2-dihydroxy-1,2,3, 4-tetrahydronaphthalene, but oxidation of the (+)-cis-(1S,2R) enantiomer was delayed until the (-)-cis-(1R,2S) enantiomer was completely depleted. When incubated with nonracemic mixtures of para-substituted cis-toluene dihydrodiols, CDD always oxidized the major enantiomer at a higher rate than the minor enantiomer. When incubated with racemic 1-indanol, CDD enantioselectively transformed the (+)-(1S) enantiomer to 1-indanone. This stereoselective transformation shows that CDD also acted as an alcohol dehydrogenase. Additionally, CDD was able to oxidize (+)-cis-(1R,2S)-dihydroxy-1, 2-dihydronaphthalene, (+)-cis-monochlorobiphenyl dihydrodiols, and (+)-cis-toluene dihydrodiol to the corresponding catechols.

  6. cis-Chlorobenzene Dihydrodiol Dehydrogenase (TcbB) from Pseudomonas sp. Strain P51, Expressed in Escherichia coli DH5α(pTCB149), Catalyzes Enantioselective Dehydrogenase Reactions

    Science.gov (United States)

    Raschke, Henning; Fleischmann, Thomas; Van Der Meer, Jan Roelof; Kohler, Hans-Peter E.

    1999-01-01

    cis-Chlorobenzene dihydrodiol dehydrogenase (CDD) from Pseudomonas sp. strain P51, cloned into Escherichia coli DH5α(pTCB149) was able to oxidize cis-dihydrodihydroxy derivatives (cis-dihydrodiols) of dihydronaphthalene, indene, and four para-substituted toluenes to the corresponding catechols. During the incubation of a nonracemic mixture of cis-1,2-indandiol, only the (+)-cis-(1R,2S) enantiomer was oxidized; the (−)-cis-(S,2R) enantiomer remained unchanged. CDD oxidized both enantiomers of cis-1,2-dihydroxy-1,2,3,4-tetrahydronaphthalene, but oxidation of the (+)-cis-(1S,2R) enantiomer was delayed until the (−)-cis-(1R,2S) enantiomer was completely depleted. When incubated with nonracemic mixtures of para-substituted cis-toluene dihydrodiols, CDD always oxidized the major enantiomer at a higher rate than the minor enantiomer. When incubated with racemic 1-indanol, CDD enantioselectively transformed the (+)-(1S) enantiomer to 1-indanone. This stereoselective transformation shows that CDD also acted as an alcohol dehydrogenase. Additionally, CDD was able to oxidize (+)-cis-(1R,2S)-dihydroxy-1,2-dihydronaphthalene, (+)-cis-monochlorobiphenyl dihydrodiols, and (+)-cis-toluene dihydrodiol to the corresponding catechols. PMID:10583971

  7. Cis-Chlorobenzene dihydrodiol dehydrogenase (TcbB) from Pseudomonas sp. strain P51, expressed in Escherichia coli DH5{alpha}(pTCB149), catalyzes enantioselective dehydrogenase reactions

    Energy Technology Data Exchange (ETDEWEB)

    Raschke, H.; Fleischmann, T.; Meer, J.R. van der; Kohler, H.P.E.

    1999-12-01

    cis-Chlorobenzene dihydrodiol dehydrogenase (CDD) from Pseudomonas sp. strain P51, cloned into Escherichia coli DH5{alpha}(pTCB149) was able to oxidize cis-dihydrodihydroxy derivatives (cis-dihydrodiols) of dihydronaphthalene, indene, and four para-substituted toluenes to the corresponding catechols. During the incubation of a nonracemic mixture of cis-1,2-indandiol, only the (+)-cis-(1R,2S) enantiomer was oxidized; the (-)-cis-(S,2R) enantiomer remained unchanged, CDD oxidized both enantiomers of cis-1,2-dihydroxy-1,2,3,4-tetrahydronaphthalene, but oxidation of the (+)-cis-(1S,2R) enantiomer was delayed until the (-)-cis-(1R,2S) enantiomer was completely depleted. When incubated with nonracemic mixtures of para-substituted cis-toluene dihydrodiols, CDD always oxidized the major enantiomer at a higher rate than the minor enantiomer. When incubated with racemic 1-indanol, CDD enantioselectively transformed the (+)-(1S) enatiomer to 1-indanone. This stereoselective transformation shows that CDD also acted as an alcohol dehydrogenase. Additionally, CDD was able to oxidize (+)-cis-(1R,2S)-dihydroxy-1,2-dihydronaphthalene, (+)-cis-monochlorobiphenyl dihydrodiols, and (+)-cis-toluene dihydrodiol to the corresponding catechols.

  8. Search Results | Page 149 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... and Central America 119 Apply North and Central America filter · Lebanon 44 Apply Lebanon filter .... Ahmedabad, the largest city in the Indian state of Gujarat, is both diverse and divided. ... growth, its population is riven by religious conflict and stark income disparities. ... Gender and the Information Revolution in Africa.

  9. 32 CFR 149.1 - Policy.

    Science.gov (United States)

    2010-07-01

    ... unclassified information, shall, in response to specific threat data and based on risk management principles... information freely; coordinate programs; practice reciprocity; and participate in consolidated programs, when...

  10. Search Results | Page 149 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    In Cercado de Lima (centretown Lima), a population of 80 000 lives in ... Medium Grants Competition in Support of the Framework Convention on Tobacco Control ... The Government of China has adopted a national reform program aimed at ...

  11. 32 CFR 149.2 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... risk management principles. (2) Report to the Security Policy Board, attention: Chair, Facilities Protection Committee (FPC), for appropriate dissemination, all-source intelligence that concerns technical... agencies, in accordance with federal law, with TSCM services of common concern. (6) Coordinate, through the...

  12. 78 FR 149 - Proposed Collection: Comment Request

    Science.gov (United States)

    2013-01-02

    ... required by the Paperwork Reduction Act of 1995, Public Law 104-13 (44 U.S.C. 3506(c)(2)(A). Currently the... consideration. ADDRESSES: Direct all written comments to Bureau of the Public Debt, Bruce A. Sharp, 200 Third Street A4-A, Parkersburg, WV 26106-1328, or bruce.sharp@bpd.treas.gov . The opportunity to make comments...

  13. 17 CFR 149.103 - Definitions.

    Science.gov (United States)

    2010-04-01

    ..., emotional or mental illness, and specific learning disabilities. The term “physical or mental impairment... person means any person who has a physical or mental impairment that substantially limits one or more.... As used in this definition, the phrase: (1) Physical or mental impairment includes— (i) Any...

  14. Publications | Page 149 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... rural families through production, processing and value addition of regional staple ... from the traditional food basket due to the influence of western food culture. ... Ecosystem Approaches to Human Health at both regional and nodal levels.

  15. 40 CFR 149.101 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... directly as aid to a project by a department, agency, or instrumentality of the Federal government in any form including contracts, grants, and loan guarantees. Actions or programs carried out by the Federal... program or action. Indirect assistance, e.g., in the form of a loan to a developer by a lending...

  16. 9 CFR 149.1 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... the Trichinae Certification Program. Audit. An inspection process, as provided in this part, that... Protection Agency. Feed mill quality assurance affidavit. A written statement signed by the feed mill... approval audit. An audit performed by AMS representatives to determine if a laboratory meets minimum...

  17. Contribution to the study of samarium-151 excited levels; Contribution a l'etude des niveaux excites du samarium-151

    Energy Technology Data Exchange (ETDEWEB)

    Locard, P [Commissariat a l' Energie Atomique, Centre d' Etudes Nucleaires de Grenoble, 38 (France)

    1967-07-01

    The nucleus of {sup 151}Sm, which has 89 neutrons, happens to be on the lower edge of the deformed nuclei of region II. Therefore, the study of its levels is very interesting for the verification of the goodness of the collective models for deformed nuclei when the deformation is small (we introduce these models in the first chapter). {sup 151}Sm has often been studied, but the direct gamma spectrum measured with a lithium drift-germanium detector (chapter 3) shows many high energy transitions which did not appear in the previous level schemes. In order to settle these transitions, we have undertaken gamma-gamma coincidence spectra (as well as sum-coincidence spectra) experiments with a scintillation spectrometer designed in our laboratory (chapter 2). The investigation of the intensities of these coincidences leads us to modify the last proposed level schemes: we suppress the levels at 405,5 and 650 keV, we add levels at 245,6 - 306,6 - 522 - 952 and 962 keV. We have also verified the multipolarities of the main transitions and measured the half-lives of a few levels (chapter 3) (we find a half-life of 1.1 {+-} 0.5 nanosecond for the level at 167,7 keV). In chapter 4, we compare our results to the predictions of the models described in chapter 1. (author) [French] Le noyau de {sup 151}Sm, qui possede 89 neutrons, se trouve a la limite inferieure des noyaux deformes de la region II. L'etude de ses niveaux excites est donc d'un interet tout particulier pour la verification de la validite des differents modeles collectifs pour les noyaux deformes, lorsque la deformation est petite (nous introduisons ces modeles dans un premier chapitre). Le {sup 151}Sm a deja fait l'objet de nombreuses etudes, mais le spectre gamma direct fait avec une jonction de germanium compense au lithium (chapitre 3), nous a montre l'existence d'un grand nombre de transitions de hautes energies qui ne sont pas placees dans les schemas proposes jusqu'a ce jour. Pour preciser la place de ces transitions, nous avons donc entrepris des experiences de coincidences gamma-gamma (et de ''spectre de somme'') a l'aide d'un ensemble de spectrometrie a scintillation realise au laboratoire (chapitre 2). L'etude des intensites de ces coincidences (chapitre 3) nous amene a modifier le dernier schema propose: nous supprimons les niveaux a 405,5 et 650 keV, nous ajoutons des niveaux a 245,6 - 306,6 - 522 - 952 et 962 keV. Nous avons egalement verifie la multipolarite des principales transitions et mesure la duree de vie de certains des niveaux (chapitre 3) (nous trouvons une periode de 1,1 {+-} 0,5) nanoseconde pour le niveau a 167,7 keV). Le chapitre 4 est enfin consacre a la comparaison de nos resultats avec les predictions des differents modeles decrits au chapitre 1. (auteur)

  18. Part I. An investigation into the mechanism of the samarium (II)-promoted Barbier reaction: Sequential radical cyclization/organometallic addition. Part II. Conjugate addition reactions of organosamarium reagents by in situ transmetalation to cuprates. Part III. Approximate absolute rate constants for the reaction of tributyltin radicals with aryl and vinyl halides. Part IV. An investigation into the synthetic utility of tri-n-butylgermanium hydride

    Energy Technology Data Exchange (ETDEWEB)

    Totleben, M.J.

    1992-01-01

    An investigation of the mechanism of the samarium diiodide mediated Barbier reaction was conducted. Through a series of alkyl halide-carbonyl coupling and deuterium labelling experiments, evidence supportive of an organometallic addition mechanism was collected. Further probing led to an expansion of the utility of SmI[sub 2] in synthesis. The author has shown that radical cyclization of aryl and alkyl radicals to olefins, followed by reduction to primary and secondary organosamarium species is feasible. Organosamarium (III) reagents, produced by the reduction of alkyl and select aryl halides with 2 equiv of SmI[sub 2] in THF/HMPA, were treated with copper (I) salts and complexes to effect in situ transmetalation to cuprates. This allowed the 1,4-addition to [alpha],[beta]-unsaturated ketones. This new methodology allows for the sequential formation of carbon-carbon bonds through a combination of free radical and cuprate chemistry. Absolute rate constants for the abstraction of bromine atoms (k[sub Br]) by tri-n-butyltin radicals from a series of vinyl and aryl bromides have been determined. Atom abstraction was modestly enhanced by proximity of the halogen to a substituent in the following order: para < meta < ortho. Tri-n-butyl germanium hydride is known to be a poorer hydrogen atom donor than its tin analog. This feature makes it attractive for use in slow radical cyclizations where tin hydride would provide mainly for reduction. A brief study was executed to improve on the utility of the reagent as current conditions do not yield desired products in high amounts. Initial investigations examined the effect of initiator on reduction by germanium hydride, and subsequent experiments probed solvent effects. t-Butyl alcohol was determined to be superior to benzene or acetonitrile, giving consistently higher yields of reduction products.

  19. Dgroup: DG01196 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available DG01196 Chemical ... DGroup Samarium (153Sm) lexidronam ... D08504 ... Samarium (153Sm) lexidron...am (INN) D05795 ... Samarium Sm 153 lexidronam pentasodium (USAN); Samarium (153Sm) lexidronam sodium (JA

  20. FCJ-149 Affect and Care in Intimate Transactions

    Directory of Open Access Journals (Sweden)

    Lone Bertelsen

    2012-01-01

    Full Text Available This article considers the ‘co-affective’ power of the new media artwork Intimate Transactions. This co-affective power operates at the ‘trans-subjective’ level of experience. In order to explore this level of experience the article draws on the work of Brian Massumi, Bracha Ettinger and Felix Guattari amongst others. For these thinkers the ‘trans-subjective’ level of experience, precisely because it is ‘co-affective’, holds ethical potential. The article argues for the importance of tending to ‘co-affective’ level of experience – both in designing “interactive” art, such as Intimate Transactions, and in life more generally.

  1. (JASR) Vol. 12, No. 1, 2012 149 FRUITS AND SEEDS ...

    African Journals Online (AJOL)

    HP

    Mean seed yield of 18.24kg and 25kg of dry cotyledon per tree ... forest fruit tree in Nigeria and can attain a height of 25m and 2m in girth ... the United State of America (Ladipo, 2003). .... value of forests in the West African humid forest zone .

  2. 49 CFR 1.49 - Delegations to Federal Railroad Administrator.

    Science.gov (United States)

    2010-10-01

    ... Agency) and (c) of section 17 of the Noise Control Act of 1972 (Pub. L. 92-574). (p) Carry out the... consultations with the Administrator of the Environmental Protection Agency) of the Noise Control Act of 1972... train travel in communities without grade separation, capital grants to the Alaska Railroad, and a study...

  3. Upwelling Index, 60N 149W, 6-hourly

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Upwelling index computed from 1-degree FNMOC sea level pressure for 15 locations off the North American West Coast at each 3 degrees of latitude from 21N to 60N. The...

  4. 45 CFR 149.700 - Change of ownership requirements.

    Science.gov (United States)

    2010-10-01

    ... applicable state law. (2) Asset sale. Transfer of all or substantially all of the assets of the sponsor to... consolidation of the sponsor's organization with one or more other corporations, resulting in a new corporate body. (b) Change of ownership; exception. Transfer of corporate stock or the merger of another...

  5. 36 CFR 14.9 - Terms and conditions.

    Science.gov (United States)

    2010-07-01

    ... of corporations, of the address of its principal place of business and of the names and addresses of..., or national origin and shall require an identical provision to be included in all subcontracts. (l... thereof will not unduly interfere with the management and administration by the United States of the lands...

  6. South of Sahara | Page 149 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Its overburdened water systems are under increasing stress from fast-growing urban areas, while the region also faces soil erosion, shrinking forests, increased ... They include advances in maternal and child health, climate change adaptation, science granting councils, governance and justice, agriculture and food security, ...

  7. 7 CFR 457.149 - Table grape crop insurance provisions.

    Science.gov (United States)

    2010-01-01

    ... grown for commercial sale for human consumption as fresh fruit on acreage where the cultural practices... determine the minimum quality grade will be: (i) The United States Standards for Grades of Table Grapes...; (6) Earthquake; (7) Volcanic eruption; or (8) Failure of irrigation water supply, if caused by an...

  8. 14 CFR 25.149 - Minimum control speed.

    Science.gov (United States)

    2010-01-01

    ... used to simulate critical engine failure must represent the most critical mode of powerplant failure with respect to controllability expected in service. (b) VMC is the calibrated airspeed at which, when... be necessary to reduce power or thrust of the operative engines. During recovery, the airplane may...

  9. 14 CFR 23.149 - Minimum control speed.

    Science.gov (United States)

    2010-01-01

    ... not more than 5 degrees. The method used to simulate critical engine failure must represent the most critical mode of powerplant failure expected in service with respect to controllability. (b) VMC for... the critical engine is made inoperative to the point at which recovery to a direction parallel to the...

  10. What we do | Page 149 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    The first phase, funded under the project, 102474 Community of Practice in Ecohealth (sub-Saharan Africa), consisted of a study of the risk of diarrheal ... for Development Actions) is a leading regional development research organization based in Lebanon with a solid history of collaboration with IDRC at the project level.

  11. What we do | Page 149 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Over the past 15 years, the Andean countries - Bolivia, Ecuador, Peru and Venezuela - have undertake a number of unsustainable political and institutional ... Development Actions) is a leading regional development research organization based in Lebanon with a solid history of collaboration with IDRC at the project level.

  12. 7 CFR 993.149 - Receiving of prunes by handlers.

    Science.gov (United States)

    2010-01-01

    ... SERVICE (Marketing Agreements and Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE DRIED... certifies that the dehydration process of the prunes being certified resulted in prunes eligible to be... conditioning by further drying or dehydration: Provided, That such prunes shall be identified and kept separate...

  13. 9 CFR 149.7 - Recordkeeping at site.

    Science.gov (United States)

    2010-01-01

    ... disposal method for all unused bait that is replaced. (iv) It must document the brand name and active... the feed mill maintains records of pest management practices or has records generated by a pest... normal business hours. (Approved by the Office of Management and Budget under control number 0579-0323) ...

  14. All projects related to | Page 149 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Mass violence in contemporary Africa typically occurs in cycles. ... The political and economic rise of women has marked the 20th century. ... Far East Asia, South Asia, North and Central America, South America, India, Mexico, South Africa.

  15. 40 CFR 65.149 - Boilers and process heaters.

    Science.gov (United States)

    2010-07-01

    ... stream is not introduced as or with the primary fuel, a temperature monitoring device in the fire box...-throughput transfer racks, as applicable, shall meet the requirements of this section. (2) The vent stream... thermal units per hour) or greater. (ii) A boiler or process heater into which the vent stream is...

  16. What we do | Page 149 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    providing developing-country researchers with financial resources, advice, and ... and institutional reforms that have caused dissatisfaction, exacerbated social and ... Central Asia, Far East Asia, South Asia, Viet Nam, Taiwan, South Korea.

  17. 40 CFR 149.109 - Decision under section 1424(e).

    Science.gov (United States)

    2010-07-01

    ... PROGRAMS (CONTINUED) SOLE SOURCE AQUIFERS Review of Projects Affecting the Edwards Underground Reservoir, A... factors into account including: (1) The extent of possible public health hazard presented by the project; (2) Planning, design, construction, operation, maintenance and monitoring measures included in the...

  18. 149 Muslim Women and Sharia Implementation in Northern Nigeria ...

    African Journals Online (AJOL)

    instrumental in the enlightenment and education of women especially on their ... express her opinions on all issues private or public; the right to education; the ..... women seems to benefit), settling marital disputes; and settling the issue of the.

  19. 33 CFR 149.405 - How are fire extinguishers classified?

    Science.gov (United States)

    2010-07-01

    ... percentages of water, are of primary importance; (2) “B” for fires of flammable liquids, greases, or other thick flammable substances where a blanketing effect is essential; and (3) “C” for fires in electrical...

  20. 149. Reparación valvular mitral en endocarditis

    Directory of Open Access Journals (Sweden)

    J. Rodríguez-Roda Stuart

    2010-01-01

    Conclusiones: Con la suficiente experiencia en reparación mitral, la reparación de la válvula mitral con endocarditis se puede realizar con una baja mortalidad quirúrgica además de aportar las ventajas de conservar la válvula nativa con una baja tasa de reoperación.

  1. 7 CFR 4279.149 - Personal and corporate guarantee.

    Science.gov (United States)

    2010-01-01

    ... guarantees are part of the collateral for the loan, but are not considered in determining whether a loan is... documents to the Agency's satisfaction that collateral, equity, cashflow, and profitability indicate an... guarantee form. When warranted by an Agency assessment of potential financial risk, Agency approved...

  2. Determination of first ionization potential of samarium atom using Rydberg series convergence

    International Nuclear Information System (INIS)

    Jayasekharan, T.; Razvi, M.A.N.; Bhale, G.L.

    1999-01-01

    The study of Rydberg states has recently received more attention partially because an efficient isotope selective ionization is possible via these states. In addition, their investigation provides useful information on the atomic structure. An electron in a shell with a high principal quantum number is a sensitive probe for the interaction with the ionic core of the atom. Measurements of these Rydberg levels give valuable data on quantum defects, anomalies in fine structure splitting, polarizabilities, configuration interactions, ionization potentials etc

  3. Trichloridotris{N-[phenyl(pyridin-2-ylmethylidene]hydroxylamine-κ2N,N′}samarium(III

    Directory of Open Access Journals (Sweden)

    Yahong Li

    2012-03-01

    Full Text Available The SmIII ion in the title compound, [SmCl3(C12H10N2O3], shows a coordination number of nine with a slightly distorted tricapped trigonal prismatic geometry based on a Cl3N6 donor set. The molecular structure is stabilized by three intramolecular O—H...Cl hydrogen bonds.

  4. Pyroelectric properties and electrical conductivity in samarium doped BiFeO 3 ceramics

    KAUST Repository

    Yao, Yingbang; Liu, Wenchao; Mak, C. L.

    2012-01-01

    . This electrical conduction was attributed to oxygen vacancy existing in the samples. An activation energy of ∼0.7 eV for the conduction process was found to be irrespective of the Sm 3+ doping level. On the other hand, the magnetic Néel temperature (T N) decreased

  5. Effect of Samarium Oxide on the Electrical Conductivity of Plasma-Sprayed SOFC Anodes

    Science.gov (United States)

    Panahi, S. N.; Samadi, H.; Nemati, A.

    2016-10-01

    Solid oxide fuel cells (SOFCs) are rapidly becoming recognized as a new alternative to traditional energy conversion systems because of their high energy efficiency. From an ecological perspective, this environmentally friendly technology, which produces clean energy, is likely to be implemented more frequently in the future. However, the current SOFC technology still cannot meet the demands of commercial applications due to temperature constraints and high cost. To develop a marketable SOFC, suppliers have tended to reduce the operating temperatures by a few hundred degrees. The overall trend for SOFC materials is to reduce their service temperature of electrolyte. Meanwhile, it is important that the other components perform at the same temperature. Currently, the anodes of SOFCs are being studied in depth. Research has indicated that anodes based on a perovskite structure are a more promising candidate in SOFCs than the traditional system because they possess more favorable electrical properties. Among the perovskite-type oxides, SrTiO3 is one of the most promising compositions, with studies demonstrating that SrTiO3 exhibits particularly favorable electrical properties in contrast with other perovskite-type oxides. The main purpose of this article is to describe our study of the effect of rare-earth dopants with a perovskite structure on the electrical behavior of anodes in SOFCs. Sm2O3-doped SrTiO3 synthesized by a solid-state reaction was coated on substrate by atmospheric plasma spray. To compare the effect of the dopant on the electrical conductivity of strontium titanate, different concentrations of Sm2O3 were used. The samples were then investigated by x-ray diffraction, four-point probe at various temperatures (to determine the electrical conductivity), and a scanning electron microscope. The study showed that at room temperature, nondoped samples have a higher electrical resistance than doped samples. As the temperature was increased, the electrical conductivity correspondingly increased. The optimum value of 1.1 S/cm was found at 340°C for samples with 1.5% mol Sm2O3.

  6. Alkaline earth metal and samarium co-doped ceria as efficient electrolytes

    Science.gov (United States)

    Ali, Amjad; Raza, Rizwan; Kaleem Ullah, M.; Rafique, Asia; Wang, Baoyuan; Zhu, Bin

    2018-01-01

    Co-doped ceramic electrolytes M0.1Sm0.1Ce0.8O2-δ (M = Ba, Ca, Mg, and Sr) were synthesized via co-precipitation. The focus of this study was to highlight the effects of alkaline earth metals in doped ceria on the microstructure, densification, conductivity, and performance. The ionic conductivity comparisons of prepared electrolytes in the air atmosphere were studied. It has been observed that Ca0.1Sm0.1Ce0.8O2-δ shows the highest conductivity of 0.124 Scm-1 at 650 °C and a lower activation energy of 0.48 eV. The cell shows a maximum power density of 630 mW cm-2 at 650 °C using hydrogen fuel. The enhancement in conductivity and performance was due to increasing the oxygen vacancies in the ceria lattice with the increasing dopant concentration. The bandgap was calculated from UV-Vis data, which shows a red shift when compared with pure ceria. The average crystallite size is in the range of 37-49 nm. DFT was used to analyze the co-doping structure, and the calculated lattice parameter was compared with the experimental lattice parameter.

  7. Utilization of Samarium-153 in bone pain and bone tumours in dog

    International Nuclear Information System (INIS)

    Martin, V. de; Marques, F.L.N.; Okamoto, M.; Guimaraes, M.I.C.C.; Dias-Neto, A.; Fonseca, A.C.

    1997-01-01

    Full text: The experimental unit of of Centro de Medicina Nuclear of the University of Sao Paulo is working on the utilization of Sm-153-EDTMP, produced by IPEN/CNEN-SP (Brazil), for the treatment of bone pain due either inflammatory process or bone tumours spontaneously developed in dogs. The effect of the injection of the radiopharmaceutical (37 MBq/kg) were analysed by observing the animal behavior against the pain and the evolution of the clinical picture of the inflammatory process. The cases where tumours were diagnosed, bone scintigraphy was performed to follow-up the evolution of those tumours. Preliminary observations indicated that, especially in inflammatory process due to disc spondylitis, there was an improvement concerning pain and consequently a better condition of the life for those animals. Bone tumours even being more difficult to evaluate, have shown a favorable evolution concerning the reduction of pain and consequently the increase in the life span of the animals

  8. Nuclear and solid state investigations for the non-cubic paramagnetic system europium in samarium

    International Nuclear Information System (INIS)

    Boehm, R.

    1979-01-01

    By means of the time-differential perturbed angular gamma distribution after a nuclear reaction (TDPAD) the g-values of the isomer 1 1/2 - states are measured in 145 Eu and 147 Eu in the host metal Sm. The results are g ( 145 Eu) = + 1.356 + 0.008 g ( 147 Eu) = + 1.28 +- 0.01. The temperature dependence of the paramagnetic correction β obeys a Curie-Weiss law β = 1 + C/CT-, with C = -(50 +- 2) K and THETA = -(29 +- 5) K between 90 K and 1000 K, for both systems, 145 EU Sm and 147 Eu Sm. For room temperature the quadrupole coupling constant νsub(Q) is determined for 145 Eu Sm for the 1 1/2 - state: νsub(Q) = (12.5 +- 0.5) MHz and the paramagnetic relaxation time tausub(p) >= 1 μs. The g values are investigated also theoretically. (BHO)

  9. Influence of samarium ions (Sm3+) on the optical properties of lithium zinc phosphate glasses

    Science.gov (United States)

    Shwetha, M.; Eraiah, B.

    2018-05-01

    New glass samples with composition xSm2O3-(15-x) Li2O-45ZnO-40P2O5, where x= 0, 0.1, 0.3 and 0.5 mol % are prepared by conventional melt-quenching method. X-ray Diffraction measurements were performed to confirm their amorphous nature. Densities of these glasses were measured by Archimedes method. Optical properties were studied using optical absorption spectra which was recorded at room temperature in the UV-Vis region. Electronic transitions specific to the rare earth ion were observed from the UV-Visible spectroscopy. Optical direct band gap and indirect band gap energies were measured and their values were found to be between 4.23-4.74 eV and 3.02-3.67 eV, respectively. Refractive index has been measured with respect to different concentrations of Sm2O3. Polaron radius, inter-nuclear distance, field strength, dielectric constant and polarizability of oxide ions have been calculated. Fluorescence spectroscopy measurements have been performed by excitation in the UV-Visible range, which resulted in the significant fluorescence peaks. The luminescence color of the glass system has been characterized using Commission International de l'Eclairage de France 1931 chromaticity diagram.

  10. One-step synthesis of samarium-doped ceria and its CO catalysis

    Indian Academy of Sciences (India)

    Administrator

    Key Laboratory for Special Functional Aggregate Materials of Education Ministry,. School of Chemistry ... increases the carbon-tolerance ability of the electrodes.6. All these properties .... which are comparable to the values of the (200) plane.

  11. Preparation method and thermal properties of samarium and europium-doped alumino-phosphate glasses

    Energy Technology Data Exchange (ETDEWEB)

    Sava, B.A., E-mail: savabogdanalexandru@yahoo.com [National Institute of Research and Development for Optoelectronics, Department for Optospintronics, 409 Atomistilor Street, P.O. Box MG – 5, RO-77125 Magurele (Romania); Elisa, M., E-mail: astatin18@yahoo.com [National Institute of Research and Development for Optoelectronics, Department for Optospintronics, 409 Atomistilor Street, P.O. Box MG – 5, RO-77125 Magurele (Romania); Boroica, L., E-mail: boroica_lucica@yahoo.com [National Institute for Lasers, Plasma and Radiation Physics, 77125 Magurele (Romania); Monteiro, R.C.C., E-mail: rcm@fct.unl.pt [Center of Materials Research/Institute for Nanostructures, Nanomodelling and Nanofabrication, (CENIMAT/I3N), Department of Materials Sciences, Faculty of Sciences and Technology, Universidade Nova de Lisboa, 2829-516 Caparica (Portugal)

    2013-12-01

    Highlights: • Improved preparation method of rare-earth-doped phosphate glasses was done. • Working and annealing temperatures were lower than for undoped phosphate glass. • Doped glass viscosity is also lower and has quasi-linear variation with temperature. • Exothermic peak appears at about 555 °C and 685 °C, due to devitrification in glass. -- Abstract: The present work investigates alumino-phosphate glasses from Li{sub 2}O–BaO–Al{sub 2}O{sub 3}–La{sub 2}O{sub 3}–P{sub 2}O{sub 5} system containing Sm{sup 3+} and Eu{sup 3+} ions, prepared by two different ways: a wet raw materials mixing route followed by evaporation and melt-quenching, and by remelting of shards. The linear thermal expansion coefficient measured by dilatometry is identical for both rare-earth-doped phosphate glasses. Comparatively to undoped phosphate glass the linear thermal expansion coefficient increases with 2 × 10{sup −7} K{sup −1} when dopants are added. The characteristic temperatures very slowly decrease but can be considered constant with atomic weight, atomic number and f electrons number of the doping ions in the case of T{sub g} (vitreous transition temperature) and T{sub sr} (high annealing temperature) but slowly increase in the case of T{sub ir} (low annealing temperature–strain point) and very slowly increase, being practically constant in the case of T{sub D} (dilatometric softening temperature). Comparatively to undoped phosphate glass the characteristic temperatures of Sm and Eu-doped glasses present lower values. The higher values of electrical conductance for both doped glasses, comparatively to usual soda-lime-silicate glass, indicate a slightly reduced stability against water. The viscosity measurements, showed a quasi-linear variation with temperature the mean square deviation (R{sup 2}) being ranged between 0.872% and 0.996%. The viscosity of doped glasses comparatively to the undoped one is lower at the same temperature. Thermogravimetric analysis did not show notable mass change for any of doped samples. DSC curves for both rare-earth-doped phosphate glasses, as bulk and powdered samples, showed T{sub g} values in the range 435–450 °C. Bulk samples exhibited a very weak exothermic peak at about 685 °C, while powdered samples showed two weak exothermic peaks at about 555 °C and 685 °C due to devitrification of the glasses. Using designed melting and annealing programs, the doped glasses were improved regarding bubbles and cords content and strain elimination.

  12. Nanostructured Samarium Doped Fluorapatites and Their Catalytic Activity towards Synthesis of 1,2,4-Triazoles

    Directory of Open Access Journals (Sweden)

    Kranthi Kumar Gangu

    2016-09-01

    Full Text Available An investigation was conducted into the influence of the amino acids as organic modifiers in the facile synthesis of metal incorporated fluorapatites (FAp and their properties. The nanostructured Sm doped fluorapatites (Sm-FAp were prepared by a co-precipitation method using four different amino acids, namely glutamic acid, aspartic acid, glycine and histidine. The materials were characterized by various techniques including X-ray diffraction (XRD, Fourier transform infra-red spectroscopy (FT-IR, field emission scanning electron microscopy (FE-SEM, energy-dispersive X-ray spectroscopy (EDX, high resolution transmission electron microscopy (HR-TEM, N2-adsorption/desorption isotherm, temperature programmed desorption (TPD and fluorescence spectrophotometry. Under similar conditions, Sm-FAp prepared using different amino acids exhibited distinctly different morphological structures, surface area and pore properties. Their activity as catalysts was assessed and Sm-FAp/Glycine displayed excellent efficiency in the synthesis of 1,2,4-triazole catalyzing the reaction between 2-nitrobenzaldehyde and thiosemicarbazide with exceptional selectivity and 98% yield in a short time interval (10 min. The study provides an insight into the role of organic modifiers as controllers of nucleation, growth and aggregation which significantly influence the nature and activity of the catalytic sites on Sm-FAp. Sm-FAp could also have potential as photoactive material.

  13. Structural and impedance spectroscopic studies of samarium modified lead zirconate titanate ceramics

    Energy Technology Data Exchange (ETDEWEB)

    Ranjan, Rajiv [Department of Physics, Jamshedpur Co-operative College, Jamshedpur 831036 (India); Kumar, Rajiv [Department of Physics, Jamshedpur Worker' s College, Jamshedpur 831012 (India); Behera, Banarji [Department of Physics and Meteorology, I.I.T. Kharagpur 721302 (India); Choudhary, R.N.P., E-mail: crnpfl@phy.iitkgp.ernet.i [Department of Physics and Meteorology, I.I.T. Kharagpur 721302 (India)

    2009-11-01

    The polycrystalline samples of Pb{sub 1-x}Sm{sub x}(Zr{sub 0.60}Ti{sub 0.40}){sub 1-x/4}O{sub 3} (PSZT) where x=0.00, 0.03, 0.06 and 0.09 were prepared by a high-temperature solid-state reaction technique. The preliminary structural analysis using X-ray diffraction (XRD) data collected at room temperature has confirmed the formation of single-phase compounds in tetragonal crystal system. The morphological study of each sample using scanning electron microscope (SEM) has revealed that the grains are uniformly distributed through out the surfaces of the samples. Using complex impedance spectroscopy (CIS) technique, the electrical impedance and modulus properties of the materials were studied in a wide range of temperatures at different frequencies. The impedance analysis indicates the presence of bulk resistive contributions in the materials which is found to decrease on increasing temperature. The nature of variation of resistances with temperature suggests a typical negative temperature coefficient of resistance (NTCR) type behavior of the materials. The complex modulus plots clearly exhibits the presence of grain boundaries along with the bulk contributions in the PSZT materials. The presence of non-Debye type of relaxation has been confirmed by the complex impedance analysis. The variation of dc conductivity (bulk) with temperature demonstrates that the compounds exhibit Arrhenius type of electrical conductivity.

  14. Clinical and clinicopathologic response of canine bone tumor patients to treatment with samarium-153-EDTMP

    International Nuclear Information System (INIS)

    Lattimer, J.C.; Corwin, L.A. Jr.; Stapleton, J.; Volkert, W.A.; Ehrhardt, G.J.; Ketring, A.R.; Anderson, S.K.; Simon, J.; Goeckeler, W.F.

    1990-01-01

    Forty dogs with spontaneous skeletal neoplasia were treated with 153Sm-EDTMP (ethylenediaminetetramethylene phosphonic acid). Both primary and metastatic lesions were treated. Two treatment regimes, a single (37 MBq (1.0 mCi)/kg dose or two 37 MBq (1.0 mCi)/kg doses separated by 1 wk) were tested. Response to treatment was varied. Large lesions with minimal tumor bone formation responded poorly, while primary lesions with substantial ossification usually exhibited a transient response. Small lesions with minimal lysis, metastatic lesions, and axial skeleton lesions generally responded well. The major adverse side effects of treatment were platelet and white blood cell count depression below baseline values for up to 4 wk (p less than 0.05). Minor depression of packed cell volume and transient elevation of serum alkaline phosphatase were also noted (p less than 0.05). No significant differences (p greater than 0.05) between the two treatment groups, either in treatment effect or undesirable side effects, were detected

  15. Simulated samarium-neodymium thermochronology of garnet-clinopyroxene-plagioclase granulites

    International Nuclear Information System (INIS)

    Munha, J; Moita, P; Palacios, T

    2001-01-01

    Cooling and uplift histories (thermochronology) of metamorphic belts can be inferred from radiometric ages measured for appropriate geochronological systems (e.g., McDougall and Harrison, 1999). The strength of this approach lies on the potential to relate radiometric ages to the geothermobarometric conditions of mineral crystallization, and it depends on the interpretation that ages recorded by each decay system correspond to a particular temperature, the 'closure' temperature (Dodson, 1973), yielding a temperature vs. time path. However, closure temperatures should not have a single value for each decay system, since they are expected to be a function of several variables; therefore, it is crucial to assess the relative significance of all influential parameters in order to establish a rigorous thermochronological characterization of metamorphic rocks. Sm-Nd mineral geochronology has been widely used for dating high-grade rocks, including garnet(gt)- clinopyroxene(cpx)-plagioclase(pl) granulites (e.g., Burton et al., 1995). 'Real' ages of granulitic metamorphism and radiometric dates rarely coincide because the measured ages reflect only a fraction of the temperature - time path of the metamorphic process; this is the time during which each rock phase behaved essentially as a closed system, reflecting the progressive blocking of diffusion-limited isotope exchanges between coexisting minerals. The present study is an attempt to assess the time (temperature) bias between the metamorphic thermal peak event and the ages (apparent closure temperatures) obtained through the application of standard Sm-Nd geochronological methods. In particular, the model simulates the influence of variable (initial/boundary) conditions on radiometric ages that would be obtained from 147 Sm/ 144 Nd - 143 Nd/ 14 24Nd systematics of gt - cpx - pl mineral pairs; it should provide preliminary guidance on thermochronological studies of granulitic terranes (au)

  16. Electronic structure and magnetism of samarium and neodymium adatoms on free-standing graphene

    Czech Academy of Sciences Publication Activity Database

    Kozub, Agnieszka L.; Shick, Alexander; Máca, František; Kolorenč, Jindřich; Lichtenstein, A.I.

    2016-01-01

    Roč. 94, č. 12 (2016), 1-7, č. článku 125113. ISSN 2469-9950 R&D Projects: GA ČR GA15-07172S Institutional support: RVO:68378271 Keywords : graphen * rare-earth adatoms * density functional theory Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.836, year: 2016

  17. Lanthanum lead boro-tellurite glasses doped with samarium trioxide for luminescent devices application

    Science.gov (United States)

    Madhu, A.; Eraiah, B.

    2018-04-01

    Boro-tellurite based glasses (10La2O3-(20-x) TeO2-30PbO-40B2O3-xSm2O3) (x = 0, 0.5, 1.0 and 2.0 mol %) doped with different concentrations of Sm3+ ions has been investigated. The optical properties have been studied through spectroscopic measurements such as absorption and luminescence. Absorption spectra reveals nine peaks due to 6H5/2→6P3/2, 4I3/2+4F5/2+4I11/2, 6F11/2, 6F9/2, 6F7/2, 6F5/2, 6F3/2, 6H15/2, and 6H13/2 transitions. Luminescence spectra under the excitation of 403 nm display four emission bands due to 4G5/2→6H5/2, 6H7/2, 6H9/2 and 6H11/2 transitions of Sm3+ ions. Among them 6H7/2 bright orange -red is more intense which proves that the present glasses are potential candidates for luminescent device applications in visible range as well as optical fibre communication since its refractive index is 1.65 high compared to other glasses.

  18. Comment on ''Spectroscopy of samarium isotopes in the sdg interacting boson model''

    International Nuclear Information System (INIS)

    Kuyucak, S.; Lac, V.

    1993-01-01

    We point out that the data used in the sdg boson model calculations by Devi and Kota [Phys. Rev. C 45, 2238 (1992)] can be equally well described by the much simpler sd boson model. We present additional data for the Sm isotopes which cannot be explained in the sd model and hence may justify such an extension to the sdg bosons. We also comment on the form of the Hamiltonian and the transition operators used in this paper

  19. Study on irradiation conditions of producing 153Sm with natural abundance samarium target

    International Nuclear Information System (INIS)

    Du Jin; Jin Xiaohai; Bai Hongsheng; Liu Yuemin; Chen Daming; Wang Fan

    1998-01-01

    Irradiation conditions of natural abundance 152 Sm targets in different forms are studied in the heavy water reactor and the light water swimming pool reactor at the China Institute of Atomic Energy. The result shows that the specific activity of 153 Sm in liquid form target irradiated in the light water swimming pool reactor is two times greater than that in solid form target. The radionuclide purity of 153 Sm is more than 99%, which can meet the needs of clinical application

  20. Ultrasound assisted sonochemical synthesis of samarium doped Y2O3 nanostructures for display applications

    Science.gov (United States)

    Venkatachalaiah, K. N.; Nagabhushana, H.; Basavaraj, R. B.; Venkataravanappa, M.; Suresh, C.

    2018-04-01

    Sm3+ doped (1-11 mol %) cubic Y2O3 nanoflowers were fabricated by simple low temperature Sonochemical method using Aloe Vera gel as fuel. The product was characterized by PXRD, SEM, TEM, DRS, PL etc. The powder X-ray diffraction (PXRD) profiles of nanophosphors showed cubic phase structure. The particle size was further confirmed by transmission electron microscope (TEM) and it was found to be in the range of 17-25 nm. The PL emission results reveal that the phosphor nanoparticles (NPs) emit an intensive yellowish light under 367 nm excitation. The excitation spectrum of Y2O3: Sm3+ (5 mol %) obtained by monitoring the emission of the 4f - 4f (4G5/2→6H7/2) transition of Sm3+ at 612 nm As can be seen that the excitation spectrum consists of strong band at 332 nm and a broad band centered at 367 nm which corresponds to host absorption, confirming the effective energy transfer from Y2O3 host to Sm3+ ions. In the present study, CIE and CCT were estimated and found to be (0.45688, 0.51727) and the CCT of Y2O3: Sm3+ at 367 nm excitation was found to be 3357 K which was within the range of vertical daylight. Thus it can be useful for artificial production of illumination devices.

  1. Three-photon laser spectroscopy of even-parity bound states of samarium atom

    International Nuclear Information System (INIS)

    Gomonaj, O.Yi.; Kudelich, O.Yi.

    2002-01-01

    The energy spectrum of highly-excited even-parity bound states of a Sm atom, lying in the energy range 34421.1 - 36031.8 cm -1 , is investigated using three-photon resonance-ionization spectroscopy. The energies and total momenta of 48 levels are determined. Eight new levels not observed before are discovered. Thirteen intense two-photon transitions, which can be used in the schemes of Sm atom effective photoionization, are observed

  2. Laser resonant ionization spectroscopy and laser-induced resonant fluorescence spectra of samarium atom

    International Nuclear Information System (INIS)

    Jin, Changtai

    1995-01-01

    We have measured new high-lying levels of Sm atom by two-colour resonant photoionisation spectroscopy; we have observed the isotope shifts of Sm atom by laser-induced resonant fluorescence spectroscopy; the lifetime of eight low-lying levels of Sm atom were measured by using pulsed laser-Boxcar technique in atomic beam.

  3. Therapy for bone pain palliation in skeletal metastases with Samarium -153 EDTMP (Indonesian experience)

    International Nuclear Information System (INIS)

    Purnomo, E.

    2007-01-01

    Full text: Radiopharmaceutical therapy may be used for the treatment of cases with painful skeletal metastases. We evaluate and want to share an experience with application and efficacy of Sm-153 EDTMP in palliative painful bone metastases therapy. Our aim was to determine the efficacy and toxicity of single-dose Sm- 153 EDTMP as a palliative treatment for painful skeletal metastases. Material and methods: we selected 18 patients (9 male, 9 female). The average age 35-65 years weight 40- 60 kg; with metastatic bone confirmed with bone scan examination. 6 with breast cancer, 5 with nasopharyngeal cancer, 5 with prostatic cancer, 2 with lung cancer were treated with 30 mCi ( 1110 MBq) Sm-153 EDTMP. All showed extensive metastatic bone disease. The patients were given intravenous injections of 30 mCi Sm-153 EDTMP, after reconditioning, hydration . We established intensity of pain, haematological parameters, scintigraphic, Karnofsky scale. Clinical assessment was performed one month later. Responses were classified in completed (good response), partial and absent taking into account symptoms and drugs reduction. The discontinuation or the reduction of analgesic drugs like opiate dosage was also considered as successful palliative results of the treatment. Result: pain relief was obtained in 16/18 patients, Sm-153 was effective in patients with reduced drug assumption. The response to Sm-153 was good in 14/18(77,7%) of the patients and partial in 3/18(16,6%) and no response in 1/18(0,5%). The application of Sm-153 in patients with painful disseminated bone metastases has a satisfactory pain alleviating effects. Sides effects were noted, decrease hemoglobin counts and white blood cell and platelets, which gradually returned to near normal after 6 weeks. Easy application and low cost and produced in own country are important factors. Conclusion: radiopharmaceutical therapy can be recommended because of the favorable palliation effect and the low cost of Sm-153, especially in developing country with limited budget. (author)

  4. Studies on the preparation and stability of samarium-153 propylene diamine tetramethylene phosphonate (PDTMP) complex as a bone seeker

    International Nuclear Information System (INIS)

    Majali, M.A.; Mathakar, A.R.; Shimpi, H.H.; Banerjee, Sharmila; Samuel, Grace

    2000-01-01

    Propylene diamine tetra methylene phosphonate (PDTMP) was synthesised by modifying a method reported for the synthesis of EDTMP. Complexation of the synthesised phosphonate ligand with 153 Sm was carried out by varying the experimental parameters and the complex was radiochemically characterized. Biodistribution studies showed that the uptake by bone in rats was 2% per g of bone, which was retained up to 48 h. The uptake by other organs was insignificant, except by the liver which showed a slightly higher absorption

  5. Fluorescence enhancement of samarium complex co-doped with terbium complex in a poly(methyl methacrylate) matrix

    International Nuclear Information System (INIS)

    Jiu Hongfang; Zhang Lixin; Liu Guode; Fan Tao

    2009-01-01

    The fluorescence property of Sm(DBM) 3 phen- (DBM-dibenzoylmethide, phen-1,10-phenanthroline) and Tb(DBM) 3 phen-co-doped poly(methyl methacrylate) (PMMA) was investigated. The excitation, emission spectra and fluorescence lifetime of the co-doped samples were examined. In the co-doped samples, the luminescence intensities of Sm 3+ enhance with an increase of the Tb(DBM) 3 phen content and with a decrease of the Sm(DBM) 3 phen content. The reason for the fluorescence enhancement effect in the co-doped polymer is the intermolecular energy transfer. To give a vivid picture for this co-doped system, a model for the fluorescence enhancement of Sm(DBM) 3 phen- and Tb(DBM) 3 phen-co-doped PMMA is presented

  6. Samarium-Neodymium model age and Geochemical (Sr-Nd) signature of a bedrock inclusion from lake Vostok accretion ice.

    Science.gov (United States)

    Delmonte, B.; Petit, J. R.; Michard, A.; Basile-Doelsch, I.; Lipenkov, V.

    2003-04-01

    We investigated properties of the basal ice from Vostok ice core as well as the sediment inclusions within the accreted ice. The Vostok ice core preserves climatic information for the last 420 kyrs down to 3310m depth, but below this depth the horizontal layers of the climatic record are disrupted by the glacier dynamics. From 3450 m to 3538 m depth thin bedrock particles, as glacial flour, are entrapped. Glacial flour is released in the northern area lake, where glacier mostly melts and contributes to sediment accumulation. In the southern area, close to Vostok station, the lake water freezes and the upstream glacial flour does not contribute to sedimentation. The accreted ice contains visible sediment inclusions down to 3608 m (accretion ice 1), while below this depth and likely down to the water interface (˜3750 m), the ice is clear (accretion ice 2). The fine inclusions (1-2mm in diameter) from Accretion Ice 1 mostly consist of fine clays and quartz aggregates and we suggest they are entrained into ice as the glacier floats over shallow depth bay then it grounds against a relief rise. Afterward the glacier freely floats over the deep lake before reaching Vostok, and accreted ice 2 is clean. Sm-Nd dating of one of two inclusions at 3570 m depth gives 1.88 (+/-0.13)Ga (DM model age), corresponding to 1.47 Ga (TCHUR), suggesting a Precambrian origin. Also the isotopic signature of such inclusion (87Sr/86Sr= 0.8232 and eNd= -16) and that of a second one (87Sr/86Sr= 0.7999 and eNd= -15) are coherent with the nature of an old continental shield. Sediments that may initially accumulate in the shallow bay prior the Antarctic glaciation, should have been eroded and exported out of the lake by the glacier movement, this assuming processes for ice accretion and for sediment entrapping operate since a long time. As the glacial flour from upstream does not contribute to sedimentation, sediments need to be renewed at the surface of the bedrock rising question about the way of clay and quartz production. Among hypothesis, a tectonic and hydrothermal circulation appears a possible scenario. Local tectonic affecting deep faults may produce rock crushing and the tinny produced material might be conveyed through faults by hydrothermal circulation up to their vents at the surface where there are swept by glacier and included in accreted ice.

  7. Dielectric behavior of samarium-doped BaZr0.2Ti0.8O3 ceramics

    International Nuclear Information System (INIS)

    Li, Yuanliang; Wang, Ranran; Ma, Xuegang; Li, Zhongqiu; Sang, Rongli; Qu, Yuanfang

    2014-01-01

    Graphical abstract: - Highlights: • We investigate dielectric properties and phase transition of Sm 3+ -doped BaZr 0.2 Ti 0.8 O 3 ceramics. • The additive amount of Sm 2 O 3 can greatly affect the dielectric properties. • The materials undergo a diffuse type ferroelectric phase transition. • There is an alternation of substitution preference of Sm 3+ ion for the host cations in perovskite lattice. - Abstract: The dielectric properties and phase transition of Sm 3+ -doped BaZr 0.2 Ti 0.8 O 3 (BZT20) ceramics were investigated. Room temperature X-ray diffraction study suggested that the compositions had single-phase cubic symmetry. Microstructure studies showed that the grain size decreased and that the Sm 2 O 3 amount markedly affected the dielectric properties of BZT20. A dielectric constant of 5700 at 0.2 mol% Sm 2 O 3 and a dissipation factor of only 0.0011 at 2 mol% Sm 2 O 3 were observed, indicating that BZT20 had significant potential applications. Moreover, the dielectric constant, dissipation factor, phase-transition temperature, and maximum dielectric constant increased with increased Sm 2 O 3 amount at ≤0.2 mol% Sm 2 O 3 but decreased with increased Sm 2 O 3 amount at >0.2 mol% Sm 2 O 3

  8. Crystal structure of a samarium(III nitrate chain cross-linked by a bis-carbamoylmethylphosphine oxide ligand

    Directory of Open Access Journals (Sweden)

    Julie A. Stoscup

    2014-10-01

    Full Text Available In the title compound poly[aquabis(μ-nitrato-κ4O,O′:O,O′′tetrakis(nitrato-κ2O,O′{μ4-tetraethyl [(ethane-1,2-diylbis(azanediylbis(2-oxoethane-2,1-diyl]diphosphonate-κ2O,O′}disamarium(III], [Sm2(NO36(C14H30N2O8P2(H2O]n, a 12-coordinate SmIII and a nine-coordinate SmIII cation are alternately linked via shared bis-bidentate nitrate anions into a corrugated chain extending parallel to the a axis. The nine-coordinate SmIII atom of this chain is also chelated by a bidentate, yet flexible, carbamoylmethylphoshine oxide (CMPO ligand and bears one water molecule. This water molecule is hydrogen bonded to nitrate groups bonded to the 12-coordinate SmIII cation. The CMPO ligand, which lies about an inversion center, links neighboring chains along the c axis, forming sheets parallel to the ac plane. Hydrogen bonds between the amide NH group and metal-bound nitrate anions are also present in these sheets. The sheets are packed along the b axis through only van der Waals interactions.

  9. Obtention of Samarium and Gadolinium concentrates by solvent extraction using mono-2-ethylhexyl ester of 2-ethylhexyl phosphonic acid

    International Nuclear Information System (INIS)

    Miranda Junior, Pedro

    1996-01-01

    The rare earth chlorides solution employed in this study, which is constituted by medium and heavy fractions, is derived from monazite processing accomplished by NUCLEMON-Mineroquimica (SP). This solution shows an acidity about 1.18 M and 189 g/L of rare earth oxides, containing as main constituents: Sm(34.55%), Gd(23.85%), Dy (6.82%), and Y (24.45%). It was used, as organic phase, 2-ethylhexyl phosphonic acid, mono-2-ethylhexylester diluted to 1 M in isododecane. (author)

  10. POLYMERIZATION OF METHYL METHACRYLATE WITH ETHYLENE BRIDGED HETERODINUCLEAR METALLOCENE OF SAMARIUM AND TITANIUM-STUDY ON SYNERGISM AND KINETICS

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    Comparison of MMA polymerization results with samarocene chloride, titanocene chloride and the title heterodinuclear (Sm-Ti) catalyst, respectively, showed synergism in the Sm-Ligand-Ti system, which ob viously influenced the polymerization behaviors, for example, of yielding higher activity and higher molecular weight polymer. Kinetic studies on polymerization of MMA with ethylene bridged samarocene and titanocene chloride/M(i-Bu) 3 showed that the polymerization rate was first-order on the catalyst concentration, and 1.9- order on the monomer. The overall activation energy measured was 52.8 kJ/mol.

  11. High-activity samarium-153-EDTMP therapy followed by autologous peripheral blood stem cell support in unresectable osteosarcoma

    International Nuclear Information System (INIS)

    Franzius, Ch.; Eckardt, J.; Sciuk, J.; Schober, O.; Bielack, S.; Flege, S.; Juergens, H.

    2001-01-01

    Purpose: Despite highly efficacious chemotherapy, patients with osteosarcomas still have a poor prognosis if adequate surgical control cannot be obtained. These patients may benefit from therapy with radiolabeled phosphonates. Patients and Methods: Six patients (three male, three female; seven to 41 years) with unresectable primary osteosarcoma (n = 3) or unresectable recurrent sites of osteosarcomas (n = 3) were treated with high-activity of Sm-153-EDTMP (150 MBq/kg BW). In all patients autologous peripheral blood stem cells had been collected before Sm-153-EDTMP therapy. Results: No immediate adverse reactions were observed in the patients. In one patient bone pain increased during the first 48 hrs after therapy. Three patients received pain relief. Autologous peripheral blood stem cell reinfusion was performed on day +12 to +27 in all patients to overcome potentially irreversible damage to the hematopoietic stem cells. In three patient external radiotherapy of the primary tumor site was performed after Sm-153-EDTMP therapy and in two of them polychemotherapy was continued. Thirty-six months later one of these patients is still free of progression. Two further patients are still alive. However, they have developed new metastases. The three patients who had no accompanying external radiotherapy, all died of disease progression five to 20 months after therapy. Conclusion: These preliminary results show that high-dose Sm-153-EDTMP therapy is feasible and warrants further evaluation of efficacy. The combination with external radiation and polychemotherapy seems to be most promising. Although osteosarcoma is believed to be relatively radioresistant, the total focal dose achieved may delay local progression or even achieve permanent local tumor control in patients with surgically inaccessible primary or relapsing tumors. (orig.)

  12. Synthesis and Thermal Decomposition Kinetics of the Complex of Samarium p-Methylbenzoate with 1 ,1O-Phenanthroline

    Institute of Scientific and Technical Information of China (English)

    ZHANG,Jian-Jun; REN,Ning; XU,Su

    2007-01-01

    The complex [Sm(p-MBA)3phen]2 (p-MBA, p-methylbenzoate; phen, 1,10-phenanthroline) was prepared and characterized by elemental analysis, IR and UV spectra. The thermal decomposition process of [Sm(p-MBA)3phen]2 was studied under a static air atmosphere by TG-DTG and IR techniques. Thermal decomposition kinetics was investigated employing a newly proposed method, together with the integral isoconversional non-linear method. Meanwhile, the thermodynamic parameters (△H≠, AG≠ and △S≠) were also calculated. The lifetime equation at mass-loss of 10% was deduced as lnτ= -24.7825+18070.43/T by isothermal thermogravimetric analysis.

  13. Ab initio calculation of the migration free energy of oxygen diffusion in pure and samarium-doped ceria

    Science.gov (United States)

    Koettgen, Julius; Schmidt, Peter C.; Bučko, Tomáš; Martin, Manfred

    2018-01-01

    We have studied the free energy migration barriers Δ F‡ for oxygen diffusion in pure ceria and Sm-doped ceria for the temperatures 300, 700, and 1000 K. We used the density functional theory in the generalized gradient approximation and an additional Hubbard U parameter for the Ce 4 f electronic states. We compare the results for the free energy deduced from three different methods. First, a static harmonic approach is applied in which the temperature dependent vibrational contributions to energy and entropy are deduced from the phonon frequencies of supercells with a fixed volume. Second, a static quasiharmonic approach is used in which a part of the anharmonicity effect is introduced via an implicit dependence of the harmonic frequencies on the thermally expanding cell volume. Third, the free energy barriers are calculated using metadynamics and molecular dynamics in which anharmonicity effects are naturally taken into account. The three methods examined in this study lead to distinctly different results. According to the harmonic approximation, the migration free energy difference Δ F‡ increases with increasing temperature due to an increasing entropic contribution. According to the quasiharmonic approximation, the migration free energy is independent of temperature. Finally, molecular dynamics predicts a thermally induced increase in the migration free energy. We conclude that temperature dependent experimental lattice constants cancel out the increasing entropic contribution with increasing temperature in the static quasiharmonic approach. The full consideration of anharmonicity effects in the metadynamics method again leads to a temperature dependent migration free energy.

  14. Preparation of the copolymer of acrylic acid and acrylamide grafted onto polyethylene and its complexation with samarium ion

    International Nuclear Information System (INIS)

    Kido, Junji; Akiba, Hideto; Nishide, Hiroyuki; Tsuchida, Eishun; Omichi, Hideki; Okamoto, Jiro.

    1986-01-01

    Acrylic acid (AA) and acrylamide (AAm) were graft-copolymerized onto polyethylene (PE) powder by the pre-irradiation method. Complex formation constants of Sm ion with the PE powder grafted with both AA and AAm (PE-g-(AA-co-AAm)) were larger than those with the PE powder grafted with AA (PE-g-AA). Sm ion was efficiently separated from the solution containing both Sm ion and a transition metal ion such as Cu ion. Even after the γ-ray irradiation on PE-g-(AA-co-AAm) and PE-g-AA, the adsorption did not decrease. (author)

  15. Complexes of lanthanum(III), cerium(III), samarium(III) and dysprosium(III) with substituted piperidines

    Energy Technology Data Exchange (ETDEWEB)

    Manhas, B S; Trikha, A K; Singh, H; Chander, M

    1983-11-01

    Complexes of the general formulae M/sub 2/Cl/sub 6/(L)/sub 3/.C/sub 2/H/sub 5/OH and M/sub 2/(NO/sub 3/)/sub 6/(L)/sub 2/.CH/sub 3/OH have been synthesised by the reactions of chlorides and nitrates of La(III), Ce(III), Sm(III) and Dy(III) with 2-methylpiperidine, 3-methylpiperidine and 4-methylpiperidine. These complexes have been characterised on the basis of their elemental analysis, and IR and electronic reflectance spectra. IR spectral data indicate the presence of coordinated ethanol and methanol molecules and bidentate nitrate groups. Coordination numbers of the metal ions vary from 5 to 8. 19 refs.

  16. SU-F-J-149: Beam and Cryostat Scatter Characteristics of the Elekta MR-Linac

    Energy Technology Data Exchange (ETDEWEB)

    Duglio, M; Towe, S; Roberts, D [Elekta Limited, Crawley, West Sussex (United Kingdom)

    2016-06-15

    Purpose: The Elekta MR-Linac combines a digital linear accelerator system with a 1.5T Philips MRI machine. This study aimed to determine key characteristic information regarding the MR-Linac beam and in particular it evaluated the effect of the MR cryostat on the out of field scatter dose. Methods: Tissue phantom ratios, profiles and depth doses were acquired in plastic water with an IC-profiler or with an MR compatible water tank using multiple system configurations (Full (B0= 1.5T), Full (B0=0T) and No cryostat). Additionally, an in-house CAD based Monte Carlo code based on Penelope was used to provide comparative data. Results: With the cryostat in place and B0=0T, the measured TPR for the MR Linac system was 0.702, indicating an energy of around 7MV. Without the cryostat, the measured TPR was 0.669. For the Full (B0=0T) case, out of field dose at a depth of 10 cm in the isocentric plane, 5 cm from the field edge was 0.8%, 3.1% and 5.4% for 3×3 cm{sup 2}, 10×10 cm{sup 2} and 20×20 cm{sup 2} fields respectively.The out of field dose (averaged between 5 cm and 10 cm beyond the field edges) in the “with cryostat” case is 0.78% (absolute difference) higher than without the cryostat for clinically relevant field sizes (i.e. 10×10 cm{sup 2}) and comparable to measured conventional 6MV treatment beams at a depth of 10 cm (within 0.1% between 5 cm and 6 cm from field edge). At dose maximum and at 5 cm from the field edge, the “with cryostat” out of field scatter for a 10×10 cm{sup 2} field is 1.5% higher than “without cryostat', with a modest increase (0.9%) compared to Agility 6MV in the same conditions. Conclusion: The study has presented typical characteristics of the MR-Linac beam and determined that out of field dose is comparable to conventional treatment beams. All authors are employed by Elekta Ltd., who are developing an MR-Linac.

  17. 26 CFR 1.149(d)-1 - Limitations on advance refundings.

    Science.gov (United States)

    2010-04-01

    ... savings test) is satisfied. The savings test is satisfied if the issuer may realize present value debt... met with respect to the date described in the preceding sentence (i.e., there are no present value... multipurpose issue increases the aggregate present value debt service savings on the entire multipurpose issue...

  18. SU-E-T-149: Brachytherapy Patient Specific Quality Assurance for a HDR Vaginal Cylinder Case

    Energy Technology Data Exchange (ETDEWEB)

    Barbiere, J; Napoli, J; Ndlovu, A [Hackensack Univ Medical Center, Hackensack, NJ (United States)

    2015-06-15

    Purpose: Commonly Ir-192 HDR treatment planning system commissioning is only based on a single absolute measurement of source activity supplemented by tabulated parameters for multiple factors without independent verification that the planned distribution corresponds to the actual delivered dose. The purpose on this work is to present a methodology using Gafchromic film with a statistically valid calibration curve that can be used to validate clinical HDR vaginal cylinder cases by comparing the calculated plan dose distribution in a plane with the corresponding measured planar dose. Methods: A vaginal cylinder plan was created with Oncentra treatment planning system. The 3D dose matrix was exported to a Varian Eclipse work station for convenient extraction of a 2D coronal dose plane corresponding to the film position. The plan was delivered with a sheet of Gafchromic EBT3 film positioned 1mm from the catheter using an Ir-192 Nucletron HDR source. The film was then digitized with an Epson 10000 XL color scanner. Film analysis is performed with MatLab imaging toolbox. A density to dose calibration curve was created using TG43 formalism for a single dwell position exposure at over 100 points for statistical accuracy. The plan and measured film dose planes were registered using a known dwell position relative to four film marks. The plan delivered 500 cGy to points 2 cm from the sources. Results: The distance to agreement of the 500 cGy isodose between the plan and film measurement laterally was 0.5 mm but can be as much as 1.5 mm superior and inferior. The difference between the computed plan dose and film measurement was calculated per pixel. The greatest errors up to 50 cGy are near the apex. Conclusion: The methodology presented will be useful to implement more comprehensive quality assurance to verify patient-specific dose distributions.

  19. METHANOL OXIDATION OVER AU/ γ -AL 2O3 CATALYSTS 149

    African Journals Online (AJOL)

    DR. AMINU

    catalysts were used to catalyze the oxidation of methanol and characterised using X-ray ... As the concentration of methoxy diminishes, so the mechanism reverts to a decomposition pathway ..... Catalysis Reviews: Science and Engineering 41.

  20. Cook Inlet Planning Area oil and gas lease sale 149: Final environmental impact statement. Volume 1

    International Nuclear Information System (INIS)

    1996-01-01

    This environmental impact statement (EIS) discusses a proposed oil and gas lease sale in the Cook Inlet Planning Area, analyzes its potential effects on the environment, describes alternatives, presents major issues determined through the scoping process and staff analyses, and evaluates potential mitigating measures. Descriptions of the (1) leasing and scoping process are given in Section 1, (2) alternatives and mitigating measures in Section 2, and (3) description of the environment in Section 3. The potential effects of the lease sale are analyzed in Section 4. Alternative 1, the proposed action, is based on offering for lease 402 blocks (approximately 0.8 million hectares--1.98 million acres) in lower Cook Inlet that range from about 5 to 50 kilometers (3 to 25 mi) offshore. Alterative 2 (No Lease Sale) would cancel the proposed lease sale tentatively scheduled for April 1996. Alternative 2 (Delay the Sale) would delay the proposed sale for 2 years. Alternatives 4, 5, 6, 7, 8, and 9 would defer from leasing areas adjacent to the lower Cook Inlet and northwestern Shelikof Strait: the size of areas deferred ranges from about 5 to 45% of the area proposed for Alternative 1. After a thorough review, the Secretary of the Interior will decide which alternative or combination of alternatives will be included in the Notice of Sale

  1. Cook Inlet Planning Area oil and gas lease sale 149: Final environmental impact statement. Volume 2

    International Nuclear Information System (INIS)

    1996-01-01

    This environmental impact statement discusses a proposed oil and gas lease sale in the Cook Inlet Planning Area, analyzes its potential effects on the environment, describes alternatives, presents major issues determined through the scoping process and staff analyses, and evaluates potential mitigating measures. During the Draft Environmental Impact Statement comment period, written statements and oral testimonies were provided by various governmental agencies, organizations, businesses, and individuals. This report contains a review and analysis of comments received on the above issues. Appendices are included which contain resource estimates and various issues relating to oil spills

  2. 149 APPLICATION OF TREATIES IN NIGERIA VIS-À-VIS THE ...

    African Journals Online (AJOL)

    Fr. Ikenga

    instruments that deal with labour rights. The paper discusses the .... voting on codification texts had lately produced unsatisfactory results. In fact, all ... 5, 6 and 12 of the African Charter on Human and Peoples' Rights (Ratification and Enforcement). Act Cap 10 Laws ... They had petitioned the Inter-American Commission on.

  3. Flight test report Focke Wulf Piaggio P149D-TP 2015

    CSIR Research Space (South Africa)

    Barker, D

    2015-09-01

    Full Text Available • Outboard • Mid span • Ferry Tank Nose U/C Basic Autopilot O2 System Cockpit Modifications Walter 601D TurboProp Walter M601D Engine • designed for remote/rugged operations. • minimal field maintenance requirements • Maintenance between...

  4. 17 CFR 1.49 - Denomination of customer funds and location of depositories.

    Science.gov (United States)

    2010-04-01

    ...) Money center country. This term means Canada, France, Italy, Germany, Japan, and the United Kingdom. (2...) A bank or trust company; (ii) A futures commission merchant registered as such with the Commission..., must be: (i) A bank or trust company: (A) That has in excess of $1 billion of regulatory capital; or (B...

  5. SOR/92-149 - 27 February 1992 - AECB Cost Recovery Fees Regulations, amendment

    International Nuclear Information System (INIS)

    1992-01-01

    The AECB began in 1990 to charge fees for the registration of each user of a certified package for the transport radioactive materials. This amendment was made to simplify the registration procedure. (NEA)

  6. December, 2013 ISSN 1119-944X 149 Perception of Agricultural ...

    African Journals Online (AJOL)

    ONIKOYI

    Postgraduate Students of Agriculture in Selected Universities in. South-West ... The study investigated perception of agricultural extension as a career among ... Human being must earn a living in order to meet the basic needs for foods, shelter ... comprehensive programme of services deliberately put in place for expanding,.

  7. Shade factors for 149 taxa of in-leaf urban trees in the USA

    Science.gov (United States)

    E. Gregory McPherson; Qingfu Xiao; Natalie S. van Doorn; Nels Johnson; Shannon Albers; Paula J. Peper

    2018-01-01

    Shade factors, defined as the percentage of sky covered by foliage and branches within the perimeter of individual tree crowns, have been used to model the effects of trees on air pollutant uptake, building energy use and rainfall interception. For the past 30 years the primary source of shade factors was a database containing values from 47 species. In most...

  8. Résultats de recherche | Page 149 | CRDI - Centre de recherches ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    La subvention permettra au Conseil des gouverneurs du CRDI de commander huit documents devant faire l'objet d'un examen par des pairs à d'éminents penseurs, afin de mettre en lumière les changements qui surviennent à l'échelle de la planète et les. Projet.

  9. Kitonde et al., Afr J Tradit Complement Altern Med. (2013) 10 (1):149 ...

    African Journals Online (AJOL)

    AJTCAM

    expression on C. albicans, function as selective transport system used to expel wastes and compounds that are otherwise deleterious to the cell; a function called efflux which is medically important in that, it allows micro-organisms to oust antimicrobial medications that are made to destroy them and therefore render them ...

  10. 149 Résumé Notre article se propose d'analyser le travail des ...

    African Journals Online (AJOL)

    8 juil. 2008 ... ... la dynamique de l'économie informelle, c'est le rapport à la loi qui est décisif… » ... qui très souvent, pour ne pas dire systématiquement, attire le con- sensus chez ceux qui .... des secteurs modernes…» (A.Invernizzi.

  11. Digital Forensics and Born-Digital Content in Cultural Heritage Collections. CLIR Publication No. 149

    Science.gov (United States)

    Kirschenbaum, Matthew G.; Ovenden, Richard; Redwine, Gabriela

    2010-01-01

    The purpose of this report is twofold: first, to introduce the field of digital forensics to professionals in the cultural heritage sector; and second, to explore some particular points of convergence between the interests of those charged with collecting and maintaining born-digital cultural heritage materials and those charged with collecting…

  12. 26 CFR 1.149(e)-1 - Information reporting requirements for tax-exempt bonds.

    Science.gov (United States)

    2010-04-01

    ... filed with respect to the issue. In the case of any constitutional home rule city (as defined in section 146(d)(3)(C)), the preceding sentence is applied by substituting “city” for “state” and “chief... an extension of time to file any form or attachment required under this section if the Commissioner...

  13. : tous les projets | Page 149 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: HEALTH EXPENDITURE, SMOKING, TOBACCO, RESPIRATORY DISEASES, CARDIOVASCULAR DISEASES, TUBERCULOSIS, SOUTHEAST ASIA. Région: Cambodia, Far East Asia, Central Asia, South Asia. Programme: Alimentation, environnement et santé. Financement total : CA$ 67,400.00. Coût des soins de ...

  14. Ali et al., Afr J Tradit Complement Altern Med. (2015) 12(2):149-154 ...

    African Journals Online (AJOL)

    Proff.Adewunmi

    Background: Fenugreek (Trigonella foenum graecum L) is receiving global attention as a functional food due to its unique nutritional and medicinal properties ... These fibrous components bind to the toxins present in food and help to protect the colon mucus membrane from cancer causing .... condition, agricultural. Table 1: ...

  15. 75 FR 6380 - Provo River Project Rate Order No. WAPA-149

    Science.gov (United States)

    2010-02-09

    ... kilowatts. The PRP power is marketed according to a marketing plan that was approved and published in the Federal Register on November 21, 1994. This marketing plan allows Western to market the output of the PRP to customers of Utah Municipal Power Agency, Utah Associated Municipal Power Systems, and Heber Light...

  16. Ali et al., Afr J Tradit Complement Altern Med. (2015) 12(2):149-154 ...

    African Journals Online (AJOL)

    Proff.Adewunmi

    1Department of Food Science and Nutrition, 2Department of Crop Sciences, College of Agricultural and Marine Sciences,. Sultan Qaboos University, P.O. Box 34, PC 123, Al-Khoud, Muscat, Oman. ..... acute poisoning in humans and animals is relatively rare under normal ... components for improved human health benefits.

  17. 75 FR 149 - Notice of Public Information Collection Being Reviewed by the Federal Communications Commission...

    Science.gov (United States)

    2010-01-04

    ... employees. The FCC may not conduct or sponsor a collection of information unless it displays a currently... find it difficult to do so within the period of time allowed by this notice, you should advise the... requirements, rate of return and price caps, and provides an improved basis for auditing and other oversight...

  18. SU-E-J-149: Secondary Emission Detection for Improved Proton Relative Stopping Power Identification

    Energy Technology Data Exchange (ETDEWEB)

    Saunders, J; Musall, B; Erickson, A [Georgia Institute of Technology, Atlanta, GA (Georgia)

    2015-06-15

    Purpose: This research investigates application of secondary prompt gamma (PG) emission spectra, resulting from nuclear reactions induced by protons, to characterize tissue composition along the particle path. The objective of utilizing the intensity of discrete high-energy peaks of PG is to improve the accuracy of relative stopping power (RSP) values available for proton therapy treatment planning on a patient specific basis and to reduce uncertainty in dose depth calculations. Methods: In this research, MCNP6 was used to simulate PG emission spectra generated from proton induced nuclear reactions in medium of varying composition of carbon, oxygen, calcium and nitrogen, the predominant elements found in human tissue. The relative peak intensities at discrete energies predicted by MCNP6 were compared to the corresponding atomic composition of the medium. Results: The results have shown a good general agreement with experimentally measured values reported by other investigators. Unexpected divergence from experimental spectra was noted in the peak intensities for some cases depending on the source of the cross-section data when using compiled proton table libraries vs. physics models built into MCNP6. While the use of proton cross-section libraries is generally recommended when available, these libraries lack data for several less abundant isotopes. This limits the range of their applicability and forces the simulations to rely on physics models for reactions with natural atomic compositions. Conclusion: Current end-of-range proton imaging provides an average RSP for the total estimated track length. The accurate identification of tissue composition along the incident particle path using PG detection and characterization allows for improved determination of the tissue RSP on the local level. While this would allow for more accurate depth calculations resulting in tighter treatment margins, precise understanding of proton beam behavior in tissue of various compositions is necessary requiring detailed simulations with a high degree of accuracy.

  19. 7 CFR 58.149 - Alternate quality control programs for dairy products.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Alternate quality control programs for dairy products... for dairy products. (a) When a plant has in operation an acceptable quality control program which is... (CONTINUED) REGULATIONS AND STANDARDS UNDER THE AGRICULTURAL MARKETING ACT OF 1946 AND THE EGG PRODUCTS...

  20. Subcoulomb fusion of 16O in odd Sm isotopes

    International Nuclear Information System (INIS)

    Pacheco, A.J.

    1989-01-01

    Cross sections for the formation of evaporation residues were measured for the reaction of 16 O with the odd 147 Sm and 149 Sm nuclei at near barrier energies. The results are well described by statistical model calculations. Fusion cross sections as a function of energy do not show any unusual behaviour that could be attributed to the presence of unpaired nucleons. An analysis based on a one-dimensional penetration model that includes the effect of permanent quadrupolar deformations shows that the extracted values of the parameter β 2 follow the systematics established by the rest of the even samarium isotopes. The dependence of β 2 on the mass of the target nucleus indicates that the influence exerted by collective aspects upon the subbarrier fusion process increases rapidly as a function of the number of neutrons added to the spherical semimagic 144 Sm nucleus. (Author) [es

  1. Processing of composites based on NiO, samarium-doped ceria and carbonates (NiO-SDCC as anode support for solid oxide fuel cells

    Directory of Open Access Journals (Sweden)

    Lily Siong Mahmud

    2017-09-01

    Full Text Available NiO-SDCC composites consisting of NiO mixed with Sm-doped ceria (SDC and carbonates (Li2CO3 and Na2CO3 were sintered at different temperatures and reduced at 550 °C. The influence of reduction on structure of the NiO-SDCC anode support for solid oxide fuel cells (SOFCs was investigated. Raman spectra of the NiO-SDCC samples sintered at 500, 600 and 700 °C showed that after reducing at 550 °C NiO was reduced to Ni. In addition, SDC and carbonates (Li2CO3 and Na2CO3 did not undergo chemical transformation after reduction and were still detected in the samples. However, no Raman modes of carbonates were identified in the NiO-SDCC pellet sintered at 1000 °C and reduced at 550 °C. It is suspected that carbonates were decomposed at high sintering temperature and eliminated due to the reaction between the CO32– and hydrogen ions during reduction in humidified gases at 550 °C. The carbonate decomposition increased porosity in the Ni-SDCC pellets and consequently caused formation of brittle and fragile structure unappropriated for SOFC application. Because of that composite NiO-SDC samples without carbonates were also analysed to determine the factors affecting the crack formation. In addition, it was shown that the different reduction temperatures also influenced the microstructure and porosity of the pellets. Thus, it was observed that Ni-SDC pellet reduced at 800 °C has higher electrical conductivity of well-connected microstructures and sufficient porosity than the pellet reduced at 550 °C.

  2. Rare earth elements in the aragonitic shell of freshwater mussel Corbicula fluminea and the bioavailability of anthropogenic lanthanum, samarium and gadolinium in river water

    International Nuclear Information System (INIS)

    Merschel, Gila; Bau, Michael

    2015-01-01

    High-technology metals — such as the rare earth elements (REE) — have become emerging contaminants in the hydrosphere, yet little is known about their bioavailability. The Rhine River and the Weser River in Germany are two prime examples of rivers that are subjected to anthropogenic REE input. While both rivers carry significant loads of anthropogenic Gd, originating from contrast agents used for magnetic resonance imaging, the Rhine River also carries large amounts of anthropogenic La and lately Sm which are discharged into the river from an industrial point source. Here, we assess the bioavailability of these anthropogenic microcontaminants in these rivers by analyzing the aragonitic shells of the freshwater bivalve Corbicula fluminea. Concentrations of purely geogenic REE in shells of comparable size cover a wide range of about one order of magnitude between different sampling sites. At a given sampling site, geogenic REE concentrations depend on shell size, i.e. mussel age. Although both rivers show large positive Gd anomalies in their dissolved loads, no anomalous enrichment of Gd relative to the geogenic REE can be observed in any of the analyzed shells. This indicates that the speciations of geogenic and anthropogenic Gd in the river water differ from each other and that the geogenic, but not the anthropogenic Gd is incorporated into the shells. In contrast, all shells sampled at sites downstream of the industrial point source of anthropogenic La and Sm in the Rhine River show positive La and Sm anomalies, revealing that these anthropogenic REE are bioavailable. Only little is known about the effects of long-term exposure to dissolved REE and their general ecotoxicity, but considering that anthropogenic Gd and even La have already been identified in German tap water and that anthropogenic La and Sm are bioavailable, this should be monitored and investigated further. - Highlights: • Corbicula fluminea shells are bioarchives of dissolved geogenic REE in rivers. • Anthropogenic La and Sm in the Rhine River are bioavailable, hence incorporated. • Anthropogenic Gd from contrast agents is not incorporated, i.e. not bioavailable. • REE concentrations in Corbicula shells decrease with increasing size, i.e. age

  3. Rare earth elements in the aragonitic shell of freshwater mussel Corbicula fluminea and the bioavailability of anthropogenic lanthanum, samarium and gadolinium in river water

    Energy Technology Data Exchange (ETDEWEB)

    Merschel, Gila, E-mail: g.merschel@jacobs-university.de; Bau, Michael

    2015-11-15

    High-technology metals — such as the rare earth elements (REE) — have become emerging contaminants in the hydrosphere, yet little is known about their bioavailability. The Rhine River and the Weser River in Germany are two prime examples of rivers that are subjected to anthropogenic REE input. While both rivers carry significant loads of anthropogenic Gd, originating from contrast agents used for magnetic resonance imaging, the Rhine River also carries large amounts of anthropogenic La and lately Sm which are discharged into the river from an industrial point source. Here, we assess the bioavailability of these anthropogenic microcontaminants in these rivers by analyzing the aragonitic shells of the freshwater bivalve Corbicula fluminea. Concentrations of purely geogenic REE in shells of comparable size cover a wide range of about one order of magnitude between different sampling sites. At a given sampling site, geogenic REE concentrations depend on shell size, i.e. mussel age. Although both rivers show large positive Gd anomalies in their dissolved loads, no anomalous enrichment of Gd relative to the geogenic REE can be observed in any of the analyzed shells. This indicates that the speciations of geogenic and anthropogenic Gd in the river water differ from each other and that the geogenic, but not the anthropogenic Gd is incorporated into the shells. In contrast, all shells sampled at sites downstream of the industrial point source of anthropogenic La and Sm in the Rhine River show positive La and Sm anomalies, revealing that these anthropogenic REE are bioavailable. Only little is known about the effects of long-term exposure to dissolved REE and their general ecotoxicity, but considering that anthropogenic Gd and even La have already been identified in German tap water and that anthropogenic La and Sm are bioavailable, this should be monitored and investigated further. - Highlights: • Corbicula fluminea shells are bioarchives of dissolved geogenic REE in rivers. • Anthropogenic La and Sm in the Rhine River are bioavailable, hence incorporated. • Anthropogenic Gd from contrast agents is not incorporated, i.e. not bioavailable. • REE concentrations in Corbicula shells decrease with increasing size, i.e. age.

  4. Development of a methodology for the separation of europium and samarium from a mixture of rare earth oxides by electroreduction/ precipitation

    International Nuclear Information System (INIS)

    Chepcanoff, Vera

    2006-01-01

    The rare earths (RE) were first used in 1903, when Welsbach developed a lighter that is still used today. Nowadays, the RE are employed in many different fields, as in the production of super-alloys , as catalysts for petroleum industry, in the manufacture of non-ferrous alloys, color television tubes, x-ray screens, special glasses, ceramics, computer industries, nuclear medicine, lasers, pigments, etc., moving, in the last decade , a market of US$ 2 billions per year. Due to their similar properties, the RE elements are very difficult to separate, requiring complex processes, what make the products very expensive. Elements like Eu and Sm, which contents in the minerals are low (0.05% and 2.0%, respectively, in monazite) are extremely expensive, but their field of application justifies the research for looking for other processes, more simple and/or more effective. Trivalent state is a characteristic of all RE, but some of them presents oxidation state +2, like Ce, Eu, Sm and Yb. In the case of Eu and Sm, the focus of the present work, the divalent state is achieved by electro-reduction in the potentials -0.65 and -1.55 (SCE), respectively. This makes possible the separation of these elements from the other rare earths and from each other. Thus, making use of this characteristic, a process for the individual separation of Eu and Sm in (NH 4 ) 2 SO 4 solution by electro-reduction/precipitation is proposed, where Sm is first separated from the solution as sulfate, and Eu, that remains in the solution, is precipitated after the decrease of temperature and potential applied. The process developed from a synthetic Eu and Sm solution was applied to a mixture of semi-heavy RE oxide, produced at IPEN-CNEN/SP, obtaining the separation of Sm. This product was analyzed by spectrophotometry, showing high purity. (author)

  5. Study of toxicity of Samarium-153-EDTMP in the treatment of painful skeletal metastasis. Final report for the period 15 December 1996 - 14 December 1997

    International Nuclear Information System (INIS)

    Zhu Shoupeng

    1998-02-01

    Favourable characteristics of Sm-153 EDTMP make it an effective agent for use in the palliative treatment of metastatic bone pain. It has also been postulated that Sm-153 might have some tumoricidal effect. But until today its mechanism of action in the treatment of skeletal metastasis is not known. This experimental study has been designed to study the cellular and molecular changes occurring in the bone tumour cells (osteosarcoma of femur of wister rats) following irradiation with different doses of Sm-153 EDTMP. Experimental osteosarcorna tumour cells were harvested and treated with Sm-153 EDTMP over different periods of time ranging from 1-24 hours. Electron microscope, fluorescence microscope, MTI assay and 3 HTdR release assay studies were conducted to observe for effects of radiation. Sm-153 EDTMP irradiation of bone tumour cells resulted in significant nuclear fragmentation, margination of condensed chromatin, marked pyknosis and increased formation of membrane bounded apoptotic bodies formation. The quantification analysis of fragmented DNA for bone tumour cells induced by Sm-153 EDTMP showed that the DNA fragmentation was enhanced with prolongation of irradiation time. The inhibition rate of proliferation of bone tumour cells as well as DNA fragmentation in bone tumour cells after irradiation with Sm-153 EDTMP increased significantly and progressively with prolongation of irradiation time, reaching levels of 63% and 78% respectively by 24 hours. (author)

  6. Morphology and orientation of β-BaB{sub 2}O{sub 4} crystals patterned by laser in the inside of samarium barium borate glass

    Energy Technology Data Exchange (ETDEWEB)

    Nishii, Akihito; Shinozaki, Kenji; Honma, Tsuyoshi; Komatsu, Takayuki, E-mail: komatsu@mst.nagaokaut.ac.jp

    2015-01-15

    Nonlinear optical β-BaB{sub 2}O{sub 4} crystal lines (β-BBO) were patterned in the inside of 8Sm{sub 2}O{sub 3}–42BaO–50B{sub 2}O{sub 3} glass by irradiations of continuous-wave Yb:YVO{sub 4} lasers with a wavelength of 1080 nm (power: P=0.8–1.0 W, scanning speed: S=0.2–2.5 μm/s), in which the laser focal position was moved gradually from the surface to the inside. The morphology, size, and orientation of β-BBO crystals were examined from polarization optical microscope and birefringence imaging observations. It was demonstrated that c-axis oriented β-BBO crystals with long lengths (e.g., 20 mm) were patterned in the inside of the glass. The morphology of β-BBO in the cross-section of lines was a rectangular shape with rounded corners, and the volume of β-BBO formed increased with increasing laser power and with decreasing laser scanning speed. The maximum depth in the inside from the surface for β-BBO patterning increased with increasing laser power, e.g., D{sub max}∼100 μm at P=0.8 W, D{sub max}∼170 μm at P=0.9 W, and D{sub max}∼200 μm at P=1 W. The present study proposes that the laser-induced crystallization opens a new door for applied engineering in glassy solids. - Graphical abstract: This figure shows the POM photographs for β-BaB{sub 2}O{sub 4} crystal lines patterned by cw Yb:YVO{sub 4} fiber laser irradiations with a laser power of P=0.8 W and a laser scanning speed S=2 μm/s in the glass. The laser focal point was moved gradually from the surface into the inside. The results shown in Fig. 1 demonstrate that it is possible to pattern highly oriented β-BaB{sub 2}O{sub 4} crystals even in the inside of glasses. - Highlights: • β-BaB{sub 2}O{sub 4} crystal lines were patterned in the inside of a glass by lasers. • Laser focal position was moved gradually from the surface to the inside. • Birefringence imaging was observed. • Morphology, size, and orientation of crystals were clarified. • Crystal lines with long lengths (e.g., 20 mm) were patterned at the depth of 200 μm.

  7. Mechanically induced strong red emission in samarium ions doped piezoelectric semiconductor CaZnOS for dynamic pressure sensing and imaging

    Science.gov (United States)

    Wang, Wei; Peng, Dengfeng; Zhang, Hanlu; Yang, Xiaohong; Pan, Caofeng

    2017-07-01

    Piezoelectric semiconductor with optical, electrical and mechanical multifunctions has great potential applications in future optoelectronic devices. The rich properties and applications mainly encompass the intrinsic structures and their coupling effects. Here, we report that lanthanide ions doped piezoelectric semiconductor CaZnOS:Sm3+ showing strong red emission induced by dynamic mechanical stress. Under moderate mechanical load, the doped piezoelectric semiconductor exhibits strong visible red emission to the naked eyes even under the day light. A flexible dynamic pressure sensor device is fabricated based on the prepared CaZnOS:Sm3+ powders. The mechanical-induced emission properties of the device are investigated by the optical fiber spectrometer. The linear characteristic emissions are attributed to the 4G5/2→6H5/2 (566 nm), 4G5/2→6H7/2 (580-632 nm), 4G5/2→6H9/2 (653-673 nm) and 4G5/2→6H11/2 (712-735 nm) f-f transitions of Sm3+ ions. The integral emission intensity is proportional to the value of applied pressure. By using the linear relationship between integrated emission intensity and the dynamic pressure, the real-time pressure distribution is visualized and recorded. Our results highlight that the incorporation of lanthanide luminescent ions into piezoelectric semiconductors as smart materials could be applied into the flexible mechanical-optical sensor device without additional auxiliary power, which has great potential for promising applications such as mapping of personalized handwriting, smart display, and human machine interface.

  8. Investigation of nuclei near N = 82 and Z = 64 VIA radioactive decay of high-spin isomers

    International Nuclear Information System (INIS)

    Toth, K.S.

    1979-01-01

    An island of very high spin isomers was found recently in neutron-deficient Gd-Lu nuclei near the N = 82 closed shell in (H.I.,xn) measurements. This exciting discovery has led to a large number of experiments trying to identify the structures of these isomers and the nuclei in which they occur. These attempts have been helped in many instances by available spectroscopic information at low excitation energies. A systematic investigation of the low-lying structure of nuclei near N = 82 and Z greater than or equal to 64 was carried out. Heavy-ion beams were used to produce proton-rich isotopes which were then transported, with the use of gas-jet systems, to shielded areas where singles and coincidence γ-ray measurements could be made. Earlier investigations dealt with the decay of terbium ( 146-149 Tb) and dysprosium ( 147-152 Dy) nuclei. During the past two years the research program was extended to holmium nuclides (A less than or equal to 152) produced in 10 B bombardments of samarium. Two new isotopes, 149 Ho and 148 Ho, were identified. The decay data of 21-s 149 Ho supplement in-beam results and locate the hg/ 2 neutron state in 149 Dy to be at 1091 keV. The most intense γ-ray associated with 9-s 148 Ho has an energy of 1688 keV. It is possibly the first-excited to ground-state transition in 148 Dy. Recent in-beam measurements have shown that the first-excited state in 146 Gd is, unespectedly, 3 - in contrast to doubly evenN = 82 nuclei below gadolinium where it is 2 + . It would be interesting to determine whether the 1688-keV level in 148 Dy, the next nucleus in this isotonic series, is 2reverse arrow or 3 - in character. 12 references

  9. 34 CFR 668.149 - Special provisions for the approval of assessment procedures for special populations for whom no...

    Science.gov (United States)

    2010-07-01

    ... procedure or instrument measures both basic verbal and quantitative skills at the secondary school level. (2... recommended by the test developer, provided that the test administrator— (i) Uses those procedures or... verbal and quantitative skills at the secondary school level; and (4) The passing scores and the methods...

  10. Performance of a 14.9-kW laminated-frame dc series motor with chopper controller

    Science.gov (United States)

    Schwab, J. R.

    1979-01-01

    Traction motor using two types of excitation: ripple free dc from a motor generator set for baseline data and chopped dc as supplied by a battery and chopper controller was tested. For the same average values of input voltage and current, the power output was independent of the type of excitation. At the same speeds, motor efficiency at low power output (corresponding to low duty cycle of the controller) was 5 to 10 percentage points less on chopped dc than on ripple-free dc. This illustrates that for chopped waveforms, it is incorrect to calculate input power as the product of average voltage and average current. Locked-rotor torque, no load losses, and magnetic saturation data were so determined.

  11. Archeological Testing at Two Sites Near White Castle, Iberville Parish, Louisiana: 16 IV 147 and 16 IV 149

    Science.gov (United States)

    1988-07-26

    styraciflua), green ash (Fraxinus pennsylvania), nutall oak (Quercus nutalli), water oak (Quercus arkansana), elm (Ulmus), and pecan (Carya illinoensis) may...Cotton production lessened, while rice, corn, fruit and pecans increased (Iberville Parish Planning Board 1945). Livestock breeding increased during the...glazed ware manufactured in France. Similar wares from Holland and England are known as delft. Equivalents in Italy , Iberia, and Mexico are called

  12. SU-E-J-149: Establishing the Relationship Between Pre-Treatment Lung Ventilation, Dose, and Toxicity Outcome

    International Nuclear Information System (INIS)

    Mistry, N; D'Souza, W; Sornsen de Koste, J; Senan, S

    2014-01-01

    Purpose: Recently, there has been an interest in incorporating functional information in treatment planning especially in thoracic tumors. The rationale is that healthy lung regions need to be spared from radiation if possible to help achieve better control on toxicity. However, it is still unclear whether high functioning regions need to be spared or have more capacity to deal with the excessive radiation as compared to the compromised regions of the lung. Our goal with this work is to establish the tools by which we can establish a relationship between pre-treatment lung function, dose, and radiographic outcomes of lung toxicity. Methods: Treatment planning was performed using a single phase of a 4DCT scan, and follow-up anatomical CT scans were performed every 3 months for most patients. In this study, we developed the pipeline of tools needed to analyze such a large dataset, while trying to establish a relationship between function, dose, and outcome. Pre-treatment lung function was evaluated using a recently published technique that evaluates Fractional Regional Ventilation (FRV). All images including the FRV map and the individual follow-up anatomical CT images were all spatially matched to the planning CT using a diffusion based Demons image registration algorithm. Change in HU value was used as a metric to capture the effects of lung toxicity. To validate the findings, a radiologist evaluated the follow-up anatomical CT images and scored lung toxicity. Results: Initial experience in 1 patient shows a relationship between the pre-treatment lung function, dose and toxicity outcome. The results are also correlated to the findings by the radiologist who was blinded to the analysis or dose. Conclusion: The pipeline we have established to study this enables future studies in large retrospective studies. However, the tools are dependent on the fidelity of 4DCT reconstruction for accurate evaluation of regional ventilation. Patent Pending for the technique presented in this work to evaluate FRV incorporating mass correction

  13. SU-E-T-149: Electron Beam Profile Differences Between Elekta MLCi2 and Elekta Agility Treatment Heads

    Energy Technology Data Exchange (ETDEWEB)

    Wu, C [Sutter Medical Foundation, Roseville, CA 95661 (United States); Hatcher, C [Sutter Shared Services S3, Sacramento, CA (United States)

    2014-06-01

    Purpose: To report and investigate observed differences in electron beam profiles at various energies/applicators between Elekta MLCi2 and Agility treatment head on Elekta Infinity LINAC Methods: When we upgraded from MLCi2 to Agility on one of our Elekta Infinity LINAC's, electron beam PDDs and profiles were acquired for comparison purpose. All clinical electron energies (6/9/12/15/12/18 MeV) and electron applicators (6/10/14/20/25 square) were included in measurement. PDDs were acquired at 100 SSD in water (PTW MP3 water tank) with a plane-parallel ion chamber (PTW Roos). X and Y Profiles were acquired using IC Profiler (Sun Nuclear Corp.) at 1cm and maximum PDD depths (water equivalent). Results: All PDD curves match very well between MLCi2 and Agility treatment head. However, some significant differences on electron profiles were found. On Agility, even after increasing the default auto-tracking offset values for backup diaphragms in Y and MLC in X by 2.8 cm (the maximum allowed change is 3.0 cm), electron profiles still have rounder shoulders comparing to corresponding MLCi2 profiles. This difference is significantly more pronounced at larger applicators (20 and 25 square), for all electron energies. Conclusion: The significant design change between MLCi2 and Agility beam limiting device seems to affect exit electron beam profiles. In IEC1217 X direction, the main change on Agility is the removal of the original MLCi2 X backup diaphragms and replacing it with MLC leaves; In Y direction, the main change is the radius and materials on Y backup diaphragms.

  14. 149 Does Ranking of Surgeons in a Publicly Available Online Platform Correlate With Objective Outcomes?

    Science.gov (United States)

    Bekelis, Kimon; Missios, Symeon; Coy, Shannon Michael; Johnson, Jeremiah N

    2016-08-01

    The accuracy of public reporting in health care, especially from private vendors, remains an issue of debate. We investigated the association of the publicly reported physician complication rates in an online platform with real-world adverse outcomes of the same physicians for patients undergoing posterior lumbar fusion. We performed a cohort study involving physicians performing posterior lumbar fusions from 2009 to 2013, who were registered in the Statewide Planning and Research Cooperative System (SPARCS) database. This cohort was merged with publicly available data over the same time period from ProPublica, a private company. Mixed-effects multivariable regression models were used to investigate the association of publicly available complication rates with the rate of discharge to a facility, length of stay (LOS), mortality, and hospitalization charges for the same surgeons. During the selected study period, there were 8457 patients in New York State who underwent posterior lumbar fusion by the 56 surgeons who were represented in the ProPublica Surgeon Scorecard over the same time. Using a mixed-effects multivariable regression model, we demonstrated that publicly reported physician level complication rates were not associated with the rate of discharge to a facility (odds ratio [OR], 0.97; 95% confidence interval [CI], 0.72-1.31), LOS (adjusted difference, -0.1; 95% CI, -0.5 to 0.2), mortality (OR, 0.87; 95% CI, 0.49-1.55), and hospitalization charges (adjusted difference, $18 735; 95% CI, -$59 177 to $96 647). Similarly, no association was observed when utilizing propensity score-adjusted models, and when restricting the cohort to a predefined subgroup of Medicare patients. After merging a comprehensive all-payer posterior lumbar fusion cohort in New York State with data from the ProPublica Surgeon Scorecard over the same time period, we observed no association of publically available physician complication rates with objective outcomes.

  15. 27 CFR 478.149 - Armor piercing ammunition manufactured or imported for the purpose of testing or experimentation.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false Armor piercing ammunition... Armor piercing ammunition manufactured or imported for the purpose of testing or experimentation. The provisions of §§ 478.37 and 478.99(d) with respect to the manufacture or importation of armor piercing...

  16. 11 CFR 100.149 - Voter registration and get-out-the-vote activities for Presidential candidates.

    Science.gov (United States)

    2010-01-01

    ... conditions are met: (a) Exemption not applicable to general public communication or political advertising..., billboard, direct mail, or similar type of general public communication or political advertising. For... a political party of the costs of voter registration and get-out-the-vote activities conducted by...

  17. An experiment using neutron activation analysis and a rare earth element to mark cotton plants and two insects that feed on them

    Energy Technology Data Exchange (ETDEWEB)

    Showler, Allan T. [USDA-ARS IFNRRU, Kika de la Garza Subtropical Agricultural Research Center, 2413 East Highway 83, Weslaco, TX 78596 (United States)]. E-mail: ashowler@weslaco.ars.usda.gov; James, William D. [Elemental Analysis Laboratory, 3144 Texas A and M University, College Station, TX 77843-3144 (United States); Armstrong, John S. [USDA-ARS BIRU, Kika de la Garza Subtropical Agricultural Research Center, 2413 East Highway 83, Weslaco, TX 78596 (United States); Westbrook, John K. [USDA-ARS APMRU, 2771 F and B Road, College Station, TX 77845-4966 (United States)

    2006-08-15

    Studies on insect dispersal and other behaviors can benefit from using markers that will not alter flight and fitness. Rare earth elements, such as samarium (Sm), have been used as ingested markers of some insects and detected using neutron activation analysis (NAA). In this study, samarium nitrate hexahydrate was mixed into artificial diet for boll weevils, Anthonomus grandis grandis Boheman (Coleoptera: Curculionidae), at different dosages and in water used to irrigate cotton, Gossypium hirsutum L. Samarium was detected in adult boll weevils fed on the samarium-labeled diet, but not after 5 or 10 days of being switched to non-labeled diet, even if the insects were given labeled diet for as long as 7 consecutive days. Introduced in irrigation water, 1% samarium (m/m) was detectable in cotton squares and leaf tissue. However, boll weevil adults fed samarium-labeled squares did not retain detectable levels of samarium, nor did boll weevil adults reared to adulthood from samarium-labeled squares. Fourth instar beet armyworms, Spodoptera exigua (Huebner) (Noctuidae: Lepidoptera), fed on samarium-labeled cotton leaves obtained enough samarium for NAA detection, but adult moths reared from them did not have detectable amounts of samarium. Although samarium can be useful as a marker when insects are presented with a continuous pulse of the label, elements that are assimilated by the insect would be more useful if a continuous infusion of the marker cannot be provided.

  18. Obtention of Samarium and Gadolinium concentrates by solvent extraction using mono-2-ethylhexyl ester of 2-ethylhexyl phosphonic acid; Obtencao de concentrados de samario e gadolinio via extracao por solventes com o ester mono-2-etilhexil do acido 2-etilhexilfosfonico

    Energy Technology Data Exchange (ETDEWEB)

    Miranda, Junior, Pedro

    1996-07-01

    The rare earth chlorides solution employed in this study, which is constituted by medium and heavy fractions, is derived from monazite processing accomplished by NUCLEMON-Mineroquimica (SP). This solution shows an acidity about 1.18 M and 189 g/L of rare earth oxides, containing as main constituents: Sm(34.55%), Gd(23.85%), Dy (6.82%), and Y (24.45%). It was used, as organic phase, 2-ethylhexyl phosphonic acid, mono-2-ethylhexylester diluted to 1 M in isododecane. (author)

  19. Fabrication of a new samarium(III) ion-selective electrode based on 3-{l_brace}[2-oxo-1(2h)-acenaphthylenyliden]amino{r_brace}-2-thioxo -1,3-thiazolidin-4-one

    Energy Technology Data Exchange (ETDEWEB)

    Zamani, Hassan Ali [Islamic Azad University, Quchan (Iran, islamic Republic of). Quchan Branch. Dept. of Chemistry]. E-mail: haszamani@yahoo.com; Ganjali, Mohammad Reza [Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of). Endocrine and Metabolism Research Center; Adib, Mehdi [University of Tehran, Tehran (Iran, Islamic Republic of). Faculty of Chemistry. Center of Excellence in Electrochemistry

    2007-07-01

    This paper introduces the development of an original PVC membrane electrode, based on 3-{l_brace}[2-oxo-1(2H)-acenaphthylenyliden]amino{r_brace}-2-thioxo-1,3-thiazolidin-4-one (ATTO) which has revealed to be a suitable carrier for Sm{sup 3+} ions. The resulting data illustrated that the electrode shows a Nernstian slope of 19.3 {+-} 0.6 mV per decade for Sm{sup 3+} ions over a broad working concentration range of 1.0 X 10{sup -6} to 1.0 X 10{sup -1} mol L{sup -1}. The lower detection limit was found to be equal to (5.5{+-} 0.3) X 10{sup -7} mol L{sup -}'1 in the pH range of 3.5-7.5, and the response time was very short ({approx}10 s). The potentiometric sensor displayed good selectivities for a number of cations such as alkali, alkaline earth, transition and heavy metal ions. (author)

  20. Direct determination of the samarium:neodymium ratio in geological materials by inductively coupled plasma quadrupole mass spectrometry with cryogenic desolvation. Comparison with isotope dilution thermal ionization mass spectrometry

    International Nuclear Information System (INIS)

    Pin, Christian; Telouk, Philippe; Imbert, J.-L.

    1995-01-01

    A cryogenic desolvation unit in the sample introduction system reduces differences in oxide formation between Sm and Nd to very low levels, enabling the direct, standardless determination of their ratio in bulk solutions by inductively coupled plasma mass spectrometry. The measured values are in reasonably good agreement with those determined by the isotope dilution thermal ionization mass spectrometry (ID-TIMS) reference technique. Although this method cannot, at present, compete with ID-TIMS in terms of precision and accuracy, it is much more straightforward and can be used in geochemistry for studies involving the screening of a large number of samples. (author)

  1. Poly(dl)lactic acid/polyglycolic acid/iron and poly(dl)lactic acid/polyglycolic acid/samarium cobalt composites for use as a delivery mechanism for magnetically directed chondrogenesis

    Science.gov (United States)

    Oppermann, Dean Alan

    Magnetically directed chondrogenesis (MDC) is a fundamental approach to articular cartilage repair. In MDC a magnet is implanted into the subchondral trabecular bone underlying a cartilage defect and used to attract chondrocytes, magnetically tagged with Fe nanoparticles, to the defect site. Pilot studies by Halpern, Crimp and Grande, using solid neodymium (Nd) magnets, indicated optimistic results by producing a hyaline-like articular cartilage after 8 weeks implantation. Since solid Nd magnets introduce long-term biocompatibility issues, the focus of this dissertation was to develop P(dl)A/PGA/Fe and P(dl)A/PGA/SmCo 5 implants for use in MDC. The effect of implant porosity, implant composition and magnetic material (Fe or SmCo5) on the initial and degraded magnetic properties were evaluated. The biocompatibility of P(dl)A/PGA/Fe implants were investigated by implantation into New Zealand white rabbits for 8 weeks. The effect of hydrogen peroxide (H2O2) and ethylene oxide (EO) sterilization techniques on the molecular weight and chemical structure of P(dl)A/PGA polymers were evaluated using gel permeation chromatography and Fourier transform infrared spectroscopy. The effect of implant morphology, size and number on the von Mises stress in the trabecular bone surrounding the implant was evaluated using a finite element model. In general, SmCo5 implants resulted in higher magnetic fields initially and after 8 weeks of degradation than comparable Fe implants. Increases in magnetic field strength were achieved by increasing the volume fraction of magnetic material and by increasing the PGA concentration. The magnetic field strength degradation rate decreased with increases in volume fraction of magnetic material and increases in PLA concentration. Implantation studies indicated that 50/50 P(dl)A/PGA were more bioactive than 75/25 P(dl)A/PGA with an increased cellular response that is specific to bone growth. The compressive strength and elastic modulus of porous implants were comparable to trabecular bone, and the compressive strength and elastic modulus of solid implants was higher than trabecular bone but less than cortical bone. Finite element modeling showed that the implantation of solid and porous P(dl)A/PGA/Fe implants did not significantly increase the von Mises stress concentration adjacent to the implant. The von Mises stress surrounding porous implants was higher than the solid implants which predicts faster bone remodeling. Comparing single implants to multiple implants indicated a significant decrease in von Mises stress between the implants. This would predict bone resorption in that area. H2O2 sterilization resulted in a gradual decrease in the molecular weight of P(dl)A/PGA polymers that was a result of hydrolytic scission of the ester bonds present between the individual monomers. The polymers were less affected by EO sterilization with only the 75/25 P(dl)A/PGA, indicating a decrease in molecular weight. From these results, it was concluded that solid 50/50 P(dl)A/PGA/SmCo 5 implants that span the entire width of the cartilage defect should be used to optimize the attraction potential and bioactivity of the implant. Also ethylene oxide, which caused less premature implant degradation, should be used for sterilization.

  2. Poison 1 - a programme for calculation of reactivity transients due to fission product poisoning and its application in continuous determination of xenon and samarium poisoning in reactor KS-150

    International Nuclear Information System (INIS)

    Rana, S.B.

    1973-12-01

    The report contains a user's description of the 3-dimensional programme POISON 1 for calculating reactivity transients due to fission-product poisoning during changes of reactor power. The chapter dealing with Xe poisoning contains a description of Xe tables, the method of operational determination of Xe poisoning, use of Xe transients for calibrating control rods and means of shutting down the reactor without being overriden by Xe poisoning. Sm poisoning is determined continuously on the basis of the power diagram of reactor operation. In conclusion a possibility of using the programme in a process computer in combination with self-powered detectors as local power sensors is indicated. (author)

  3. UABUC - Single energy point model burnup computer code for water reactors

    International Nuclear Information System (INIS)

    El-Meshad, Y.; Morsy, S.; El-Osery, I.A.

    1981-01-01

    UABUC is a single energy point reactor burnup computer program in FORTRAN language. The program calculates the change in the isotopic composition of the uranium fuel as a function of irradiation time with all its associated quantities such as the average point flux, the conversion ratio, macroscopic fuel cross sections, and the point reactivity profile. A step-wise time analytical solution was developed for the nonlinear first order burnup differential equations. The ''Westcott'' convention of the effective cross sections was used except for plutonium-240 and uranium-238. For plutonium-240, an effective microscopic cross section was derived from the direct physical arguments taking into account the selfshielding effect of plutonium-240 as well as the 1 ev. resonance absorption. For uranium-238, an effective cross section, reflecting the effect of fast fission and resonance absorption was used. The fission products were treated in the three groups with 50, 300, and 800 barns. The yields in the groups were treated as functions of the type of fissionable nuclides, the effective neutron temperature, and the epithermal index. Xenon-135 and Samarium-149 were treated separately as functions of irradiation time. (author)

  4. The relevance of rare earth elements to nuclear medicine

    International Nuclear Information System (INIS)

    Cox, P.H.

    1998-01-01

    Full text: The lanthanides are an interesting series of metallic elements which have almost identical chemical characteristics and which offer a variety of radioisotopes with differing energy spectra suitable for open source therapy. Their inorganic salts tend to form chemically and biological stable colloids which have proved to be useful for intercavity therapies, in particular for synovectomy. Yttrium-90 silicate is a standard product for large joints with a thick synovium whilst for smaller joints Erbium-169, with its shorter tissue penetration, is more widely used for smaller joints to reduce the risk of radiation induced bone necrosis. Recently the development of an inert biodegradable colloid, chitosan, labelled with Holmium 166. for intercavity therapy of cystic brain tumours has been reported. Yttrium-90 has been chelated to peptide and antibody fragments for tumour targeting as a potentially more effective radionuclide than Iodine-131. The search for alternatives to Strontium-89 for the palliative treatment of pain arising from bone metastases has led to the introduction of diphosphonate complexes of Samarium-153, Lutetium-177 and Holmium-166. These complexes are of special interest because the radionuclides can be produced economically in developing countries. Terbium-149, an alpha emitter, has been mentioned as a possible therapeutic radionuclide. Yttrium-90 and Holmium-166 can an both be made available as generator products which is an added potential advantage for developing nuclear medical applications

  5. Reactivity effects of fission product decay in PWRs

    International Nuclear Information System (INIS)

    Aragones, J.M.; Ahnert, C.

    1988-01-01

    The purpose of the work reported in this paper is to analyze the effects of fission product chains with radioactive decay on the reactivity in pressurized water reactor (PWR) cores, calculating their accumulation and absorption rates along fuel burnup at continuous operation and after shutdown periods extending from 1 day to a few months. The authors PWR version of the WIMS-D4 code is first used to obtain the individual number densities, absorption rates, and averaged cross sections for every nuclide of the fission product chains with significant decay rates, as a function of fuel burnup at continuous irradiation. Next, by an auxiliary ad hoc code, these data, have been processed together with the required one for fissile nuclides and boron, also taken from WIMS at each burnup step, to calculate the average or effective values relevant for the analysis and the decay and change in overall absorption after several shutdown times. (1) The reactivity effect of fission product decay changes significantly with the shutdown time. The maximum absorption increase by decay is reached in ∼ 10 days' shutdown. (2) The dependence with fuel type, enrichment, and burnup is slight, but the change with previous power density is nearly linear, which might be significant after coast-down in previous cycles. (3) For long shutdown periods, the overall reactivity effect of decay in the three fission product chains considered is much less than if only the samarium peak due to 149 Nd is considered

  6. Comment on "Astronomical constraints on the duration of the Early Jurassic Pliensbachian Stage and global climatic fluctuations" [Earth Planet. Sci. Lett. 455 (2016) 149-165

    Science.gov (United States)

    Smith, David G.; Bailey, Robin J.

    2018-01-01

    Astrochronology employs spectral analysis of stratigraphic data series to substantiate and quantify depositional cyclicity, and thus to establish a probable causal link between cases of rhythmic bedding and periodic orbitally-forced climate change. Vaughan et al. (2011 - not cited by Ruhl et al.) showed that the spectral methods conventionally used in cyclostratigraphy will generate false positive results - they will identify multiple cycles that are not present in the data. Tests with synthetic random datasets are both a simple and an essential way to prove this. Ruhl et al. (2016) used the methods to which these criticisms apply in their analysis of XRF-compositional data series from the Early Jurassic of the Mochras borehole, Wales. We use properly corrected methods to re-examine some of their data, showing that their spectral results are not valid, thus casting doubt on their proposed calibration of Pliensbachian time.

  7. Interest of the Ergo-Kit(®) for the clinical practice of the occupational physician. A study of 149 patients recruited in a rehabilitation program.

    Science.gov (United States)

    Caron, J; Ronzi, Y; Bodin, J; Richard, I; Bontoux, L; Roquelaure, Y; Petit, A

    2015-10-01

    Functional capacity evaluation is commonly used to assess the abilities of patients to perform some tasks. Ergo-Kit(®) is a validated tool assessing both functional capacities of patients and workplace demands. The objective of this study was to evaluate the relevance of the Ergo-Kit(®) data for occupational physicians during the return-to-work process. A retrospective and monocenter study was conducted on all patients included in a rehabilitation program and assessed with the Ergo-Kit(®) tool between 2005 and 2014. Workplace demands and patients' functional capacities were evaluated and confronted. Self-beliefs and perceived disability were also assessed and compared to the functional capacity evaluation. One hundred and forty-nine working-age patients (85 men, 64 women; 39±12 years) suffering from musculoskeletal disorders or other diseases were included. Main causes of mismatch between workplace demands and functional capacities were manual handling of loads, postures with arms away from the body and repetitive motions at work; sitting posture was correlated with a lesser physical workload; and Oswestry score was correlated with functional capacities evaluated by the Ergo-Kit(®). Ergo-Kit(®) is a relevant tool to assess the multidimensional aspects of workplace demands and functional capacities. It could be very helpful for occupational physicians to manage return-to-work. Copyright © 2015 Elsevier Masson SAS. All rights reserved.

  8. Pharmacokinetics of amoxicillin after oral administration in recently weaned piglets with experimentally induced Escherichia coli subtype O149 : F4 diarrhea

    DEFF Research Database (Denmark)

    Jensen, G.M.; Lykkesfeldt, J.; Frydendahl, K.

    2004-01-01

    Objective-To measure the effect of Escherichia coli subtype 0149:F4-induced diarrhea on the pharmacokinetics of orally administered amoxicillin in affected piglets relative to that of uninfected piglets. Animals-22 healthy 4-week-old recently weaned Danish crossbred piglets. Procedure-12 piglets...... were orally inoculated through gastric intubation with 10(9) CFUs of an E coli 0149:F4 strain and responded by developing diarrhea 12 to 16 hours later. Piglets were dosed with amoxicillin trihydrate solution (20 mg/kg) by gastric intubation. A control group of 10 age-matched piglets without signs...... that the concentration of the antimicrobial at the site of infection reflects the systemic concentration, higher doses of amoxicillin in the treatment of piglets with E coli 0149:F4-induced diarrhea may be appropriate....

  9. Aerospace Physiologist, AFSCs 43AX, M11XXY, and M122XY (Formerly AFSCs 916X, 149XA, and 229XY)

    Science.gov (United States)

    1993-12-01

    need arises, such as during hyperbaric and hypobaric chamber operations and specialized aerospace physiology classroom training requirements. xi 7... Hyperbaric And Hypobaric Chambers Little Rock AFB AK High Altitude Airdrop Mission Support (HAAMS) Holloman AFB NM Centrifuge Training Travis AFB CA... hypobaric , or hyperbaric chambers, etc.). Representative tasks which show the differentiation in time spent on duties among the DAFSC officers are

  10. Periscope Acuity at Night. 1. Central and Paracentral Acuity as a Function of Contrast and Adaptation. Volume 9, Pages 128-149

    Science.gov (United States)

    1950-11-28

    This paper presents an investigation of the capacity of the eye for discriminating a small target from its background tinder low levels of...ideal conditions in the Laboratory, using persons highly trained in this type of observation. This paper indicates the capacities and limita- tions...periscope. The targets were rectangular and subtended 1.0° x .33° of visual angle at 10 feet. -135- Five gray targets were used which were graded in

  11. A single-aliquot regenerative-dose method based on IR (1.49 eV) bleaching of the fast OSL component in quartz

    DEFF Research Database (Denmark)

    Jain, M.; Murray, A.S.; Bøtter-Jensen, L.

    2005-01-01

    In the optically stimulated luminescence (OSL) dating of quartz, the presence of significant medium and slow components in the initial-OSL signal (first 0.8 s or so) can give rise to erroneous dose estimates. Thus it is desirable to develop a dose estimation method that is based on the OSL from t...

  12. De herba lunatica (London, Wellcome Library, 573, f. 149v): edition and translation of a medieval opuscule on the magical properties of common moonwort (Botrychium lunaria Swartz)

    OpenAIRE

    Ferraces Rodríguez, Arsenio

    2014-01-01

    This article provides the first edition of a medieval text on the properties of a plant named herba lunatica. From the description of the plant found in this text as well as in other medieval sources, together with its iconographic representation on the lower margin of the manuscript, we propose its identification with the ‘Botrychium lunaria’ Swartz. The edition of the Latin text includes its translation into Spanish.

  13. Investigation of (n, 2n) reaction and fission rates in iron-shielded uranium samples bombarded by 14.9 MeV neutrons

    International Nuclear Information System (INIS)

    Shani, G.

    1976-01-01

    The effect of the thickness of iron shielding on the (n, 2n) reaction rate in a fusion reactor (hybrid) blanket is investigated. The results are compared with the fission rate-dependence. Samples of natural uranium are irradiated with 14 MeV neutrons, with iron slabs of various thickness between the neutron generator target and the samples. Both reactions are threshold reactions but the fact that the 238 U (n, 2n) reaction threshold is at 6 MeV and that of fission is at 2 MeV makes the ratio between the two very much geometry-dependent. Two geometrical effects take place, the 1/r 2 and the build-up. While the build-up affects the (n, 2n) reaction rate, the fission rate is affected more by the 1/r 2 effect. The reason is that both elastic and inelastic scattering end up with neutrons with energy above fission threshold, while only elastic scattering brings high energy neutrons to the sample and causes (n, 2n) reaction. A comparison is made with calculated results where the geometrical effects do not exist. (author)

  14. 149. Uso del oxigenador de membrana extracorpórea en el perioperatorio de trasplante pulmonar. Análisis de dos casos en nuestro centro

    Directory of Open Access Journals (Sweden)

    J.A. Fernández-Divar

    2012-04-01

    Conclusiones: El sistema ECMO es una herramienta válida para sustituir la CEC y disminuir sus riesgos en el trasplante pulmonar. Se puede mantener ECMO durante el postoperatorio precoz, sobre todo si se trata de pulmones de donante subóptimo o en casos de receptores de riesgo, especialmente aquellos con hipertensión pulmonar grave.

  15. Prevalence of KCNJ5 mutations and functional impact of a novel KCNJ5-insT149 mutation in aldosterone producing adenoma causing resistant hypertension

    OpenAIRE

    Kuppusamy, Maniselvan

    2014-01-01

    Primary aldosteronism (PA), a common form of secondary hypertension, is characterized by an excess autonomous aldosterone secretion. In a percentage ranging from a half to two thirds of the cases it is due to a surgically curable aldosterone-producing adenoma (APA) and in the rest to bilateral adrenal hyperplasia. The molecular mechanisms underlying aldosterone hypersecretion are unknown. Recent evidences suggest that amino acid residue substitutions in the selectivity filter of the Kir3....

  16. Two cycles of cisplatin-vindesine and radiotherapy for localized nonsmall cell carcinoma of the lung (stage III). Results of a prospective trial with 149 patients

    International Nuclear Information System (INIS)

    Tourani, J.M.; Timsit, J.F.; Delaisement, C.; Balzon, J.C.; Caubarrere, I.; Darse, J.; Geraads, A.; Lebas, F.X.; Andrieu, J.M.

    1990-01-01

    One hundred forty-nine patients with localized nonsmall cell carcinoma of the lung (Stage III A and B) were treated with two monthly cycles of initial chemotherapy that included vindesine-cisplatin followed by 6000 cGy of thoracic irradiation. Patients with complete, partial, and minor response after initial chemotherapy were randomized into groups to receive either maintenance chemotherapy (four cycles) after radiotherapy or radiotherapy alone. The objective response rate was 24% after chemotherapy and 41% after combined chemoradiotherapy (complete response, 7.5%). The overall median survival was 9 months and the 2-year survival was 14%. Survival was identical with or without maintenance chemotherapy. The 2-year survival of patients with complete response was 75% compared with 9% for patients with partial or minor response. These results suggest that only the few patients (ten) who achieve complete response have a strong probability of survival. It is therefore essential to search for other therapeutic modalities that result in an increase of the complete response rate

  17. Multibeam collection for TN149: Multibeam data collected aboard Thomas G. Thompson from 2002-07-09 to 2002-07-10, Seattle, WA to Victoria, Canada

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  18. Radiographic and Functional Outcome in Adolescent Idiopathic Scoliosis Operated With Hook/Hybrid Versus All-Pedicle Screw Instrumentation-A Retrospective Study in 149 Patients

    DEFF Research Database (Denmark)

    Ohrt-Nissen, Søren; Hallager, Dennis W; Karbo, Ture

    2017-01-01

    largely replaced H/H in the surgical treatment of AIS but whether a normalized sagittal profile can be obtained with the PS construct is still debated. Additionally, comparative studies assessing HRQL and surgical complications are needed. METHODS: Two consecutive series of surgically treated AIS patients...... were included. Surgical treatment consisted of H/H or low-profile all-PS instrumentation. Radiographic and clinical follow-up, including SRS-22r questionnaires, was performed a minimum of two years postoperatively. RESULTS: There were 85 and 64 patients in the H/H and PS group, respectively. The groups...... 4° (p kyphosis was significantly higher in the H/H group (27° ± 11° vs. 22° ± 11° in the PS group) with a mean change in kyphosis of 3° ± 9° versus -3° ± 12...

  19. Establishing comparability and compatibility in the purity assessment of high purity zinc as demonstrated by the CCQM-P149 intercomparison

    Science.gov (United States)

    Vogl, Jochen; Kipphardt, Heinrich; Richter, Silke; Bremser, Wolfram; del Rocío Arvizu Torres, María; Manzano, Judith Velina Lara; Buzoianu, Mirella; Hill, Sarah; Petrov, Panayot; Goenaga-Infante, Heidi; Sargent, Mike; Fisicaro, Paola; Labarraque, Guillaume; Zhou, Tao; Turk, Gregory C.; Winchester, Michael; Miura, Tsutomu; Methven, Brad; Sturgeon, Ralph; Jährling, Reinhard; Rienitz, Olaf; Mariassy, Michal; Hankova, Zuzana; Sobina, Egor; Ivanovich Krylov, Anatoly; Anatolievich Kustikov, Yuri; Vladimirovich Smirnov, Vadim

    2018-04-01

    For the first time, an international comparison was conducted on the determination of the purity of a high purity element. Participants were free to choose any analytical approach appropriate for their institute’s applications and services. The material tested was a high purity zinc, which had earlier been assessed for homogeneity and previously used in CCQM-K72 for the determination of six defined metallic impurities. Either a direct metal assay of the Zn mass fraction was undertaken by EDTA titrimetry, or an indirect approach was used wherein all impurities, or at least the major ones, were determined and their sum subtracted from ideal purity of 100%, or 1 kg kg-1. Impurity assessment techniques included glow discharge mass spectrometry, inductively coupled plasma mass spectrometry and carrier gas hot extraction/combustion analysis. Up to 91 elemental impurities covering metals, non-metals and semi-metals/metalloids were quantified. Due to the lack of internal experience or experimental capabilities, some participants contracted external laboratories for specific analytical tasks, mainly for the analysis of non-metals. The reported purity, expressed as zinc mass fraction in the high purity zinc material, showed excellent agreement for all participants, with a relative standard deviation of 0.011%. The calculated reference value, w(Zn)  =  0.999 873 kg kg-1, was assigned an asymmetric combined uncertainty of  +0.000 025 kg kg-1 and  -0.000 028 kg kg-1. Comparability amongst participating metrology institutes is thus demonstrated for the purity determination of high purity metals which have no particular difficulties with their decomposition/dissolution process when solution-based analytical methods are used, or which do not have specific difficulties when direct analysis approaches are used. Nevertheless, further development is required in terms of uncertainty assessment, quantification of non-metals and the determination of purity of less pure elements and/or for those elements suffering difficulties with the decomposition process.

  20. Avaliação de duas fontes de metionina a dois níveis de adição no desempenho de frangos de corte (1-49 dias Evaluation of two synthetic sources of methionine, on the performance of broilers (1-49 days

    Directory of Open Access Journals (Sweden)

    Paulo Tabajara Chaves Costa

    1997-08-01

    Full Text Available O experimento foi conduzido no Setor de Avicultura do Departamento de Zootecnia da Universidade Federal de Santa Maria (RS, no período de 12 de setembro à 01 de novembro de 1989, com o objetivo de avaliar os efeitos de diferentes fontes e níveis de adição de aminoácido metionina, através do desempenho de aves (machos e fêmeas criados separadamente no período de 1 - 49 dias. Foram utilizados 640 pintos de corte, sexados, da linhagem Hubbard. O delineamento experimental utilizado foi o inteiramente casualizado, num esquema fatorial 2 x 2 x 2 (2 fontes x 2 níveis x 2 sexos com quatro repetições de 20 aves cada unidade experimental. As fontes foram: DL-Metionina e Methionina Hidróxi-Análoga (MHA, com dois níveis de metionina suplementar: 1500 e 1050ppm, nível alto e baixo de cada, respectivamente; sendo que na fase inicial (1 - 20 dias utilizou-se 100% destes níveis, no crescimento, (21 - 42 dias 83,3% e na fase de terminação (43 - 49 dias, 75% destes níveis. As dietas foram calculadas para serem isonutritivas, diferindo apenas nos níveis de peso, consumo alimentar, conversão alimentar, viabilidade criatória e índice de eficiência produtiva. Apesar de ter havido diferenças significativas nos períodos inicial, crescimento e terminação enttre alguns tratamentos, no período total (1 - 49 dias estas diferenças não foram significativas (P > 0,05 evidenciando uma compensação de ganho de peso. Na análise estatística do consumo alimentar verificou-se na fase inicial (1 - 20 dias houve diferenças significativas (F = 5,97 P This study was conducted in the Poultry Section of the Animal Science Department at the Federal University of Santa Maria, RS - Brazil, from September 12th to November 1st, 1989. The main objective was to evaluate the effect of two different sources and levels of synthetic methionine on the broiler performance, raised separetely by sex, from day old up to 49 days of age. A total of 640 dayold chicks, from both sexes, on pen floor were used. The experimental design was enterely randomized in a factorial 2 x 2 x 2 (source x level x sex with 4 replicates of 20 chicks each. The sources of methionine were DL-Methionine and Methionine Hidroxy-analogue, and the levels were 1.500 and 1.050ppm for phase I (1 - 20 days; for phase II (20 - 42 days and phase III (42 - 49 days, were 83.33 and 75.0% of the phase I, respectively. Diets contained 20.5, 19.5 and 17.5% of crude protein and 3.000, 3.050 and 3.100kcal/kg of ME for phase I, II and III, respectively. In all phases, males were significantly better than females for all parameters studied. Weight gain was different at phases I and III for sources and levels, but not in the overall period which demonstrates a compensatory growth through the period. Feed consumption and feed conversion for the overall period (1 - 49 days did not show significant differences for sources or levels. Viability was similar between sexes and also related to sources or levels of methionine suplementation. The productive efficiency index (IEP was 21.4% better for males than females. Feathering score was significantly better for females. The abdominal fat and carcass yield were not affected by sources or levels of methionine, but highly differents between sexes; females had 26.2% more abdominal fat deposition than males, and the carcass yield was 2.7% better for males. It was concluded that both sources of methionine (DL-Methionine or MHA on a equimolar basis of adition for broiler diets, can be used without any reduction of performance.

  1. Experimental evaluation of the production of the poisons Xe-135 and Sm-149 of the TRIGA Mark III reactor with mixed core, configuration No. 16 (Final report of the project); Evaluacion experimental de la produccion de los venenos Xe-135 y Sm-149 del reactor TRIGA Mark III con nucleo mixto, config. No. 16 (Informe final del proyecto)

    Energy Technology Data Exchange (ETDEWEB)

    Paredes G, L C

    1991-11-15

    It was generated the concentration curve of the Xe{sup 135} (t) during the TRIGA Mark III reactor operation cycle, for a continuous irradiation of 72 h to 1 MW of thermal power, as well as the accumulation curve of the isotope after the shutdown, for the fuel configuration No. 16 in the thermal column. The maximum negative reactivities generated by the Xe{sup 135} for operation times greater than 60 h to 1 MW and after the reactor shutdown its were of 1.968 {+-} 0.15 dollars and 2.30 {+-} 0.15 dollars respectively. When comparing these results with those theoretically calculated we find differences of the order of 3.6% and 5.34% which are understood inside the experimental error that on the average was of 7.6%. The results before mentioned have an important application during the start up process of the Reactor, when analyzing the value of the weekly reactivity excess of the core and when is choice the pattern of bars to use for experiments of but of 2 h, where is required to minimize the temporary and space interferences of the neutron flux. (Author)

  2. Neutron cross section measurements using the ORELA: 40Ar(n,x), 40Ca(n,x), 22Ne(n,γ), 187Os(n,n') 186187188Os(n,nn'γ), the stable tellurium isotopes (n,γ), and 205Tl(n,nγ). Progress report, September 1, 1982-August 31, 1983

    International Nuclear Information System (INIS)

    Winters, R.R.

    1983-09-01

    The research performed during this reporting period consisted primarily of (1) measurement, analysis, and publication of the 187 Os(n,n') cross section near 30 keV, (2) measurement and analysis of the 148 149 159 Sm(n,γ) cross sections, (3) development and publication of a significantly better approximation to the average neutron scattering function as determined by total cross section measurements at the Oak Ridge Electron Linear Accelerator (ORELA), and (4) providing support for the neutron capture facility at ORELA as in the corrections made to the 60 Ni(n,γ) data discussed in a paper included with this report. The major result of the 187 Os(n,n') cross section measurement was the 30 keV average value for that cross section anti sigma/sub nn'/ approx. = 1.5 +- 0.2 b and the implication that the duration of stellar nucleosynthesis, as derived from the 187 Re → 187 Os beta decay, is estimated to be (8.9 +- 2.0) x 10 9 year consistent with an earlier estimate reported by Winters and Macklin. The Sm(n,γ) measurement has already resulted in an estimate of the importance of branching in the s-process in the samarium mass region. We estimate the average neutron density during s-process nucleosynthesis in the vicinity of the solar system to be between less than or equal to (1.1 + 0.7) and (1.1 - 0.6) x 10 8 neutrons/cm 3 . In the optical model analysis of neutron total cross sections we continue to find that orbital angular momentum dependent well depths are required if the spherical optical model is used to describe the neutron-nucleus interaction at low neutron energies

  3. Natural nuclear reactor at Oklo and variation of fundamental constants: Computation of neutronics of a fresh core

    International Nuclear Information System (INIS)

    Petrov, Yu. V.; Nazarov, A. I.; Onegin, M. S.; Petrov, V. Yu.; Sakhnovsky, E. G.

    2006-01-01

    Using modern methods of reactor physics, we performed full-scale calculations of the Oklo natural reactor. For reliability, we used recent versions of two Monte Carlo codes: the Russian code MCU-REA and the well-known international code MCNP. Both codes produced similar results. We constructed a computer model of the Oklo reactor zone RZ2 which takes into account all details of design and composition. The calculations were performed for three fresh cores with different uranium contents. Multiplication factors, reactivities, and neutron fluxes were calculated. We also estimated the temperature and void effects for the fresh core. As would be expected, we found for the fresh core a significant difference between reactor and Maxwell spectra, which had been used before for averaging cross sections in the Oklo reactor. The averaged cross section of 62 149 Sm and its dependence on the shift of a resonance position E r (due to variation of fundamental constants) are significantly different from previous results. Contrary to the results of previous papers, we found no evidence of a change of the samarium cross section: a possible shift of the resonance energy is given by the limits -73≤ΔE r ≤62 meV. Following tradition, we have used formulas of Damour and Dyson to estimate the rate of change of the fine structure constant α. We obtain new, more accurate limits of -4x10 -17 ≤α·/α≤3x10 -17 yr -1 . Further improvement of the accuracy of the limits can be achieved by taking account of the core burn-up. These calculations are in progress

  4. 89Sr and 153Sm-EDTMP therapy of disseminated skeletal metastasis

    International Nuclear Information System (INIS)

    Zhang Junning; Hong Chengjiao; Zhu Shoupeng

    2001-01-01

    A retrospective analysis was performed on 72 patients with disseminated skeletal metastasis to evaluate the effect of strontium-89 or samarium-153 EDTMP therapy. There existed 87.88% of clinical response, 12.12% of no response in the group treated with strontium-89 as compared with 90.24% of clinical response, 9.76% no response in one treated with samarium-153 EDTMP; and there were no correlation between the treatment results and the amounts of isotopes administrated. The results suggest that strontium-89 or samarium-153 EDTMP therapy is a method of first choice in the palliative treatment for disseminated skeletal metastasis

  5. sup 8 sup 9 Sr and sup 1 sup 5 sup 3 Sm-EDTMP therapy of disseminated skeletal metastasis

    CERN Document Server

    Zhang Jun Ning; Zhu Shou Peng

    2001-01-01

    A retrospective analysis was performed on 72 patients with disseminated skeletal metastasis to evaluate the effect of strontium-89 or samarium-153 EDTMP therapy. There existed 87.88% of clinical response, 12.12% of no response in the group treated with strontium-89 as compared with 90.24% of clinical response, 9.76% no response in one treated with samarium-153 EDTMP; and there were no correlation between the treatment results and the amounts of isotopes administrated. The results suggest that strontium-89 or samarium-153 EDTMP therapy is a method of first choice in the palliative treatment for disseminated skeletal metastasis

  6. {sup 89}Sr and {sup 153}Sm-EDTMP therapy of disseminated skeletal metastasis

    Energy Technology Data Exchange (ETDEWEB)

    Junning, Zhang; Chengjiao, Hong; Shoupeng, Zhu [Suzhou Univ., Suzhou (China)

    2001-07-01

    A retrospective analysis was performed on 72 patients with disseminated skeletal metastasis to evaluate the effect of strontium-89 or samarium-153 EDTMP therapy. There existed 87.88% of clinical response, 12.12% of no response in the group treated with strontium-89 as compared with 90.24% of clinical response, 9.76% no response in one treated with samarium-153 EDTMP; and there were no correlation between the treatment results and the amounts of isotopes administrated. The results suggest that strontium-89 or samarium-153 EDTMP therapy is a method of first choice in the palliative treatment for disseminated skeletal metastasis.

  7. Printed educational materials about sexual and reproductive health used in basic care in Belo Horizonte, MG: characterization and some considerations - DOI: 10.3395/reciis.v3i4.149en

    Directory of Open Access Journals (Sweden)

    Virginia Torres Schall

    2009-12-01

    Full Text Available An initial analysis of printed educational materials used by the Municipal Health Office (MHO of Belo Horizonte (BH on themes linked to sexual and reproductive health was carried out. Premises were that health education is a practice developed at the social relations level and that mass media and daily interaction can be a link between the population and the health services. Printed material was collected from a Basic Health Unit (BHU of the MHO/BH and its content was classified, described and analyzed. To study the meanings that teenagers attributed to the body’s sexual and reproductive dimensions, using one of the materials, a focal group was formed. Semi-structured interviews were carried out with health professionals.It should be emphasized that the materials are produced in a vertical manner, treating the target audience as an airtight and homogenous block, with the STD/AIDS thematic prevailing. Some of the materials focusing on aids display good quality, presenting an objective and clear language and pertinent illustrations. However, in the majority, the prevailing approach is that of the biomedical body in detriment to a broader approach to sexuality. Assessments and reception studies are needed so that the production of educational material can be linked to the target audience’s existential context and that quality criteria for these materials are included in health professionals’ training.

  8. Resenha: A democracia grega. Organização de Hélio Jaguaribe. Brasília, Editora da Universidade de Brasília, 1982. 149p.

    OpenAIRE

    Brandão, Jacyntho José Lins; Santos, Magda Guadalupe dos

    1987-01-01

    O volume é composto pelas cinco conferências e mesa redonda realizadas durante a "Semana da Grécia" — promovida em 1980 pela UnB e pelo Instituto de Estudos Políticos e Sociais — acrescidas de uma introdução geral ao tema e da Oração Fúnebre de Péricles, em tradução portuguesa. Procura-se dar ao leitor uma informação geral a respeito da democracia grega — o que se obtém principalmente através da leitura da referida introdução e do artigo "A Democracia de Péricles", assinados ambos por Hélio J...

  9. Bilinguisme et problematique des langues ethniques. Enquete sur le comportement linguistique des jeunes montrealais d'origine italienne (Bilingualism and the Problem of Ethnic Languages. A Study of the Linguistic Behavior of Young Montrealers of Italian Descent). Publication B-149.

    Science.gov (United States)

    Villata, Bruno

    A study is reported of the language behavior of trilingual 9-to-12-year-old native Italian speakers in Montreal, some of whom were studying Italian on Saturdays and some of whom were not. The study focused on their available vocabulary in the three languages (Italian, French, and English) and on their language productivity during their various…

  10. Physical and transcript map of the region between D6S264 and D6S149 on chromosome 6q27, the minimal region of allele loss in sporadic epithelial ovarian cancer

    DEFF Research Database (Denmark)

    Liu, Ying; Emilion, Gracy; Mungall, Andrew J

    2002-01-01

    We have previously shown a high frequency of allele loss at D6S193 (62%) on chromosomal arm 6q27 in ovarian tumours and mapped the minimal region of allele loss between D6S297 and D6S264 (3 cM). We isolated and mapped a single non-chimaeric YAC (17IA12, 260-280 kb) containing D6S193 and D6S297...

  11. Discussion on ‘‘Bearing capacity of circular footings over rock mass by using axisymmetric quasi lower bound finite element limit analysis” by Manash Chakraborty and Jyant Kumar [Comput. Geotech. 70 (2015) 138–149

    DEFF Research Database (Denmark)

    Clausen, Johan Christian

    2016-01-01

    The commenter has read the above mentioned article with great interest and will commend the authors for their work. The article give rise to some comments which will be presented in the following. The designations and symbols used in this comment corresponds to those used in the commented paper....

  12. Studies of light charged particle emission from fission and ER reactions in the system 344 MeV {sup 28}Si+{sup 121}Sb{yields}{sup 149}Tb (E{sup *}=240 MeV)

    Energy Technology Data Exchange (ETDEWEB)

    Kaplan, Morton E-mail: kaplan@cmchem.chem.cmu.edu; Copi, Craig J.; DeYoung, Paul A.; Gilfoyle, G.J.; Karol, Paul J.; Moses, David J.; Parker, W.E.; Rehm, K. Ernst; Sarafa, John; Vardaci, Emanuele

    2001-04-09

    Light charged particles (LCP) have been measured for the reaction 344 MeV {sup 28}Si+{sup 121}Sb in singles and in coincidence with evaporation residues (ER), fusion-fission fragments (FF), and other LCP. A major feature of this experiment was the use of a gas-filled magnetic spectrometer in the forward direction to separate ER from the much more abundant yield of elastically scattered projectiles and projectile-like fragments. The dominant sources of evaporative {sup 1}H and {sup 4}He emission are the ER (approximately 75%), with the remainder being largely associated with fission reactions. For these latter reactions, most of the {sup 1}H and {sup 4}He can be well accounted for by evaporation from the composite system prior to fission and by evaporation from the postfission fragments. LCP emission cross sections were determined for each identified source, and a comparison has been made to previous studies. From this comparison, indications were found for significant entrance channel effects, with the more asymmetric channels exhibiting much larger LCP cross sections. Statistical model predictions for ER emissions are in good agreement with observed LCP energy spectra, angular distributions, and integrated inclusive and exclusive cross sections, with all calculations using the same unique set of model parameters. This result contrasts strongly with recent reports for light mass systems, where model calculations were unable to simultaneously reproduce all observables.

  13. Development of a methodology for the separation of europium and samarium from a mixture of rare earth oxides by electroreduction/ precipitation; Desenvolvimento de uma metodologia para a separacao de samario e europio a partir de mistura de oxidos de terras raras por reducao eletroquimica/precipitacao

    Energy Technology Data Exchange (ETDEWEB)

    Chepcanoff, Vera

    2006-07-01

    The rare earths (RE) were first used in 1903, when Welsbach developed a lighter that is still used today. Nowadays, the RE are employed in many different fields, as in the production of super-alloys , as catalysts for petroleum industry, in the manufacture of non-ferrous alloys, color television tubes, x-ray screens, special glasses, ceramics, computer industries, nuclear medicine, lasers, pigments, etc., moving, in the last decade , a market of US$ 2 billions per year. Due to their similar properties, the RE elements are very difficult to separate, requiring complex processes, what make the products very expensive. Elements like Eu and Sm, which contents in the minerals are low (0.05% and 2.0%, respectively, in monazite) are extremely expensive, but their field of application justifies the research for looking for other processes, more simple and/or more effective. Trivalent state is a characteristic of all RE, but some of them presents oxidation state +2, like Ce, Eu, Sm and Yb. In the case of Eu and Sm, the focus of the present work, the divalent state is achieved by electro-reduction in the potentials -0.65 and -1.55 (SCE), respectively. This makes possible the separation of these elements from the other rare earths and from each other. Thus, making use of this characteristic, a process for the individual separation of Eu and Sm in (NH{sub 4}){sub 2}SO{sub 4} solution by electro-reduction/precipitation is proposed, where Sm is first separated from the solution as sulfate, and Eu, that remains in the solution, is precipitated after the decrease of temperature and potential applied. The process developed from a synthetic Eu and Sm solution was applied to a mixture of semi-heavy RE oxide, produced at IPEN-CNEN/SP, obtaining the separation of Sm. This product was analyzed by spectrophotometry, showing high purity. (author)

  14. Microwave studies on the dielectric properties of Sm3+ and Sm3+/CdTe doped sol-gel silica glasses

    International Nuclear Information System (INIS)

    Mathew, Siby; Rejikumar, P.R.; Yohannan, Jaimon; Mathew, K.T.; Unnikrishnan, N.V.

    2008-01-01

    Complex permittivity and conductivity studies of Samarium and Samarium/semiconductor cadmium telluride sol-gel silica glass samples were done. We use cavity perturbation technique at S band frequencies using TE 10p Mode. Structural evolution of the matrix on annealing is discussed based on FTIR analysis/XRD power diffraction. In cavity perturbation technique dielectric parameters like complex permittivity and conductivity are determined by measuring changes in resonant frequency due to small perturbation inside the cavity produced by the introduction of the samples. The addition of the semiconductor along with the samarium was found to lower the permittivity, loss factor and conductivity. Variations of permittivity values with annealing temperature find applications in IC Technology, optic fibre communication, etc. The Sm 3+ /CdTe doped glasses can also be used in the fabrication of new and improved materials for microwave electronic circuits and in electromagnetic shielding devices

  15. Determination of the {sup 151}Sm half-life

    Energy Technology Data Exchange (ETDEWEB)

    Be, Marie-Martine; Cassette, Philippe [CEA, LIST, Gif sur Yvette (France). LNE-Laboratoire National Henri Becquerel; Isnard, Helene [CEA-LANIE, Gif sur Yvette (France); and others

    2015-07-01

    New measurements have been undertaken to determine the half-life of {sup 151}Sm. A pure {sup 151}Sm solution was obtained after chemical separation from a samarium solution resulting from the dissolution of an irradiated samarium sample. The concentration of {sup 151}Sm in the solution was measured by mass spectrometry, combined with the isotope dilution technique. The activity of the solution was measured by liquid scintillation counting by six European laboratories as part of an international comparison. These combined results lead to a half-life of T{sub 1/2} = 94.6(6)a.

  16. Udvikling af materialer til brintpermeable membraner

    DEFF Research Database (Denmark)

    Bentzer, Henrik Karnøe

    doped samarium titanate, lanthanum magnesium titanate and strontium cerate doped with yttrium and nickel. Concentration cell measurements were used to estimate transport numbers for protons and oxide ions in yttrium doped strontium cerate and calcium doped samarium titanate. Furthermore, the voltage......Due to global warming as well as other factors, it is necessary to find alternatives to the current consumption of fossil fuels. Oxide materials with high protonic conductivity can potentially find application within many different technological fields in a society that is based on renewable energy...

  17. Valency state changes in lanthanide-contained systems under high pressure

    Energy Technology Data Exchange (ETDEWEB)

    Jayaraman, A

    1980-08-01

    Changes in valency state induced by pressure in samarium sulphide SmS remind one of alchemy, as the mat black initial substance shines golden after the electron transition. The alchemist's dream is of course not realized, however the compound does exhibit an unusually interesting behaviour in the new state. The valency state of samarium as newly appeared fluctuated very rapidly between two electron configurations. Manipulation of the valency state by pressure or chemical substitution can basically change the physical properties of systems containing lanthanides. The phenomena are described and discussed in the following survey.

  18. Neutron capture cross section measurement of $^{151}Sm$ at the CERN neutron Time of Flight Facility (nTOF)

    CERN Document Server

    Abbondanno, U; Alvarez-Velarde, F; Alvarez-Pol, H; Andriamonje, Samuel A; Andrzejewski, J; Badurek, G; Baumann, P; Becvar, F; Benlliure, J; Berthoumieux, E; Calviño, F; Cano-Ott, D; Capote, R; Cennini, P; Chepel, V; Chiaveri, Enrico; Colonna, N; Cortés, G; Cortina-Gil, D; Couture, A; Cox, J; Dababneh, S; Dahlfors, M; David, S; Dolfini, R; Domingo-Pardo, C; Durán, I; Embid-Segura, M; Ferrant, L; Ferrari, A; Ferreira-Marques, R; Frais-Kölbl, H; Furman, W; Gonçalves, I; Gallino, R; Gonzalez-Romero, E; Goverdovski, A; Gramegna, F; Griesmayer, E; Gunsing, F; Haas, B; Haight, R; Heil, M; Herrera-Martínez, A; Isaev, S; Jericha, E; Kappeler, F; Kadi, Y; Karadimos, D; Kerveno, M; Ketlerov, V; Köhler, P; Konovalov, V; Krticka, M; Lamboudis, C; Leeb, H; Lindote, A; Lopes, I; Lozano, M; Lukic, S; Marganiec, J; Marrone, S; Martinez-Val, J; Mastinu, P; Mengoni, A; Milazzo, P M; Molina-Coballes, A; Moreau, C; Mosconi, M; Neves, F; Oberhummer, Heinz; O'Brien, S; Pancin, J; Papaevangelou, T; Paradela, C; Pavlik, A; Pavlopoulos, P; Perlado, J M; Perrot, L; Pignatari, M; Plag, R; Plompen, A; Plukis, A; Poch, A; Policarpo, Armando; Pretel, C; Quesada, J; Raman, S; Rapp, W; Rauscher, T; Reifarth, R; Rosetti, M; Rubbia, Carlo; Rudolf, G; Rullhusen, P; Salgado, J; Soares, J C; Stéphan, C; Tagliente, G; Taín, J L; Tassan-Got, L; Tavora, L; Terlizzi, R; Vannini, G; Vaz, P; Ventura, A; Villamarín, D; Vincente, M C; Vlachoudis, V; Voss, F; Wendler, H; Wiescher, M; Wissha, K

    2004-01-01

    The measurement of **1**5**1Sm(n, gamma)**1**5**2Sm (samarium) cross section showed improved performance of the new spallation neutron facility. It covered a wide energy range with good resolution, high neutron flux, low backgrounds and a favourable duty factor. The samarium cross section was found to be of great importance for characterizing neutron capture nucleosynthesis in asymptotic giant stars. The combination of these features provided a promising basis for a broad experimental program directed towards application in astrophysics and advanced nuclear technologies. (Edited abstract)

  19. Thermodynamics and statistical mechanics of some hydrides of the lanthanides and actinides

    International Nuclear Information System (INIS)

    Mintz, M.H.

    1976-06-01

    This work deals mainly with the thermodynamic and physical properties of the hydrides of the lanthanides and actinides. In addition, statistical models have been developed and applied to metal-hydrogen systems. A kinetic study of the uranium-hydrogen system was performed. The thermodynamic properties of the hydrides of neptunium, thorium, praseodymium, neodymium, samarium and europium were determined. In addition the samarium-europium-hydrogen ternary system was investigated. Moessbauer effect measurements of cubic neptunium hydrides were interpreted according to a model presented. A comparison. (author)

  20. {6,6′-Dimethoxy-2,2′-[ethane-1,2-diylbis(nitrilomethylidyne]diphenolato-1κ4O1,O1′,O6,O6′:2κ4O1,N,N′,O1′}(ethanol-1κO-μ-nitrato-1:2κ2O:O′-dinitrato-1κ4O,O′-samarium(IIIzinc(II

    Directory of Open Access Journals (Sweden)

    Qiang Huang

    2009-10-01

    Full Text Available In the title heteronuclear ZnII–SmIII complex, [SmZn(C18H18N2O4(NO33(CH3CH2OH], with the hexadentate Schiff base compartmental ligand N,N′-bis(3-methoxysalicylideneethylenediamine (H2L, the SmIII and ZnII ions are triply bridged by two phenolate O atoms from the Schiff base ligand and one nitrate anion. The five-coordinate ZnII ion is in a square-pyramidal geometry formed by the donor centers of two imine N atoms, two phenolate O atoms and one of the bridging nitrate O atoms. The SmIII center is in a ten-fold coordination of O atoms, involving the phenolate O atoms, two methoxy O atoms, one ethanol O atom, and two O atoms from two nitrate anions and one from the bridging nitrate anion. In the crystal, intermolecular O—H...O and C—H...O interactions generate a layer structure extending parallel to (101.

  1. ORF Alignment: NC_005125 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available SDREIAMVRVFNAPPRLVFDALTRPELLKRWLGPRDWQLVVCEIELQVGGTYRYVMRGPD 60 ... Query: 135 RDAVLASPMESGLAESYDRLDELLTTMSA 163 ... RDAVLASPME...SGLAESYDRLDELLTTMSA Sbjct: 121 RDAVLASPMESGLAESYDRLDELLTTMSA 149

  2. Pain therapy with Samario 153-EDTM in prostate cancer. Pilot experience in Paraguay

    International Nuclear Information System (INIS)

    Jara Yorg, Jorge

    2001-07-01

    To relieve the skeletal pain in metastasis disseminated in bones, numerous radiotracers have been used without achieving important clinical acceptance. The SAMARIUM 153 EDT (Etilendiaminetrametilen acid phosphonic) is a radiopharmaceutic that is chemically and biologically stable and preferably concentrates on the skeletal metastasis [es

  3. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    It is observed that. the dielectric permittivity () and loss tangent (tan ) are dependent on frequency,; the temperature of dielectric permittivity maximum shifts toward lower temperature side with the increase of samarium ion (Sm+3) concentration at the Pb sites, and; observed and calculated -values of XRD patterns show ...

  4. Measurement of total angular momentum values of high-lying even ...

    Indian Academy of Sciences (India)

    Spectrally resolved laser-induced fluorescence technique was used to uniquely assign total angular momentum () values to high-lying even-parity energy levels of atomic samarium. Unique value assignment was done for seven energy levels in the energy region 34,800–36,200 cm-1 , recently observed and reported in ...

  5. Simplified syntheses of the water-soluble chiral shift reagents Sm-(R)-pdta and Sm-(S)-pdta

    Czech Academy of Sciences Publication Activity Database

    Hrubá, L.; Buděšínský, Miloš; Pícha, Jan; Jiráček, Jiří; Vaněk, Václav

    2013-01-01

    Roč. 54, č. 47 (2013), s. 6296-6297 ISSN 0040-4039 Institutional support: RVO:61388963 Keywords : NMR * chiral shift reagents * Sm-pdta * PDTA * samarium * 1,2-diaminopropane Subject RIV: CC - Organic Chemistry Impact factor: 2.391, year: 2013

  6. Stable isotope tracer marking of individual boll weevils

    International Nuclear Information System (INIS)

    James, W.D.; Showler, A.T.; Armstrong, J.S.; Westbrook, J.K.

    2006-01-01

    Stable isotope markers have been used to study animal nutrition for several decades and more recently to study the foraging and cultural habits of imported fire ants. In this work, we have extended that effort to evaluate the potential for marking boll weevils, Anthonomus grandis grandis Boheman (Coleoptera: Curculionidae), with the rare earth element samarium to aid in studies of insect invasion and pest eradication protocols. Neutron activation analysis (NAA) was performed on the marked boll weevils as well as plant material from the cotton squares on which the insects were fed. Samarium levels in non-dosed insects average about 20 ng/g or about 100 pg total element per insect. Our computed average determination limit was 36 pg samarium/weevil. The determination limit for cotton plant squares and leaves averaged 3.5 ng/g and 8.2 ng/g, respectively. These initial results indicate the NAA method is capable of identifying individual marked insects which have assimilated 1 ng of samarium, a ten-fold increase in content over average blank values. (author)

  7. Specification and comparative calculation of enthalpies and Gibbs formation energies of anhydrous lanthanide nitrates

    International Nuclear Information System (INIS)

    Del' Pino, Kh.; Chukurov, P.M.; Drakin, S.I.

    1980-01-01

    Analyzed are the results of experimental depermination of formation enthalpies of waterless nitrates of lanthane cerium, praseodymium, neodymium and samarium. Using method of comparative calculation computed are enthalpies of formation of waterless lanthanide and yttrium nitrates. Calculated values of enthalpies and Gibbs energies of waterless lanthanide nitrate formation are tabulated

  8. Study of 148-152Sm nuclei employing γ - derived from B(E2) values and level energies

    International Nuclear Information System (INIS)

    Sharma, Aparna; Varshney, A.K.; Singh, M.; Gupta, D.K.; Singh, Yuvraj; Gupta, K.K.; Bihari, Chhail; Varshney, Mani

    2011-01-01

    The study of samarium nuclei has been a challenging theoretical problem, since they lie in the range from near spherical to well deformed shapes. 148 Sm was believed to be basically spherical while 154 Sm is thought to be well deformed nucleus and 150-15 '2Sm are transitional nuclei

  9. A convenient method for the conversion of N-acyloxazolidinones to hydroxamic acids.

    Science.gov (United States)

    Sibi, Mukund P; Hasegawa, Hikaru; Ghorpade, Sandeep R

    2002-10-03

    Treatment of N-acyloxazolidinones with hydroxylamines using samarium triflate as a Lewis acid provides the corresponding hydroxamic acids in 50-98% yields at room temperature. The conversion proceeds with high degree of chemoselectivity and without racemization of chiral centers alpha- to the acyl group. [reaction: see text

  10. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    ... and theoretical aspects of fundamental symmetry violations in atoms .... The current status of and achievements in targets are provided and validation experiments are ... of samarium by spectrally resolved laser-induced fluorescence technique .... Surface roughness-aided hard X-ray emission from carbon nanotubes.

  11. Tuning the activity of Pt alloy electrocatalysts by means of the lanthanide contraction

    DEFF Research Database (Denmark)

    Escribano, Maria Escudero; Malacrida, Paolo; Hansen, Martin Hangaard

    2016-01-01

    is lanthanum, cerium, samarium, gadolinium, terbium, dysprosium, thulium, or calcium. The materials are among the most active polycrystalline Pt-based catalysts reported, presenting activity enhancement by a factor of 3 to 6 over Pt. The active phase consists of a Pt overlayer formed by acid leaching. The ORR...

  12. Carmen system: a code block for neutronic PWR calculation by diffusion theory with spacedependent feedback effects

    International Nuclear Information System (INIS)

    Ahnert, C.; Aragones, J.M.

    1982-01-01

    The Carmen code (theory and user's manual) is described. This code for assembly and core calculations uses diffusion theory (Citation), with feedback in the cross sections by zone due to the effects of burnup, water density, fuel temperature, Xenon and Samarium. The burnup calculation of a full cycle is solved in only an execution of Carmen, and in a reduced computer time. (auth.)

  13. Bis(phenolate)amine-supported lanthanide borohydride complexes for styrene and trans-1,4-isoprene (co-)polymerisations

    NARCIS (Netherlands)

    Bonnet, Fanny; Dyer, Hellen E.; El Kinani, Yassine; Dietz, Carin; Roussel, Pascal; Bria, Marc; Visseaux, Marc; Zinck, Philippe; Mountford, Philip

    2015-01-01

    New bis(phenolate)amine-supported neodymium borohydride complexes and their previously reported samarium analogues were tested as catalysts for the polymerisation of styrene and isoprene. Reaction of Na2O2NL (L = py, OMe, NMe2) with Nd(BH4)3(THF)3 afforded the borohydride complexes

  14. Thermoluminescent coactivated rare earth oxyhalide phosphors and x-ray image converters utilizing said phosphors

    International Nuclear Information System (INIS)

    Rabatin, J.G.

    1984-01-01

    Oxyhalides of lanthanum, gadolinium and lutetium coactivated with a first activator selected from bismuth and samarium to provide the color of light emission and a second coactivator (e.g. terbium or praseodymium) which increases the amount of stored energy in a stored radiographic latent image are found to be superior in their conversion efficiency of x-rays to visible light. (author)

  15. Contribution of current carrier mobility variation to piezo-resistive effect in SmS

    International Nuclear Information System (INIS)

    Vasil'ev, L.N.; Kaminskij, V.V.

    1999-01-01

    The value of the contribution from the change in the current carriers mobility and pressure to the piezo-resistive effect value in the materials on the basis of the samarium, monosulfide is studied. The conclusion, that the value of the piezoresistance of comprehensive compression should not exceed 7x10 -3 MPa -1 at T=300 K, experimental data [ru

  16. Fundamental studies on multicharged impurities of the Tokamaks

    International Nuclear Information System (INIS)

    Bernardi, J. de; Geller, R.; Jacquot, B.; Jacquot, C.

    1979-11-01

    We describe Micromafios which is an Ion source delivering particles up to completely stripped Carbon, Nitrogen and Oxygen ions. The beams are utilized on an experiment device for cross section measurements enabling fondamental studies for Tokamak impurity ions. The source is a miniaturized Supermafios device where the minimum B configuration is obtained with Samarium Cobalt magnetized Ferrites and a solenoidal axial field [fr

  17. 2. Home 3. Journals 4. Bulletin of Materials Science 5. Volume 28 6 ...

    Indian Academy of Sciences (India)

    483. Acceptor. Study on electrical properties of Ni-doped SrTiO3 ceramics .... Effect of Cr and Ni on diffusion bonding of Fe3Al with steel. 63. Creep ... Oriented growth of thin films of samarium oxide by MOCVD. 49 .... Grain boundary. Study on ...

  18. Biological evaluation of 153Sm-ethylenediaminetetra methylene phosphonate (EDTMP)

    International Nuclear Information System (INIS)

    Ranganatha, D.K.; Lal, Ramji

    1997-01-01

    Samarium-153 EDTMP has been studied in rats to establish bone localisation in normal bone tissue and the uptake in the soft tissue. Biodistribution results were highly promising with >3% of the injected dose localizing in the femurs and 15 days. (author). 4 refs., 2 tabs

  19. Perovskite catalysts for oxidative coupling

    Science.gov (United States)

    Campbell, Kenneth D.

    1991-01-01

    Perovskites of the structure A.sub.2 B.sub.2 C.sub.3 O.sub.10 are useful as catalysts for the oxidative coupling of lower alkane to heavier hydrocarbons. A is alkali metal; B is lanthanide or lanthanum, cerium, neodymium, samarium, praseodymium, gadolinium or dysprosium; and C is titanium.

  20. Electric Field-Assisted Pressureless Sintering of Ceramic Protonic Conductors

    DEFF Research Database (Denmark)

    Muccillo, R.; Esposito, Vincenzo; de Florio, D. Z.

    2017-01-01

    Gadolinium, yttrium and samarium-doped barium cerate pressed pellets were submitted to flash sintering experiments isothermally in the temperature range 800-1300oC under 200 V cm-1 electric field. The pellets were positioned inside a dilatometer furnace with Pt-Ir electrodes connected either to a...